1YA0A

Crystal structure of the n-terminal domain of human smg7
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
497
structure length
458
Chain Sequence
MSLQSAQYLRQAEVLKADMTDSKLGPAEVWTSRQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQITTLQGQAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTQSSSCSYICQHCLVHLGDIARYRNQTSQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNLQKALSKALESRDEVKTKWGVSDFIKAFIKFHGHVYLSKSLEKLSPLREKLEEQFKELLFQKAFNSQQLVHVTVINLFQLHHLRDFSNETEQHTYSQDEQLCWTQLLALFMSFLGILCKCPLQNSQEESYNAYPLPAVKVSMDWLRLRPRVFQEAVVDERQYIWPWLISLLNSFHPHEEDLSISATPLPEEFELQGFLALRPSFRNLDFSKGHKEGQQRRIRQQRLISIGKWIADNQPRLIQCENEVGKLLFITEIPELILEDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SMG-7 transcript variant 2
publication title SMG7 Is a 14-3-3-like Adaptor in the Nonsense-Mediated mRNA Decay Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 166
structure length 458
sequence length 497
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10373 EST1_DNA_bind Est1 DNA/RNA binding domain
A PF10374 EST1 Telomerase activating protein Est1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1ya0A01
4UI9K 5D0QD 3CVQA 2L6JA 3KS2A 3ZHEB 4UQZA 2XCBA 4BTBA 4N5CA 2HO1A 2KCLA 1WM5A 3RO2A 5M72A 5JJ7A 3O48A 3WXXA 2AVPA 4G2VA 3LPZA 4GZ3A 5D0OD 5KJKA 3ZFWA 2UY1A 3ZHEA 2E2EA 2Y4TA 3CK9A 1PC2A 4I2ZA 4GCNA 2GW1A 1NZNA 4WNDA 3MKRA 3ASHA 4KBQA 2VSYA 4I2WA 4A1SA 2P58C 4XIFA 2KCKA 3AS4A 4KYOB 3S7DA 2YQ8A 1FCHA 5HQ8A 3Q5MA 3PDNA 3QKYA 5G04C 5A7DB 2J9QA 2NC9A 3UUXA 4WNEA 3OXLA 3AS5A 3QDNA 4GYWA 1A17A 3CKCA 3LYAA 4JL0A 3URZA 2PL2A 3RO3A 3ASFA 2C0MA 4CGWA 3MEKA 1TJCA 4CDRA 3CK8A 2C0LA 3CVNA 4LEUA 4NQ0A 2VQ2A 5KJMA 4U0SA 1IYGA 1YA0A 5ARFA 4GPKA 3CK7A 5BT1A 2FO7A 3K9IA 4GA0A 4JA7A 4BT9A 1QZ2A 4UI9J 3Q47B 4YVQC 3R9AB 2HR2A 3OXFA 4GCOA 3CV0A 4HOTA 1KT0A 4YVOA 4I1AA 3RIBA 5FZQA 3QWVA 2V5FA 4H7YA 4F3VA 4IN3B 3FP3A 5FZRA 3E4BA 3KD7A 4GYYA 1WAO1 3N71A 3TG4A 2BUGA 4XI0A 3RKVA 2VGYA 3KAEA 3MV2B 2R5SA 2VYIA 4U04A 3AS8A 2OOEA 1W3BA 2Y4UA 4HOUA 4UQYA 5CHEE 3BEEA 3UPVA 4WNGA 3Q49B 4I9EA 3ZGQA 2IF4A 4HORA 4JA9A 2XGOA 2KCVA 4J8DA 2ONDA 4GYOA 4AIFA 2FI7A 2DBAA 2I6HA 4WNFA 1HZ4A 4XI9A 1Y8MA 3RU0A 3TAXA 1QQEA 4B94A 2JLBA 5CCMA 2FF4A 4ABNA 1KLXA 1ZU2A 5EX3A 4U0ZA 3Q4AB 3S7BA 4N3BA 1HH8A 4JHRA 4G1TA 3NF1A 5FT9A 5G05J 4J8FA 2WQHA 4HOSA 4Y6CA 3SF4A 4UI9C 3GW4A 5LCWJ 1ZBPA 3LKUA 5EX0A 4O6FA 2KC7A 3LCAA 5AYWD 3FWVA 3CVLA 3MV3B 2VGXB 5JJTA 1OUVA 3EDTB 2XGMA 1XNFA 2KATA 1KT1A 2YHCA 4N3AA 4RG6A 5ARGA 4J0UA 2FBNA 3S7FA 3TG5A 3UQ3A 4KXKB 4U07A 5BNWA 2Q7FA 1E96B 2WPVA 3LY7A 4AY5A 2VGXA 2VSNA 4U0UA 2PZIA 3OXGA 4YNDA 3MA5A 3QWWA 2UY1B 3FFLA 3LY8A 4BTAA 5JJ6A 3TGOA 2FEZA 2IFUA 4N39A 4GA1A 2XGSA 5EKQD 3ZN3A 3U4TA 5C1DA 5FTPA 3VTYA 3ZPJA 1P5QA 4AY6A 4NRHB 4AM9A 3PE4A 3ESKA 2LSUA 4W9RA 3ULQA 4G24A 2PQNA 4WUYA 5A6CA 4BWRA 5KJLA 4H7XA 1ELRA 2HYZA 5KJNA 4N2SA 4G23A 4GZ5A 2C2LA 4BT8A 4I17A 4GZ6A 5FZSA 4N3CA 3LY9A 3CVPA 3Q15A 4I9CA 3QOUA 3ASDA 2XCCA 3PE3A 1NA3A 5DBKA 2MHKA 4EQFA 4Y6WA 5G05C 2LNIA 5LCWC 3IEGA 4HOQA 4GA2A 5DIZA 2UWJG 3GYZA 5G04J 4J8EA 3CEQA 3CKBA 3GZ2A 2QFCA 3JYSA 4G26A 3RJVA 4RG9A 2XEVA 3GZ1A 1B89A 2PQRA 5HI7A 3VTXA 4UQXA 3QWPA 1HXIA 3ASGA 3S7JA 4G25A 3U3WA 2LSVA 3SZ7A 4N2QA 5CCLA 2XPIA 3HYMB 4ME2A 1IHGA 4CGVA 4APOA 1ELWA 1NA0A 5BW8C 5FJYA
chains in the Genus database with same CATH superfamily
4O1OA 1BU9A 2XEHA 3QJZA 2AXUA 4QFVA 3FULA 3PNLB 3ZHEB 3APDA 4UQZA 2XCBA 3FEYA 1O1TA 1WM5A 3RO2A 2F37A 3O48A 3WXXA 4G2VA 3LPZA 4GZ3A 1LD7A 5FQ4A 2H6FA 5HRYA 4I2ZA 3HIZA 3QC1A 1NZNA 1U3DA 4DLOA 2I1JA 4U7EB 4C48B 3ASHA 4ILIA 2JABA 3UM3A 3NAWA 2WXNA 3CVWA 3G2UA 1AWCB 2OVFA 5JMND 3KEZA 4IULA 2P9UG 3R7RA 4XIFA 4R7LA 4KVMA 5EIBE 3HXCA 3SBSA 4PS7A 1FCHA 5G04C 3MJWA 3DSVA 2NC9A 3TJPA 2L0TB 3SO8A 2MYOA 1TN7A 4RSYA 2BTDA 1BI8B 1EDUA 3SQVA 4JL0A 3RO3A 2C0MA 4LG6A 4YDWA 4F1SA 1L5JA 4GMLA 1V55E 4AVXA 2VQ2A 1YA0A 5B3SE 4JZYA 4GPKA 3CK7A 3CVXA 1YCSB 3R7QA 1N94A 4JA7A 4JXTA 3OXFA 3R9AB 2J49A 3UI2A 2BKGA 3L22A 4U8HA 1SA4A 1JCRA 5LOZA 3CVYA 2V5FA 4H7YA 5FZRA 3FP3A 3C72A 3LJNA 4IYPA 1HE8A 3E30A 1LD8A 2CHXA 3TG4A 2J09A 4I6GA 4JB8P 2VGYA 2V8SE 2PM7A 3EHRA 4DPRA 2GGFA 2KXPC 2A4ZA 3CVUA 3CHPA 2Y4UA 5AQBA 1DNPA 4UWLA 3RRUA 2ZISA 3UPVA 4TXQA 1O1SA 4LRZA 3Q49B 4I9EA 4BX8A 4EBAA 4WWNA 3WG7E 2IO2C 2DBAA 1SW6A 4WNFA 4DJAA 4JVSA 1HZ4A 3ENEA 3IBEA 4U96D 4B94A 1JCSA 2JEKA 2JLBA 2LXLA 1N9AA 2DYSE 3ZW3A 3UINC 3T8KA 3EU5A 2IEJA 4U0ZA 3OTNA 1IQUA 3PUJA 3ASNE 1S63A 3T8MA 4FC8A 4GZCA 2AWIA 1DVPA 2QYJA 2DZNA 3HXEA 3P2BA 3DSWA 3NF1A 4PH4B 2WXLA 3FH5A 3UIPC 4HOSA 3GW4A 3HVEB 1SQMA 2ETAA 3D9JA 3JXJA 5G55A 3FWVA 3U9WA 3MV3B 2EINE 5KBAA 1IHBA 5AQAA 3EDTB 1OY3D 3PREA 3C5RA 4TV3A 2XS1A 2YHCA 3KSQA 3E32A 3S7FA 2ZIRA 3UQ3A 1VDYA 2IO3C 2Q7FA 3EUVA 4DX5D 2IQCA 1E96B 2A5UA 4J8YA 1O1RA 2VGXA 4I1MA 5AAOA 1E8XA 3G2SA 4L9PA 4YNDA 1SVXA 3E34A 1E8ZA 2LAHA 3FFLA 4MLPA 4B8AA 2IFUA 4N39A 2CFZA 3MX3A 4U63A 3VLFA 3VTYA 1P5QA 2P2CP 3FU0A 4HRMB 2FULA 3EHNA 5LP0A 4JEHA 4WUYA 2XQ0A 5KJLA 4LNGA 4GU5A 2HYZA 2P9KG 4HB5A 3LY9A 2XS8A 3DEOA 1N52A 1N4PA 3DBSA 3SFXA 4EPZA 3IHYA 5DBKA 3CGHA 5D66A 2B0OE 1N0QA 4L23A 2XENA 1WY6A 3CR3A 4CT4A 4UWKA 1H6OA 4HOQA 2QZAA 4KT6B 2LAIA 3LJ3A 2CG2A 2DCPA 1OXJA 5BXUA 4GTQA 2XEVA 1UOHA 1B89A 5AJDA 2PQRA 3VTXA 5J08A 1SZ9A 4N2QA 4HVBA 3B7SA 4DX7D 1FPPA 1IHGA 5AENA 1H19A 1JWFA 4APOA 4YDEA 3UMVA 1NA0A 1TNUA 4ILGA 3QARA 2IU1A 3B95A 1KZOA 2WVIA 1TJFA 3DSUA 4I43A 4F53A 1QYMA 3KS2A 2ZGGA 3MZLB 3PZ3A 3FU5A 3Q78A 4C0MA 5EDSA 2IONA 3ONLA 5EN5D 5KJKA 3E37A 3FUFA 5CRUA 3RRNB 4CEMA 4NIKA 2UY1A 3IKOB 3CK9A 2CHZA 3ML8A 3PZ1A 2LO6A 4GCNA 1X81A 2GW1A 4KVOA 3C3QA 3Q7FA 4WNDA 3MKRA 2V4HC 3UM1A 4FU3A 3FH7A 3HXDA 2GRNB 3PEVB 3FTSA 1D8DA 2M63A 4I2WA 2WXPA 5T8IA 3TWSA 2ZU6B 4GMRA 2WXQA 3AJIA 5BV1A 1U2VG 2YQ8A 5FQ7A 5HQ8A 5FQ6A 3IXEA 4EBAG 4K5AB 3JUEA 3UUXA 5BV0A 1BPOA 4GYWA 3V2XA 1H0AA 1RZ4A 5C2YA 4PS8A 3CKCA 3DEPA 4DLQA 1PY1A 2CHWA 5BUZA 4XX5A 2PL2A 4CGWA 1IQRA 3KSLA 2A5EA 3FUJA 3CK8A 3TWRA 4LEUA 4NQ0A 4U0SA 2FO7A 3ZU7B 3L54A 4UI9J 5G2NA 2F0YA 3TWQA 3CV0A 1KT0A 5CMYA 5LX8A 4F3VA 4AEZC 4FA6A 3FEXA 3NOCD 3RK6A 3KAEA 1FT1A 1OT8A 3MV2B 3SI5A 3ML9A 3T5XA 4DUIA 2L6BA 3MCXA 4U04A 1N4RA 5ENQD 3FTUA 4DX2A 1HS6A 4HOUA 3NZSA 3BEEA 1TN6A 4AV7A 3MKQA 4WNGA 3ZGQA 2IF4A 5CMWA 4HORA 4JA9A 2XGOA 4F6RD 2KCVA 5ENOD 4GYOA 2I6HA 3SBTB 3L82A 1E7UA 3B7TA 3Q9NC 4Q69A 3FTWA 2GRLA 5AQ7A 3ZYQA 1E8YA 2AXZA 1D9SA 1TYQG 5HKPA 3J5PA 3QB2A 3SFYA 2FF4A 3CLJA 2IJGX 2B6CA 5KNGA 1ZU2A 5EX3A 4CDNA 3L13A 3JCKC 4BETA 3W9GA 4EZKA 1OCCE 1HF8A 3PEUB 3PRZA 2GRMA 3ZXSA 1MQSA 1HFAA 2KZTA 3V30A 4N5QA 3L9TA 3RAUA 3AG4E 2IY0C 2P9IG 3UT4A 4Y6CA 3CHRA 5LCWJ 4JPSA 3U66A 3LKUA 4O6FA 4LUNU 2WM9A 3CVLA 1QBQA 5JJTA 4OAVB 2P9NG 1KT1A 2ETCA 3ESLA 2V5QC 1UW4B 2WQ7A 4XKCA 1ELKA 4KXKB 4J6IA 1OCOE 4ANXA 1N0RA 2XZTG 4AY5A 3RSEG 5T3RA 2GRPB 2VSNA 3C98A 2VSOE 1KZPA 2PZIA 4OVUA 2WXKA 3BUAA 4JW1A 4AP2A 3EIJA 3ZEFA 2UY1B 2DWZA 4BTAA 2FEZA 1OWMA 4MKTA 1EF1C 2NSZA 2VTBA 3ISMC 2XGSA 5EKQD 2BF0X 3VLEA 3SD5A 4HI9A 3DXMG 5KCMA 3ZPJA 4DRXE 5CECB 3AU5A 2YINA 5ENRD 3EIQC 5A6CA 4GTTA 5AQ9A 2X6IA 3Q7AA 4JHJA 2KBXA 1MHQA 2C2LA 2VSXE 4NACA 4I17A 4GZ6A 5FZSA 4N3CA 2BKKB 2RFMA 3ASDA 3D9LA 2EQXA 4AOFA 3PE3A 4JC8A 3EJNA 1TNOA 2MHKA 4GTSA 4EQFA 4Y6WA 5G05C 5IY5E 3NB2A 3KEAA 1O5MA 5DIZA 3GYZA 3I4RB 5G04J 4BY6A 2QFCA 4G26A 3TWXA 1H2VC 3GZ1A 4A55A 1OWNA 1HXIA 1E90A 1MYOA 2WXGA 5ENPD 1EPUA 2LSVA 3ULYA 5CERB 3BU8A 2YNQA 5CCLA 1WDYA 3HYMB 1TR4A 1BI7B 4GTOA 2XHEA 3D9MA 3FUMA 2I9CA 3U64A 5EYLA 2F8YA 3C3RA 4UI9K 3TWUA 2IOLA 2X38A 3HG0D 3L6AA 2L6JA 2Y1LE 4MS6A 4K5CA 1RW2A 1BD8A 3P1UA 1S0PA 3D9IA 4FADA 2HO1A 3D9NA 3TWVA 2QC9A 2KCLA 1N54A 2OCCE 5M72A 3DPDA 2AVPA 4CDMA 1INZA 5D0OD 2WXJA 3MKQB 3ZHEA 4L2LA 3IHVA 3SHFA 3UM2A 4MRUA 5ANLA 5JHBA 4L7TA 2WMOA 3PUKA 1TNBA 1JUQA 4FHJA 3ZUVB 1TN8A 1FVFA 3TWTA 3D9KA 3W9FA 4Q96A 2AXVA 5HS0A 3MGBA 3ZRHA 4BSXA 5CBOA 2VSYA 3ONKA 5EYPF 1UN8A 4A1SA 2P58C 3AG2E 3PH0C 4JHKA 3LEWA 3APFA 4KYOB 3S7DA 3FUNA 4Z68A 3FUEA 5B1BE 3FTZA 3ZYLA 4LSZE 3Q5MA 3B7BA 3PDNA 3OAWA 2J9QA 5FINA 1A5EA 3AG3E 4ACKA 2KZTB 3AS5A 3QDNA 3LYAA 4HLEA 2P9LG 2H6GA 3D9PA 4FJYA 2XPZA 1Q2ZA 2X6KA 2XZDG 3DWLG 3ZXPA 2WXFA 3MEKA 3B7RL 4J7WA 3CVNA 4K03A 5BT1A 1E7VA 2KM4A 1HX8A 2XPYA 3PZ4A 3CSFA 3K9IA 4GA0A 1IKND 4BT9A 3CHQA 3Q79A 3FUDA 4U8YD 4GCOA 3UKUG 1K1BA 4HOTA 1K1AA 4I1AA 5FZQA 4DX6D 2ETBA 4HNAD 4IN3B 3E4BA 4K5BA 2RKKA 4TXPA 3FUIA 2VTBB 2BUGA 1MX6A 4EZLA 3L08A 2WXIA 3CHOA 3AG1E 3NQPA 1H6KA 4HXIA 1NFIE 4KMOA 2YHEA 3AS8A 4HRNA 1W3BA 4U95D 3NOGD 3LVRE 3JXIA 2X6HA 3D9HA 4TUMA 5CHEE 4EECA 1NI1A 4L2YA 2Y0BG 2ZXWE 3SY2A 2FI7A 1LF8A 2J8SD 3HRAA 1XGWA 5JA4D 3ABLE 4XI9A 1Y8MA 1OCRE 3UIOC 2EIME 2XRYA 1QQEA 5ITZF 4DI4A 4TXRA 4ACLA 4XE0A 4PUCA 3E33A 4APFA 5ENTD 4E85A 1KLXA 1Z3XA 1NP7A 5KNHD 2J4BA 1N95A 5AJLA 5CEAA 3B13A 3S7BA 3ZVVA 1E8WA 1HH8A 3FTYA 3UTMA 4G1TA 1YMPA 5FT9A 1N4QA 4A1GA 3G2TA 5A23A 1HG2A 2FO1E 2WQHA 3SF4A 3DXKG 4B0ZA 4YDYA 3I5PA 5EX0A 1OWPA 4FLBA 2KC7A 1MJ0A 4D10C 4A3TA 5AYWD 3HDXA 2EIJE 4NURA 4FJZA 2VGXB 3DSTA 1OUVA 4J8SA 2XGMA 1XNFA 2WQ6A 2R05A 3Q75A 4ANUA 4TUUA 4RG6A 4J0UA 2FBNA 2GRQB 3TG5A 4GB9A 4M7CA 4U07A 4GTVA 3FUKA 4EZJA 2P9PG 3OXGA 4CYMD 3JUIA 3MA5A 3FH8A 3F6QA 4F7AA 4DK5A 4XKBA 3UXGA 3ZN3A 1TNYA 3SGHA 3U4TA 3BG1B 5FTPA 4RQIA 4AM9A 4I6EA 2DYRE 3ESKA 2LSUA 3PE4A 5KWDA 4WWOA 4G24A 2Y69E 2ILRA 1LTXA 4JD2G 2PQNA 3FHEA 1AP7A 4BWRA 4H7XA 1TNZA 1DCQA 1ELRA 4BFRA 3L17A 4IRUA 4N2SA 4BESA 4BSZB 1TEZA 2Y3AA 1GW6A 1JWGA 3AU4A 4I9CA 1H2UA 3DSSA 3TL5A 2WXOA 2F8XK 2XCCA 4QQIA 4BX9A 4UWHA 2PM6A 4O1PA 3NBNB 3MYVA 2LNIA 3NZUA 2H6IA 3IEGA 3HHMA 4CRWA 3ZIMA 5CBNA 2PNNA 1MX2A 4J8EA 3T9KA 4F1PA 3CKBA 4O60A 3LXUX 3BG0B 4RG9A 1UJJA 2DIWA 5HI7A 4RLYA 1UN9A 1D8EA 4A63B 3QWPA 1FVHA 5FWQA 3U3WA 5ENNA 3QNKA 4A3VA 3SZ7A 4WWPA 3CSTA 2HE0A 3V31A 1KPSB 4TRQA 4CGVA 1Z6TA 1ELWA 3FTVA 5H7PA 4JEUA 4LNUD 4HLLA 4K0RA 5E76A 3ULEG 5FJYA 1EYHA 5LFAA 5D0QD 2GROB 3CVQA 4P29A 4EHMA 3CHSA 2L9BA 5ENSD 5FIOA 3SNXA 4GMJA 3B7UX 3D3MA 4GTMA 1HO8A 1Z5SC 4BTBA 4N5CA 3LVQE 3LDZA 4DX1A 1MZCA 2J4DA 5JJ7A 2GRRB 1K3ZD 4GTRA 2BEDA 2MRIA 5FQ8A 3ZFWA 2WB2A 1NL4A 3RRMB 4FLHA 2E2EA 2Y4TA 5AARA 1PC2A 4UWFA 2OV8A 1DCEA 3I4GA 4FULA 3J5QB 2MOWA 3APCA 4ANWA 4OYSA 3IV0A 3Q73A 2HM8A 3T5VA 3CQGB 4B93B 4UWGA 2XEEA 2ZGDA 4GPMA 4KBQA 1H6PA 1Y6IA 4UUCA 2KCKA 3AS4A 3UKRG 1OCZE 3AAAC 2CG3A 3QKYA 5A7DB 3C3OA 3GZSA 4XEIG 4HS2A 4WNEA 4KZ0A 3OXLA 2I2OA 3PZDA 5B1AE 3PNTB 1A17A 4URKA 2V4LA 3QK0A 3Q9UC 4HBDA 3URZA 3L16A 2J07A 3X2QE 4RVBA 3ASFA 4FHKA 4OAUC 1TJCA 2X6FA 4CDRA 4PDXA 2C0LA 3VLDA 2QY7A 2WXMA 1N11A 3EHMA 5KJMA 4HFGA 1IYGA 5ARFA 2H6HA 3ABKE 3CQCB 4GAAA 2L0IA 4XZ4A 2CFUA 1QZ2A 3Q47B 4YVQC 1Z3YA 2HR2A 3EHQA 3D9OA 3ZNGA 4YVOA 3JQ1A 3RIBA 3QWVA 1IXVA 4DI3A 3KD7A 4GYYA 2VJ8A 2QYUA 1WAO1 3N71A 2I1KA 1U3CA 5AN8A 5J90A 2WXHA 4XI0A 3RKVA 3FU6A 3FDHA 3HXFA 3ZYMA 3PZ2A 3TXNA 2DVWA 5EILA 2R5SA 4BERA 2VYIA 4FP7A 3ZKJA 2OOEA 4GTPA 1SA5A 1S70B 3R9MA 4CT0A 2X6JA 4UQYA 3CHMA 2OVBA 4I1OB 3UM0A 3BQOA 4J8DA 2IOSA 2ONDA 4AIFA 4ZFHA 1DC2A 2J08A 1OWLA 5EIDA 3PVLA 2LXMA 3PS6A 1N4SA 2NYJA 3RU0A 3V79K 3TAXA 5CCMA 5T4YA 4ABNA 3CVVA 4Q94A 5E75A 1S64A 5AIJA 1BLXB 4LNBA 3FY4A 5D2MC 3Q4AB 1H2TC 3EU9A 3DRAA 4N3BA 4HRLA 2EIKE 4JHRA 2XRZA 1K8KG 2RD0A 2R2LA 3LS8A 4LERA 4WAFA 1UJKA 5CEDB 2DZOA 5G05J 4E6HA 4J8FA 4UI9C 1HG5A 4C9BB 1ZBPA 4CZ2D 2EILE 4MBGA 3QAQA 3LCAA 4G11A 3FTXA 1UG3A 2KATA 1FT2A 4U8VD 4N3AA 2AW6A 5ARGA 1V54E 2RG8A 5BNWA 3G2WA 4AXHA 2WPVA 2V0PA 3LY7A 3UT7A 4ILHB 4U0UA 2E0IA 3TWWA 3JQ0A 2R03A 2R59A 3QWWA 2X3MA 4CCAA 1SZAA 2AJAA 3LY8A 1YYHA 4HQDA 5JJ6A 3TGOA 5CRVA 3ZYKA 2R02A 4GA1A 4LCTA 2LUHA 2OEVA 4BEPA 4ZHBA 5BXOA 3FUHA 5C1DA 3I3NA 3HXBA 4C0EA 4YDOA 4AY6A 4NRHB 4HI8A 4B89A 1WG0A 2P9SG 3DSXA 4W9RA 3ULQA 4AJWA 3DPYA 4KZCA 1X5BA 2WMNA 1HU3A 1G3NB 3CIAA 4V3IA 4ANVA 5KJNA 4G23A 4GZ5A 5JHAA 4BT8A 2OEWA 3SFZA 3CVPA 2RFAA 1OWOA 3Q15A 2VGEA 3QOUA 4OVVA 4B8CB 1ZB1A 3G2VA 4L1BA 5ANRA 1NA3A 4ATGA 3V2OA 3UT8A 1JCQA 4M3OA 5LCWC 3TXMA 2R17C 4ATZD 4GA2A 4X8QA 4G8LA 4GZDA 2UWJG 1JPLA 3CEQA 3GZ2A 3JYSA 4G8KA 3RJVA 4PS3A 4UQXA 3ASGA 2NXPA 4G25A 3S7JA 5BPPA 1PAQA 3ASOE 1QNFA 3UX4A 2XPIA 4ME2A 3FU3A 3ABME 3O4ZA 3S2AA 1MX4A 3HVEA 5BW8C 4I6JA 2WXRA
chains in the Genus database with same CATH topology
4UI9K 2IU1A 2IOLA 2X38A 5D0QD 3L6AA 3CVQA 4P29A 2WVIA 3CHSA 2L6JA 2L9BA 1TJFA 3QJZA 2AXUA 4QFVA 3SNXA 4GMJA 4MS6A 3B7UX 3D3MA 4I43A 3FULA 3PNLB 4F53A 3P1UA 1S0PA 3KS2A 3ZHEB 3APDA 4UQZA 1HO8A 3D9IA 3MZLB 2XCBA 3FEYA 4FADA 4BTBA 4N5CA 2HO1A 3D9NA 3FU5A 3LVQE 3LDZA 4C0MA 2KCLA 1N54A 5EDSA 1WM5A 2J4DA 3RO2A 2IONA 3ONLA 5M72A 3DPDA 5JJ7A 3O48A 3WXXA 2AVPA 4CDMA 1INZA 4G2VA 3LPZA 4GZ3A 2MRIA 5D0OD 5KJKA 5FQ8A 3FUFA 3ZFWA 2WB2A 2WXJA 3RRNB 5FQ4A 4CEMA 3RRMB 3MKQB 4FLHA 2UY1A 3ZHEA 3IKOB 2E2EA 4L2LA 2Y4TA 3IHVA 3CK9A 3SHFA 1PC2A 2CHZA 4UWFA 2OV8A 4MRUA 4I2ZA 3ML8A 4GCNA 2LO6A 3HIZA 3QC1A 2GW1A 3I4GA 4FULA 1NZNA 2MOWA 4KVOA 5ANLA 5JHBA 4L7TA 3APCA 1U3DA 2WMOA 4ANWA 3PUKA 4OYSA 4WNDA 4DLOA 2I1JA 3MKRA 1JUQA 3IV0A 3ASHA 4FU3A 4ILIA 3FH7A 4FHJA 1FVFA 3PEVB 2HM8A 3T5VA 3FTSA 2WXNA 3D9KA 3CVWA 3G2UA 3CQGB 4Q96A 2AXVA 4UWGA 2M63A 3MGBA 3ZRHA 2OVFA 4BSXA 4KBQA 2VSYA 3ONKA 4I2WA 2WXPA 1UN8A 1Y6IA 4A1SA 2P58C 3KEZA 3PH0C 4JHKA 5T8IA 4IULA 3LEWA 3APFA 3R7RA 2ZU6B 4XIFA 4R7LA 2WXQA 2KCKA 3AS4A 4KVMA 5BV1A 4KYOB 3S7DA 3FUNA 2YQ8A 5FQ7A 3SBSA 4PS7A 3FUEA 3ZYLA 3FTZA 1FCHA 5HQ8A 5FQ6A 2CG3A 3Q5MA 3PDNA 3QKYA 5G04C 3OAWA 5A7DB 3GZSA 4EBAG 2J9QA 3MJWA 2NC9A 3TJPA 3UUXA 4HS2A 4WNEA 4ACKA 2KZTB 4KZ0A 2L0TB 5BV0A 3OXLA 1BPOA 2I2OA 3AS5A 3PZDA 3QDNA 3PNTB 4GYWA 4RSYA 1A17A 2BTDA 1EDUA 1H0AA 4URKA 5C2YA 2V4LA 4PS8A 3CKCA 4DLQA 1PY1A 2CHWA 5BUZA 3LYAA 4HLEA 4XX5A 3QK0A 4JL0A 3D9PA 3URZA 2PL2A 3L16A 4FJYA 3RO3A 2J07A 2XPZA 4RVBA 3ASFA 2C0MA 2X6KA 4FHKA 4CGWA 1IQRA 2WXFA 3MEKA 1TJCA 3B7RL 2X6FA 4CDRA 4F1SA 4PDXA 3FUJA 1L5JA 4GMLA 3CK8A 2C0LA 3VLDA 2QY7A 2WXMA 3CVNA 3EHMA 4LEUA 2VQ2A 4NQ0A 4AVXA 5KJMA 4U0SA 4HFGA 1IYGA 4K03A 1YA0A 5ARFA 4JZYA 4GPKA 3CK7A 1E7VA 5BT1A 3CVXA 2FO7A 3CQCB 2KM4A 4GAAA 1HX8A 2L0IA 2XPYA 4XZ4A 2CFUA 3L54A 3R7QA 3CSFA 3K9IA 4GA0A 4JA7A 4BT9A 1QZ2A 3CHQA 4UI9J 3Q47B 4YVQC 5G2NA 3FUDA 1Z3YA 2HR2A 3OXFA 4JXTA 2J49A 3R9AB 4GCOA 3CV0A 3L22A 3D9OA 4U8HA 4HOTA 1KT0A 4YVOA 5LOZA 4I1AA 3JQ1A 5CMYA 5FZQA 3RIBA 5LX8A 3CVYA 3QWVA 2V5FA 4H7YA 4F3VA 4AEZC 4IN3B 3FP3A 5FZRA 3E4BA 3KD7A 2VJ8A 4GYYA 4DI3A 1WAO1 4IYPA 3N71A 2I1KA 1U3CA 1HE8A 3FUIA 2VTBB 2CHXA 3TG4A 5J90A 2BUGA 4FA6A 4EZLA 2WXHA 4XI0A 3RKVA 3FU6A 3L08A 3FDHA 2WXIA 3CHOA 3FEXA 3ZYMA 3TXNA 2J09A 4I6GA 3RK6A 2VGYA 2V8SE 2PM7A 3KAEA 3NQPA 1H6KA 3MV2B 3SI5A 4HXIA 2R5SA 3ML9A 3T5XA 4KMOA 2VYIA 4DPRA 3MCXA 2GGFA 2YHEA 4U04A 2A4ZA 3AS8A 4FP7A 3CVUA 2OOEA 1W3BA 3CHPA 2Y4UA 3LVRE 3FTUA 4CT0A 1DNPA 2X6HA 4UWLA 2X6JA 1HS6A 4HOUA 3NZSA 4UQYA 3RRUA 5CHEE 3BEEA 4EECA 3UPVA 3CHMA 4LRZA 4AV7A 2OVBA 3MKQA 3Q49B 4I1OB 4I9EA 4WNGA 2IF4A 4L2YA 3ZGQA 5CMWA 4HORA 4JA9A 4BX8A 4EBAA 2XGOA 4WWNA 2KCVA 4J8DA 2IOSA 2ONDA 4GYOA 4AIFA 2FI7A 1LF8A 2DBAA 2I6HA 3SBTB 2J08A 1XGWA 1E7UA 3B7TA 4WNFA 4DJAA 4Q69A 1OWLA 4JVSA 1HZ4A 4XI9A 1Y8MA 3PVLA 3FTWA 2GRLA 3ENEA 3PS6A 3ZYQA 1E8YA 3RU0A 2AXZA 2XRYA 3IBEA 3TAXA 3QB2A 1QQEA 4B94A 2JLBA 2JEKA 4DI4A 5CCMA 4ACLA 2FF4A 4XE0A 3CLJA 2IJGX 5T4YA 4PUCA 4ABNA 4APFA 3ZW3A 3CVVA 4E85A 1KLXA 4Q94A 1Z3XA 1ZU2A 1NP7A 5E75A 5EX3A 5AIJA 2J4BA 4CDNA 3L13A 3JCKC 3FY4A 4U0ZA 3Q4AB 5AJLA 1H2TC 3OTNA 3B13A 4EZKA 1IQUA 3S7BA 3PUJA 3ZVVA 1E8WA 1HF8A 3PEUB 3PRZA 2GRMA 4N3BA 3ZXSA 3T8MA 4FC8A 1MQSA 1HH8A 4GZCA 3FTYA 1HFAA 2KZTA 2AWIA 1DVPA 4JHRA 2XRZA 3P2BA 2RD0A 4G1TA 3LS8A 3NF1A 1UJKA 4LERA 4PH4B 4WAFA 2WXLA 5FT9A 4A1GA 3FH5A 3G2TA 5A23A 5G05J 4E6HA 1HG2A 4J8FA 2WQHA 4HOSA 3UT4A 4Y6CA 3SF4A 4UI9C 3GW4A 1HG5A 3CHRA 4C9BB 1ZBPA 3HVEB 5LCWJ 1SQMA 4JPSA 4B0ZA 3D9JA 3U66A 3I5PA 3LKUA 5EX0A 1OWPA 4O6FA 4FLBA 2KC7A 3QAQA 3LCAA 4D10C 4A3TA 4LUNU 5AYWD 3HDXA 4G11A 3FTXA 5G55A 2WM9A 3FWVA 3U9WA 3CVLA 4NURA 4FJZA 3MV3B 2VGXB 1UG3A 5JJTA 1OUVA 4J8SA 3EDTB 2XGMA 1XNFA 2KATA 3PREA 2WQ6A 1KT1A 3ESLA 4ANUA 4TV3A 4TUUA 2YHCA 1UW4B 4N3AA 2AW6A 4RG6A 5ARGA 4XKCA 4J0UA 2FBNA 2WQ7A 3S7FA 1ELKA 3TG5A 3UQ3A 4GB9A 4KXKB 4U07A 2RG8A 1VDYA 5BNWA 3G2WA 4AXHA 2Q7FA 2IQCA 1E96B 4J6IA 2WPVA 4ANXA 2V0PA 3LY7A 3UT7A 4ILHB 2A5UA 4AY5A 3FUKA 5T3RA 2VGXA 2VSNA 3C98A 4U0UA 4EZJA 2E0IA 4I1MA 2VSOE 1E8XA 3JQ0A 2PZIA 3G2SA 3OXGA 2WXKA 4OVUA 4YNDA 4JW1A 3EIJA 2R59A 3JUIA 3FH8A 3MA5A 2X3MA 3QWWA 3ZEFA 4AP2A 4CCAA 2UY1B 1SZAA 1E8ZA 2LAHA 3FFLA 3LY8A 4MLPA 4BTAA 4B8AA 5JJ6A 3TGOA 2FEZA 1OWMA 2IFUA 4MKTA 3ZYKA 4N39A 4F7AA 4GA1A 4XKBA 4DK5A 1EF1C 2CFZA 4LCTA 2NSZA 2VTBA 3MX3A 2XGSA 5EKQD 3ZN3A 3SGHA 4U63A 3U4TA 2BF0X 3BG1B 3VLEA 3FUHA 3SD5A 5C1DA 3I3NA 3VLFA 5FTPA 4C0EA 5KCMA 3VTYA 3ZPJA 1P5QA 4AY6A 4NRHB 4AM9A 4I6EA 4B89A 3PE4A 3ESKA 2LSUA 3FU0A 4W9RA 3ULQA 4WWOA 2FULA 3EHNA 4AJWA 4G24A 5LP0A 2ILRA 4KZCA 1X5BA 2PQNA 3AU5A 2YINA 4JEHA 4WUYA 2WMNA 2XQ0A 3FHEA 5A6CA 1HU3A 3EIQC 4BWRA 5KJLA 4H7XA 3CIAA 4GU5A 1ELRA 2X6IA 2HYZA 4JHJA 4V3IA 4BFRA 4ANVA 3L17A 4IRUA 5KJNA 4G23A 4GZ5A 5JHAA 4N2SA 1MHQA 2C2LA 2VSXE 4BT8A 4NACA 1TEZA 4I17A 4GZ6A 5FZSA 2Y3AA 4N3CA 3SFZA 3LY9A 3CVPA 1GW6A 1JWGA 1OWOA 3AU4A 3Q15A 3QOUA 4I9CA 4OVVA 1N52A 4B8CB 1H2UA 3ASDA 3DBSA 3TL5A 4EPZA 3D9LA 2EQXA 3IHYA 2WXOA 3G2VA 4L1BA 2XCCA 3PE3A 4AOFA 4JC8A 4BX9A 5ANRA 3EJNA 1NA3A 5DBKA 4ATGA 2MHKA 4UWHA 3CGHA 3UT8A 4EQFA 2PM6A 4Y6WA 4L23A 5G05C 1WY6A 3MYVA 2LNIA 3CR3A 3NZUA 4CT4A 4M3OA 5LCWC 3TXMA 4UWKA 3IEGA 3HHMA 4CRWA 4HOQA 2R17C 3ZIMA 4GA2A 4KT6B 5DIZA 4GZDA 2LAIA 2UWJG 3LJ3A 3GYZA 2CG2A 1JPLA 3I4RB 5G04J 2DCPA 4J8EA 4BY6A 3CEQA 3CKBA 3GZ2A 2QFCA 3JYSA 3LXUX 4G26A 3BG0B 3RJVA 4RG9A 2XEVA 1H2VC 3GZ1A 1B89A 5AJDA 2PQRA 4A55A 1UJJA 2DIWA 4PS3A 5HI7A 1UN9A 3VTXA 4UQXA 3QWPA 1OWNA 1HXIA 3ASGA 1FVHA 5J08A 1E90A 1SZ9A 2NXPA 4G25A 3S7JA 2WXGA 5FWQA 5BPPA 3U3WA 5ENNA 1EPUA 2LSVA 3QNKA 4A3VA 3SZ7A 4N2QA 4WWPA 4HVBA 2YNQA 1PAQA 3CSTA 5CCLA 1QNFA 3B7SA 3UX4A 2XPIA 3HYMB 4ME2A 4TRQA 1IHGA 3FU3A 2XHEA 5AENA 1H19A 4CGVA 1JWFA 1Z6TA 4APOA 1ELWA 3FTVA 3D9MA 3O4ZA 4JEUA 3FUMA 3S2AA 3HVEA 3UMVA 1NA0A 4K0RA 5E76A 5BW8C 5FJYA 1EYHA 2I9CA 4I6JA 2WXRA 3U64A 4ILGA 3QARA 5LFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UI9 K;  5D0Q D;  3CVQ A;  2L6J A;  3KS2 A;  3ZHE B;  4UQZ A;  2XCB A;  4BTB A;  4N5C A;  2HO1 A;  2KCL A;  1WM5 A;  3RO2 A;  5M72 A;  5JJ7 A;  3O48 A;  3WXX A;  2AVP A;  4G2V A;  3LPZ A;  4GZ3 A;  5D0O D;  5KJK A;  3ZFW A;  2UY1 A;  3ZHE A;  2E2E A;  2Y4T A;  3CK9 A;  1PC2 A;  4I2Z A;  4GCN A;  2GW1 A;  1NZN A;  4WND A;  3MKR A;  3ASH A;  4KBQ A;  2VSY A;  4I2W A;  4A1S A;  2P58 C;  4XIF A;  2KCK A;  3AS4 A;  4KYO B;  3S7D A;  2YQ8 A;  1FCH A;  5HQ8 A;  3Q5M A;  3PDN A;  3QKY A;  5G04 C;  5A7D B;  2J9Q A;  2NC9 A;  3UUX A;  4WNE A;  3OXL A;  3AS5 A;  3QDN A;  4GYW A;  1A17 A;  3CKC A;  3LYA A;  4JL0 A;  3URZ A;  2PL2 A;  3RO3 A;  3ASF A;  2C0M A;  4CGW A;  3MEK A;  1TJC A;  4CDR A;  3CK8 A;  2C0L A;  3CVN A;  4LEU A;  4NQ0 A;  2VQ2 A;  5KJM A;  4U0S A;  1IYG A;  1YA0 A;  5ARF A;  4GPK A;  3CK7 A;  5BT1 A;  2FO7 A;  3K9I A;  4GA0 A;  4JA7 A;  4BT9 A;  1QZ2 A;  4UI9 J;  3Q47 B;  4YVQ C;  3R9A B;  2HR2 A;  3OXF A;  4GCO A;  3CV0 A;  4HOT A;  1KT0 A;  4YVO A;  4I1A A;  3RIB A;  5FZQ A;  3QWV A;  2V5F A;  4H7Y A;  4F3V A;  4IN3 B;  3FP3 A;  5FZR A;  3E4B A;  3KD7 A;  4GYY A;  1WAO 1;  3N71 A;  3TG4 A;  2BUG A;  4XI0 A;  3RKV A;  2VGY A;  3KAE A;  3MV2 B;  2R5S A;  2VYI A;  4U04 A;  3AS8 A;  2OOE A;  1W3B A;  2Y4U A;  4HOU A;  4UQY A;  5CHE E;  3BEE A;  3UPV A;  4WNG A;  3Q49 B;  4I9E A;  3ZGQ A;  2IF4 A;  4HOR A;  4JA9 A;  2XGO A;  2KCV A;  4J8D A;  2OND A;  4GYO A;  4AIF A;  2FI7 A;  2DBA A;  2I6H A;  4WNF A;  1HZ4 A;  4XI9 A;  1Y8M A;  3RU0 A;  3TAX A;  1QQE A;  4B94 A;  2JLB A;  5CCM A;  2FF4 A;  4ABN A;  1KLX A;  1ZU2 A;  5EX3 A;  4U0Z A;  3Q4A B;  3S7B A;  4N3B A;  1HH8 A;  4JHR A;  4G1T A;  3NF1 A;  5FT9 A;  5G05 J;  4J8F A;  2WQH A;  4HOS A;  4Y6C A;  3SF4 A;  4UI9 C;  3GW4 A;  5LCW J;  1ZBP A;  3LKU A;  5EX0 A;  4O6F A;  2KC7 A;  3LCA A;  5AYW D;  3FWV A;  3CVL A;  3MV3 B;  2VGX B;  5JJT A;  1OUV A;  3EDT B;  2XGM A;  1XNF A;  2KAT A;  1KT1 A;  2YHC A;  4N3A A;  4RG6 A;  5ARG A;  4J0U A;  2FBN A;  3S7F A;  3TG5 A;  3UQ3 A;  4KXK B;  4U07 A;  5BNW A;  2Q7F A;  1E96 B;  2WPV A;  3LY7 A;  4AY5 A;  2VGX A;  2VSN A;  4U0U A;  2PZI A;  3OXG A;  4YND A;  3MA5 A;  3QWW A;  2UY1 B;  3FFL A;  3LY8 A;  4BTA A;  5JJ6 A;  3TGO A;  2FEZ A;  2IFU A;  4N39 A;  4GA1 A;  2XGS A;  5EKQ D;  3ZN3 A;  3U4T A;  5C1D A;  5FTP A;  3VTY A;  3ZPJ A;  1P5Q A;  4AY6 A;  4NRH B;  4AM9 A;  3PE4 A;  3ESK A;  2LSU A;  4W9R A;  3ULQ A;  4G24 A;  2PQN A;  4WUY A;  5A6C A;  4BWR A;  5KJL A;  4H7X A;  1ELR A;  2HYZ A;  5KJN A;  4N2S A;  4G23 A;  4GZ5 A;  2C2L A;  4BT8 A;  4I17 A;  4GZ6 A;  5FZS A;  4N3C A;  3LY9 A;  3CVP A;  3Q15 A;  4I9C A;  3QOU A;  3ASD A;  2XCC A;  3PE3 A;  1NA3 A;  5DBK A;  2MHK A;  4EQF A;  4Y6W A;  5G05 C;  2LNI A;  5LCW C;  3IEG A;  4HOQ A;  4GA2 A;  5DIZ A;  2UWJ G;  3GYZ A;  5G04 J;  4J8E A;  3CEQ A;  3CKB A;  3GZ2 A;  2QFC A;  3JYS A;  4G26 A;  3RJV A;  4RG9 A;  2XEV A;  3GZ1 A;  1B89 A;  2PQR A;  5HI7 A;  3VTX A;  4UQX A;  3QWP A;  1HXI A;  3ASG A;  3S7J A;  4G25 A;  3U3W A;  2LSV A;  3SZ7 A;  4N2Q A;  5CCL A;  2XPI A;  3HYM B;  4ME2 A;  1IHG A;  4CGV A;  4APO A;  1ELW A;  1NA0 A;  5BW8 C;  5FJY A; 
#chains in the Genus database with same CATH topology
 4O1O A;  1BU9 A;  2XEH A;  3QJZ A;  2AXU A;  4QFV A;  3FUL A;  3PNL B;  3ZHE B;  3APD A;  4UQZ A;  2XCB A;  3FEY A;  1O1T A;  1WM5 A;  3RO2 A;  2F37 A;  3O48 A;  3WXX A;  4G2V A;  3LPZ A;  4GZ3 A;  1LD7 A;  5FQ4 A;  2H6F A;  5HRY A;  4I2Z A;  3HIZ A;  3QC1 A;  1NZN A;  1U3D A;  4DLO A;  2I1J A;  4U7E B;  4C48 B;  3ASH A;  4ILI A;  2JAB A;  3UM3 A;  3NAW A;  2WXN A;  3CVW A;  3G2U A;  1AWC B;  2OVF A;  5JMN D;  3KEZ A;  4IUL A;  2P9U G;  3R7R A;  4XIF A;  4R7L A;  4KVM A;  5EIB E;  3HXC A;  3SBS A;  4PS7 A;  1FCH A;  5G04 C;  3MJW A;  3DSV A;  2NC9 A;  3TJP A;  2L0T B;  3SO8 A;  2MYO A;  1TN7 A;  4RSY A;  2BTD A;  1BI8 B;  1EDU A;  3SQV A;  4JL0 A;  3RO3 A;  2C0M A;  4LG6 A;  4YDW A;  4F1S A;  1L5J A;  4GML A;  1V55 E;  4AVX A;  2VQ2 A;  1YA0 A;  5B3S E;  4JZY A;  4GPK A;  3CK7 A;  3CVX A;  1YCS B;  3R7Q A;  1N94 A;  4JA7 A;  4JXT A;  3OXF A;  3R9A B;  2J49 A;  3UI2 A;  2BKG A;  3L22 A;  4U8H A;  1SA4 A;  1JCR A;  5LOZ A;  3CVY A;  2V5F A;  4H7Y A;  5FZR A;  3FP3 A;  3C72 A;  3LJN A;  4IYP A;  1HE8 A;  3E30 A;  1LD8 A;  2CHX A;  3TG4 A;  2J09 A;  4I6G A;  4JB8 P;  2VGY A;  2V8S E;  2PM7 A;  3EHR A;  4DPR A;  2GGF A;  2KXP C;  2A4Z A;  3CVU A;  3CHP A;  2Y4U A;  5AQB A;  1DNP A;  4UWL A;  3RRU A;  2ZIS A;  3UPV A;  4TXQ A;  1O1S A;  4LRZ A;  3Q49 B;  4I9E A;  4BX8 A;  4EBA A;  4WWN A;  3WG7 E;  2IO2 C;  2DBA A;  1SW6 A;  4WNF A;  4DJA A;  4JVS A;  1HZ4 A;  3ENE A;  3IBE A;  4U96 D;  4B94 A;  1JCS A;  2JEK A;  2JLB A;  2LXL A;  1N9A A;  2DYS E;  3ZW3 A;  3UIN C;  3T8K A;  3EU5 A;  2IEJ A;  4U0Z A;  3OTN A;  1IQU A;  3PUJ A;  3ASN E;  1S63 A;  3T8M A;  4FC8 A;  4GZC A;  2AWI A;  1DVP A;  2QYJ A;  2DZN A;  3HXE A;  3P2B A;  3DSW A;  3NF1 A;  4PH4 B;  2WXL A;  3FH5 A;  3UIP C;  4HOS A;  3GW4 A;  3HVE B;  1SQM A;  2ETA A;  3D9J A;  3JXJ A;  5G55 A;  3FWV A;  3U9W A;  3MV3 B;  2EIN E;  5KBA A;  1IHB A;  5AQA A;  3EDT B;  1OY3 D;  3PRE A;  3C5R A;  4TV3 A;  2XS1 A;  2YHC A;  3KSQ A;  3E32 A;  3S7F A;  2ZIR A;  3UQ3 A;  1VDY A;  2IO3 C;  2Q7F A;  3EUV A;  4DX5 D;  2IQC A;  1E96 B;  2A5U A;  4J8Y A;  1O1R A;  2VGX A;  4I1M A;  5AAO A;  1E8X A;  3G2S A;  4L9P A;  4YND A;  1SVX A;  3E34 A;  1E8Z A;  2LAH A;  3FFL A;  4MLP A;  4B8A A;  2IFU A;  4N39 A;  2CFZ A;  3MX3 A;  4U63 A;  3VLF A;  3VTY A;  1P5Q A;  2P2C P;  3FU0 A;  4HRM B;  2FUL A;  3EHN A;  5LP0 A;  4JEH A;  4WUY A;  2XQ0 A;  5KJL A;  4LNG A;  4GU5 A;  2HYZ A;  2P9K G;  4HB5 A;  3LY9 A;  2XS8 A;  3DEO A;  1N52 A;  1N4P A;  3DBS A;  3SFX A;  4EPZ A;  3IHY A;  5DBK A;  3CGH A;  5D66 A;  2B0O E;  1N0Q A;  4L23 A;  2XEN A;  1WY6 A;  3CR3 A;  4CT4 A;  4UWK A;  1H6O A;  4HOQ A;  2QZA A;  4KT6 B;  2LAI A;  3LJ3 A;  2CG2 A;  2DCP A;  1OXJ A;  5BXU A;  4GTQ A;  2XEV A;  1UOH A;  1B89 A;  5AJD A;  2PQR A;  3VTX A;  5J08 A;  1SZ9 A;  4N2Q A;  4HVB A;  3B7S A;  4DX7 D;  1FPP A;  1IHG A;  5AEN A;  1H19 A;  1JWF A;  4APO A;  4YDE A;  3UMV A;  1NA0 A;  1TNU A;  4ILG A;  3QAR A;  2IU1 A;  3B95 A;  1KZO A;  2WVI A;  1TJF A;  3DSU A;  4I43 A;  4F53 A;  1QYM A;  3KS2 A;  2ZGG A;  3MZL B;  3PZ3 A;  3FU5 A;  3Q78 A;  4C0M A;  5EDS A;  2ION A;  3ONL A;  5EN5 D;  5KJK A;  3E37 A;  3FUF A;  5CRU A;  3RRN B;  4CEM A;  4NIK A;  2UY1 A;  3IKO B;  3CK9 A;  2CHZ A;  3ML8 A;  3PZ1 A;  2LO6 A;  4GCN A;  1X81 A;  2GW1 A;  4KVO A;  3C3Q A;  3Q7F A;  4WND A;  3MKR A;  2V4H C;  3UM1 A;  4FU3 A;  3FH7 A;  3HXD A;  2GRN B;  3PEV B;  3FTS A;  1D8D A;  2M63 A;  4I2W A;  2WXP A;  5T8I A;  3TWS A;  2ZU6 B;  4GMR A;  2WXQ A;  3AJI A;  5BV1 A;  1U2V G;  2YQ8 A;  5FQ7 A;  5HQ8 A;  5FQ6 A;  3IXE A;  4EBA G;  4K5A B;  3JUE A;  3UUX A;  5BV0 A;  1BPO A;  4GYW A;  3V2X A;  1H0A A;  1RZ4 A;  5C2Y A;  4PS8 A;  3CKC A;  3DEP A;  4DLQ A;  1PY1 A;  2CHW A;  5BUZ A;  4XX5 A;  2PL2 A;  4CGW A;  1IQR A;  3KSL A;  2A5E A;  3FUJ A;  3CK8 A;  3TWR A;  4LEU A;  4NQ0 A;  4U0S A;  2FO7 A;  3ZU7 B;  3L54 A;  4UI9 J;  5G2N A;  2F0Y A;  3TWQ A;  3CV0 A;  1KT0 A;  5CMY A;  5LX8 A;  4F3V A;  4AEZ C;  4FA6 A;  3FEX A;  3NOC D;  3RK6 A;  3KAE A;  1FT1 A;  1OT8 A;  3MV2 B;  3SI5 A;  3ML9 A;  3T5X A;  4DUI A;  2L6B A;  3MCX A;  4U04 A;  1N4R A;  5ENQ D;  3FTU A;  4DX2 A;  1HS6 A;  4HOU A;  3NZS A;  3BEE A;  1TN6 A;  4AV7 A;  3MKQ A;  4WNG A;  3ZGQ A;  2IF4 A;  5CMW A;  4HOR A;  4JA9 A;  2XGO A;  4F6R D;  2KCV A;  5ENO D;  4GYO A;  2I6H A;  3SBT B;  3L82 A;  1E7U A;  3B7T A;  3Q9N C;  4Q69 A;  3FTW A;  2GRL A;  5AQ7 A;  3ZYQ A;  1E8Y A;  2AXZ A;  1D9S A;  1TYQ G;  5HKP A;  3J5P A;  3QB2 A;  3SFY A;  2FF4 A;  3CLJ A;  2IJG X;  2B6C A;  5KNG A;  1ZU2 A;  5EX3 A;  4CDN A;  3L13 A;  3JCK C;  4BET A;  3W9G A;  4EZK A;  1OCC E;  1HF8 A;  3PEU B;  3PRZ A;  2GRM A;  3ZXS A;  1MQS A;  1HFA A;  2KZT A;  3V30 A;  4N5Q A;  3L9T A;  3RAU A;  3AG4 E;  2IY0 C;  2P9I G;  3UT4 A;  4Y6C A;  3CHR A;  5LCW J;  4JPS A;  3U66 A;  3LKU A;  4O6F A;  4LUN U;  2WM9 A;  3CVL A;  1QBQ A;  5JJT A;  4OAV B;  2P9N G;  1KT1 A;  2ETC A;  3ESL A;  2V5Q C;  1UW4 B;  2WQ7 A;  4XKC A;  1ELK A;  4KXK B;  4J6I A;  1OCO E;  4ANX A;  1N0R A;  2XZT G;  4AY5 A;  3RSE G;  5T3R A;  2GRP B;  2VSN A;  3C98 A;  2VSO E;  1KZP A;  2PZI A;  4OVU A;  2WXK A;  3BUA A;  4JW1 A;  4AP2 A;  3EIJ A;  3ZEF A;  2UY1 B;  2DWZ A;  4BTA A;  2FEZ A;  1OWM A;  4MKT A;  1EF1 C;  2NSZ A;  2VTB A;  3ISM C;  2XGS A;  5EKQ D;  2BF0 X;  3VLE A;  3SD5 A;  4HI9 A;  3DXM G;  5KCM A;  3ZPJ A;  4DRX E;  5CEC B;  3AU5 A;  2YIN A;  5ENR D;  3EIQ C;  5A6C A;  4GTT A;  5AQ9 A;  2X6I A;  3Q7A A;  4JHJ A;  2KBX A;  1MHQ A;  2C2L A;  2VSX E;  4NAC A;  4I17 A;  4GZ6 A;  5FZS A;  4N3C A;  2BKK B;  2RFM A;  3ASD A;  3D9L A;  2EQX A;  4AOF A;  3PE3 A;  4JC8 A;  3EJN A;  1TNO A;  2MHK A;  4GTS A;  4EQF A;  4Y6W A;  5G05 C;  5IY5 E;  3NB2 A;  3KEA A;  1O5M A;  5DIZ A;  3GYZ A;  3I4R B;  5G04 J;  4BY6 A;  2QFC A;  4G26 A;  3TWX A;  1H2V C;  3GZ1 A;  4A55 A;  1OWN A;  1HXI A;  1E90 A;  1MYO A;  2WXG A;  5ENP D;  1EPU A;  2LSV A;  3ULY A;  5CER B;  3BU8 A;  2YNQ A;  5CCL A;  1WDY A;  3HYM B;  1TR4 A;  1BI7 B;  4GTO A;  2XHE A;  3D9M A;  3FUM A;  2I9C A;  3U64 A;  5EYL A;  2F8Y A;  3C3R A;  4UI9 K;  3TWU A;  2IOL A;  2X38 A;  3HG0 D;  3L6A A;  2L6J A;  2Y1L E;  4MS6 A;  4K5C A;  1RW2 A;  1BD8 A;  3P1U A;  1S0P A;  3D9I A;  4FAD A;  2HO1 A;  3D9N A;  3TWV A;  2QC9 A;  2KCL A;  1N54 A;  2OCC E;  5M72 A;  3DPD A;  2AVP A;  4CDM A;  1INZ A;  5D0O D;  2WXJ A;  3MKQ B;  3ZHE A;  4L2L A;  3IHV A;  3SHF A;  3UM2 A;  4MRU A;  5ANL A;  5JHB A;  4L7T A;  2WMO A;  3PUK A;  1TNB A;  1JUQ A;  4FHJ A;  3ZUV B;  1TN8 A;  1FVF A;  3TWT A;  3D9K A;  3W9F A;  4Q96 A;  2AXV A;  5HS0 A;  3MGB A;  3ZRH A;  4BSX A;  5CBO A;  2VSY A;  3ONK A;  5EYP F;  1UN8 A;  4A1S A;  2P58 C;  3AG2 E;  3PH0 C;  4JHK A;  3LEW A;  3APF A;  4KYO B;  3S7D A;  3FUN A;  4Z68 A;  3FUE A;  5B1B E;  3FTZ A;  3ZYL A;  4LSZ E;  3Q5M A;  3B7B A;  3PDN A;  3OAW A;  2J9Q A;  5FIN A;  1A5E A;  3AG3 E;  4ACK A;  2KZT B;  3AS5 A;  3QDN A;  3LYA A;  4HLE A;  2P9L G;  2H6G A;  3D9P A;  4FJY A;  2XPZ A;  1Q2Z A;  2X6K A;  2XZD G;  3DWL G;  3ZXP A;  2WXF A;  3MEK A;  3B7R L;  4J7W A;  3CVN A;  4K03 A;  5BT1 A;  1E7V A;  2KM4 A;  1HX8 A;  2XPY A;  3PZ4 A;  3CSF A;  3K9I A;  4GA0 A;  1IKN D;  4BT9 A;  3CHQ A;  3Q79 A;  3FUD A;  4U8Y D;  4GCO A;  3UKU G;  1K1B A;  4HOT A;  1K1A A;  4I1A A;  5FZQ A;  4DX6 D;  2ETB A;  4HNA D;  4IN3 B;  3E4B A;  4K5B A;  2RKK A;  4TXP A;  3FUI A;  2VTB B;  2BUG A;  1MX6 A;  4EZL A;  3L08 A;  2WXI A;  3CHO A;  3AG1 E;  3NQP A;  1H6K A;  4HXI A;  1NFI E;  4KMO A;  2YHE A;  3AS8 A;  4HRN A;  1W3B A;  4U95 D;  3NOG D;  3LVR E;  3JXI A;  2X6H A;  3D9H A;  4TUM A;  5CHE E;  4EEC A;  1NI1 A;  4L2Y A;  2Y0B G;  2ZXW E;  3SY2 A;  2FI7 A;  1LF8 A;  2J8S D;  3HRA A;  1XGW A;  5JA4 D;  3ABL E;  4XI9 A;  1Y8M A;  1OCR E;  3UIO C;  2EIM E;  2XRY A;  1QQE A;  5ITZ F;  4DI4 A;  4TXR A;  4ACL A;  4XE0 A;  4PUC A;  3E33 A;  4APF A;  5ENT D;  4E85 A;  1KLX A;  1Z3X A;  1NP7 A;  5KNH D;  2J4B A;  1N95 A;  5AJL A;  5CEA A;  3B13 A;  3S7B A;  3ZVV A;  1E8W A;  1HH8 A;  3FTY A;  3UTM A;  4G1T A;  1YMP A;  5FT9 A;  1N4Q A;  4A1G A;  3G2T A;  5A23 A;  1HG2 A;  2FO1 E;  2WQH A;  3SF4 A;  3DXK G;  4B0Z A;  4YDY A;  3I5P A;  5EX0 A;  1OWP A;  4FLB A;  2KC7 A;  1MJ0 A;  4D10 C;  4A3T A;  5AYW D;  3HDX A;  2EIJ E;  4NUR A;  4FJZ A;  2VGX B;  3DST A;  1OUV A;  4J8S A;  2XGM A;  1XNF A;  2WQ6 A;  2R05 A;  3Q75 A;  4ANU A;  4TUU A;  4RG6 A;  4J0U A;  2FBN A;  2GRQ B;  3TG5 A;  4GB9 A;  4M7C A;  4U07 A;  4GTV A;  3FUK A;  4EZJ A;  2P9P G;  3OXG A;  4CYM D;  3JUI A;  3MA5 A;  3FH8 A;  3F6Q A;  4F7A A;  4DK5 A;  4XKB A;  3UXG A;  3ZN3 A;  1TNY A;  3SGH A;  3U4T A;  3BG1 B;  5FTP A;  4RQI A;  4AM9 A;  4I6E A;  2DYR E;  3ESK A;  2LSU A;  3PE4 A;  5KWD A;  4WWO A;  4G24 A;  2Y69 E;  2ILR A;  1LTX A;  4JD2 G;  2PQN A;  3FHE A;  1AP7 A;  4BWR A;  4H7X A;  1TNZ A;  1DCQ A;  1ELR A;  4BFR A;  3L17 A;  4IRU A;  4N2S A;  4BES A;  4BSZ B;  1TEZ A;  2Y3A A;  1GW6 A;  1JWG A;  3AU4 A;  4I9C A;  1H2U A;  3DSS A;  3TL5 A;  2WXO A;  2F8X K;  2XCC A;  4QQI A;  4BX9 A;  4UWH A;  2PM6 A;  4O1P A;  3NBN B;  3MYV A;  2LNI A;  3NZU A;  2H6I A;  3IEG A;  3HHM A;  4CRW A;  3ZIM A;  5CBN A;  2PNN A;  1MX2 A;  4J8E A;  3T9K A;  4F1P A;  3CKB A;  4O60 A;  3LXU X;  3BG0 B;  4RG9 A;  1UJJ A;  2DIW A;  5HI7 A;  4RLY A;  1UN9 A;  1D8E A;  4A63 B;  3QWP A;  1FVH A;  5FWQ A;  3U3W A;  5ENN A;  3QNK A;  4A3V A;  3SZ7 A;  4WWP A;  3CST A;  2HE0 A;  3V31 A;  1KPS B;  4TRQ A;  4CGV A;  1Z6T A;  1ELW A;  3FTV A;  5H7P A;  4JEU A;  4LNU D;  4HLL A;  4K0R A;  5E76 A;  3ULE G;  5FJY A;  1EYH A;  5LFA A;  5D0Q D;  2GRO B;  3CVQ A;  4P29 A;  4EHM A;  3CHS A;  2L9B A;  5ENS D;  5FIO A;  3SNX A;  4GMJ A;  3B7U X;  3D3M A;  4GTM A;  1HO8 A;  1Z5S C;  4BTB A;  4N5C A;  3LVQ E;  3LDZ A;  4DX1 A;  1MZC A;  2J4D A;  5JJ7 A;  2GRR B;  1K3Z D;  4GTR A;  2BED A;  2MRI A;  5FQ8 A;  3ZFW A;  2WB2 A;  1NL4 A;  3RRM B;  4FLH A;  2E2E A;  2Y4T A;  5AAR A;  1PC2 A;  4UWF A;  2OV8 A;  1DCE A;  3I4G A;  4FUL A;  3J5Q B;  2MOW A;  3APC A;  4ANW A;  4OYS A;  3IV0 A;  3Q73 A;  2HM8 A;  3T5V A;  3CQG B;  4B93 B;  4UWG A;  2XEE A;  2ZGD A;  4GPM A;  4KBQ A;  1H6P A;  1Y6I A;  4UUC A;  2KCK A;  3AS4 A;  3UKR G;  1OCZ E;  3AAA C;  2CG3 A;  3QKY A;  5A7D B;  3C3O A;  3GZS A;  4XEI G;  4HS2 A;  4WNE A;  4KZ0 A;  3OXL A;  2I2O A;  3PZD A;  5B1A E;  3PNT B;  1A17 A;  4URK A;  2V4L A;  3QK0 A;  3Q9U C;  4HBD A;  3URZ A;  3L16 A;  2J07 A;  3X2Q E;  4RVB A;  3ASF A;  4FHK A;  4OAU C;  1TJC A;  2X6F A;  4CDR A;  4PDX A;  2C0L A;  3VLD A;  2QY7 A;  2WXM A;  1N11 A;  3EHM A;  5KJM A;  4HFG A;  1IYG A;  5ARF A;  2H6H A;  3ABK E;  3CQC B;  4GAA A;  2L0I A;  4XZ4 A;  2CFU A;  1QZ2 A;  3Q47 B;  4YVQ C;  1Z3Y A;  2HR2 A;  3EHQ A;  3D9O A;  3ZNG A;  4YVO A;  3JQ1 A;  3RIB A;  3QWV A;  1IXV A;  4DI3 A;  3KD7 A;  4GYY A;  2VJ8 A;  2QYU A;  1WAO 1;  3N71 A;  2I1K A;  1U3C A;  5AN8 A;  5J90 A;  2WXH A;  4XI0 A;  3RKV A;  3FU6 A;  3FDH A;  3HXF A;  3ZYM A;  3PZ2 A;  3TXN A;  2DVW A;  5EIL A;  2R5S A;  4BER A;  2VYI A;  4FP7 A;  3ZKJ A;  2OOE A;  4GTP A;  1SA5 A;  1S70 B;  3R9M A;  4CT0 A;  2X6J A;  4UQY A;  3CHM A;  2OVB A;  4I1O B;  3UM0 A;  3BQO A;  4J8D A;  2IOS A;  2OND A;  4AIF A;  4ZFH A;  1DC2 A;  2J08 A;  1OWL A;  5EID A;  3PVL A;  2LXM A;  3PS6 A;  1N4S A;  2NYJ A;  3RU0 A;  3V79 K;  3TAX A;  5CCM A;  5T4Y A;  4ABN A;  3CVV A;  4Q94 A;  5E75 A;  1S64 A;  5AIJ A;  1BLX B;  4LNB A;  3FY4 A;  5D2M C;  3Q4A B;  1H2T C;  3EU9 A;  3DRA A;  4N3B A;  4HRL A;  2EIK E;  4JHR A;  2XRZ A;  1K8K G;  2RD0 A;  2R2L A;  3LS8 A;  4LER A;  4WAF A;  1UJK A;  5CED B;  2DZO A;  5G05 J;  4E6H A;  4J8F A;  4UI9 C;  1HG5 A;  4C9B B;  1ZBP A;  4CZ2 D;  2EIL E;  4MBG A;  3QAQ A;  3LCA A;  4G11 A;  3FTX A;  1UG3 A;  2KAT A;  1FT2 A;  4U8V D;  4N3A A;  2AW6 A;  5ARG A;  1V54 E;  2RG8 A;  5BNW A;  3G2W A;  4AXH A;  2WPV A;  2V0P A;  3LY7 A;  3UT7 A;  4ILH B;  4U0U A;  2E0I A;  3TWW A;  3JQ0 A;  2R03 A;  2R59 A;  3QWW A;  2X3M A;  4CCA A;  1SZA A;  2AJA A;  3LY8 A;  1YYH A;  4HQD A;  5JJ6 A;  3TGO A;  5CRV A;  3ZYK A;  2R02 A;  4GA1 A;  4LCT A;  2LUH A;  2OEV A;  4BEP A;  4ZHB A;  5BXO A;  3FUH A;  5C1D A;  3I3N A;  3HXB A;  4C0E A;  4YDO A;  4AY6 A;  4NRH B;  4HI8 A;  4B89 A;  1WG0 A;  2P9S G;  3DSX A;  4W9R A;  3ULQ A;  4AJW A;  3DPY A;  4KZC A;  1X5B A;  2WMN A;  1HU3 A;  1G3N B;  3CIA A;  4V3I A;  4ANV A;  5KJN A;  4G23 A;  4GZ5 A;  5JHA A;  4BT8 A;  2OEW A;  3SFZ A;  3CVP A;  2RFA A;  1OWO A;  3Q15 A;  2VGE A;  3QOU A;  4OVV A;  4B8C B;  1ZB1 A;  3G2V A;  4L1B A;  5ANR A;  1NA3 A;  4ATG A;  3V2O A;  3UT8 A;  1JCQ A;  4M3O A;  5LCW C;  3TXM A;  2R17 C;  4ATZ D;  4GA2 A;  4X8Q A;  4G8L A;  4GZD A;  2UWJ G;  1JPL A;  3CEQ A;  3GZ2 A;  3JYS A;  4G8K A;  3RJV A;  4PS3 A;  4UQX A;  3ASG A;  2NXP A;  4G25 A;  3S7J A;  5BPP A;  1PAQ A;  3ASO E;  1QNF A;  3UX4 A;  2XPI A;  4ME2 A;  3FU3 A;  3ABM E;  3O4Z A;  3S2A A;  1MX4 A;  3HVE A;  5BW8 C;  4I6J A;  2WXR A; 
#chains in the Genus database with same CATH homology
 4UI9 K;  2IU1 A;  2IOL A;  2X38 A;  5D0Q D;  3L6A A;  3CVQ A;  4P29 A;  2WVI A;  3CHS A;  2L6J A;  2L9B A;  1TJF A;  3QJZ A;  2AXU A;  4QFV A;  3SNX A;  4GMJ A;  4MS6 A;  3B7U X;  3D3M A;  4I43 A;  3FUL A;  3PNL B;  4F53 A;  3P1U A;  1S0P A;  3KS2 A;  3ZHE B;  3APD A;  4UQZ A;  1HO8 A;  3D9I A;  3MZL B;  2XCB A;  3FEY A;  4FAD A;  4BTB A;  4N5C A;  2HO1 A;  3D9N A;  3FU5 A;  3LVQ E;  3LDZ A;  4C0M A;  2KCL A;  1N54 A;  5EDS A;  1WM5 A;  2J4D A;  3RO2 A;  2ION A;  3ONL A;  5M72 A;  3DPD A;  5JJ7 A;  3O48 A;  3WXX A;  2AVP A;  4CDM A;  1INZ A;  4G2V A;  3LPZ A;  4GZ3 A;  2MRI A;  5D0O D;  5KJK A;  5FQ8 A;  3FUF A;  3ZFW A;  2WB2 A;  2WXJ A;  3RRN B;  5FQ4 A;  4CEM A;  3RRM B;  3MKQ B;  4FLH A;  2UY1 A;  3ZHE A;  3IKO B;  2E2E A;  4L2L A;  2Y4T A;  3IHV A;  3CK9 A;  3SHF A;  1PC2 A;  2CHZ A;  4UWF A;  2OV8 A;  4MRU A;  4I2Z A;  3ML8 A;  4GCN A;  2LO6 A;  3HIZ A;  3QC1 A;  2GW1 A;  3I4G A;  4FUL A;  1NZN A;  2MOW A;  4KVO A;  5ANL A;  5JHB A;  4L7T A;  3APC A;  1U3D A;  2WMO A;  4ANW A;  3PUK A;  4OYS A;  4WND A;  4DLO A;  2I1J A;  3MKR A;  1JUQ A;  3IV0 A;  3ASH A;  4FU3 A;  4ILI A;  3FH7 A;  4FHJ A;  1FVF A;  3PEV B;  2HM8 A;  3T5V A;  3FTS A;  2WXN A;  3D9K A;  3CVW A;  3G2U A;  3CQG B;  4Q96 A;  2AXV A;  4UWG A;  2M63 A;  3MGB A;  3ZRH A;  2OVF A;  4BSX A;  4KBQ A;  2VSY A;  3ONK A;  4I2W A;  2WXP A;  1UN8 A;  1Y6I A;  4A1S A;  2P58 C;  3KEZ A;  3PH0 C;  4JHK A;  5T8I A;  4IUL A;  3LEW A;  3APF A;  3R7R A;  2ZU6 B;  4XIF A;  4R7L A;  2WXQ A;  2KCK A;  3AS4 A;  4KVM A;  5BV1 A;  4KYO B;  3S7D A;  3FUN A;  2YQ8 A;  5FQ7 A;  3SBS A;  4PS7 A;  3FUE A;  3ZYL A;  3FTZ A;  1FCH A;  5HQ8 A;  5FQ6 A;  2CG3 A;  3Q5M A;  3PDN A;  3QKY A;  5G04 C;  3OAW A;  5A7D B;  3GZS A;  4EBA G;  2J9Q A;  3MJW A;  2NC9 A;  3TJP A;  3UUX A;  4HS2 A;  4WNE A;  4ACK A;  2KZT B;  4KZ0 A;  2L0T B;  5BV0 A;  3OXL A;  1BPO A;  2I2O A;  3AS5 A;  3PZD A;  3QDN A;  3PNT B;  4GYW A;  4RSY A;  1A17 A;  2BTD A;  1EDU A;  1H0A A;  4URK A;  5C2Y A;  2V4L A;  4PS8 A;  3CKC A;  4DLQ A;  1PY1 A;  2CHW A;  5BUZ A;  3LYA A;  4HLE A;  4XX5 A;  3QK0 A;  4JL0 A;  3D9P A;  3URZ A;  2PL2 A;  3L16 A;  4FJY A;  3RO3 A;  2J07 A;  2XPZ A;  4RVB A;  3ASF A;  2C0M A;  2X6K A;  4FHK A;  4CGW A;  1IQR A;  2WXF A;  3MEK A;  1TJC A;  3B7R L;  2X6F A;  4CDR A;  4F1S A;  4PDX A;  3FUJ A;  1L5J A;  4GML A;  3CK8 A;  2C0L A;  3VLD A;  2QY7 A;  2WXM A;  3CVN A;  3EHM A;  4LEU A;  2VQ2 A;  4NQ0 A;  4AVX A;  5KJM A;  4U0S A;  4HFG A;  1IYG A;  4K03 A;  1YA0 A;  5ARF A;  4JZY A;  4GPK A;  3CK7 A;  1E7V A;  5BT1 A;  3CVX A;  2FO7 A;  3CQC B;  2KM4 A;  4GAA A;  1HX8 A;  2L0I A;  2XPY A;  4XZ4 A;  2CFU A;  3L54 A;  3R7Q A;  3CSF A;  3K9I A;  4GA0 A;  4JA7 A;  4BT9 A;  1QZ2 A;  3CHQ A;  4UI9 J;  3Q47 B;  4YVQ C;  5G2N A;  3FUD A;  1Z3Y A;  2HR2 A;  3OXF A;  4JXT A;  2J49 A;  3R9A B;  4GCO A;  3CV0 A;  3L22 A;  3D9O A;  4U8H A;  4HOT A;  1KT0 A;  4YVO A;  5LOZ A;  4I1A A;  3JQ1 A;  5CMY A;  5FZQ A;  3RIB A;  5LX8 A;  3CVY A;  3QWV A;  2V5F A;  4H7Y A;  4F3V A;  4AEZ C;  4IN3 B;  3FP3 A;  5FZR A;  3E4B A;  3KD7 A;  2VJ8 A;  4GYY A;  4DI3 A;  1WAO 1;  4IYP A;  3N71 A;  2I1K A;  1U3C A;  1HE8 A;  3FUI A;  2VTB B;  2CHX A;  3TG4 A;  5J90 A;  2BUG A;  4FA6 A;  4EZL A;  2WXH A;  4XI0 A;  3RKV A;  3FU6 A;  3L08 A;  3FDH A;  2WXI A;  3CHO A;  3FEX A;  3ZYM A;  3TXN A;  2J09 A;  4I6G A;  3RK6 A;  2VGY A;  2V8S E;  2PM7 A;  3KAE A;  3NQP A;  1H6K A;  3MV2 B;  3SI5 A;  4HXI A;  2R5S A;  3ML9 A;  3T5X A;  4KMO A;  2VYI A;  4DPR A;  3MCX A;  2GGF A;  2YHE A;  4U04 A;  2A4Z A;  3AS8 A;  4FP7 A;  3CVU A;  2OOE A;  1W3B A;  3CHP A;  2Y4U A;  3LVR E;  3FTU A;  4CT0 A;  1DNP A;  2X6H A;  4UWL A;  2X6J A;  1HS6 A;  4HOU A;  3NZS A;  4UQY A;  3RRU A;  5CHE E;  3BEE A;  4EEC A;  3UPV A;  3CHM A;  4LRZ A;  4AV7 A;  2OVB A;  3MKQ A;  3Q49 B;  4I1O B;  4I9E A;  4WNG A;  2IF4 A;  4L2Y A;  3ZGQ A;  5CMW A;  4HOR A;  4JA9 A;  4BX8 A;  4EBA A;  2XGO A;  4WWN A;  2KCV A;  4J8D A;  2IOS A;  2OND A;  4GYO A;  4AIF A;  2FI7 A;  1LF8 A;  2DBA A;  2I6H A;  3SBT B;  2J08 A;  1XGW A;  1E7U A;  3B7T A;  4WNF A;  4DJA A;  4Q69 A;  1OWL A;  4JVS A;  1HZ4 A;  4XI9 A;  1Y8M A;  3PVL A;  3FTW A;  2GRL A;  3ENE A;  3PS6 A;  3ZYQ A;  1E8Y A;  3RU0 A;  2AXZ A;  2XRY A;  3IBE A;  3TAX A;  3QB2 A;  1QQE A;  4B94 A;  2JLB A;  2JEK A;  4DI4 A;  5CCM A;  4ACL A;  2FF4 A;  4XE0 A;  3CLJ A;  2IJG X;  5T4Y A;  4PUC A;  4ABN A;  4APF A;  3ZW3 A;  3CVV A;  4E85 A;  1KLX A;  4Q94 A;  1Z3X A;  1ZU2 A;  1NP7 A;  5E75 A;  5EX3 A;  5AIJ A;  2J4B A;  4CDN A;  3L13 A;  3JCK C;  3FY4 A;  4U0Z A;  3Q4A B;  5AJL A;  1H2T C;  3OTN A;  3B13 A;  4EZK A;  1IQU A;  3S7B A;  3PUJ A;  3ZVV A;  1E8W A;  1HF8 A;  3PEU B;  3PRZ A;  2GRM A;  4N3B A;  3ZXS A;  3T8M A;  4FC8 A;  1MQS A;  1HH8 A;  4GZC A;  3FTY A;  1HFA A;  2KZT A;  2AWI A;  1DVP A;  4JHR A;  2XRZ A;  3P2B A;  2RD0 A;  4G1T A;  3LS8 A;  3NF1 A;  1UJK A;  4LER A;  4PH4 B;  4WAF A;  2WXL A;  5FT9 A;  4A1G A;  3FH5 A;  3G2T A;  5A23 A;  5G05 J;  4E6H A;  1HG2 A;  4J8F A;  2WQH A;  4HOS A;  3UT4 A;  4Y6C A;  3SF4 A;  4UI9 C;  3GW4 A;  1HG5 A;  3CHR A;  4C9B B;  1ZBP A;  3HVE B;  5LCW J;  1SQM A;  4JPS A;  4B0Z A;  3D9J A;  3U66 A;  3I5P A;  3LKU A;  5EX0 A;  1OWP A;  4O6F A;  4FLB A;  2KC7 A;  3QAQ A;  3LCA A;  4D10 C;  4A3T A;  4LUN U;  5AYW D;  3HDX A;  4G11 A;  3FTX A;  5G55 A;  2WM9 A;  3FWV A;  3U9W A;  3CVL A;  4NUR A;  4FJZ A;  3MV3 B;  2VGX B;  1UG3 A;  5JJT A;  1OUV A;  4J8S A;  3EDT B;  2XGM A;  1XNF A;  2KAT A;  3PRE A;  2WQ6 A;  1KT1 A;  3ESL A;  4ANU A;  4TV3 A;  4TUU A;  2YHC A;  1UW4 B;  4N3A A;  2AW6 A;  4RG6 A;  5ARG A;  4XKC A;  4J0U A;  2FBN A;  2WQ7 A;  3S7F A;  1ELK A;  3TG5 A;  3UQ3 A;  4GB9 A;  4KXK B;  4U07 A;  2RG8 A;  1VDY A;  5BNW A;  3G2W A;  4AXH A;  2Q7F A;  2IQC A;  1E96 B;  4J6I A;  2WPV A;  4ANX A;  2V0P A;  3LY7 A;  3UT7 A;  4ILH B;  2A5U A;  4AY5 A;  3FUK A;  5T3R A;  2VGX A;  2VSN A;  3C98 A;  4U0U A;  4EZJ A;  2E0I A;  4I1M A;  2VSO E;  1E8X A;  3JQ0 A;  2PZI A;  3G2S A;  3OXG A;  2WXK A;  4OVU A;  4YND A;  4JW1 A;  3EIJ A;  2R59 A;  3JUI A;  3FH8 A;  3MA5 A;  2X3M A;  3QWW A;  3ZEF A;  4AP2 A;  4CCA A;  2UY1 B;  1SZA A;  1E8Z A;  2LAH A;  3FFL A;  3LY8 A;  4MLP A;  4BTA A;  4B8A A;  5JJ6 A;  3TGO A;  2FEZ A;  1OWM A;  2IFU A;  4MKT A;  3ZYK A;  4N39 A;  4F7A A;  4GA1 A;  4XKB A;  4DK5 A;  1EF1 C;  2CFZ A;  4LCT A;  2NSZ A;  2VTB A;  3MX3 A;  2XGS A;  5EKQ D;  3ZN3 A;  3SGH A;  4U63 A;  3U4T A;  2BF0 X;  3BG1 B;  3VLE A;  3FUH A;  3SD5 A;  5C1D A;  3I3N A;  3VLF A;  5FTP A;  4C0E A;  5KCM A;  3VTY A;  3ZPJ A;  1P5Q A;  4AY6 A;  4NRH B;  4AM9 A;  4I6E A;  4B89 A;  3PE4 A;  3ESK A;  2LSU A;  3FU0 A;  4W9R A;  3ULQ A;  4WWO A;  2FUL A;  3EHN A;  4AJW A;  4G24 A;  5LP0 A;  2ILR A;  4KZC A;  1X5B A;  2PQN A;  3AU5 A;  2YIN A;  4JEH A;  4WUY A;  2WMN A;  2XQ0 A;  3FHE A;  5A6C A;  1HU3 A;  3EIQ C;  4BWR A;  5KJL A;  4H7X A;  3CIA A;  4GU5 A;  1ELR A;  2X6I A;  2HYZ A;  4JHJ A;  4V3I A;  4BFR A;  4ANV A;  3L17 A;  4IRU A;  5KJN A;  4G23 A;  4GZ5 A;  5JHA A;  4N2S A;  1MHQ A;  2C2L A;  2VSX E;  4BT8 A;  4NAC A;  1TEZ A;  4I17 A;  4GZ6 A;  5FZS A;  2Y3A A;  4N3C A;  3SFZ A;  3LY9 A;  3CVP A;  1GW6 A;  1JWG A;  1OWO A;  3AU4 A;  3Q15 A;  3QOU A;  4I9C A;  4OVV A;  1N52 A;  4B8C B;  1H2U A;  3ASD A;  3DBS A;  3TL5 A;  4EPZ A;  3D9L A;  2EQX A;  3IHY A;  2WXO A;  3G2V A;  4L1B A;  2XCC A;  3PE3 A;  4AOF A;  4JC8 A;  4BX9 A;  5ANR A;  3EJN A;  1NA3 A;  5DBK A;  4ATG A;  2MHK A;  4UWH A;  3CGH A;  3UT8 A;  4EQF A;  2PM6 A;  4Y6W A;  4L23 A;  5G05 C;  1WY6 A;  3MYV A;  2LNI A;  3CR3 A;  3NZU A;  4CT4 A;  4M3O A;  5LCW C;  3TXM A;  4UWK A;  3IEG A;  3HHM A;  4CRW A;  4HOQ A;  2R17 C;  3ZIM A;  4GA2 A;  4KT6 B;  5DIZ A;  4GZD A;  2LAI A;  2UWJ G;  3LJ3 A;  3GYZ A;  2CG2 A;  1JPL A;  3I4R B;  5G04 J;  2DCP A;  4J8E A;  4BY6 A;  3CEQ A;  3CKB A;  3GZ2 A;  2QFC A;  3JYS A;  3LXU X;  4G26 A;  3BG0 B;  3RJV A;  4RG9 A;  2XEV A;  1H2V C;  3GZ1 A;  1B89 A;  5AJD A;  2PQR A;  4A55 A;  1UJJ A;  2DIW A;  4PS3 A;  5HI7 A;  1UN9 A;  3VTX A;  4UQX A;  3QWP A;  1OWN A;  1HXI A;  3ASG A;  1FVH A;  5J08 A;  1E90 A;  1SZ9 A;  2NXP A;  4G25 A;  3S7J A;  2WXG A;  5FWQ A;  5BPP A;  3U3W A;  5ENN A;  1EPU A;  2LSV A;  3QNK A;  4A3V A;  3SZ7 A;  4N2Q A;  4WWP A;  4HVB A;  2YNQ A;  1PAQ A;  3CST A;  5CCL A;  1QNF A;  3B7S A;  3UX4 A;  2XPI A;  3HYM B;  4ME2 A;  4TRQ A;  1IHG A;  3FU3 A;  2XHE A;  5AEN A;  1H19 A;  4CGV A;  1JWF A;  1Z6T A;  4APO A;  1ELW A;  3FTV A;  3D9M A;  3O4Z A;  4JEU A;  3FUM A;  3S2A A;  3HVE A;  3UMV A;  1NA0 A;  4K0R A;  5E76 A;  5BW8 C;  5FJY A;  1EYH A;  2I9C A;  4I6J A;  2WXR A;  3U64 A;  4ILG A;  3QAR A;  5LFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...