1YA0A

Crystal structure of the n-terminal domain of human smg7
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
497
structure length
458
Chain Sequence
MSLQSAQYLRQAEVLKADMTDSKLGPAEVWTSRQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQITTLQGQAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTQSSSCSYICQHCLVHLGDIARYRNQTSQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNLQKALSKALESRDEVKTKWGVSDFIKAFIKFHGHVYLSKSLEKLSPLREKLEEQFKELLFQKAFNSQQLVHVTVINLFQLHHLRDFSNETEQHTYSQDEQLCWTQLLALFMSFLGILCKCPLQNSQEESYNAYPLPAVKVSMDWLRLRPRVFQEAVVDERQYIWPWLISLLNSFHPHEEDLSISATPLPEEFELQGFLALRPSFRNLDFSKGHKEGQQRRIRQQRLISIGKWIADNQPRLIQCENEVGKLLFITEIPELILEDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SMG7 Is a 14-3-3-like Adaptor in the Nonsense-Mediated mRNA Decay Pathway.
pubmed doi rcsb
molecule keywords SMG-7 transcript variant 2
molecule tags Signaling protein
source organism Homo sapiens
total genus 166
structure length 458
sequence length 497
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10373 EST1_DNA_bind Est1 DNA/RNA binding domain
A PF10374 EST1 Telomerase activating protein Est1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1ya0A01
2FO7A 2MHKA 2DBAA 1NZNA 2E2EA 3QDNA 4LEUA 3S7DA 1XNFA 3LYAA 4NRHB 3SF4A 3EDTB 1ELWA 5KJNA 3RO3A 2UY1B 1P5QA 4CDRA 2FBNA 3BEEA 5G04C 3ESKA 2HYZA 4WNEA 4Y6WA 3ZHEA 5FZQA 4AM9A 4KBQA 1W3BA 4XI9A 1KLXA 4H7XA 3ASHA 3TG5A 5KJKA 3QOUA 4WNDA 4BTBA 3WXXA 3Q47B 2PZIA 2AVPA 4U07A 4AY5A 2VGXB 4WNFA 3K9IA 4UI9K 4GYOA 4UQZA 3Q15A 3TAXA 2J9QA 1HH8A 3LCAA 4AY6A 4RG9A 4HOQA 3LPZA 3CKBA 3FWVA 5AYWD 5LCWJ 3R9AB 5FT9A 3U4TA 4XIFA 2C2LA 2LNIA 3ZGQA 4I17A 4U04A 4N39A 3GZ2A 2VSYA 3CVLA 2C0MA 2I6HA 4YNDA 5A6CA 4UQYA 3CEQA 4G26A 3CK9A 2IF4A 3RU0A 4YVOA 3AS8A 2KCVA 3IEGA 3MV3B 5DIZA 3FP3A 1ZU2A 4ME2A 2IFUA 2LSVA 4CGWA 4U0ZA 4N3BA 3CV0A 5M72A 5JJTA 2Q7FA 1NA3A 4B94A 3UQ3A 4N2SA 3TGOA 3QWVA 3S7FA 2L6JA 5FJYA 5D0OD 2XGSA 4APOA 2HR2A 3N71A 2VSNA 2XPIA 1IHGA 1YA0A 4Y6CA 4GYYA 4GCNA 4O6FA 5D0QD 2KCKA 5JJ7A 4GZ6A 3MV2B 1WM5A 3RIBA 2WPVA 2WQHA 4WNGA 4I2ZA 5BW8C 3TG4A 3ZFWA 5A7DB 3E4BA 3OXLA 3CK7A 1A17A 3ZN3A 4G23A 4N5CA 3RO2A 3GYZA 5C1DA 5CCMA 3Q4AB 5FZSA 3U3WA 2VGYA 5CHEE 5CCLA 3KD7A 2HO1A 2Y4TA 3MA5A 4EQFA 5G04J 4GPKA 1IYGA 1FCHA 1WAO1 4HOSA 4KYOB 3URZA 4KXKB 3S7BA 4N2QA 3CK8A 3ZHEB 1QZ2A 2BUGA 3LY7A 4GZ3A 3LKUA 1OUVA 3LY9A 2R5SA 3ASFA 3UUXA 3RJVA 3GZ1A 4A1SA 2PQRA 4I9EA 2P58C 4G25A 2Y4UA 4YVQC 4XI0A 3OXGA 2KC7A 4N3CA 1KT1A 3QWPA 1HXIA 1ZBPA 2C0LA 4J0UA 1HZ4A 2UY1A 5G05C 4I9CA 2NC9A 2QFCA 2V5FA 1B89A 4GA1A 3HYMB 2UWJG 3AS4A 4HOTA 1E96B 5ARFA 4UQXA 4JA7A 4W9RA 1PC2A 3KAEA 1QQEA 3VTYA 4BT8A 4CGVA 4GZ5A 2VGXA 3Q49B 4J8EA 3QWWA 4JA9A 3PE4A 4BWRA 3NF1A 4F3VA 2PL2A 4IN3B 2YQ8A 2FF4A 4GCOA 3ZPJA 2VYIA 2OOEA 3LY8A 5HQ8A 5G05J 4U0SA 4JL0A 2VQ2A 5BT1A 3Q5MA 5LCWC 4BTAA 4I2WA 4N3AA 2GW1A 3AS5A 4H7YA 1NA0A 5HI7A 4BT9A 3S7JA 3FFLA 2XGOA 2KCLA 5DBKA 5FTPA 1ELRA 5JJ6A 4AIFA 4WUYA 2KATA 3PE3A 3OXFA 4GA0A 3JYSA 1TJCA 2FI7A 5KJLA 4RG6A 3CVNA 4G1TA 3VTXA 4UI9C 4GYWA 3CVQA 2XEVA 2YHCA 4GA2A 5EX0A 2LSUA 5EX3A 5EKQD 3ASGA 4I1AA 5BNWA 4G2VA 3QKYA 4U0UA 5KJMA 5FZRA 5ARGA 4ABNA 4NQ0A 4J8DA 1Y8MA 4J8FA 3PDNA 3MEKA 3RKVA 2PQNA 4JHRA 4UI9J 2XCCA 4G24A 3SZ7A 4HORA 3ULQA 3O48A 2FEZA 2JLBA 3ASDA 2XCBA 1KT0A 3MKRA 2ONDA 3KS2A 3CKCA 4HOUA 3UPVA 3GW4A 3CVPA 2XGMA
chains in the Genus database with same CATH superfamily
4OYSA 1N94A 4ATGA 1MZCA 4KVOA 4AP2A 3UT4A 3FH5A 3LEWA 4K5CA 1QNFA 3LYAA 2XPYA 3EDTB 2VTBB 1E8YA 4AOFA 3G2UA 4HRNA 3QB2A 3TWTA 3D9PA 1EDUA 2ILRA 1ELKA 4HRMB 4LSZE 4GU5A 3U66A 5AENA 5CEDB 4DX1A 3OAWA 3QC1A 3ASHA 3Q9UC 4EBAG 2X6JA 3UKRG 3JXJA 4C48B 5J08A 3PZ2A 2VGXB 4WNFA 1JCQA 4GYOA 4TUUA 1HH8A 3FUDA 3VLFA 4AY6A 4JPSA 2EIJE 3FWVA 5AYWD 3HIZA 2XRYA 4FLBA 1LF8A 2L9BA 4CYMD 2QYJA 2IQCA 3PEUB 1N4SA 4DLOA 4U04A 3GZ2A 5BV1A 2VSYA 3CVLA 2P9NG 4UQYA 4XE0A 4G26A 3Q75A 2BTDA 3FEYA 3EU5A 1E7UA 3FUJA 2L6BA 4FA6A 2IFUA 1LTXA 3G2WA 1JUQA 3DSVA 4U0ZA 4N3BA 4IRUA 3CV0A 2YINA 4Q96A 5JHBA 1MX6A 2I1KA 1D8DA 3DSWA 2ZISA 3IHVA 1G3NB 3FUEA 3LJ3A 4P29A 2GRRB 4WWNA 2XENA 3DSSA 4N2SA 1LD8A 4KZ0A 2RG8A 3W9GA 3G2SA 2WXOA 1UJJA 4HI9A 3TGOA 3QWVA 3S7FA 4ZFHA 5ENTD 4UWHA 5D0OD 3FTZA 3EU9A 4APOA 3FEXA 4CCAA 1MX2A 2VSNA 4HRLA 3RSEG 2XPIA 5T8IA 1V55E 3EHRA 4O1OA 3HRAA 3LVRE 2XQ0A 5D0QD 2KCKA 5JJ7A 4LNBA 1SQMA 4F1SA 1MHQA 3L22A 1WM5A 4JHKA 3APDA 2WPVA 4I2ZA 1N4QA 4V3IA 4G23A 4N5CA 3RO2A 4O60A 2EIKE 4GTTA 5CHEE 2E0IA 2F37A 4GPMA 3NB2A 5AQ9A 3V79K 2ZXWE 1N9AA 4JC8A 3FU3A 5ENNA 3MA5A 4DJAA 4Q69A 4GMJA 1SZAA 3SD5A 3URZA 3L16A 4GTQA 1TR4A 4F1PA 1K3ZD 4GZ3A 3LKUA 1VDYA 4FHJA 4B8AA 1OXJA 4DX5D 3B13A 3CVYA 4A1SA 1HFAA 4G25A 2R02A 3CLJA 3UT7A 4YVQC 2P9PG 3E33A 1AWCB 3ABME 2V4HC 3KEAA 5FIOA 2KC7A 1HXIA 2C0LA 4J0UA 1QYMA 2I2OA 1UW4B 3CHQA 1HG5A 2QFCA 1B89A 1KZPA 2A5UA 3HYMB 4B93B 5CMYA 3EUVA 5JHAA 2ETCA 2VJ8A 2Y69E 2EIME 2VSXE 4LG6A 5ARFA 4BESA 4JA7A 4GZCA 2JEKA 4GZ5A 1Z6TA 3ASNE 3CHMA 3DSTA 4R7LA 2EINE 3CVWA 3PE4A 3NZSA 1FVFA 5JA4D 2RFMA 3VLDA 2H6FA 2PL2A 4U8HA 5B1AE 2ZU6B 3V31A 4RLYA 5HQ8A 4DRXE 4JL0A 5CBOA 2OVBA 4N3AA 2DIWA 4I43A 3AS5A 1TJFA 4H7YA 3FTXA 2BKGA 3FFLA 3T5VA 3D9LA 2NSZA 3JQ1A 3CQCB 2KCLA 5DBKA 4WUYA 4WAFA 1K1BA 2KATA 2CG3A 3MCXA 3OXFA 4GTMA 4GA0A 1HO8A 4M3OA 3D9NA 1TJCA 1S70B 5D66A 4HI8A 3L13A 2DYRE 2Y1LE 3QJZA 4BEPA 4GYWA 5D2MC 2XEVA 3MKQB 2YHCA 3CQGB 3TWRA 3TXMA 2LSUA 5FQ4A 4CT4A 4OAUC 3ASGA 3FU0A 3PH0C 3FUHA 5BNWA 3RRMB 4ANWA 5E75A 3P2BA 1OWPA 3MX3A 5FINA 3DBSA 4DPRA 5FZRA 2X6HA 1OWNA 2GRMA 4BY6A 3MYVA 2F8XK 5A23A 3MEKA 1E7VA 3RKVA 3JCKC 4JHRA 3V2XA 4C9BB 3R9MA 4G11A 2ETBA 3ULQA 2FEZA 2JLBA 2XCBA 4XEIG 1KT0A 3MKRA 2V0PA 2ONDA 3PEVB 1O1TA 2OVFA 3I4GA 3IKOB 3UKUG 1O5MA 2IY0C 5KWDA 4AEZC 3U64A 1QZ2A 2M63A 3SBTB 2MHKA 5BXOA 1Z3YA 1NZNA 2E2EA 3QDNA 3L17A 4FC8A 4RQIA 5KJNA 4J8SA 1RZ4A 2AXZA 4XKBA 3ESKA 3EIJA 1N52A 1FT2A 1NFIE 3LXUX 3ZHEA 3TWXA 5FZQA 3E30A 4AM9A 5JMND 1TNBA 1W3BA 2KBXA 4OAVB 4K0RA 3B7BA 5AIJA 2PZIA 4U07A 3KSLA 2LAHA 2Y0BG 3RK6A 3HDXA 2B0OE 3FULA 2LXMA 3ZRHA 4HFGA 3R9AB 3SGHA 2LUHA 4YDEA 5ANLA 3LS8A 1E90A 1D9SA 2C0MA 3JQ0A 2F0YA 1OWOA 2F8YA 3CK9A 4QQIA 3TJPA 3IEGA 2GRPB 4O1PA 1EYHA 1SW6A 2XS1A 5T3RA 4B0ZA 2EQXA 2NXPA 3C3QA 3LVQE 4CDMA 1NA3A 2WM9A 3C72A 4HB5A 3UQ3A 1U3CA 4JEUA 2P9LG 3UX4A 1JWFA 3T5XA 1U2VG 4UUCA 1FPPA 3VLEA 1TN8A 2AWIA 4DX2A 4BFRA 2IOLA 1YA0A 4EBAA 4Y6CA 4FULA 1S0PA 4GYYA 2FULA 3PRZA 4L23A 5BXUA 2R03A 2R59A 3FTWA 2ETAA 3MV2B 3AU4A 3CVUA 1IKND 2IOSA 2R2LA 3ISMC 3Q7FA 1WY6A 2X6FA 3E34A 2QY7A 2PM6A 3NOGD 3ZFWA 3B7RL 5C1DA 5CCMA 3KSQA 3ENEA 3AU5A 2WXGA 2VGYA 3ZYQA 3L82A 1H6PA 5KNGA 5CCLA 1YYHA 3CHSA 3CSFA 2J07A 2X6IA 1TNOA 2L0IA 2XRZA 2KZTB 3TWWA 2LO6A 4FJYA 4ILHB 4EQFA 1DVPA 3ZNGA 1FCHA 3ASOE 3HVEA 4HOSA 4KXKB 2J49A 3CVVA 3ZXPA 2WXJA 2LXLA 2YNQA 4KT6B 2GRLA 2R5SA 4NIKA 4FU3A 2WXLA 3T9KA 2P9IG 3PS6A 3FU6A 2Y4UA 3TXNA 1K1AA 4XI0A 2X3MA 3PZ4A 2OEWA 3HXCA 3OXGA 1TYQG 3PREA 4M7CA 1KT1A 3QWPA 2RD0A 1IXVA 3PUJA 2UY1A 3FY4A 4I9CA 2WXRA 4GA1A 4MBGA 2WXKA 3ML8A 3AG2E 5LFAA 4MS6A 4BERA 4HNAD 4RVBA 4J8YA 4BX9A 1X5BA 3KEZA 1MYOA 4DUIA 3Q78A 4L1BA 1OCCE 4GMLA 1K8KG 5B1BE 4BWRA 4F3VA 1DCEA 3ULYA 3IXEA 2FF4A 4AV7A 4PUCA 4LUNU 3ESLA 4GCOA 3DRAA 3LY8A 2VQ2A 4DLQA 3Q5MA 2WXFA 4L2YA 5BT1A 5LCWC 4CRWA 3OTNA 2RKKA 1H0AA 4OVVA 1OCZE 3J5PA 3CHOA 1EPUA 1TN7A 4BX8A 1YMPA 4FHKA 4WWPA 2FI7A 5CRVA 5KJLA 2WXHA 5BPPA 4LNUD 5HS0A 3CVNA 4ANVA 3HXDA 1BD8A 4DX6D 2CG2A 4L7TA 3CVQA 3L08A 1XGWA 3ZYMA 2IU1A 3B7SA 2P9SG 2V4LA 4I1AA 3UINC 3DPDA 3QKYA 3L9TA 4K03A 4U0UA 5KJMA 1SVXA 2J8SD 1JCSA 5ARGA 1O1RA 4J8DA 3DXKG 1UOHA 3Q7AA 3BG1B 2GRNB 1O1SA 3FTSA 4G24A 3ZEFA 4I6JA 2J09A 3SZ7A 4HORA 3O48A 4PH4B 2FO1E 3HXBA 1HS6A 4BSZB 3G2VA 3MGBA 4HBDA 4ACLA 4JD2G 4GTPA 4B8CB 2P9KG 1SA4A 4EECA 3I5PA 3EIQC 1DCQA 1NL4A 4EZJA 2DVWA 4LEUA 4Q94A 1XNFA 4NRHB 4TV3A 3AG3E 1ELWA 5C2YA 3RO3A 1P5QA 5G2NA 2IJGX 4CDRA 2J08A 1H2TC 5G04C 3ULEG 2HYZA 4AXHA 4HLLA 4IULA 3PNTB 2IEJA 4KVMA 4KMOA 4UWKA 4J6IA 5EILA 1KLXA 2YHEA 5AAOA 1H6KA 2BEDA 4B89A 3CR3A 3D3MA 4WNDA 1HE8A 4BTBA 2KXPC 1JPLA 4N5QA 2GGFA 3K9IA 5EYLA 1H19A 4UQZA 3Q15A 3TAXA 2J9QA 3FTUA 1TNUA 3SNXA 5CRUA 3ZIMA 4HOQA 3LPZA 4A1GA 5CECB 2EILE 3W9FA 4XIFA 5E76A 2C2LA 2LNIA 3L6AA 3TWUA 3ZGQA 3C5RA 4N39A 4I6EA 4A63B 4YNDA 5A6CA 5EYPF 1PAQA 4L9PA 4WWOA 2IF4A 5CMWA 3SI5A 2WXNA 4YVOA 3AS8A 3PZ3A 1RW2A 3CIAA 3MV3B 5DIZA 3FP3A 5AQAA 1H2UA 3TWSA 1ZU2A 4RSYA 2BF0X 4U8YD 3FHEA 2GRQB 5M72A 3UM0A 3NBNB 3FH7A 2L6JA 5FJYA 2HE0A 3Q79A 1OWMA 2HR2A 4G8LA 3AG1E 3CVXA 2KM4A 1A5EA 1LD7A 2PNNA 1MQSA 5AJDA 4GCNA 1JCRA 4C0EA 1FT1A 3ONKA 5AN8A 3NOCD 3E37A 2WXMA 2LAIA 1N54A 3TG4A 4LNGA 2OCCE 1INZA 4A3VA 3E4BA 3OXLA 3CK7A 4URKA 2WVIA 3ZN3A 3QAQA 3GYZA 3NQPA 3Q4AB 3U3WA 4LERA 3ZUVB 3UIOC 3HG0D 3KD7A 4DI3A 4JEHA 5CERB 4A55A 3P1UA 3ML9A 3JUEA 1BLXB 1D8EA 1TNZA 4CEMA 2OV8A 2AXVA 2NYJA 5ENPD 1WAO1 1OT8A 3UXGA 3CK8A 2ZGDA 3ZHEB 2MRIA 1MX4A 2BUGA 1BPOA 3LY9A 3ASFA 3GZ1A 2PQRA 4I9EA 2P58C 1TN6A 4JHJA 3RRNB 3UM2A 3SHFA 1N4PA 1OY3D 1ZBPA 2VTBA 5H7PA 1HZ4A 4XX5A 2H6IA 2IONA 3APCA 3HXFA 4I1OB 2XPZA 3ZYKA 4F53A 1WG0A 3GZSA 1KZOA 2NC9A 3I3NA 2V5FA 3FUIA 3FTYA 3AS4A 4HOTA 2HM8A 4TRQA 1E96B 5G55A 5ENSD 4UQXA 4LRZA 5FQ8A 4HVBA 3D9KA 4W9RA 1QQEA 1QBQA 4CZ2D 5B3SE 3C3RA 5BUZA 1S63A 2VGXA 3Q49B 3UMVA 4J8EA 4CT0A 3QWWA 3ABLE 2GROB 5EIDA 3NF1A 3BG0B 3CHPA 2IO2C 4IN3B 4DK5A 1UG3A 2VYIA 2KZTA 4U0SA 5BV0A 4BTAA 1SA5A 1NA0A 4BT9A 3NZUA 2WB2A 3DEPA 3DWLG 3L54A 5JJ6A 3PE3A 2WXPA 2CFZA 3JYSA 4AVXA 4TXQA 2QYUA 4RG6A 5ITZF 3I4RB 3FTVA 2I1JA 3UIPC 3DPYA 4FP7A 4ATZD 3MJWA 2VSOE 2L0TB 1E8WA 4YDWA 4BSXA 2WQ7A 4ZHBA 4I6GA 5EX0A 1X81A 1WDYA 5EX3A 4JB8P 3R7QA 3V30A 1E8XA 3QARA 4D10C 2XEEA 4G2VA 3APFA 3AAAC 4A3TA 4ABNA 4NQ0A 3EHQA 3B7UX 3IBEA 4U8VD 1S64A 4E85A 1Y8MA 1DNPA 3PDNA 3ZU7B 3D9OA 2XCCA 1NI1A 3G2TA 3HVEB 5ANRA 4EZLA 3ASDA 1IQRA 3KS2A 3CKCA 1N0QA 5LP0A 3D9IA 2A4ZA 4EHMA 3CVPA 2XGMA 4ILIA 2FO7A 3LDZA 4APFA 3DSUA 3ZXSA 4I1MA 4UWGA 1L5JA 2DBAA 4F6RD 1N4RA 2RFAA 3S7DA 3FH8A 3SF4A 3V2OA 4PS7A 4HLEA 5FQ6A 4GTSA 4IYPA 2UY1B 2QC9A 5EDSA 3JUIA 2FBNA 3BEEA 3FUNA 4J7WA 2AXUA 3SQVA 2Y3AA 3UTMA 1HX8A 3IHYA 4WNEA 4Y6WA 3EHMA 1IHBA 1HG2A 4KBQA 3FDHA 3BU8A 4E6HA 4XI9A 4X8QA 4H7XA 4YDOA 3TG5A 4DX7D 5KJKA 4EZKA 3QOUA 3E32A 3WXXA 3Q47B 2AVPA 4AY5A 4UWLA 2IO3C 4UI9K 2PM7A 1YCSB 1GW6A 3LCAA 1N95A 4RG9A 1U3DA 1SZ9A 3CKBA 5LCWJ 2BKKB 5ENOD 4AJWA 4ANXA 3S2AA 5FT9A 3U4TA 2P9UG 2XZTG 3MZLB 4I17A 3ONLA 3TL5A 1H2VC 1BI7B 2I6HA 3LJNA 4XKCA 4KZCA 3CEQA 4GB9A 3C3OA 3RU0A 4FLHA 3CGHA 3CHRA 4U96D 3O4ZA 2XZDG 2KCVA 4G8KA 3UM3A 4ME2A 2J4BA 4YDYA 2LSVA 4CGWA 5EN5D 4FADA 2X6KA 2ZGGA 1TNYA 4JZYA 1BU9A 5JJTA 2Q7FA 3AJIA 3FUFA 4GTOA 3PVLA 3SFYA 3SFXA 4K5BA 2A5EA 2MOWA 5ENQD 4B94A 4GAAA 3ZYLA 3SO8A 3DSXA 3UI2A 5CEAA 5T4YA 4GMRA 2DZOA 2XGSA 2AJAA 1OWLA 3N71A 2MYOA 4F7AA 1Q2ZA 5KCMA 2WQ6A 3D9JA 1IHGA 1OCRE 3UT8A 4DI4A 4O6FA 4LCTA 4GZ6A 5FQ7A 4TXRA 3X2QE 3MKQA 4L2LA 3RIBA 3B95A 3D9HA 4JXTA 2WQHA 4WNGA 3FUKA 3DEOA 4MRUA 5BW8C 4Z68A 5A7DB 3SY2A 4BETA 5IY5E 1A17A 3R7RA 2DZNA 4FJZA 5FZSA 5AQ7A 3T8MA 1Z5SC 2P2CP 2HO1A 3U9WA 2Y4TA 2AW6A 4OVUA 1N11A 2DYSE 5G04J 1MJ0A 2CHWA 5LOZA 3SFZA 3TWQA 4GPKA 3RAUA 3JXIA 4GTRA 4HQDA 3ZKJA 5KBAA 4HS2A 1IYGA 4KYOB 3HHMA 5AQBA 3J5QB 3PZ1A 3S7BA 4N2QA 3QNKA 3PNLB 5HRYA 3LY7A 3ZVVA 4EPZA 1OUVA 2H6HA 4ILGA 3SBSA 5LX8A 2CFUA 4UWFA 3UUXA 3RJVA 4U7EB 3NAWA 1ZB1A 4QFVA 1KPSB 1NP7A 2XEHA 4N3CA 3B7TA 4ACKA 4U95D 3D9MA 5G05C 4XZ4A 3UM1A 4TUMA 2B6CA 3RRUA 2UWJG 3PZDA 3Q9NC 1PC2A 3KAEA 3QK0A 1DC2A 3VTYA 4BT8A 2VGEA 4CGVA 2JABA 1PY1A 5CBNA 2DWZA 4JA9A 2CHXA 1H6OA 1JWGA 1V54E 2H6GA 2ZIRA 3BQOA 2YQ8A 1N0RA 3ZPJA 2OOEA 2WXQA 1IQUA 5FWQA 5G05J 4GZDA 2OEVA 2WMNA 3WG7E 1EF1C 1HF8A 4I2WA 2V8SE 2GW1A 5KNHD 5HI7A 3S7JA 3AG4E 3HXEA 4MKTA 2XGOA 1AP7A 3TWVA 1Y6IA 4PS3A 5FTPA 1TEZA 4K5AB 1HU3A 1ELRA 4AIFA 3C98A 2X38A 4TXPA 1E8ZA 3EHNA 2V5QC 2R17C 2XHEA 1OCOE 4G1TA 3DXMG 3VTXA 4UI9C 3BUAA 4C0MA 5ENRD 4GTVA 4MLPA 4JVSA 4PS8A 4GA2A 4JW1A 3Q73A 2DCPA 1FVHA 5EKQD 1BI8B 4U63A 3CSTA 2R05A 3FUMA 4HXIA 1UJKA 2QZAA 3PUKA 5AARA 5AJLA 3FU5A 4J8FA 3EJNA 4PDXA 2I9CA 2PQNA 2WMOA 2J4DA 4NURA 3ZW3A 5J90A 4CDNA 3ABKE 4UI9J 1UN8A 5EIBE 5HKPA 3T8KA 4NACA 2CHZA 3IV0A 1UN9A 3F6QA 2WXIA 2XS8A 4HOUA 1Z3XA 3UPVA 3GW4A 4ANUA
chains in the Genus database with same CATH topology
2M63A 4ILIA 4OYSA 2FO7A 3LDZA 4ATGA 4APFA 3SBTB 4B8CB 3ZXSA 4I1MA 4KVOA 2MHKA 4UWGA 1L5JA 4AP2A 2DBAA 3I5PA 3EIQC 4EECA 3UT4A 1Z3YA 1NZNA 3FH5A 4EZJA 3LEWA 2E2EA 3QDNA 4LEUA 1QNFA 3S7DA 3L17A 1XNFA 4Q94A 3LYAA 2XPYA 4NRHB 3FH8A 4TV3A 4FC8A 3SF4A 3EDTB 1ELWA 4PS7A 2VTBB 4HLEA 5KJNA 1E8YA 5C2YA 3G2UA 4J8SA 4AOFA 3RO3A 5FQ6A 3QB2A 4IYPA 2UY1B 3D9PA 1P5QA 5G2NA 5EDSA 2IJGX 3JUIA 1EDUA 4CDRA 2AXZA 2FBNA 1H2TC 2J08A 3BEEA 3FUNA 4XKBA 5G04C 3ESKA 2ILRA 2AXUA 1N52A 3EIJA 1ELKA 2HYZA 4AXHA 4IULA 2Y3AA 3PNTB 1HX8A 3IHYA 4WNEA 3LXUX 4GU5A 4Y6WA 3EHMA 3ZHEA 3U66A 5FZQA 1HG2A 4KBQA 4AM9A 5AENA 4KVMA 3OAWA 3FDHA 4KMOA 4UWKA 1W3BA 4E6HA 4J6IA 3QC1A 4XI9A 1KLXA 4H7XA 2YHEA 1H6KA 3ASHA 4K0RA 3CR3A 3TG5A 4B89A 5KJKA 4EZKA 4EBAG 3QOUA 3D3MA 4WNDA 1HE8A 4BTBA 5AIJA 2X6JA 3WXXA 3Q47B 2PZIA 2AVPA 1JPLA 5J08A 2GGFA 4U07A 4AY5A 2VGXB 4UWLA 4WNFA 3K9IA 2LAHA 2PM7A 4UI9K 4GYOA 1H19A 4UQZA 3Q15A 3RK6A 3TAXA 3HDXA 2J9QA 4TUUA 1GW6A 1HH8A 3FTUA 3FUDA 3LCAA 4JPSA 4RG9A 3VLFA 4AY6A 3FULA 3SNXA 3ZIMA 1U3DA 1SZ9A 4HOQA 3LPZA 3CKBA 3FWVA 5AYWD 4A1GA 3HIZA 2XRYA 4FLBA 5LCWJ 4AJWA 3ZRHA 4ANXA 1LF8A 4HFGA 3R9AB 2L9BA 3S2AA 5FT9A 3SGHA 3U4TA 3MZLB 2IQCA 4XIFA 5E76A 3PEUB 2C2LA 2LNIA 3L6AA 3ZGQA 4I17A 4U04A 4N39A 3GZ2A 5ANLA 3ONLA 3TL5A 3LS8A 1H2VC 4I6EA 1E90A 5BV1A 2VSYA 3CVLA 2C0MA 2I6HA 3JQ0A 4YNDA 4XKCA 5A6CA 4UQYA 4KZCA 4XE0A 3CEQA 4G26A 1OWOA 1PAQA 4WWOA 3CK9A 2IF4A 4GB9A 3RU0A 5CMWA 4FLHA 3SI5A 2WXNA 3CGHA 2BTDA 3FEYA 4YVOA 3AS8A 3CHRA 3TJPA 3CIAA 3O4ZA 2KCVA 3IEGA 1E7UA 3MV3B 5DIZA 3FP3A 3FUJA 1H2UA 1ZU2A 4RSYA 4ME2A 2J4BA 2IFUA 4FA6A 2LSVA 3G2WA 4CGWA 1JUQA 2BF0X 4U0ZA 4N3BA 4FADA 2X6KA 4IRUA 3CV0A 2YINA 4Q96A 5JHBA 3FHEA 1EYHA 5M72A 4JZYA 5T3RA 2I1KA 4B0ZA 5JJTA 2EQXA 2Q7FA 2NXPA 3LVQE 3FUFA 4CDMA 1NA3A 3IHVA 3PVLA 2WM9A 3FUEA 3LJ3A 4P29A 2MOWA 4B94A 3FH7A 4WWNA 3UQ3A 1U3CA 4N2SA 4KZ0A 2RG8A 4JEUA 4GAAA 3ZYLA 3G2SA 2WXOA 1UJJA 4ACLA 3QWVA 3S7FA 3TGOA 2L6JA 5FJYA 3UX4A 1JWFA 5T4YA 4UWHA 5D0OD 2XGSA 3FTZA 1OWMA 3T5XA 4APOA 1OWLA 2HR2A 3FEXA 3N71A 4CCAA 3VLEA 4F7AA 2VSNA 2AWIA 5KCMA 2WQ6A 2XPIA 5T8IA 3CVXA 2KM4A 4BFRA 3D9JA 1IHGA 2IOLA 1YA0A 4EBAA 4Y6CA 4FULA 1MQSA 1S0PA 3UT8A 3LVRE 5AJDA 4GYYA 2FULA 3PRZA 4L23A 4DI4A 4GCNA 2XQ0A 4O6FA 5D0QD 2KCKA 4LCTA 5JJ7A 4C0EA 1SQMA 3ONKA 4GZ6A 4F1SA 2R59A 3FTWA 5FQ7A 1MHQA 3MV2B 3L22A 3MKQA 1WM5A 3AU4A 3CVUA 4L2LA 2IOSA 3RIBA 4JHKA 3APDA 4JXTA 2WXMA 1WY6A 2LAIA 2WPVA 2X6FA 1N54A 2WQHA 4WNGA 2QY7A 4I2ZA 2PM6A 3FUKA 5BW8C 4MRUA 3TG4A 1INZA 3ZFWA 5A7DB 4A3VA 3E4BA 3OXLA 3CK7A 1A17A 4URKA 4V3IA 2WVIA 3R7RA 3ZN3A 4G23A 3QAQA 4N5CA 3B7RL 3RO2A 3GYZA 5C1DA 3NQPA 5CCMA 3ENEA 3Q4AB 3AU5A 4FJZA 5FZSA 3U3WA 4LERA 2WXGA 2VGYA 5CHEE 3ZYQA 2E0IA 3T8MA 5CCLA 3KD7A 4DI3A 3CHSA 4JEHA 2HO1A 3U9WA 2Y4TA 3CSFA 2J07A 2X6IA 4A55A 3P1UA 3ML9A 2AW6A 2L0IA 4OVUA 4JC8A 2XRZA 3FU3A 2KZTB 2LO6A 4FJYA 4ILHB 3MA5A 5ENNA 4DJAA 4EQFA 5G04J 4Q69A 4CEMA 2CHWA 2OV8A 5LOZA 3SFZA 4GPKA 1DVPA 4GMJA 1SZAA 4HS2A 2AXVA 1IYGA 1FCHA 1WAO1 3HVEA 4KYOB 3HHMA 3SD5A 4HOSA 3URZA 4KXKB 3L16A 2J49A 3S7BA 4N2QA 3QNKA 3PNLB 3CVVA 3CK8A 3ZHEB 2MRIA 1QZ2A 2BUGA 2WXJA 2YNQA 3LY7A 3ZVVA 4KT6B 4GZ3A 3LKUA 4EPZA 1OUVA 3SBSA 4ILGA 2GRLA 1BPOA 3LY9A 1VDYA 4FHJA 4B8AA 5LX8A 2CFUA 4UWFA 2R5SA 3B13A 3ASFA 3UUXA 4FU3A 3RJVA 2WXLA 3CVYA 3GZ1A 4A1SA 2PQRA 1HFAA 4I9EA 2P58C 3PS6A 4G25A 3CLJA 3FU6A 2Y4UA 3UT7A 4YVQC 3TXNA 4JHJA 4XI0A 2X3MA 3RRNB 4QFVA 3OXGA 1NP7A 2KC7A 4N3CA 3PREA 3SHFA 1KT1A 3QWPA 1HXIA 1ZBPA 2C0LA 4J0UA 2VTBA 1HZ4A 3B7TA 4ACKA 4XX5A 2RD0A 3PUJA 2UY1A 3FY4A 2I2OA 2IONA 3D9MA 3APCA 4I1OB 5G05C 2XPZA 3ZYKA 4XZ4A 4F53A 1UW4B 3GZSA 3CHQA 4I9CA 1HG5A 2NC9A 2QFCA 2WXRA 1B89A 2V5FA 3I3NA 4GA1A 2A5UA 3FUIA 3HYMB 3FTYA 5CMYA 3RRUA 2UWJG 3AS4A 3PZDA 4HOTA 2HM8A 5JHAA 4TRQA 1E96B 2WXKA 3ML8A 2VJ8A 5LFAA 4MS6A 5G55A 4RVBA 2VSXE 5ARFA 4UQXA 4LRZA 5FQ8A 4JA7A 4HVBA 3D9KA 1PC2A 4W9RA 3KAEA 1QQEA 3QK0A 3VTYA 4BT8A 4CGVA 4GZCA 4BX9A 2JEKA 5BUZA 1X5BA 3KEZA 4GZ5A 2VGXA 1Z6TA 3Q49B 3UMVA 3CHMA 4J8EA 4CT0A 1PY1A 3QWWA 4R7LA 4JA9A 4L1BA 2CHXA 3CVWA 4GMLA 1JWGA 3PE4A 4BWRA 3NF1A 3NZSA 3BG0B 1FVFA 4F3VA 3CHPA 3VLDA 2PL2A 4U8HA 4IN3B 4DK5A 2YQ8A 2FF4A 4AV7A 4PUCA 1UG3A 4LUNU 2ZU6B 3ESLA 4GCOA 2VYIA 3ZPJA 2OOEA 3LY8A 2KZTA 5HQ8A 2WXQA 1IQUA 5FWQA 5G05J 4GZDA 4U0SA 4JL0A 2VQ2A 4DLQA 3Q5MA 2WXFA 4L2YA 5BT1A 2WMNA 5BV0A 5LCWC 1EF1C 2OVBA 1HF8A 3OTNA 4I2WA 2V8SE 4N3AA 4BTAA 2DIWA 2GW1A 4CRWA 4I43A 1H0AA 4OVVA 3AS5A 1TJFA 4H7YA 3FTXA 1NA0A 5HI7A 4BT9A 3S7JA 3NZUA 3FFLA 3T5VA 2WB2A 3D9LA 2NSZA 3JQ1A 3CHOA 3CQCB 2XGOA 3L54A 2KCLA 1EPUA 4MKTA 1Y6IA 4PS3A 5DBKA 5FTPA 1TEZA 1HU3A 1ELRA 4BX8A 5JJ6A 4AIFA 4WUYA 4WAFA 3C98A 2KATA 3PE3A 2CG3A 3MCXA 2WXPA 3OXFA 4GA0A 1HO8A 4M3OA 2CFZA 1TJCA 3D9NA 3JYSA 4FHKA 4WWPA 2FI7A 2X38A 4AVXA 4RG6A 5KJLA 2WXHA 1E8ZA 3EHNA 5BPPA 2R17C 3I4RB 3FTVA 2I1JA 2XHEA 3CVNA 3L13A 4G1TA 3VTXA 4ANVA 4FP7A 4UI9C 3MJWA 2VSOE 3QJZA 2L0TB 4C0MA 2CG2A 4L7TA 4GYWA 3CVQA 2XEVA 3L08A 3MKQB 2YHCA 4MLPA 1E8WA 3CQGB 4JVSA 1XGWA 4PS8A 3ZYMA 4BSXA 2WQ7A 2IU1A 4I6GA 4GA2A 3TXMA 5EX0A 2LSUA 4JW1A 3B7SA 5EX3A 3R7QA 2DCPA 5FQ4A 4CT4A 1FVHA 5EKQD 2V4LA 3ASGA 3FU0A 1E8XA 4U63A 3CSTA 3QARA 4D10C 3PH0C 3FUMA 4HXIA 3FUHA 4I1AA 5BNWA 1UJKA 4G2VA 3DPDA 3PUKA 3RRMB 4ANWA 3QKYA 5E75A 3P2BA 1OWPA 3MX3A 3DBSA 4U0UA 4K03A 4DPRA 5KJMA 5FZRA 3APFA 2X6HA 1OWNA 2GRMA 4A3TA 5ARGA 4ABNA 4BY6A 4NQ0A 3IBEA 3B7UX 4J8DA 3MYVA 5AJLA 4E85A 3FU5A 1Y8MA 4J8FA 3EJNA 4PDXA 5A23A 1DNPA 3PDNA 3MEKA 1E7VA 2I9CA 2PQNA 3BG1B 3RKVA 3JCKC 2WMOA 2J4DA 4NURA 3ZW3A 5J90A 4CDNA 4JHRA 4UI9J 4C9BB 3FTSA 1UN8A 3D9OA 2XCCA 4G24A 3ZEFA 4I6JA 4G11A 2J09A 3G2TA 3SZ7A 4HORA 3HVEB 3O48A 2FEZA 5ANRA 2JLBA 3ASDA 3ULQA 4DLOA 4PH4B 4EZLA 2XCBA 1IQRA 4NACA 2CHZA 1KT0A 3IV0A 3MKRA 2V0PA 1HS6A 1UN9A 2ONDA 3KS2A 3CKCA 5LP0A 3G2VA 3PEVB 2WXIA 2OVFA 3I4GA 3IKOB 3D9IA 4HOUA 1Z3XA 2A4ZA 3UPVA 3MGBA 3GW4A 4ANUA 3CVPA 4AEZC 3U64A 2XGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FO7 A;  2MHK A;  2DBA A;  1NZN A;  2E2E A;  3QDN A;  4LEU A;  3S7D A;  1XNF A;  3LYA A;  4NRH B;  3SF4 A;  3EDT B;  1ELW A;  5KJN A;  3RO3 A;  2UY1 B;  1P5Q A;  4CDR A;  2FBN A;  3BEE A;  5G04 C;  3ESK A;  2HYZ A;  4WNE A;  4Y6W A;  3ZHE A;  5FZQ A;  4AM9 A;  4KBQ A;  1W3B A;  4XI9 A;  1KLX A;  4H7X A;  3ASH A;  3TG5 A;  5KJK A;  3QOU A;  4WND A;  4BTB A;  3WXX A;  3Q47 B;  2PZI A;  2AVP A;  4U07 A;  4AY5 A;  2VGX B;  4WNF A;  3K9I A;  4UI9 K;  4GYO A;  4UQZ A;  3Q15 A;  3TAX A;  2J9Q A;  1HH8 A;  3LCA A;  4AY6 A;  4RG9 A;  4HOQ A;  3LPZ A;  3CKB A;  3FWV A;  5AYW D;  5LCW J;  3R9A B;  5FT9 A;  3U4T A;  4XIF A;  2C2L A;  2LNI A;  3ZGQ A;  4I17 A;  4U04 A;  4N39 A;  3GZ2 A;  2VSY A;  3CVL A;  2C0M A;  2I6H A;  4YND A;  5A6C A;  4UQY A;  3CEQ A;  4G26 A;  3CK9 A;  2IF4 A;  3RU0 A;  4YVO A;  3AS8 A;  2KCV A;  3IEG A;  3MV3 B;  5DIZ A;  3FP3 A;  1ZU2 A;  4ME2 A;  2IFU A;  2LSV A;  4CGW A;  4U0Z A;  4N3B A;  3CV0 A;  5M72 A;  5JJT A;  2Q7F A;  1NA3 A;  4B94 A;  3UQ3 A;  4N2S A;  3TGO A;  3QWV A;  3S7F A;  2L6J A;  5FJY A;  5D0O D;  2XGS A;  4APO A;  2HR2 A;  3N71 A;  2VSN A;  2XPI A;  1IHG A;  1YA0 A;  4Y6C A;  4GYY A;  4GCN A;  4O6F A;  5D0Q D;  2KCK A;  5JJ7 A;  4GZ6 A;  3MV2 B;  1WM5 A;  3RIB A;  2WPV A;  2WQH A;  4WNG A;  4I2Z A;  5BW8 C;  3TG4 A;  3ZFW A;  5A7D B;  3E4B A;  3OXL A;  3CK7 A;  1A17 A;  3ZN3 A;  4G23 A;  4N5C A;  3RO2 A;  3GYZ A;  5C1D A;  5CCM A;  3Q4A B;  5FZS A;  3U3W A;  2VGY A;  5CHE E;  5CCL A;  3KD7 A;  2HO1 A;  2Y4T A;  3MA5 A;  4EQF A;  5G04 J;  4GPK A;  1IYG A;  1FCH A;  1WAO 1;  4HOS A;  4KYO B;  3URZ A;  4KXK B;  3S7B A;  4N2Q A;  3CK8 A;  3ZHE B;  1QZ2 A;  2BUG A;  3LY7 A;  4GZ3 A;  3LKU A;  1OUV A;  3LY9 A;  2R5S A;  3ASF A;  3UUX A;  3RJV A;  3GZ1 A;  4A1S A;  2PQR A;  4I9E A;  2P58 C;  4G25 A;  2Y4U A;  4YVQ C;  4XI0 A;  3OXG A;  2KC7 A;  4N3C A;  1KT1 A;  3QWP A;  1HXI A;  1ZBP A;  2C0L A;  4J0U A;  1HZ4 A;  2UY1 A;  5G05 C;  4I9C A;  2NC9 A;  2QFC A;  2V5F A;  1B89 A;  4GA1 A;  3HYM B;  2UWJ G;  3AS4 A;  4HOT A;  1E96 B;  5ARF A;  4UQX A;  4JA7 A;  4W9R A;  1PC2 A;  3KAE A;  1QQE A;  3VTY A;  4BT8 A;  4CGV A;  4GZ5 A;  2VGX A;  3Q49 B;  4J8E A;  3QWW A;  4JA9 A;  3PE4 A;  4BWR A;  3NF1 A;  4F3V A;  2PL2 A;  4IN3 B;  2YQ8 A;  2FF4 A;  4GCO A;  3ZPJ A;  2VYI A;  2OOE A;  3LY8 A;  5HQ8 A;  5G05 J;  4U0S A;  4JL0 A;  2VQ2 A;  5BT1 A;  3Q5M A;  5LCW C;  4BTA A;  4I2W A;  4N3A A;  2GW1 A;  3AS5 A;  4H7Y A;  1NA0 A;  5HI7 A;  4BT9 A;  3S7J A;  3FFL A;  2XGO A;  2KCL A;  5DBK A;  5FTP A;  1ELR A;  5JJ6 A;  4AIF A;  4WUY A;  2KAT A;  3PE3 A;  3OXF A;  4GA0 A;  3JYS A;  1TJC A;  2FI7 A;  5KJL A;  4RG6 A;  3CVN A;  4G1T A;  3VTX A;  4UI9 C;  4GYW A;  3CVQ A;  2XEV A;  2YHC A;  4GA2 A;  5EX0 A;  2LSU A;  5EX3 A;  5EKQ D;  3ASG A;  4I1A A;  5BNW A;  4G2V A;  3QKY A;  4U0U A;  5KJM A;  5FZR A;  5ARG A;  4ABN A;  4NQ0 A;  4J8D A;  1Y8M A;  4J8F A;  3PDN A;  3MEK A;  3RKV A;  2PQN A;  4JHR A;  4UI9 J;  2XCC A;  4G24 A;  3SZ7 A;  4HOR A;  3ULQ A;  3O48 A;  2FEZ A;  2JLB A;  3ASD A;  2XCB A;  1KT0 A;  3MKR A;  2OND A;  3KS2 A;  3CKC A;  4HOU A;  3UPV A;  3GW4 A;  3CVP A;  2XGM A; 
#chains in the Genus database with same CATH topology
 4OYS A;  1N94 A;  4ATG A;  1MZC A;  4KVO A;  4AP2 A;  3UT4 A;  3FH5 A;  3LEW A;  4K5C A;  1QNF A;  3LYA A;  2XPY A;  3EDT B;  2VTB B;  1E8Y A;  4AOF A;  3G2U A;  4HRN A;  3QB2 A;  3TWT A;  3D9P A;  1EDU A;  2ILR A;  1ELK A;  4HRM B;  4LSZ E;  4GU5 A;  3U66 A;  5AEN A;  5CED B;  4DX1 A;  3OAW A;  3QC1 A;  3ASH A;  3Q9U C;  4EBA G;  2X6J A;  3UKR G;  3JXJ A;  4C48 B;  5J08 A;  3PZ2 A;  2VGX B;  4WNF A;  1JCQ A;  4GYO A;  4TUU A;  1HH8 A;  3FUD A;  3VLF A;  4AY6 A;  4JPS A;  2EIJ E;  3FWV A;  5AYW D;  3HIZ A;  2XRY A;  4FLB A;  1LF8 A;  2L9B A;  4CYM D;  2QYJ A;  2IQC A;  3PEU B;  1N4S A;  4DLO A;  4U04 A;  3GZ2 A;  5BV1 A;  2VSY A;  3CVL A;  2P9N G;  4UQY A;  4XE0 A;  4G26 A;  3Q75 A;  2BTD A;  3FEY A;  3EU5 A;  1E7U A;  3FUJ A;  2L6B A;  4FA6 A;  2IFU A;  1LTX A;  3G2W A;  1JUQ A;  3DSV A;  4U0Z A;  4N3B A;  4IRU A;  3CV0 A;  2YIN A;  4Q96 A;  5JHB A;  1MX6 A;  2I1K A;  1D8D A;  3DSW A;  2ZIS A;  3IHV A;  1G3N B;  3FUE A;  3LJ3 A;  4P29 A;  2GRR B;  4WWN A;  2XEN A;  3DSS A;  4N2S A;  1LD8 A;  4KZ0 A;  2RG8 A;  3W9G A;  3G2S A;  2WXO A;  1UJJ A;  4HI9 A;  3TGO A;  3QWV A;  3S7F A;  4ZFH A;  5ENT D;  4UWH A;  5D0O D;  3FTZ A;  3EU9 A;  4APO A;  3FEX A;  4CCA A;  1MX2 A;  2VSN A;  4HRL A;  3RSE G;  2XPI A;  5T8I A;  1V55 E;  3EHR A;  4O1O A;  3HRA A;  3LVR E;  2XQ0 A;  5D0Q D;  2KCK A;  5JJ7 A;  4LNB A;  1SQM A;  4F1S A;  1MHQ A;  3L22 A;  1WM5 A;  4JHK A;  3APD A;  2WPV A;  4I2Z A;  1N4Q A;  4V3I A;  4G23 A;  4N5C A;  3RO2 A;  4O60 A;  2EIK E;  4GTT A;  5CHE E;  2E0I A;  2F37 A;  4GPM A;  3NB2 A;  5AQ9 A;  3V79 K;  2ZXW E;  1N9A A;  4JC8 A;  3FU3 A;  5ENN A;  3MA5 A;  4DJA A;  4Q69 A;  4GMJ A;  1SZA A;  3SD5 A;  3URZ A;  3L16 A;  4GTQ A;  1TR4 A;  4F1P A;  1K3Z D;  4GZ3 A;  3LKU A;  1VDY A;  4FHJ A;  4B8A A;  1OXJ A;  4DX5 D;  3B13 A;  3CVY A;  4A1S A;  1HFA A;  4G25 A;  2R02 A;  3CLJ A;  3UT7 A;  4YVQ C;  2P9P G;  3E33 A;  1AWC B;  3ABM E;  2V4H C;  3KEA A;  5FIO A;  2KC7 A;  1HXI A;  2C0L A;  4J0U A;  1QYM A;  2I2O A;  1UW4 B;  3CHQ A;  1HG5 A;  2QFC A;  1B89 A;  1KZP A;  2A5U A;  3HYM B;  4B93 B;  5CMY A;  3EUV A;  5JHA A;  2ETC A;  2VJ8 A;  2Y69 E;  2EIM E;  2VSX E;  4LG6 A;  5ARF A;  4BES A;  4JA7 A;  4GZC A;  2JEK A;  4GZ5 A;  1Z6T A;  3ASN E;  3CHM A;  3DST A;  4R7L A;  2EIN E;  3CVW A;  3PE4 A;  3NZS A;  1FVF A;  5JA4 D;  2RFM A;  3VLD A;  2H6F A;  2PL2 A;  4U8H A;  5B1A E;  2ZU6 B;  3V31 A;  4RLY A;  5HQ8 A;  4DRX E;  4JL0 A;  5CBO A;  2OVB A;  4N3A A;  2DIW A;  4I43 A;  3AS5 A;  1TJF A;  4H7Y A;  3FTX A;  2BKG A;  3FFL A;  3T5V A;  3D9L A;  2NSZ A;  3JQ1 A;  3CQC B;  2KCL A;  5DBK A;  4WUY A;  4WAF A;  1K1B A;  2KAT A;  2CG3 A;  3MCX A;  3OXF A;  4GTM A;  4GA0 A;  1HO8 A;  4M3O A;  3D9N A;  1TJC A;  1S70 B;  5D66 A;  4HI8 A;  3L13 A;  2DYR E;  2Y1L E;  3QJZ A;  4BEP A;  4GYW A;  5D2M C;  2XEV A;  3MKQ B;  2YHC A;  3CQG B;  3TWR A;  3TXM A;  2LSU A;  5FQ4 A;  4CT4 A;  4OAU C;  3ASG A;  3FU0 A;  3PH0 C;  3FUH A;  5BNW A;  3RRM B;  4ANW A;  5E75 A;  3P2B A;  1OWP A;  3MX3 A;  5FIN A;  3DBS A;  4DPR A;  5FZR A;  2X6H A;  1OWN A;  2GRM A;  4BY6 A;  3MYV A;  2F8X K;  5A23 A;  3MEK A;  1E7V A;  3RKV A;  3JCK C;  4JHR A;  3V2X A;  4C9B B;  3R9M A;  4G11 A;  2ETB A;  3ULQ A;  2FEZ A;  2JLB A;  2XCB A;  4XEI G;  1KT0 A;  3MKR A;  2V0P A;  2OND A;  3PEV B;  1O1T A;  2OVF A;  3I4G A;  3IKO B;  3UKU G;  1O5M A;  2IY0 C;  5KWD A;  4AEZ C;  3U64 A;  1QZ2 A;  2M63 A;  3SBT B;  2MHK A;  5BXO A;  1Z3Y A;  1NZN A;  2E2E A;  3QDN A;  3L17 A;  4FC8 A;  4RQI A;  5KJN A;  4J8S A;  1RZ4 A;  2AXZ A;  4XKB A;  3ESK A;  3EIJ A;  1N52 A;  1FT2 A;  1NFI E;  3LXU X;  3ZHE A;  3TWX A;  5FZQ A;  3E30 A;  4AM9 A;  5JMN D;  1TNB A;  1W3B A;  2KBX A;  4OAV B;  4K0R A;  3B7B A;  5AIJ A;  2PZI A;  4U07 A;  3KSL A;  2LAH A;  2Y0B G;  3RK6 A;  3HDX A;  2B0O E;  3FUL A;  2LXM A;  3ZRH A;  4HFG A;  3R9A B;  3SGH A;  2LUH A;  4YDE A;  5ANL A;  3LS8 A;  1E90 A;  1D9S A;  2C0M A;  3JQ0 A;  2F0Y A;  1OWO A;  2F8Y A;  3CK9 A;  4QQI A;  3TJP A;  3IEG A;  2GRP B;  4O1P A;  1EYH A;  1SW6 A;  2XS1 A;  5T3R A;  4B0Z A;  2EQX A;  2NXP A;  3C3Q A;  3LVQ E;  4CDM A;  1NA3 A;  2WM9 A;  3C72 A;  4HB5 A;  3UQ3 A;  1U3C A;  4JEU A;  2P9L G;  3UX4 A;  1JWF A;  3T5X A;  1U2V G;  4UUC A;  1FPP A;  3VLE A;  1TN8 A;  2AWI A;  4DX2 A;  4BFR A;  2IOL A;  1YA0 A;  4EBA A;  4Y6C A;  4FUL A;  1S0P A;  4GYY A;  2FUL A;  3PRZ A;  4L23 A;  5BXU A;  2R03 A;  2R59 A;  3FTW A;  2ETA A;  3MV2 B;  3AU4 A;  3CVU A;  1IKN D;  2IOS A;  2R2L A;  3ISM C;  3Q7F A;  1WY6 A;  2X6F A;  3E34 A;  2QY7 A;  2PM6 A;  3NOG D;  3ZFW A;  3B7R L;  5C1D A;  5CCM A;  3KSQ A;  3ENE A;  3AU5 A;  2WXG A;  2VGY A;  3ZYQ A;  3L82 A;  1H6P A;  5KNG A;  5CCL A;  1YYH A;  3CHS A;  3CSF A;  2J07 A;  2X6I A;  1TNO A;  2L0I A;  2XRZ A;  2KZT B;  3TWW A;  2LO6 A;  4FJY A;  4ILH B;  4EQF A;  1DVP A;  3ZNG A;  1FCH A;  3ASO E;  3HVE A;  4HOS A;  4KXK B;  2J49 A;  3CVV A;  3ZXP A;  2WXJ A;  2LXL A;  2YNQ A;  4KT6 B;  2GRL A;  2R5S A;  4NIK A;  4FU3 A;  2WXL A;  3T9K A;  2P9I G;  3PS6 A;  3FU6 A;  2Y4U A;  3TXN A;  1K1A A;  4XI0 A;  2X3M A;  3PZ4 A;  2OEW A;  3HXC A;  3OXG A;  1TYQ G;  3PRE A;  4M7C A;  1KT1 A;  3QWP A;  2RD0 A;  1IXV A;  3PUJ A;  2UY1 A;  3FY4 A;  4I9C A;  2WXR A;  4GA1 A;  4MBG A;  2WXK A;  3ML8 A;  3AG2 E;  5LFA A;  4MS6 A;  4BER A;  4HNA D;  4RVB A;  4J8Y A;  4BX9 A;  1X5B A;  3KEZ A;  1MYO A;  4DUI A;  3Q78 A;  4L1B A;  1OCC E;  4GML A;  1K8K G;  5B1B E;  4BWR A;  4F3V A;  1DCE A;  3ULY A;  3IXE A;  2FF4 A;  4AV7 A;  4PUC A;  4LUN U;  3ESL A;  4GCO A;  3DRA A;  3LY8 A;  2VQ2 A;  4DLQ A;  3Q5M A;  2WXF A;  4L2Y A;  5BT1 A;  5LCW C;  4CRW A;  3OTN A;  2RKK A;  1H0A A;  4OVV A;  1OCZ E;  3J5P A;  3CHO A;  1EPU A;  1TN7 A;  4BX8 A;  1YMP A;  4FHK A;  4WWP A;  2FI7 A;  5CRV A;  5KJL A;  2WXH A;  5BPP A;  4LNU D;  5HS0 A;  3CVN A;  4ANV A;  3HXD A;  1BD8 A;  4DX6 D;  2CG2 A;  4L7T A;  3CVQ A;  3L08 A;  1XGW A;  3ZYM A;  2IU1 A;  3B7S A;  2P9S G;  2V4L A;  4I1A A;  3UIN C;  3DPD A;  3QKY A;  3L9T A;  4K03 A;  4U0U A;  5KJM A;  1SVX A;  2J8S D;  1JCS A;  5ARG A;  1O1R A;  4J8D A;  3DXK G;  1UOH A;  3Q7A A;  3BG1 B;  2GRN B;  1O1S A;  3FTS A;  4G24 A;  3ZEF A;  4I6J A;  2J09 A;  3SZ7 A;  4HOR A;  3O48 A;  4PH4 B;  2FO1 E;  3HXB A;  1HS6 A;  4BSZ B;  3G2V A;  3MGB A;  4HBD A;  4ACL A;  4JD2 G;  4GTP A;  4B8C B;  2P9K G;  1SA4 A;  4EEC A;  3I5P A;  3EIQ C;  1DCQ A;  1NL4 A;  4EZJ A;  2DVW A;  4LEU A;  4Q94 A;  1XNF A;  4NRH B;  4TV3 A;  3AG3 E;  1ELW A;  5C2Y A;  3RO3 A;  1P5Q A;  5G2N A;  2IJG X;  4CDR A;  2J08 A;  1H2T C;  5G04 C;  3ULE G;  2HYZ A;  4AXH A;  4HLL A;  4IUL A;  3PNT B;  2IEJ A;  4KVM A;  4KMO A;  4UWK A;  4J6I A;  5EIL A;  1KLX A;  2YHE A;  5AAO A;  1H6K A;  2BED A;  4B89 A;  3CR3 A;  3D3M A;  4WND A;  1HE8 A;  4BTB A;  2KXP C;  1JPL A;  4N5Q A;  2GGF A;  3K9I A;  5EYL A;  1H19 A;  4UQZ A;  3Q15 A;  3TAX A;  2J9Q A;  3FTU A;  1TNU A;  3SNX A;  5CRU A;  3ZIM A;  4HOQ A;  3LPZ A;  4A1G A;  5CEC B;  2EIL E;  3W9F A;  4XIF A;  5E76 A;  2C2L A;  2LNI A;  3L6A A;  3TWU A;  3ZGQ A;  3C5R A;  4N39 A;  4I6E A;  4A63 B;  4YND A;  5A6C A;  5EYP F;  1PAQ A;  4L9P A;  4WWO A;  2IF4 A;  5CMW A;  3SI5 A;  2WXN A;  4YVO A;  3AS8 A;  3PZ3 A;  1RW2 A;  3CIA A;  3MV3 B;  5DIZ A;  3FP3 A;  5AQA A;  1H2U A;  3TWS A;  1ZU2 A;  4RSY A;  2BF0 X;  4U8Y D;  3FHE A;  2GRQ B;  5M72 A;  3UM0 A;  3NBN B;  3FH7 A;  2L6J A;  5FJY A;  2HE0 A;  3Q79 A;  1OWM A;  2HR2 A;  4G8L A;  3AG1 E;  3CVX A;  2KM4 A;  1A5E A;  1LD7 A;  2PNN A;  1MQS A;  5AJD A;  4GCN A;  1JCR A;  4C0E A;  1FT1 A;  3ONK A;  5AN8 A;  3NOC D;  3E37 A;  2WXM A;  2LAI A;  1N54 A;  3TG4 A;  4LNG A;  2OCC E;  1INZ A;  4A3V A;  3E4B A;  3OXL A;  3CK7 A;  4URK A;  2WVI A;  3ZN3 A;  3QAQ A;  3GYZ A;  3NQP A;  3Q4A B;  3U3W A;  4LER A;  3ZUV B;  3UIO C;  3HG0 D;  3KD7 A;  4DI3 A;  4JEH A;  5CER B;  4A55 A;  3P1U A;  3ML9 A;  3JUE A;  1BLX B;  1D8E A;  1TNZ A;  4CEM A;  2OV8 A;  2AXV A;  2NYJ A;  5ENP D;  1WAO 1;  1OT8 A;  3UXG A;  3CK8 A;  2ZGD A;  3ZHE B;  2MRI A;  1MX4 A;  2BUG A;  1BPO A;  3LY9 A;  3ASF A;  3GZ1 A;  2PQR A;  4I9E A;  2P58 C;  1TN6 A;  4JHJ A;  3RRN B;  3UM2 A;  3SHF A;  1N4P A;  1OY3 D;  1ZBP A;  2VTB A;  5H7P A;  1HZ4 A;  4XX5 A;  2H6I A;  2ION A;  3APC A;  3HXF A;  4I1O B;  2XPZ A;  3ZYK A;  4F53 A;  1WG0 A;  3GZS A;  1KZO A;  2NC9 A;  3I3N A;  2V5F A;  3FUI A;  3FTY A;  3AS4 A;  4HOT A;  2HM8 A;  4TRQ A;  1E96 B;  5G55 A;  5ENS D;  4UQX A;  4LRZ A;  5FQ8 A;  4HVB A;  3D9K A;  4W9R A;  1QQE A;  1QBQ A;  4CZ2 D;  5B3S E;  3C3R A;  5BUZ A;  1S63 A;  2VGX A;  3Q49 B;  3UMV A;  4J8E A;  4CT0 A;  3QWW A;  3ABL E;  2GRO B;  5EID A;  3NF1 A;  3BG0 B;  3CHP A;  2IO2 C;  4IN3 B;  4DK5 A;  1UG3 A;  2VYI A;  2KZT A;  4U0S A;  5BV0 A;  4BTA A;  1SA5 A;  1NA0 A;  4BT9 A;  3NZU A;  2WB2 A;  3DEP A;  3DWL G;  3L54 A;  5JJ6 A;  3PE3 A;  2WXP A;  2CFZ A;  3JYS A;  4AVX A;  4TXQ A;  2QYU A;  4RG6 A;  5ITZ F;  3I4R B;  3FTV A;  2I1J A;  3UIP C;  3DPY A;  4FP7 A;  4ATZ D;  3MJW A;  2VSO E;  2L0T B;  1E8W A;  4YDW A;  4BSX A;  2WQ7 A;  4ZHB A;  4I6G A;  5EX0 A;  1X81 A;  1WDY A;  5EX3 A;  4JB8 P;  3R7Q A;  3V30 A;  1E8X A;  3QAR A;  4D10 C;  2XEE A;  4G2V A;  3APF A;  3AAA C;  4A3T A;  4ABN A;  4NQ0 A;  3EHQ A;  3B7U X;  3IBE A;  4U8V D;  1S64 A;  4E85 A;  1Y8M A;  1DNP A;  3PDN A;  3ZU7 B;  3D9O A;  2XCC A;  1NI1 A;  3G2T A;  3HVE B;  5ANR A;  4EZL A;  3ASD A;  1IQR A;  3KS2 A;  3CKC A;  1N0Q A;  5LP0 A;  3D9I A;  2A4Z A;  4EHM A;  3CVP A;  2XGM A;  4ILI A;  2FO7 A;  3LDZ A;  4APF A;  3DSU A;  3ZXS A;  4I1M A;  4UWG A;  1L5J A;  2DBA A;  4F6R D;  1N4R A;  2RFA A;  3S7D A;  3FH8 A;  3SF4 A;  3V2O A;  4PS7 A;  4HLE A;  5FQ6 A;  4GTS A;  4IYP A;  2UY1 B;  2QC9 A;  5EDS A;  3JUI A;  2FBN A;  3BEE A;  3FUN A;  4J7W A;  2AXU A;  3SQV A;  2Y3A A;  3UTM A;  1HX8 A;  3IHY A;  4WNE A;  4Y6W A;  3EHM A;  1IHB A;  1HG2 A;  4KBQ A;  3FDH A;  3BU8 A;  4E6H A;  4XI9 A;  4X8Q A;  4H7X A;  4YDO A;  3TG5 A;  4DX7 D;  5KJK A;  4EZK A;  3QOU A;  3E32 A;  3WXX A;  3Q47 B;  2AVP A;  4AY5 A;  4UWL A;  2IO3 C;  4UI9 K;  2PM7 A;  1YCS B;  1GW6 A;  3LCA A;  1N95 A;  4RG9 A;  1U3D A;  1SZ9 A;  3CKB A;  5LCW J;  2BKK B;  5ENO D;  4AJW A;  4ANX A;  3S2A A;  5FT9 A;  3U4T A;  2P9U G;  2XZT G;  3MZL B;  4I17 A;  3ONL A;  3TL5 A;  1H2V C;  1BI7 B;  2I6H A;  3LJN A;  4XKC A;  4KZC A;  3CEQ A;  4GB9 A;  3C3O A;  3RU0 A;  4FLH A;  3CGH A;  3CHR A;  4U96 D;  3O4Z A;  2XZD G;  2KCV A;  4G8K A;  3UM3 A;  4ME2 A;  2J4B A;  4YDY A;  2LSV A;  4CGW A;  5EN5 D;  4FAD A;  2X6K A;  2ZGG A;  1TNY A;  4JZY A;  1BU9 A;  5JJT A;  2Q7F A;  3AJI A;  3FUF A;  4GTO A;  3PVL A;  3SFY A;  3SFX A;  4K5B A;  2A5E A;  2MOW A;  5ENQ D;  4B94 A;  4GAA A;  3ZYL A;  3SO8 A;  3DSX A;  3UI2 A;  5CEA A;  5T4Y A;  4GMR A;  2DZO A;  2XGS A;  2AJA A;  1OWL A;  3N71 A;  2MYO A;  4F7A A;  1Q2Z A;  5KCM A;  2WQ6 A;  3D9J A;  1IHG A;  1OCR E;  3UT8 A;  4DI4 A;  4O6F A;  4LCT A;  4GZ6 A;  5FQ7 A;  4TXR A;  3X2Q E;  3MKQ A;  4L2L A;  3RIB A;  3B95 A;  3D9H A;  4JXT A;  2WQH A;  4WNG A;  3FUK A;  3DEO A;  4MRU A;  5BW8 C;  4Z68 A;  5A7D B;  3SY2 A;  4BET A;  5IY5 E;  1A17 A;  3R7R A;  2DZN A;  4FJZ A;  5FZS A;  5AQ7 A;  3T8M A;  1Z5S C;  2P2C P;  2HO1 A;  3U9W A;  2Y4T A;  2AW6 A;  4OVU A;  1N11 A;  2DYS E;  5G04 J;  1MJ0 A;  2CHW A;  5LOZ A;  3SFZ A;  3TWQ A;  4GPK A;  3RAU A;  3JXI A;  4GTR A;  4HQD A;  3ZKJ A;  5KBA A;  4HS2 A;  1IYG A;  4KYO B;  3HHM A;  5AQB A;  3J5Q B;  3PZ1 A;  3S7B A;  4N2Q A;  3QNK A;  3PNL B;  5HRY A;  3LY7 A;  3ZVV A;  4EPZ A;  1OUV A;  2H6H A;  4ILG A;  3SBS A;  5LX8 A;  2CFU A;  4UWF A;  3UUX A;  3RJV A;  4U7E B;  3NAW A;  1ZB1 A;  4QFV A;  1KPS B;  1NP7 A;  2XEH A;  4N3C A;  3B7T A;  4ACK A;  4U95 D;  3D9M A;  5G05 C;  4XZ4 A;  3UM1 A;  4TUM A;  2B6C A;  3RRU A;  2UWJ G;  3PZD A;  3Q9N C;  1PC2 A;  3KAE A;  3QK0 A;  1DC2 A;  3VTY A;  4BT8 A;  2VGE A;  4CGV A;  2JAB A;  1PY1 A;  5CBN A;  2DWZ A;  4JA9 A;  2CHX A;  1H6O A;  1JWG A;  1V54 E;  2H6G A;  2ZIR A;  3BQO A;  2YQ8 A;  1N0R A;  3ZPJ A;  2OOE A;  2WXQ A;  1IQU A;  5FWQ A;  5G05 J;  4GZD A;  2OEV A;  2WMN A;  3WG7 E;  1EF1 C;  1HF8 A;  4I2W A;  2V8S E;  2GW1 A;  5KNH D;  5HI7 A;  3S7J A;  3AG4 E;  3HXE A;  4MKT A;  2XGO A;  1AP7 A;  3TWV A;  1Y6I A;  4PS3 A;  5FTP A;  1TEZ A;  4K5A B;  1HU3 A;  1ELR A;  4AIF A;  3C98 A;  2X38 A;  4TXP A;  1E8Z A;  3EHN A;  2V5Q C;  2R17 C;  2XHE A;  1OCO E;  4G1T A;  3DXM G;  3VTX A;  4UI9 C;  3BUA A;  4C0M A;  5ENR D;  4GTV A;  4MLP A;  4JVS A;  4PS8 A;  4GA2 A;  4JW1 A;  3Q73 A;  2DCP A;  1FVH A;  5EKQ D;  1BI8 B;  4U63 A;  3CST A;  2R05 A;  3FUM A;  4HXI A;  1UJK A;  2QZA A;  3PUK A;  5AAR A;  5AJL A;  3FU5 A;  4J8F A;  3EJN A;  4PDX A;  2I9C A;  2PQN A;  2WMO A;  2J4D A;  4NUR A;  3ZW3 A;  5J90 A;  4CDN A;  3ABK E;  4UI9 J;  1UN8 A;  5EIB E;  5HKP A;  3T8K A;  4NAC A;  2CHZ A;  3IV0 A;  1UN9 A;  3F6Q A;  2WXI A;  2XS8 A;  4HOU A;  1Z3X A;  3UPV A;  3GW4 A;  4ANU A; 
#chains in the Genus database with same CATH homology
 2M63 A;  4ILI A;  4OYS A;  2FO7 A;  3LDZ A;  4ATG A;  4APF A;  3SBT B;  4B8C B;  3ZXS A;  4I1M A;  4KVO A;  2MHK A;  4UWG A;  1L5J A;  4AP2 A;  2DBA A;  3I5P A;  3EIQ C;  4EEC A;  3UT4 A;  1Z3Y A;  1NZN A;  3FH5 A;  4EZJ A;  3LEW A;  2E2E A;  3QDN A;  4LEU A;  1QNF A;  3S7D A;  3L17 A;  1XNF A;  4Q94 A;  3LYA A;  2XPY A;  4NRH B;  3FH8 A;  4TV3 A;  4FC8 A;  3SF4 A;  3EDT B;  1ELW A;  4PS7 A;  2VTB B;  4HLE A;  5KJN A;  1E8Y A;  5C2Y A;  3G2U A;  4J8S A;  4AOF A;  3RO3 A;  5FQ6 A;  3QB2 A;  4IYP A;  2UY1 B;  3D9P A;  1P5Q A;  5G2N A;  5EDS A;  2IJG X;  3JUI A;  1EDU A;  4CDR A;  2AXZ A;  2FBN A;  1H2T C;  2J08 A;  3BEE A;  3FUN A;  4XKB A;  5G04 C;  3ESK A;  2ILR A;  2AXU A;  1N52 A;  3EIJ A;  1ELK A;  2HYZ A;  4AXH A;  4IUL A;  2Y3A A;  3PNT B;  1HX8 A;  3IHY A;  4WNE A;  3LXU X;  4GU5 A;  4Y6W A;  3EHM A;  3ZHE A;  3U66 A;  5FZQ A;  1HG2 A;  4KBQ A;  4AM9 A;  5AEN A;  4KVM A;  3OAW A;  3FDH A;  4KMO A;  4UWK A;  1W3B A;  4E6H A;  4J6I A;  3QC1 A;  4XI9 A;  1KLX A;  4H7X A;  2YHE A;  1H6K A;  3ASH A;  4K0R A;  3CR3 A;  3TG5 A;  4B89 A;  5KJK A;  4EZK A;  4EBA G;  3QOU A;  3D3M A;  4WND A;  1HE8 A;  4BTB A;  5AIJ A;  2X6J A;  3WXX A;  3Q47 B;  2PZI A;  2AVP A;  1JPL A;  5J08 A;  2GGF A;  4U07 A;  4AY5 A;  2VGX B;  4UWL A;  4WNF A;  3K9I A;  2LAH A;  2PM7 A;  4UI9 K;  4GYO A;  1H19 A;  4UQZ A;  3Q15 A;  3RK6 A;  3TAX A;  3HDX A;  2J9Q A;  4TUU A;  1GW6 A;  1HH8 A;  3FTU A;  3FUD A;  3LCA A;  4JPS A;  4RG9 A;  3VLF A;  4AY6 A;  3FUL A;  3SNX A;  3ZIM A;  1U3D A;  1SZ9 A;  4HOQ A;  3LPZ A;  3CKB A;  3FWV A;  5AYW D;  4A1G A;  3HIZ A;  2XRY A;  4FLB A;  5LCW J;  4AJW A;  3ZRH A;  4ANX A;  1LF8 A;  4HFG A;  3R9A B;  2L9B A;  3S2A A;  5FT9 A;  3SGH A;  3U4T A;  3MZL B;  2IQC A;  4XIF A;  5E76 A;  3PEU B;  2C2L A;  2LNI A;  3L6A A;  3ZGQ A;  4I17 A;  4U04 A;  4N39 A;  3GZ2 A;  5ANL A;  3ONL A;  3TL5 A;  3LS8 A;  1H2V C;  4I6E A;  1E90 A;  5BV1 A;  2VSY A;  3CVL A;  2C0M A;  2I6H A;  3JQ0 A;  4YND A;  4XKC A;  5A6C A;  4UQY A;  4KZC A;  4XE0 A;  3CEQ A;  4G26 A;  1OWO A;  1PAQ A;  4WWO A;  3CK9 A;  2IF4 A;  4GB9 A;  3RU0 A;  5CMW A;  4FLH A;  3SI5 A;  2WXN A;  3CGH A;  2BTD A;  3FEY A;  4YVO A;  3AS8 A;  3CHR A;  3TJP A;  3CIA A;  3O4Z A;  2KCV A;  3IEG A;  1E7U A;  3MV3 B;  5DIZ A;  3FP3 A;  3FUJ A;  1H2U A;  1ZU2 A;  4RSY A;  4ME2 A;  2J4B A;  2IFU A;  4FA6 A;  2LSV A;  3G2W A;  4CGW A;  1JUQ A;  2BF0 X;  4U0Z A;  4N3B A;  4FAD A;  2X6K A;  4IRU A;  3CV0 A;  2YIN A;  4Q96 A;  5JHB A;  3FHE A;  1EYH A;  5M72 A;  4JZY A;  5T3R A;  2I1K A;  4B0Z A;  5JJT A;  2EQX A;  2Q7F A;  2NXP A;  3LVQ E;  3FUF A;  4CDM A;  1NA3 A;  3IHV A;  3PVL A;  2WM9 A;  3FUE A;  3LJ3 A;  4P29 A;  2MOW A;  4B94 A;  3FH7 A;  4WWN A;  3UQ3 A;  1U3C A;  4N2S A;  4KZ0 A;  2RG8 A;  4JEU A;  4GAA A;  3ZYL A;  3G2S A;  2WXO A;  1UJJ A;  4ACL A;  3QWV A;  3S7F A;  3TGO A;  2L6J A;  5FJY A;  3UX4 A;  1JWF A;  5T4Y A;  4UWH A;  5D0O D;  2XGS A;  3FTZ A;  1OWM A;  3T5X A;  4APO A;  1OWL A;  2HR2 A;  3FEX A;  3N71 A;  4CCA A;  3VLE A;  4F7A A;  2VSN A;  2AWI A;  5KCM A;  2WQ6 A;  2XPI A;  5T8I A;  3CVX A;  2KM4 A;  4BFR A;  3D9J A;  1IHG A;  2IOL A;  1YA0 A;  4EBA A;  4Y6C A;  4FUL A;  1MQS A;  1S0P A;  3UT8 A;  3LVR E;  5AJD A;  4GYY A;  2FUL A;  3PRZ A;  4L23 A;  4DI4 A;  4GCN A;  2XQ0 A;  4O6F A;  5D0Q D;  2KCK A;  4LCT A;  5JJ7 A;  4C0E A;  1SQM A;  3ONK A;  4GZ6 A;  4F1S A;  2R59 A;  3FTW A;  5FQ7 A;  1MHQ A;  3MV2 B;  3L22 A;  3MKQ A;  1WM5 A;  3AU4 A;  3CVU A;  4L2L A;  2IOS A;  3RIB A;  4JHK A;  3APD A;  4JXT A;  2WXM A;  1WY6 A;  2LAI A;  2WPV A;  2X6F A;  1N54 A;  2WQH A;  4WNG A;  2QY7 A;  4I2Z A;  2PM6 A;  3FUK A;  5BW8 C;  4MRU A;  3TG4 A;  1INZ A;  3ZFW A;  5A7D B;  4A3V A;  3E4B A;  3OXL A;  3CK7 A;  1A17 A;  4URK A;  4V3I A;  2WVI A;  3R7R A;  3ZN3 A;  4G23 A;  3QAQ A;  4N5C A;  3B7R L;  3RO2 A;  3GYZ A;  5C1D A;  3NQP A;  5CCM A;  3ENE A;  3Q4A B;  3AU5 A;  4FJZ A;  5FZS A;  3U3W A;  4LER A;  2WXG A;  2VGY A;  5CHE E;  3ZYQ A;  2E0I A;  3T8M A;  5CCL A;  3KD7 A;  4DI3 A;  3CHS A;  4JEH A;  2HO1 A;  3U9W A;  2Y4T A;  3CSF A;  2J07 A;  2X6I A;  4A55 A;  3P1U A;  3ML9 A;  2AW6 A;  2L0I A;  4OVU A;  4JC8 A;  2XRZ A;  3FU3 A;  2KZT B;  2LO6 A;  4FJY A;  4ILH B;  3MA5 A;  5ENN A;  4DJA A;  4EQF A;  5G04 J;  4Q69 A;  4CEM A;  2CHW A;  2OV8 A;  5LOZ A;  3SFZ A;  4GPK A;  1DVP A;  4GMJ A;  1SZA A;  4HS2 A;  2AXV A;  1IYG A;  1FCH A;  1WAO 1;  3HVE A;  4KYO B;  3HHM A;  3SD5 A;  4HOS A;  3URZ A;  4KXK B;  3L16 A;  2J49 A;  3S7B A;  4N2Q A;  3QNK A;  3PNL B;  3CVV A;  3CK8 A;  3ZHE B;  2MRI A;  1QZ2 A;  2BUG A;  2WXJ A;  2YNQ A;  3LY7 A;  3ZVV A;  4KT6 B;  4GZ3 A;  3LKU A;  4EPZ A;  1OUV A;  3SBS A;  4ILG A;  2GRL A;  1BPO A;  3LY9 A;  1VDY A;  4FHJ A;  4B8A A;  5LX8 A;  2CFU A;  4UWF A;  2R5S A;  3B13 A;  3ASF A;  3UUX A;  4FU3 A;  3RJV A;  2WXL A;  3CVY A;  3GZ1 A;  4A1S A;  2PQR A;  1HFA A;  4I9E A;  2P58 C;  3PS6 A;  4G25 A;  3CLJ A;  3FU6 A;  2Y4U A;  3UT7 A;  4YVQ C;  3TXN A;  4JHJ A;  4XI0 A;  2X3M A;  3RRN B;  4QFV A;  3OXG A;  1NP7 A;  2KC7 A;  4N3C A;  3PRE A;  3SHF A;  1KT1 A;  3QWP A;  1HXI A;  1ZBP A;  2C0L A;  4J0U A;  2VTB A;  1HZ4 A;  3B7T A;  4ACK A;  4XX5 A;  2RD0 A;  3PUJ A;  2UY1 A;  3FY4 A;  2I2O A;  2ION A;  3D9M A;  3APC A;  4I1O B;  5G05 C;  2XPZ A;  3ZYK A;  4XZ4 A;  4F53 A;  1UW4 B;  3GZS A;  3CHQ A;  4I9C A;  1HG5 A;  2NC9 A;  2QFC A;  2WXR A;  1B89 A;  2V5F A;  3I3N A;  4GA1 A;  2A5U A;  3FUI A;  3HYM B;  3FTY A;  5CMY A;  3RRU A;  2UWJ G;  3AS4 A;  3PZD A;  4HOT A;  2HM8 A;  5JHA A;  4TRQ A;  1E96 B;  2WXK A;  3ML8 A;  2VJ8 A;  5LFA A;  4MS6 A;  5G55 A;  4RVB A;  2VSX E;  5ARF A;  4UQX A;  4LRZ A;  5FQ8 A;  4JA7 A;  4HVB A;  3D9K A;  1PC2 A;  4W9R A;  3KAE A;  1QQE A;  3QK0 A;  3VTY A;  4BT8 A;  4CGV A;  4GZC A;  4BX9 A;  2JEK A;  5BUZ A;  1X5B A;  3KEZ A;  4GZ5 A;  2VGX A;  1Z6T A;  3Q49 B;  3UMV A;  3CHM A;  4J8E A;  4CT0 A;  1PY1 A;  3QWW A;  4R7L A;  4JA9 A;  4L1B A;  2CHX A;  3CVW A;  4GML A;  1JWG A;  3PE4 A;  4BWR A;  3NF1 A;  3NZS A;  3BG0 B;  1FVF A;  4F3V A;  3CHP A;  3VLD A;  2PL2 A;  4U8H A;  4IN3 B;  4DK5 A;  2YQ8 A;  2FF4 A;  4AV7 A;  4PUC A;  1UG3 A;  4LUN U;  2ZU6 B;  3ESL A;  4GCO A;  2VYI A;  3ZPJ A;  2OOE A;  3LY8 A;  2KZT A;  5HQ8 A;  2WXQ A;  1IQU A;  5FWQ A;  5G05 J;  4GZD A;  4U0S A;  4JL0 A;  2VQ2 A;  4DLQ A;  3Q5M A;  2WXF A;  4L2Y A;  5BT1 A;  2WMN A;  5BV0 A;  5LCW C;  1EF1 C;  2OVB A;  1HF8 A;  3OTN A;  4I2W A;  2V8S E;  4N3A A;  4BTA A;  2DIW A;  2GW1 A;  4CRW A;  4I43 A;  1H0A A;  4OVV A;  3AS5 A;  1TJF A;  4H7Y A;  3FTX A;  1NA0 A;  5HI7 A;  4BT9 A;  3S7J A;  3NZU A;  3FFL A;  3T5V A;  2WB2 A;  3D9L A;  2NSZ A;  3JQ1 A;  3CHO A;  3CQC B;  2XGO A;  3L54 A;  2KCL A;  1EPU A;  4MKT A;  1Y6I A;  4PS3 A;  5DBK A;  5FTP A;  1TEZ A;  1HU3 A;  1ELR A;  4BX8 A;  5JJ6 A;  4AIF A;  4WUY A;  4WAF A;  3C98 A;  2KAT A;  3PE3 A;  2CG3 A;  3MCX A;  2WXP A;  3OXF A;  4GA0 A;  1HO8 A;  4M3O A;  2CFZ A;  1TJC A;  3D9N A;  3JYS A;  4FHK A;  4WWP A;  2FI7 A;  2X38 A;  4AVX A;  4RG6 A;  5KJL A;  2WXH A;  1E8Z A;  3EHN A;  5BPP A;  2R17 C;  3I4R B;  3FTV A;  2I1J A;  2XHE A;  3CVN A;  3L13 A;  4G1T A;  3VTX A;  4ANV A;  4FP7 A;  4UI9 C;  3MJW A;  2VSO E;  3QJZ A;  2L0T B;  4C0M A;  2CG2 A;  4L7T A;  4GYW A;  3CVQ A;  2XEV A;  3L08 A;  3MKQ B;  2YHC A;  4MLP A;  1E8W A;  3CQG B;  4JVS A;  1XGW A;  4PS8 A;  3ZYM A;  4BSX A;  2WQ7 A;  2IU1 A;  4I6G A;  4GA2 A;  3TXM A;  5EX0 A;  2LSU A;  4JW1 A;  3B7S A;  5EX3 A;  3R7Q A;  2DCP A;  5FQ4 A;  4CT4 A;  1FVH A;  5EKQ D;  2V4L A;  3ASG A;  3FU0 A;  1E8X A;  4U63 A;  3CST A;  3QAR A;  4D10 C;  3PH0 C;  3FUM A;  4HXI A;  3FUH A;  4I1A A;  5BNW A;  1UJK A;  4G2V A;  3DPD A;  3PUK A;  3RRM B;  4ANW A;  3QKY A;  5E75 A;  3P2B A;  1OWP A;  3MX3 A;  3DBS A;  4U0U A;  4K03 A;  4DPR A;  5KJM A;  5FZR A;  3APF A;  2X6H A;  1OWN A;  2GRM A;  4A3T A;  5ARG A;  4ABN A;  4BY6 A;  4NQ0 A;  3IBE A;  3B7U X;  4J8D A;  3MYV A;  5AJL A;  4E85 A;  3FU5 A;  1Y8M A;  4J8F A;  3EJN A;  4PDX A;  5A23 A;  1DNP A;  3PDN A;  3MEK A;  1E7V A;  2I9C A;  2PQN A;  3BG1 B;  3RKV A;  3JCK C;  2WMO A;  2J4D A;  4NUR A;  3ZW3 A;  5J90 A;  4CDN A;  4JHR A;  4UI9 J;  4C9B B;  3FTS A;  1UN8 A;  3D9O A;  2XCC A;  4G24 A;  3ZEF A;  4I6J A;  4G11 A;  2J09 A;  3G2T A;  3SZ7 A;  4HOR A;  3HVE B;  3O48 A;  2FEZ A;  5ANR A;  2JLB A;  3ASD A;  3ULQ A;  4DLO A;  4PH4 B;  4EZL A;  2XCB A;  1IQR A;  4NAC A;  2CHZ A;  1KT0 A;  3IV0 A;  3MKR A;  2V0P A;  1HS6 A;  1UN9 A;  2OND A;  3KS2 A;  3CKC A;  5LP0 A;  3G2V A;  3PEV B;  2WXI A;  2OVF A;  3I4G A;  3IKO B;  3D9I A;  4HOU A;  1Z3X A;  2A4Z A;  3UPV A;  3MGB A;  3GW4 A;  4ANU A;  3CVP A;  4AEZ C;  3U64 A;  2XGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...