1YA0A

Crystal structure of the n-terminal domain of human smg7
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
497
structure length
458
Chain Sequence
MSLQSAQYLRQAEVLKADMTDSKLGPAEVWTSRQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQITTLQGQAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTQSSSCSYICQHCLVHLGDIARYRNQTSQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNLQKALSKALESRDEVKTKWGVSDFIKAFIKFHGHVYLSKSLEKLSPLREKLEEQFKELLFQKAFNSQQLVHVTVINLFQLHHLRDFSNETEQHTYSQDEQLCWTQLLALFMSFLGILCKCPLQNSQEESYNAYPLPAVKVSMDWLRLRPRVFQEAVVDERQYIWPWLISLLNSFHPHEEDLSISATPLPEEFELQGFLALRPSFRNLDFSKGHKEGQQRRIRQQRLISIGKWIADNQPRLIQCENEVGKLLFITEIPELILEDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SMG7 Is a 14-3-3-like Adaptor in the Nonsense-Mediated mRNA Decay Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords SMG-7 transcript variant 2
total genus 166
structure length 458
sequence length 497
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10373 EST1_DNA_bind Est1 DNA/RNA binding domain
A PF10374 EST1 Telomerase activating protein Est1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1ya0A01
1ZU2A 2JLBA 4UI9J 5DBKA 3SF4A 1A17A 4I1AA 4BT9A 4XI0A 1PC2A 4LEUA 2KATA 5G05C 2GW1A 4GZ5A 1KT0A 4UQYA 2P58C 5FZRA 5BW8C 4Y6CA 4NQ0A 3QWWA 4H7XA 5EX0A 3RU0A 2UY1B 3E4BA 3K9IA 4YVQC 3VTXA 2IF4A 2L6JA 5KJKA 2Q7FA 3RO3A 4J8EA 4N3CA 3S7FA 4CGVA 3RO2A 4UQZA 1W3BA 4WNFA 4U04A 2YHCA 4YNDA 4A1SA 2UY1A 5G04C 4AIFA 4GYOA 2I6HA 4HORA 3CEQA 4XI9A 3CKBA 1FCHA 3LCAA 3RIBA 4GPKA 3MV2B 2PL2A 2XGOA 5JJ6A 5A7DB 2UWJG 3CVPA 1HZ4A 2KCKA 4GZ6A 1TJCA 2PQNA 4BWRA 1YA0A 4WNGA 3MKRA 5LCWC 2J9QA 3UQ3A 1OUVA 2FBNA 3ZGQA 3Q47B 1B89A 4ME2A 1ZBPA 2R5SA 3CV0A 3AS5A 3MV3B 3CK8A 3ASFA 5JJTA 1P5QA 3TGOA 3RJVA 4KBQA 5A6CA 3N71A 3QWPA 4WNEA 4GYYA 5KJMA 1Y8MA 2VSYA 5FZQA 3BEEA 4G25A 2FI7A 4I9CA 3S7DA 2NC9A 2BUGA 5HI7A 3GZ1A 4G26A 3TG4A 2VGXB 5BNWA 5LCWJ 2C0MA 2VYIA 3ASHA 5BT1A 4I2WA 2XEVA 3GZ2A 1IYGA 2HO1A 3HYMB 5KJNA 1IHGA 3PDNA 3UUXA 2HR2A 3LY7A 4RG6A 2V5FA 3RKVA 3VTYA 2YQ8A 1WM5A 2LSUA 3LPZA 2FF4A 4U07A 4U0UA 2KC7A 3URZA 3ZHEB 4KXKB 4AM9A 5HQ8A 3WXXA 4AY6A 5ARFA 3Q5MA 4J8FA 4GYWA 3OXLA 3PE4A 2XGSA 4CGWA 5D0QD 3U3WA 3ZHEA 4ABNA 4JA9A 1NA3A 5FT9A 3TG5A 3ZN3A 5FZSA 2AVPA 2PZIA 4AY5A 5CCLA 2VGXA 1WAO1 4B94A 1NA0A 1KLXA 1XNFA 4GCOA 5G04J 4GA1A 4J0UA 5FTPA 5EKQD 3KD7A 3FP3A 2MHKA 2QFCA 3ESKA 4G2VA 4UQXA 2XPIA 2E2EA 1HH8A 3CK7A 2KCLA 3O48A 4G23A 4HOQA 1NZNA 2Y4TA 4G1TA 5JJ7A 2XCCA 2WQHA 3KAEA 2DBAA 5FJYA 4JHRA 5EX3A 5D0OD 4W9RA 3FWVA 5G05J 3GYZA 4N3BA 3QOUA 4XIFA 4F3VA 4CDRA 4N3AA 5CHEE 3QKYA 3ULQA 4I9EA 3Q15A 4N39A 3KS2A 4APOA 4HOSA 3FFLA 2FEZA 3GW4A 4I2ZA 3U4TA 2PQRA 3ASDA 3QDNA 4EQFA 5C1DA 4WNDA 4H7YA 3LY9A 4BTAA 4N2QA 4GA2A 2HYZA 2KCVA 3AS4A 5M72A 3CVQA 4NRHB 3LY8A 3LYAA 3OXGA 4KYOB 2IFUA 2VSNA 3CVLA 1KT1A 3CK9A 2XCBA 4GCNA 4GA0A 2C0LA 2LSVA 3S7BA 3ZFWA 3CVNA 3CKCA 3NF1A 3Q4AB 2OOEA 4JL0A 2VQ2A 2WPVA 3ZPJA 3AS8A 4BTBA 4O6FA 3R9AB 5AYWD 4U0SA 4UI9C 3ASGA 3OXFA 1HXIA 2FO7A 4I17A 4N5CA 3SZ7A 4BT8A 1ELWA 5DIZA 5KJLA 4IN3B 2ONDA 4U0ZA 3UPVA 4N2SA 3JYSA 4HOTA 4YVOA 4J8DA 3MEKA 3TAXA 1ELRA 2LNIA 2C2LA 2VGYA 4G24A 4GZ3A 4RG9A 5CCMA 4JA7A 4Y6WA 5ARGA 3EDTB 3QWVA 1QQEA 1E96B 3LKUA 3PE3A 3IEGA 1QZ2A 4UI9K 4HOUA 2XGMA 3MA5A 3Q49B 4WUYA 2Y4UA 3S7JA
chains in the Genus database with same CATH superfamily
4GZDA 4ILIA 3I5PA 5KBAA 1WG0A 1UOHA 3CGHA 4DI4A 4CT4A 4YVQC 4PS8A 3LJNA 1FVFA 3HIZA 3RO2A 4UQZA 2KZTB 4APFA 2RD0A 4TXPA 1LTXA 4JZYA 4HLEA 4GPKA 3G2WA 2XGOA 3EHNA 4BFRA 4JXTA 4O60A 1H6PA 3QNKA 3QJZA 5KNGA 3BEEA 1OWMA 3PZ2A 1HU3A 3IBEA 4O1PA 2GROB 2WVIA 2V5FA 3G2UA 3PRZA 2ZIRA 4EHMA 4HXIA 4JA9A 1WAO1 1Y6IA 2XPIA 1MX4A 4XKCA 2OEWA 4ACKA 3UM3A 3O4ZA 3KAEA 5EX3A 1SA5A 4XKBA 1O5MA 3FUNA 3GW4A 2WXMA 3CHPA 2MOWA 2IEJA 4YDWA 4Z68A 1JCRA 3E33A 1ELWA 4FU3A 1TN6A 4ILHB 5AARA 3CSTA 1RZ4A 1FT2A 4I43A 5FINA 4LEUA 3HDXA 3I4GA 5C2YA 3W9FA 2L6JA 5HRYA 3GZSA 3S7FA 4A1SA 1EYHA 2VGEA 5ENRD 1N0QA 3RIBA 5AAOA 1TJCA 4HI9A 4ANVA 3Q73A 2XRYA 4GTPA 3UQ3A 3ZGQA 3ZYQA 3W9GA 3CK8A 3D9OA 4TUMA 3FU5A 1SA4A 3TG4A 3ZW3A 5LCWJ 2WXKA 4UWLA 2A5EA 4K0RA 3LPZA 2WXQA 2XHEA 3AAAC 1U3CA 1Z3XA 3OXLA 3LS8A 5AQBA 3G2TA 1NP7A 3R7QA 3ISMC 4U8YD 5AN8A 1S63A 5T3RA 2R59A 4KMOA 1WDYA 4GB9A 5H7PA 3ONLA 1HO8A 4J8YA 3VLEA 2R03A 4AV7A 3BU8A 3SQVA 4N39A 3QB2A 2KCVA 1JCQA 4AXHA 3UINC 2E0IA 3I3NA 5G04J 2XCBA 2WPVA 1LF8A 3SZ7A 3ASGA 3D9NA 3J5PA 2ONDA 3IKOB 3JYSA 3C72A 2XS1A 1JWFA 1N0RA 3C3RA 2I1KA 3L08A 1PAQA 1D8EA 1DNPA 5KCMA 4XI0A 4E6HA 3PNLB 4Y6CA 3HXFA 3VTXA 4ANUA 4AVXA 5AQ9A 1L5JA 3L6AA 4GZ6A 3CVPA 1N4RA 2PQNA 2V8SE 4XZ4A 1B89A 2R5SA 3AS5A 3C3OA 2VSYA 5FZQA 3FUIA 2QZAA 4G26A 3HXDA 5BT1A 3HG0D 3HYMB 3EU9A 5KJNA 2FULA 3RRUA 2WXOA 4LNUD 1HE8A 1Q2ZA 4J8FA 2KM4A 1V55E 2XGSA 2BKKB 2GRLA 4GTMA 4G8KA 3UIPC 5FQ6A 3FY4A 3P2BA 4BX8A 1H2VC 5FTPA 1AWCB 3CK7A 3O48A 1TN8A 2IJGX 4F7AA 3UKUG 4DX7D 3ULYA 3V2XA 3QDNA 3PUKA 4Q94A 3BG1B 1S70B 4C0EA 4CYMD 4U0SA 2DYRE 5LOZA 4BT8A 2V0PA 2PNNA 5CBOA 3MEKA 1ELRA 4G24A 2C2LA 1HF8A 3KEAA 3NOCD 2J4BA 3HVEB 2XGMA 3SF4A 2QY7A 1KPSB 3LEWA 4RVBA 5G05C 4JHJA 1N9AA 4L23A 2H6GA 2IF4A 2WM9A 2YINA 4N3CA 3ZRHA 4CGVA 3D9KA 5T4YA 4YNDA 1X81A 3CEQA 2PL2A 1HZ4A 3JQ1A 3ZIMA 4XE0A 3MV3B 3Q7AA 2V4HC 4TRQA 4L9PA 3CHRA 4RG6A 2LAIA 3D9PA 3PZ3A 3ONKA 4BSZB 3ZHEA 2LXMA 4ABNA 5EN5D 2VGXA 3QK0A 4J0UA 5D66A 3TWSA 1OCOE 2J08A 3IXEA 2WXLA 2RKKA 4DX5D 2Y4TA 2BF0X 3V30A 3FUEA 5ANLA 3KSQA 2P9NG 3RRMB 2CHXA 4HRMB 3X2QE 5T8IA 3SO8A 1OT8A 4M3OA 3ZFWA 4IULA 3L9TA 4R7LA 1V54E 4BTBA 5AYWD 4YDEA 5CRVA 3FTXA 5AQ7A 3JUEA 3MGBA 4FP7A 4HLLA 2VGYA 2AXZA 5G55A 3PS6A 3MZLB 3APFA 4UQYA 2JLBA 2WXIA 2Y69E 3RRNB 2IY0C 4FA6A 4NQ0A 3J5QB 5JHAA 5EIBE 4MKTA 2UY1A 2CHZA 4GYOA 1TNZA 3FH5A 5CRUA 1ZBPA 2AJAA 1DCEA 3RJVA 4MLPA 4ATGA 5D2MC 5HI7A 3GZ1A 3L22A 5B1BE 1H19A 4I2WA 3B7UX 4RLYA 2I2OA 5CERB 1MZCA 4BX9A 1IHBA 4KVOA 4I1OB 3DSVA 5ARFA 2GRRB 4LRZA 1H6KA 3HRAA 3L17A 4NURA 1NFIE 2E2EA 1TNYA 2IO3C 3L16A 5D0OD 2I9CA 3ULQA 2L0IA 3QKYA 1A5EA 3PEVB 1KZOA 4WNFA 3RK6A 2PM6A 2JEKA 3FUFA 3D9IA 3ZPJA 3TWWA 2LXLA 1RW2A 1E8ZA 3KEZA 3EHRA 1TNOA 4IN3B 4HOTA 2X6KA 2LNIA 4K5CA 4FHJA 3QARA 4H7XA 3E30A 4B89A 4IRUA 2P9KG 1DC2A 1TR4A 3FDHA 4RSYA 4URKA 5EX0A 3FUHA 3DSWA 2ZGDA 4HORA 4XI9A 3LCAA 2DWZA 2KCKA 3CIAA 4PDXA 4ANWA 3B7BA 1OUVA 5ENNA 2FO1E 4KBQA 5KJMA 1INZA 2AXVA 1KZPA 2FI7A 4A1GA 4HFGA 1QNFA 3RKVA 4CZ2D 4U0UA 4U07A 2EIJE 3UT8A 5HQ8A 4HVBA 4AY6A 3VLFA 3Q5MA 4XEIG 1N4QA 5FT9A 3TG5A 1KLXA 2X6FA 3PNTB 5HS0A 3ESKA 2DZNA 3DSTA 4GTTA 4EBAG 4CDRA 4WAFA 2FEZA 3PUJA 3T9KA 4EQFA 3DRAA 1BLXB 3LYAA 1ZB1A 3OXGA 4KYOB 3S7BA 4GA0A 4ZHBA 3CKCA 3SHFA 2F8YA 4O6FA 4UI9C 3OXFA 4WWOA 3UPVA 2AWIA 3FUMA 3EDTB 3QWVA 1QQEA 1PY1A 4AOFA 3FH8A 2JABA 3B7TA 3DWLG 2VJ8A 2KATA 5ENQD 2CHWA 5HKPA 3UM1A 3E4BA 4AIFA 3IHYA 4J8SA 3ZVVA 3E32A 2IONA 3Q79A 4BWRA 4WNGA 2WMOA 3Q47B 1JPLA 3Q7FA 3ASFA 5JJTA 3TGOA 2IOLA 4ZFHA 3NZUA 2C0MA 3ASNE 4BY6A 2WQ7A 1YCSB 5J90A 1GW6A 3HXEA 1H2UA 2H6IA 5LX8A 4KXKB 4DK5A 4B8AA 3PE4A 3U3WA 5D0QD 2MRIA 3ZN3A 5CEAA 2MHKA 4UQXA 5AJLA 3E37A 3APCA 5FJYA 1XGWA 4JHKA 4DX6D 2X6HA 3EHMA 2XENA 3KS2A 3U4TA 4PH4B 3MKQA 4U96D 4BTAA 3R9MA 4U95D 3CVLA 4GCNA 4K5AB 2RFAA 2KXPC 2OOEA 4FC8A 2J09A 5EILA 4I17A 3HXBA 2OEVA 5AIJA 1H6OA 4EZKA 1FT1A 4WUYA 2X6IA 3S7JA 1ZU2A 1UJJA 2R17C 1N94A 5FZRA 5BW8C 3UT7A 2P9IG 3FEYA 4JC8A 3ULEG 3LVQE 3RO3A 2MYOA 4IYPA 3NZSA 3FUKA 4JW1A 3MV2B 4UWKA 1OXJA 4UUCA 1TYQG 3FU3A 3T5XA 2L9BA 3SFYA 1TJFA 1P5QA 1K3ZD 1NL4A 1OWLA 3ASHA 4DX1A 2DVWA 3CVVA 2WXRA 2WXFA 3GZ2A 2HO1A 4FLHA 1YMPA 4WWPA 4KT6B 2EQXA 3ASOE 5FWQA 3FHEA 5CMWA 4YDYA 3SFXA 4CGWA 4LNBA 4B93B 1K1AA 3B7RL 4D10C 2AVPA 1NA0A 1XNFA 4QQIA 3AG3E 3EJNA 4NIKA 1NZNA 4C48B 4W9RA 4JPSA 3GYZA 4XIFA 2EIME 4GTOA 3FFLA 3EU5A 3FU6A 5M72A 3FUDA 1TN7A 4NRHB 2LUHA 1E7UA 5BUZA 3DPDA 2DIWA 1MQSA 3AS8A 3LJ3A 2FO7A 2B0OE 3DSXA 2KBXA 1OCCE 1MJ0A 1BI8B 3LKUA 3PE3A 3LVRE 1UG3A 1UJKA 2X6JA 2EIKE 3UM0A 3QWWA 1O1RA 3BG0B 5ENTD 2NXPA 5ENPD 4J8EA 4BETA 3SI5A 4U04A 4A63B 4G11A 4YDOA 2DYSE 5A7DB 3TL5A 2VSOE 2ZU6B 2FBNA 3HXCA 4N5QA 5E76A 3UX4A 3DSUA 3OTNA 2HE0A 2X38A 2HR2A 2IU1A 3EUVA 5BXUA 2IQCA 4M7CA 4OAUC 1TEZA 4JD2G 1OWPA 2PZIA 3FUJA 5CMYA 4EBAA 1EPUA 4FADA 5EKQD 2OVBA 1OCZE 2KCLA 4G23A 2P9LG 3AG1E 4JHRA 5G05J 4F3VA 4TUUA 1WY6A 3CR3A 3T5VA 4I2ZA 5C1DA 5LP0A 3UKRG 2HYZA 3CHMA 1OCRE 3CVQA 4TXRA 1IXVA 1DVPA 3ZXPA 4FLBA 4ACLA 4U0ZA 3FTWA 3C3QA 3TAXA 3MKQB 4RG9A 3T8MA 2BTDA 1E96B 1UN8A 5JHBA 4KVMA 5E75A 3Q49B 3U66A 2Y4UA 1U3DA 4HI8A 3TWXA 1PC2A 1D8DA 4UWGA 3D9JA 5KJKA 3I4RB 2J49A 2EILE 1ELKA 3CVXA 2J07A 1FCHA 3T8KA 5JJ6A 1SQMA 2UWJG 2XS8A 1HG5A 3CHSA 4C0MA 5LCWC 3PREA 5BXOA 1E8WA 5CEDB 3N71A 1HFAA 2L0TB 5BV0A 2VGXB 3FTYA 4GMRA 1JCSA 1JUQA 2LAHA 5JMND 4KZ0A 2WB2A 3HHMA 2CG3A 5ANRA 4LG6A 3Q9UC 3FH7A 4LERA 3QAQA 2GRNB 4FHKA 4DRXE 4WWNA 4L2LA 2DBAA 4U8VD 3CHQA 1OWNA 3QOUA 3ZXSA 4GZCA 1H2TC 4CDMA 2R05A 3ML8A 4P29A 3EIQC 4A55A 1Z3YA 1K8KG 1FVHA 2WXGA 3CVNA 3S2AA 3L82A 3CLJA 3BQOA 4B8CB 2H6FA 4O1OA 3D9LA 4GU5A 3MCXA 4UI9J 4I1AA 1VDYA 5LFAA 3UMVA 5BPPA 1EF1C 2VTBB 4F53A 1H0AA 3DEPA 1G3NB 4GMJA 2EINE 3LXUX 3ABLE 1W3BA 4AJWA 5AQAA 5EDSA 1N4PA 3DXKG 3E34A 1FPPA 3PEUB 2F0YA 4HRLA 4BERA 1S64A 4ME2A 3CV0A 3FTUA 3QWPA 3TXNA 4I9CA 4UWFA 4GTVA 1SZ9A 3R7RA 2AW6A 1IYGA 1IHGA 2YHEA 3VTYA 2P9UG 4DLOA 3D9MA 3DEOA 4E85A 1NA3A 1DCQA 4GTSA 5AENA 1K1BA 3TWVA 1MX2A 5IY5E 3PH0C 3CVUA 3ZU7B 3TWUA 2ETCA 1N95A 4G1TA 3NB2A 2WQHA 4I6JA 3ZYMA 4F6RD 3G2SA 3B13A 4Q96A 2Y3AA 3NAWA 4HQDA 5KWDA 4HOSA 1N52A 4JEHA 3ENEA 2CFZA 3LY9A 3KSLA 2VSNA 4DI3A 1E8XA 4EZJA 4RQIA 4A3TA 4L7TA 5ENOD 3SY2A 3UIOC 4J8DA 4LNGA 2WMNA 1QZ2A 2R02A 2XEEA 5DBKA 3TWTA 1A17A 2GW1A 3FEXA 3ZKJA 2P9PG 3CVYA 3ZUVB 4MRUA 2NYJA 4BESA 2RFMA 1SVXA 1N54A 3S7DA 4PUCA 4TXQA 4MBGA 2GRPB 2A5UA 2XEVA 3TJPA 3DBSA 3SBTB 3UUXA 1IQRA 2QC9A 3ZHEB 2WXHA 2DZOA 5B1AE 1BPOA 2ETBA 3NQPA 1MYOA 2DCPA 4FJYA 4DX2A 3KD7A 5CBNA 4G2VA 4DJAA 2IOSA 2XCCA 1IKND 3FTSA 1NI1A 2XPYA 4N2QA 2GGFA 3L54A 3CQGB 3ABME 4GMLA 1KT1A 2C0LA 3AU5A 3DPYA 3NF1A 4JL0A 1SZAA 3Q9NC 2J8SD 3UTMA 4ANXA 5DIZA 3V31A 5J08A 3PZ1A 5ARGA 3AU4A 1IQUA 2OCCE 1Z6TA 2GRQB 2PM7A 4HRNA 4L2YA 3PVLA 2UY1B 4PS7A 3BUAA 2YHCA 2QYUA 5G04C 3MYVA 4J7WA 3B7SA 1YA0A 4DLQA 3MKRA 2WQ6A 4BEPA 5A6CA 3UXGA 2BUGA 3LY7A 4HBDA 2YNQA 4XX5A 3URZA 4B0ZA 4GYWA 3SNXA 4KZCA 3CHOA 3ZYKA 4TV3A 2OV8A 2CG2A 4AY5A 4CCAA 2ZXWE 3MX3A 2QFCA 2V4LA 3JXJA 5B3SE 2LO6A 3ZYLA 4F1PA 1N11A 4Q69A 4N3AA 4I9EA 2AXUA 3ASDA 1SW6A 3AS4A 2P9SG 3NOGD 1O1TA 2ZISA 2XEHA 4I6GA 5G2NA 2LSVA 2VQ2A 5AJDA 3TWQA 2OVFA 3OAWA 2CFUA 3P1UA 3PZ4A 5CCMA 3IEGA 4UI9K 5A23A 4EZLA 5BNWA 2A4ZA 1TNUA 3D9HA 4DPRA 4GZ5A 1KT0A 1Z5SC 5EIDA 4F1SA 2I1JA 4I6EA 4GTQA 5JA4D 2Y1LE 4K03A 3SFZA 1LD8A 4QFVA 3DSSA 3V79K 3TXMA 5FQ7A 4GYYA 2L6BA 3U9WA 4EPZA 5FQ8A 2VYIA 4I1MA 3JUIA 2BKGA 3FTVA 4AM9A 2LSUA 2KC7A 3SBSA 1E7VA 3MJWA 3D3MA 4GAAA 5EYPF 1HX8A 1HG2A 3CSFA 2B6CA 5CECB 3FU0A 4GPMA 4GA1A 3NBNB 3FP3A 4A3VA 4CDNA 2ZGGA 3CQCB 4CT0A 3HVEA 4N3BA 2BEDA 3ZEFA 3Q15A 2VSXE 3EHQA 2X3MA 1N4SA 4WNDA 4GA2A 1E8YA 3LDZA 3CK9A 4U63A 3VLDA 1JWGA 3DXMG 4N5CA 2M63A 3EIJA 4ATZD 1BU9A 1UW4B 4YVOA 4GZ3A 3C5RA 4HNAD 2KZTA 4V3IA 3MA5A 1UN9A 3TWRA 4BT9A 4UWHA 4ILGA 3K9IA 1U2VG 4LUNU 2Q7FA 4CRWA 2WXJA 3AG2E 1S0PA 3U64A 5ITZF 3AJIA 2Y0BG 1MHQA 4WNEA 3WG7E 2V5QC 5ENSD 4BSXA 4JB8P 2YQ8A 2FF4A 3F6QA 4OVUA 3C98A 3PZDA 1EDUA 4MS6A 4LCTA 4OVVA 3UM2A 1BD8A 3B95A 5FIOA 4B94A 4GCOA 3APDA 2J4DA 3V2OA 2NSZA 4OAVB 1BI7B 4X8QA 3RAUA 4K5BA 1O1SA 2XQ0A 5EYLA 4HS2A 3QC1A 2PQRA 4H7YA 3UT4A 1OWOA 2ILRA 1AP7A 1LD7A 3Q4AB 2WXNA 3L13A 1HXIA 1OY3D 3G2VA 4CEMA 4JA7A 1HS6A 3SGHA 3ZNGA 4FULA 5KJLA 1D9SA 2XRZA 3IHVA 4GTRA 2R2LA 2P58C 4C9BB 3RU0A 1QYMA 2F37A 2RG8A 1QBQA 4JVSA 5KNHD 2I6HA 3CKBA 3JQ0A 4NACA 3RSEG 4AEZC 2J9QA 2WXPA 3Q78A 4HB5A 2IO2C 3IV0A 1Y8MA 3ABKE 4EECA 4G25A 2NC9A 4JEUA 3PDNA 4DUIA 3JCKC 2GRMA 1WM5A 4OYSA 2ETAA 3WXXA 4J6IA 2XZTG 3UI2A 4U7EB 2F8XK 4PS3A 5FZSA 5CCLA 1MX6A 4LSZE 2P2CP 2QYJA 1HH8A 4HOQA 3FULA 1YYHA 1TNBA 5JJ7A 5BV1A 3FWVA 5CHEE 3AG4E 3JXIA 4APOA 4G8LA 1X5BA 2H6HA 3LY8A 2HM8A 3FTZA 2IFUA 1E90A 3CVWA 3Q75A 4FJZA 4U8HA 3R9AB 2VTBA 3ESLA 4AP2A 4N2SA 5FQ4A 4L1BA 2XPZA 3ML9A 4Y6WA 4HOUA 2XZDG 3SD5A
chains in the Genus database with same CATH topology
2JLBA 2X6JA 2WXIA 4GZDA 3RRNB 1Z6TA 2PM7A 3I5PA 4ILIA 4L2YA 3CGHA 3PVLA 4FA6A 4NQ0A 4DI4A 3QWWA 4CT4A 2UY1B 4YVQC 4PS8A 3BG0B 1FVFA 2NXPA 4PS7A 4J8EA 3HIZA 3RO2A 5JHAA 4UQZA 2KZTB 3SI5A 4MKTA 4U04A 2YHCA 2RD0A 4APFA 2UY1A 5G04C 2CHZA 4GYOA 3MYVA 4G11A 4JZYA 4HLEA 3B7SA 3G2WA 4GPKA 2XGOA 3EHNA 5A7DB 4BFRA 3TL5A 4JXTA 3FH5A 2VSOE 1YA0A 4DLQA 2ZU6B 3MKRA 2WQ6A 2FBNA 1ZBPA 3QNKA 3QJZA 3RJVA 5E76A 4MLPA 5A6CA 3UX4A 4ATGA 3BEEA 1OWMA 2BUGA 5HI7A 3GZ1A 3L22A 3OTNA 1H19A 4I2WA 1HU3A 3B7UX 3IBEA 2X38A 2I2OA 2HR2A 2WVIA 3LY7A 2IU1A 2V5FA 4BX9A 2YNQA 4XX5A 3G2UA 3URZA 4KVOA 4B0ZA 3PRZA 4I1OB 2IQCA 5ARFA 1TEZA 4GYWA 4HXIA 3SNXA 4KZCA 3CHOA 4LRZA 3ZYKA 4TV3A 4JA9A 2OV8A 1OWPA 2CG2A 2PZIA 1H6KA 4AY5A 1WAO1 1Y6IA 3FUJA 4CCAA 5CMYA 4EBAA 3MX3A 1EPUA 4FADA 3L17A 4NURA 5EKQD 2OVBA 2QFCA 2XPIA 2V4LA 2E2EA 4XKCA 2KCLA 4G23A 2LO6A 4ACKA 3ZYLA 3O4ZA 3KAEA 4JHRA 3L16A 5D0OD 5EX3A 2I9CA 5G05J 4Q69A 4F3VA 4TUUA 1WY6A 4N3AA 2L0IA 3QKYA 3CR3A 4I9EA 4XKBA 3ULQA 3T5VA 3FUNA 2AXUA 3GW4A 4I2ZA 5C1DA 3PEVB 3ASDA 5LP0A 2HYZA 2WXMA 3AS4A 3CHMA 3CVQA 3CHPA 4WNFA 3RK6A 2PM6A 4I6GA 5G2NA 2JEKA 2LSVA 3FUFA 2MOWA 3D9IA 1DVPA 3ZPJA 2VQ2A 4FLBA 5AJDA 1E8ZA 2OVFA 3KEZA 1ELWA 4ACLA 3OAWA 4FU3A 4IN3B 4U0ZA 2CFUA 3FTWA 4HOTA 4ILHB 2X6KA 3TAXA 2LNIA 3MKQB 3P1UA 4RG9A 3T8MA 3CSTA 2BTDA 5CCMA 1E96B 4FHJA 1UN8A 5JHBA 3IEGA 3QARA 4UI9K 5A23A 4H7XA 4KVMA 3Q49B 5E75A 4B89A 2Y4UA 4EZLA 2A4ZA 4IRUA 5BNWA 1U3DA 3U66A 4I43A 4DPRA 1PC2A 4LEUA 4GZ5A 1KT0A 3FDHA 3HDXA 4RSYA 4URKA 3I4GA 5EX0A 3FUHA 5C2YA 4UWGA 4F1SA 3D9JA 2I1JA 2L6JA 5KJKA 3GZSA 3I4RB 4I6EA 3S7FA 2J49A 4A1SA 1EYHA 1ELKA 3CVXA 4HORA 4XI9A 4K03A 2J07A 1FCHA 3LCAA 3RIBA 3SFZA 5JJ6A 1SQMA 2UWJG 2KCKA 1HG5A 1TJCA 3CIAA 3CHSA 4ANVA 4C0MA 4PDXA 4ANWA 2XRYA 5LCWC 3UQ3A 1OUVA 3PREA 3ZGQA 4QFVA 3ZYQA 1E8WA 5ENNA 3CK8A 3TXMA 3D9OA 4KBQA 5KJMA 3N71A 5FQ7A 1HFAA 2L0TB 4GYYA 2AXVA 1INZA 5BV0A 2FI7A 3U9WA 3FU5A 3TG4A 4A1GA 3ZW3A 2VGXB 3FTYA 4HFGA 5FQ8A 4EPZA 2VYIA 2WXKA 4I1MA 4UWLA 3JUIA 1QNFA 1JUQA 3FTVA 2LAHA 4K0RA 3RKVA 4KZ0A 2WB2A 2LSUA 3LPZA 4U07A 4U0UA 4AM9A 2KC7A 3SBSA 2WXQA 3UT8A 1E7VA 4HVBA 5HQ8A 2XHEA 3HHMA 3MJWA 4AY6A 1U3CA 2CG3A 3VLFA 3D3MA 4GAAA 5ANRA 3Q5MA 1Z3XA 3OXLA 3LS8A 1HX8A 1HG2A 3CSFA 3G2TA 3FH7A 5FT9A 3TG5A 1NP7A 3FU0A 3R7QA 1KLXA 4LERA 3QAQA 4GA1A 2X6FA 3PNTB 3FP3A 4A3VA 4CDNA 5T3RA 2R59A 3ESKA 3CQCB 4FHKA 4KMOA 4GB9A 4WWNA 3ONLA 4L2LA 1HO8A 2DBAA 3VLEA 4CT0A 4EBAG 3HVEA 3CHQA 1OWNA 4N3BA 3QOUA 3ZXSA 4AV7A 4CDRA 4WAFA 4GZCA 3ZEFA 3Q15A 4N39A 1H2TC 2VSXE 3QB2A 2FEZA 3PUJA 4EQFA 2X3MA 4CDMA 3ML8A 4WNDA 4P29A 3EIQC 4GA2A 2KCVA 1Z3YA 4A55A 3LYAA 4AXHA 1E8YA 2E0IA 3I3NA 3OXGA 3LDZA 4KYOB 5G04J 1FVHA 3CK9A 2XCBA 2WXGA 4GA0A 4U63A 3S7BA 3CVNA 3CKCA 3S2AA 3SHFA 3VLDA 2WPVA 1LF8A 1JWGA 4O6FA 4UI9C 3ASGA 3OXFA 4N5CA 4WWOA 3SZ7A 3D9NA 3CLJA 3UPVA 2M63A 2ONDA 3EIJA 2AWIA 3IKOB 1UW4B 3JYSA 4B8CB 4YVOA 3D9LA 3FUMA 4GZ3A 4GU5A 1JWFA 3EDTB 3QWVA 1QQEA 1PY1A 2KZTA 4AOFA 3FH8A 4V3IA 3MA5A 2I1KA 3MCXA 3L08A 1PAQA 4UI9J 1UN9A 4BT9A 1DNPA 4I1AA 3B7TA 1VDYA 5KCMA 4XI0A 2VJ8A 5LFAA 2KATA 4E6HA 2CHWA 3UMVA 5BPPA 1EF1C 2VTBB 3PNLB 4UWHA 4ILGA 4F53A 4Y6CA 1H0AA 3VTXA 3E4BA 3K9IA 4LUNU 4GMJA 2Q7FA 3LXUX 4CRWA 1W3BA 2WXJA 4AIFA 3IHYA 4AJWA 4J8SA 3ZVVA 5EDSA 4ANUA 1S0PA 4AVXA 1L5JA 3L6AA 3PEUB 3U64A 2IONA 4GZ6A 3CVPA 4BWRA 2PQNA 4WNGA 2V8SE 2WMOA 4XZ4A 3Q47B 1B89A 1JPLA 3CV0A 2R5SA 4ME2A 3AS5A 3ASFA 5JJTA 3TGOA 3FTUA 2IOLA 1MHQA 3QWPA 4WNEA 2VSYA 5FZQA 3TXNA 4I9CA 3FUIA 4UWFA 3NZUA 1SZ9A 4G26A 3R7RA 2C0MA 4BY6A 5BT1A 2AW6A 2WQ7A 1IYGA 3HYMB 5KJNA 1IHGA 2FULA 4BSXA 3RRUA 2YHEA 5J90A 3VTYA 1GW6A 2WXOA 2YQ8A 1H2UA 1HE8A 2FF4A 4OVUA 4DLOA 3C98A 4KXKB 5LX8A 3PZDA 4DK5A 4B8AA 3D9MA 1EDUA 4J8FA 2KM4A 4E85A 3PE4A 2XGSA 2GRLA 4LCTA 4MS6A 4OVVA 5D0QD 3U3WA 1NA3A 2MRIA 3ZN3A 5AENA 5FQ6A 4B94A 3FY4A 4GCOA 3P2BA 4BX8A 1H2VC 3APDA 2J4DA 3PH0C 5FTPA 3CVUA 2MHKA 4UQXA 2NSZA 5AJLA 3CK7A 3O48A 4G1TA 2IJGX 2WQHA 4I6JA 4Q96A 3APCA 3G2SA 3B13A 5FJYA 3ZYMA 4F7AA 2XQ0A 2Y3AA 1XGWA 4JHKA 4HS2A 2X6HA 3EHMA 3KS2A 5LCWJ 3QC1A 4HOSA 1N52A 4JEHA 3U4TA 2PQRA 3ENEA 3QDNA 4PH4B 4H7YA 2CFZA 3LY9A 3MKQA 4BTAA 3PUKA 4Q94A 3UT4A 1OWOA 2ILRA 3CVLA 2VSNA 4GCNA 3BG1B 1E8XA 4DI3A 3Q4AB 2OOEA 4FC8A 2J09A 2WXNA 3L13A 4C0EA 4EZJA 4U0SA 4I17A 1HXIA 5LOZA 4A3TA 4BT8A 2V0PA 4L7TA 3G2VA 4J8DA 3MEKA 5AIJA 1ELRA 4G24A 2C2LA 4CEMA 4EZKA 1HF8A 4JA7A 1HS6A 2J4BA 3SGHA 2WMNA 3HVEB 1QZ2A 4FULA 2XGMA 5KJLA 4WUYA 2X6IA 3S7JA 1ZU2A 5DBKA 3SF4A 2XRZA 2QY7A 1A17A 3IHVA 3LEWA 4RVBA 1UJJA 2R17C 2GW1A 5G05C 4JHJA 2P58C 5FZRA 4C9BB 5BW8C 3RU0A 3FEXA 4L23A 3UT7A 3FEYA 2IF4A 4JC8A 3LVQE 2WM9A 2RG8A 2YINA 4N3CA 4IYPA 3RO3A 3ZRHA 3D9KA 5T4YA 4JVSA 4CGVA 3CVYA 4YNDA 3NZSA 3FUKA 2I6HA 3CEQA 4JW1A 3CKBA 3JQ0A 2PL2A 3MV2B 4NACA 4UWKA 4MRUA 1HZ4A 4AEZC 3JQ1A 3ZIMA 4XE0A 2J9QA 3FU3A 3T5XA 2L9BA 1N54A 3MV3B 2WXPA 1TJFA 1P5QA 3IV0A 1Y8MA 4EECA 4G25A 3S7DA 2NC9A 4JEUA 4TRQA 4PUCA 1OWLA 3ASHA 3CVVA 3CHRA 2WXRA 2A5UA 2XEVA 3TJPA 2WXFA 3DBSA 2HO1A 3GZ2A 4FLHA 3PDNA 3SBTB 1IQRA 3UUXA 4WWPA 4RG6A 2LAIA 3JCKC 2GRMA 1WM5A 4KT6B 4OYSA 3ZHEB 2EQXA 2WXHA 3D9PA 3WXXA 4J6IA 5FWQA 1BPOA 3FHEA 5CMWA 3ONKA 3NQPA 4CGWA 3ZHEA 4ABNA 3B7RL 4D10C 4PS3A 2DCPA 5FZSA 2AVPA 5CCLA 2VGXA 4FJYA 3QK0A 1NA0A 1XNFA 4J0UA 3KD7A 2J08A 4G2VA 4DJAA 2WXLA 3EJNA 1HH8A 2IOSA 4HOQA 3FULA 1NZNA 2Y4TA 5JJ7A 2BF0X 2XCCA 3FUEA 5ANLA 4W9RA 5BV1A 3FWVA 4JPSA 3GYZA 4XIFA 5CHEE 3FTSA 4APOA 3RRMB 2CHXA 2XPYA 3FFLA 1X5BA 4N2QA 3FU6A 5M72A 3FUDA 4NRHB 2GGFA 3LY8A 5T8IA 3L54A 2HM8A 3FTZA 3CQGB 1E7UA 2IFUA 4M3OA 4GMLA 3DPDA 1E90A 1KT1A 5BUZA 2C0LA 2DIWA 3AU5A 4IULA 4R7LA 3ZFWA 3NF1A 4JL0A 1SZAA 3CVWA 1MQSA 3AS8A 3LJ3A 4FJZA 4U8HA 5AYWD 3R9AB 4BTBA 2VTBA 2FO7A 4ANXA 3ESLA 5DIZA 4AP2A 3FTXA 4N2SA 3MGBA 5FQ4A 4FP7A 4L1BA 5J08A 2VGYA 2XPZA 3ML9A 4Y6WA 5ARGA 2AXZA 5G55A 3PS6A 3LKUA 3PE3A 3AU4A 3LVRE 3MZLB 3APFA 4HOUA 4UQYA 1IQUA 1UG3A 3SD5A 1UJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZU2 A;  2JLB A;  4UI9 J;  5DBK A;  3SF4 A;  1A17 A;  4I1A A;  4BT9 A;  4XI0 A;  1PC2 A;  4LEU A;  2KAT A;  5G05 C;  2GW1 A;  4GZ5 A;  1KT0 A;  4UQY A;  2P58 C;  5FZR A;  5BW8 C;  4Y6C A;  4NQ0 A;  3QWW A;  4H7X A;  5EX0 A;  3RU0 A;  2UY1 B;  3E4B A;  3K9I A;  4YVQ C;  3VTX A;  2IF4 A;  2L6J A;  5KJK A;  2Q7F A;  3RO3 A;  4J8E A;  4N3C A;  3S7F A;  4CGV A;  3RO2 A;  4UQZ A;  1W3B A;  4WNF A;  4U04 A;  2YHC A;  4YND A;  4A1S A;  2UY1 A;  5G04 C;  4AIF A;  4GYO A;  2I6H A;  4HOR A;  3CEQ A;  4XI9 A;  3CKB A;  1FCH A;  3LCA A;  3RIB A;  4GPK A;  3MV2 B;  2PL2 A;  2XGO A;  5JJ6 A;  5A7D B;  2UWJ G;  3CVP A;  1HZ4 A;  2KCK A;  4GZ6 A;  1TJC A;  2PQN A;  4BWR A;  1YA0 A;  4WNG A;  3MKR A;  5LCW C;  2J9Q A;  3UQ3 A;  1OUV A;  2FBN A;  3ZGQ A;  3Q47 B;  1B89 A;  4ME2 A;  1ZBP A;  2R5S A;  3CV0 A;  3AS5 A;  3MV3 B;  3CK8 A;  3ASF A;  5JJT A;  1P5Q A;  3TGO A;  3RJV A;  4KBQ A;  5A6C A;  3N71 A;  3QWP A;  4WNE A;  4GYY A;  5KJM A;  1Y8M A;  2VSY A;  5FZQ A;  3BEE A;  4G25 A;  2FI7 A;  4I9C A;  3S7D A;  2NC9 A;  2BUG A;  5HI7 A;  3GZ1 A;  4G26 A;  3TG4 A;  2VGX B;  5BNW A;  5LCW J;  2C0M A;  2VYI A;  3ASH A;  5BT1 A;  4I2W A;  2XEV A;  3GZ2 A;  1IYG A;  2HO1 A;  3HYM B;  5KJN A;  1IHG A;  3PDN A;  3UUX A;  2HR2 A;  3LY7 A;  4RG6 A;  2V5F A;  3RKV A;  3VTY A;  2YQ8 A;  1WM5 A;  2LSU A;  3LPZ A;  2FF4 A;  4U07 A;  4U0U A;  2KC7 A;  3URZ A;  3ZHE B;  4KXK B;  4AM9 A;  5HQ8 A;  3WXX A;  4AY6 A;  5ARF A;  3Q5M A;  4J8F A;  4GYW A;  3OXL A;  3PE4 A;  2XGS A;  4CGW A;  5D0Q D;  3U3W A;  3ZHE A;  4ABN A;  4JA9 A;  1NA3 A;  5FT9 A;  3TG5 A;  3ZN3 A;  5FZS A;  2AVP A;  2PZI A;  4AY5 A;  5CCL A;  2VGX A;  1WAO 1;  4B94 A;  1NA0 A;  1KLX A;  1XNF A;  4GCO A;  5G04 J;  4GA1 A;  4J0U A;  5FTP A;  5EKQ D;  3KD7 A;  3FP3 A;  2MHK A;  2QFC A;  3ESK A;  4G2V A;  4UQX A;  2XPI A;  2E2E A;  1HH8 A;  3CK7 A;  2KCL A;  3O48 A;  4G23 A;  4HOQ A;  1NZN A;  2Y4T A;  4G1T A;  5JJ7 A;  2XCC A;  2WQH A;  3KAE A;  2DBA A;  5FJY A;  4JHR A;  5EX3 A;  5D0O D;  4W9R A;  3FWV A;  5G05 J;  3GYZ A;  4N3B A;  3QOU A;  4XIF A;  4F3V A;  4CDR A;  4N3A A;  5CHE E;  3QKY A;  3ULQ A;  4I9E A;  3Q15 A;  4N39 A;  3KS2 A;  4APO A;  4HOS A;  3FFL A;  2FEZ A;  3GW4 A;  4I2Z A;  3U4T A;  2PQR A;  3ASD A;  3QDN A;  4EQF A;  5C1D A;  4WND A;  4H7Y A;  3LY9 A;  4BTA A;  4N2Q A;  4GA2 A;  2HYZ A;  2KCV A;  3AS4 A;  5M72 A;  3CVQ A;  4NRH B;  3LY8 A;  3LYA A;  3OXG A;  4KYO B;  2IFU A;  2VSN A;  3CVL A;  1KT1 A;  3CK9 A;  2XCB A;  4GCN A;  4GA0 A;  2C0L A;  2LSV A;  3S7B A;  3ZFW A;  3CVN A;  3CKC A;  3NF1 A;  3Q4A B;  2OOE A;  4JL0 A;  2VQ2 A;  2WPV A;  3ZPJ A;  3AS8 A;  4BTB A;  4O6F A;  3R9A B;  5AYW D;  4U0S A;  4UI9 C;  3ASG A;  3OXF A;  1HXI A;  2FO7 A;  4I17 A;  4N5C A;  3SZ7 A;  4BT8 A;  1ELW A;  5DIZ A;  5KJL A;  4IN3 B;  2OND A;  4U0Z A;  3UPV A;  4N2S A;  3JYS A;  4HOT A;  4YVO A;  4J8D A;  3MEK A;  3TAX A;  1ELR A;  2LNI A;  2C2L A;  2VGY A;  4G24 A;  4GZ3 A;  4RG9 A;  5CCM A;  4JA7 A;  4Y6W A;  5ARG A;  3EDT B;  3QWV A;  1QQE A;  1E96 B;  3LKU A;  3PE3 A;  3IEG A;  1QZ2 A;  4UI9 K;  4HOU A;  2XGM A;  3MA5 A;  3Q49 B;  4WUY A;  2Y4U A;  3S7J A; 
#chains in the Genus database with same CATH topology
 4GZD A;  4ILI A;  3I5P A;  5KBA A;  1WG0 A;  1UOH A;  3CGH A;  4DI4 A;  4CT4 A;  4YVQ C;  4PS8 A;  3LJN A;  1FVF A;  3HIZ A;  3RO2 A;  4UQZ A;  2KZT B;  4APF A;  2RD0 A;  4TXP A;  1LTX A;  4JZY A;  4HLE A;  4GPK A;  3G2W A;  2XGO A;  3EHN A;  4BFR A;  4JXT A;  4O60 A;  1H6P A;  3QNK A;  3QJZ A;  5KNG A;  3BEE A;  1OWM A;  3PZ2 A;  1HU3 A;  3IBE A;  4O1P A;  2GRO B;  2WVI A;  2V5F A;  3G2U A;  3PRZ A;  2ZIR A;  4EHM A;  4HXI A;  4JA9 A;  1WAO 1;  1Y6I A;  2XPI A;  1MX4 A;  4XKC A;  2OEW A;  4ACK A;  3UM3 A;  3O4Z A;  3KAE A;  5EX3 A;  1SA5 A;  4XKB A;  1O5M A;  3FUN A;  3GW4 A;  2WXM A;  3CHP A;  2MOW A;  2IEJ A;  4YDW A;  4Z68 A;  1JCR A;  3E33 A;  1ELW A;  4FU3 A;  1TN6 A;  4ILH B;  5AAR A;  3CST A;  1RZ4 A;  1FT2 A;  4I43 A;  5FIN A;  4LEU A;  3HDX A;  3I4G A;  5C2Y A;  3W9F A;  2L6J A;  5HRY A;  3GZS A;  3S7F A;  4A1S A;  1EYH A;  2VGE A;  5ENR D;  1N0Q A;  3RIB A;  5AAO A;  1TJC A;  4HI9 A;  4ANV A;  3Q73 A;  2XRY A;  4GTP A;  3UQ3 A;  3ZGQ A;  3ZYQ A;  3W9G A;  3CK8 A;  3D9O A;  4TUM A;  3FU5 A;  1SA4 A;  3TG4 A;  3ZW3 A;  5LCW J;  2WXK A;  4UWL A;  2A5E A;  4K0R A;  3LPZ A;  2WXQ A;  2XHE A;  3AAA C;  1U3C A;  1Z3X A;  3OXL A;  3LS8 A;  5AQB A;  3G2T A;  1NP7 A;  3R7Q A;  3ISM C;  4U8Y D;  5AN8 A;  1S63 A;  5T3R A;  2R59 A;  4KMO A;  1WDY A;  4GB9 A;  5H7P A;  3ONL A;  1HO8 A;  4J8Y A;  3VLE A;  2R03 A;  4AV7 A;  3BU8 A;  3SQV A;  4N39 A;  3QB2 A;  2KCV A;  1JCQ A;  4AXH A;  3UIN C;  2E0I A;  3I3N A;  5G04 J;  2XCB A;  2WPV A;  1LF8 A;  3SZ7 A;  3ASG A;  3D9N A;  3J5P A;  2OND A;  3IKO B;  3JYS A;  3C72 A;  2XS1 A;  1JWF A;  1N0R A;  3C3R A;  2I1K A;  3L08 A;  1PAQ A;  1D8E A;  1DNP A;  5KCM A;  4XI0 A;  4E6H A;  3PNL B;  4Y6C A;  3HXF A;  3VTX A;  4ANU A;  4AVX A;  5AQ9 A;  1L5J A;  3L6A A;  4GZ6 A;  3CVP A;  1N4R A;  2PQN A;  2V8S E;  4XZ4 A;  1B89 A;  2R5S A;  3AS5 A;  3C3O A;  2VSY A;  5FZQ A;  3FUI A;  2QZA A;  4G26 A;  3HXD A;  5BT1 A;  3HG0 D;  3HYM B;  3EU9 A;  5KJN A;  2FUL A;  3RRU A;  2WXO A;  4LNU D;  1HE8 A;  1Q2Z A;  4J8F A;  2KM4 A;  1V55 E;  2XGS A;  2BKK B;  2GRL A;  4GTM A;  4G8K A;  3UIP C;  5FQ6 A;  3FY4 A;  3P2B A;  4BX8 A;  1H2V C;  5FTP A;  1AWC B;  3CK7 A;  3O48 A;  1TN8 A;  2IJG X;  4F7A A;  3UKU G;  4DX7 D;  3ULY A;  3V2X A;  3QDN A;  3PUK A;  4Q94 A;  3BG1 B;  1S70 B;  4C0E A;  4CYM D;  4U0S A;  2DYR E;  5LOZ A;  4BT8 A;  2V0P A;  2PNN A;  5CBO A;  3MEK A;  1ELR A;  4G24 A;  2C2L A;  1HF8 A;  3KEA A;  3NOC D;  2J4B A;  3HVE B;  2XGM A;  3SF4 A;  2QY7 A;  1KPS B;  3LEW A;  4RVB A;  5G05 C;  4JHJ A;  1N9A A;  4L23 A;  2H6G A;  2IF4 A;  2WM9 A;  2YIN A;  4N3C A;  3ZRH A;  4CGV A;  3D9K A;  5T4Y A;  4YND A;  1X81 A;  3CEQ A;  2PL2 A;  1HZ4 A;  3JQ1 A;  3ZIM A;  4XE0 A;  3MV3 B;  3Q7A A;  2V4H C;  4TRQ A;  4L9P A;  3CHR A;  4RG6 A;  2LAI A;  3D9P A;  3PZ3 A;  3ONK A;  4BSZ B;  3ZHE A;  2LXM A;  4ABN A;  5EN5 D;  2VGX A;  3QK0 A;  4J0U A;  5D66 A;  3TWS A;  1OCO E;  2J08 A;  3IXE A;  2WXL A;  2RKK A;  4DX5 D;  2Y4T A;  2BF0 X;  3V30 A;  3FUE A;  5ANL A;  3KSQ A;  2P9N G;  3RRM B;  2CHX A;  4HRM B;  3X2Q E;  5T8I A;  3SO8 A;  1OT8 A;  4M3O A;  3ZFW A;  4IUL A;  3L9T A;  4R7L A;  1V54 E;  4BTB A;  5AYW D;  4YDE A;  5CRV A;  3FTX A;  5AQ7 A;  3JUE A;  3MGB A;  4FP7 A;  4HLL A;  2VGY A;  2AXZ A;  5G55 A;  3PS6 A;  3MZL B;  3APF A;  4UQY A;  2JLB A;  2WXI A;  2Y69 E;  3RRN B;  2IY0 C;  4FA6 A;  4NQ0 A;  3J5Q B;  5JHA A;  5EIB E;  4MKT A;  2UY1 A;  2CHZ A;  4GYO A;  1TNZ A;  3FH5 A;  5CRU A;  1ZBP A;  2AJA A;  1DCE A;  3RJV A;  4MLP A;  4ATG A;  5D2M C;  5HI7 A;  3GZ1 A;  3L22 A;  5B1B E;  1H19 A;  4I2W A;  3B7U X;  4RLY A;  2I2O A;  5CER B;  1MZC A;  4BX9 A;  1IHB A;  4KVO A;  4I1O B;  3DSV A;  5ARF A;  2GRR B;  4LRZ A;  1H6K A;  3HRA A;  3L17 A;  4NUR A;  1NFI E;  2E2E A;  1TNY A;  2IO3 C;  3L16 A;  5D0O D;  2I9C A;  3ULQ A;  2L0I A;  3QKY A;  1A5E A;  3PEV B;  1KZO A;  4WNF A;  3RK6 A;  2PM6 A;  2JEK A;  3FUF A;  3D9I A;  3ZPJ A;  3TWW A;  2LXL A;  1RW2 A;  1E8Z A;  3KEZ A;  3EHR A;  1TNO A;  4IN3 B;  4HOT A;  2X6K A;  2LNI A;  4K5C A;  4FHJ A;  3QAR A;  4H7X A;  3E30 A;  4B89 A;  4IRU A;  2P9K G;  1DC2 A;  1TR4 A;  3FDH A;  4RSY A;  4URK A;  5EX0 A;  3FUH A;  3DSW A;  2ZGD A;  4HOR A;  4XI9 A;  3LCA A;  2DWZ A;  2KCK A;  3CIA A;  4PDX A;  4ANW A;  3B7B A;  1OUV A;  5ENN A;  2FO1 E;  4KBQ A;  5KJM A;  1INZ A;  2AXV A;  1KZP A;  2FI7 A;  4A1G A;  4HFG A;  1QNF A;  3RKV A;  4CZ2 D;  4U0U A;  4U07 A;  2EIJ E;  3UT8 A;  5HQ8 A;  4HVB A;  4AY6 A;  3VLF A;  3Q5M A;  4XEI G;  1N4Q A;  5FT9 A;  3TG5 A;  1KLX A;  2X6F A;  3PNT B;  5HS0 A;  3ESK A;  2DZN A;  3DST A;  4GTT A;  4EBA G;  4CDR A;  4WAF A;  2FEZ A;  3PUJ A;  3T9K A;  4EQF A;  3DRA A;  1BLX B;  3LYA A;  1ZB1 A;  3OXG A;  4KYO B;  3S7B A;  4GA0 A;  4ZHB A;  3CKC A;  3SHF A;  2F8Y A;  4O6F A;  4UI9 C;  3OXF A;  4WWO A;  3UPV A;  2AWI A;  3FUM A;  3EDT B;  3QWV A;  1QQE A;  1PY1 A;  4AOF A;  3FH8 A;  2JAB A;  3B7T A;  3DWL G;  2VJ8 A;  2KAT A;  5ENQ D;  2CHW A;  5HKP A;  3UM1 A;  3E4B A;  4AIF A;  3IHY A;  4J8S A;  3ZVV A;  3E32 A;  2ION A;  3Q79 A;  4BWR A;  4WNG A;  2WMO A;  3Q47 B;  1JPL A;  3Q7F A;  3ASF A;  5JJT A;  3TGO A;  2IOL A;  4ZFH A;  3NZU A;  2C0M A;  3ASN E;  4BY6 A;  2WQ7 A;  1YCS B;  5J90 A;  1GW6 A;  3HXE A;  1H2U A;  2H6I A;  5LX8 A;  4KXK B;  4DK5 A;  4B8A A;  3PE4 A;  3U3W A;  5D0Q D;  2MRI A;  3ZN3 A;  5CEA A;  2MHK A;  4UQX A;  5AJL A;  3E37 A;  3APC A;  5FJY A;  1XGW A;  4JHK A;  4DX6 D;  2X6H A;  3EHM A;  2XEN A;  3KS2 A;  3U4T A;  4PH4 B;  3MKQ A;  4U96 D;  4BTA A;  3R9M A;  4U95 D;  3CVL A;  4GCN A;  4K5A B;  2RFA A;  2KXP C;  2OOE A;  4FC8 A;  2J09 A;  5EIL A;  4I17 A;  3HXB A;  2OEV A;  5AIJ A;  1H6O A;  4EZK A;  1FT1 A;  4WUY A;  2X6I A;  3S7J A;  1ZU2 A;  1UJJ A;  2R17 C;  1N94 A;  5FZR A;  5BW8 C;  3UT7 A;  2P9I G;  3FEY A;  4JC8 A;  3ULE G;  3LVQ E;  3RO3 A;  2MYO A;  4IYP A;  3NZS A;  3FUK A;  4JW1 A;  3MV2 B;  4UWK A;  1OXJ A;  4UUC A;  1TYQ G;  3FU3 A;  3T5X A;  2L9B A;  3SFY A;  1TJF A;  1P5Q A;  1K3Z D;  1NL4 A;  1OWL A;  3ASH A;  4DX1 A;  2DVW A;  3CVV A;  2WXR A;  2WXF A;  3GZ2 A;  2HO1 A;  4FLH A;  1YMP A;  4WWP A;  4KT6 B;  2EQX A;  3ASO E;  5FWQ A;  3FHE A;  5CMW A;  4YDY A;  3SFX A;  4CGW A;  4LNB A;  4B93 B;  1K1A A;  3B7R L;  4D10 C;  2AVP A;  1NA0 A;  1XNF A;  4QQI A;  3AG3 E;  3EJN A;  4NIK A;  1NZN A;  4C48 B;  4W9R A;  4JPS A;  3GYZ A;  4XIF A;  2EIM E;  4GTO A;  3FFL A;  3EU5 A;  3FU6 A;  5M72 A;  3FUD A;  1TN7 A;  4NRH B;  2LUH A;  1E7U A;  5BUZ A;  3DPD A;  2DIW A;  1MQS A;  3AS8 A;  3LJ3 A;  2FO7 A;  2B0O E;  3DSX A;  2KBX A;  1OCC E;  1MJ0 A;  1BI8 B;  3LKU A;  3PE3 A;  3LVR E;  1UG3 A;  1UJK A;  2X6J A;  2EIK E;  3UM0 A;  3QWW A;  1O1R A;  3BG0 B;  5ENT D;  2NXP A;  5ENP D;  4J8E A;  4BET A;  3SI5 A;  4U04 A;  4A63 B;  4G11 A;  4YDO A;  2DYS E;  5A7D B;  3TL5 A;  2VSO E;  2ZU6 B;  2FBN A;  3HXC A;  4N5Q A;  5E76 A;  3UX4 A;  3DSU A;  3OTN A;  2HE0 A;  2X38 A;  2HR2 A;  2IU1 A;  3EUV A;  5BXU A;  2IQC A;  4M7C A;  4OAU C;  1TEZ A;  4JD2 G;  1OWP A;  2PZI A;  3FUJ A;  5CMY A;  4EBA A;  1EPU A;  4FAD A;  5EKQ D;  2OVB A;  1OCZ E;  2KCL A;  4G23 A;  2P9L G;  3AG1 E;  4JHR A;  5G05 J;  4F3V A;  4TUU A;  1WY6 A;  3CR3 A;  3T5V A;  4I2Z A;  5C1D A;  5LP0 A;  3UKR G;  2HYZ A;  3CHM A;  1OCR E;  3CVQ A;  4TXR A;  1IXV A;  1DVP A;  3ZXP A;  4FLB A;  4ACL A;  4U0Z A;  3FTW A;  3C3Q A;  3TAX A;  3MKQ B;  4RG9 A;  3T8M A;  2BTD A;  1E96 B;  1UN8 A;  5JHB A;  4KVM A;  5E75 A;  3Q49 B;  3U66 A;  2Y4U A;  1U3D A;  4HI8 A;  3TWX A;  1PC2 A;  1D8D A;  4UWG A;  3D9J A;  5KJK A;  3I4R B;  2J49 A;  2EIL E;  1ELK A;  3CVX A;  2J07 A;  1FCH A;  3T8K A;  5JJ6 A;  1SQM A;  2UWJ G;  2XS8 A;  1HG5 A;  3CHS A;  4C0M A;  5LCW C;  3PRE A;  5BXO A;  1E8W A;  5CED B;  3N71 A;  1HFA A;  2L0T B;  5BV0 A;  2VGX B;  3FTY A;  4GMR A;  1JCS A;  1JUQ A;  2LAH A;  5JMN D;  4KZ0 A;  2WB2 A;  3HHM A;  2CG3 A;  5ANR A;  4LG6 A;  3Q9U C;  3FH7 A;  4LER A;  3QAQ A;  2GRN B;  4FHK A;  4DRX E;  4WWN A;  4L2L A;  2DBA A;  4U8V D;  3CHQ A;  1OWN A;  3QOU A;  3ZXS A;  4GZC A;  1H2T C;  4CDM A;  2R05 A;  3ML8 A;  4P29 A;  3EIQ C;  4A55 A;  1Z3Y A;  1K8K G;  1FVH A;  2WXG A;  3CVN A;  3S2A A;  3L82 A;  3CLJ A;  3BQO A;  4B8C B;  2H6F A;  4O1O A;  3D9L A;  4GU5 A;  3MCX A;  4UI9 J;  4I1A A;  1VDY A;  5LFA A;  3UMV A;  5BPP A;  1EF1 C;  2VTB B;  4F53 A;  1H0A A;  3DEP A;  1G3N B;  4GMJ A;  2EIN E;  3LXU X;  3ABL E;  1W3B A;  4AJW A;  5AQA A;  5EDS A;  1N4P A;  3DXK G;  3E34 A;  1FPP A;  3PEU B;  2F0Y A;  4HRL A;  4BER A;  1S64 A;  4ME2 A;  3CV0 A;  3FTU A;  3QWP A;  3TXN A;  4I9C A;  4UWF A;  4GTV A;  1SZ9 A;  3R7R A;  2AW6 A;  1IYG A;  1IHG A;  2YHE A;  3VTY A;  2P9U G;  4DLO A;  3D9M A;  3DEO A;  4E85 A;  1NA3 A;  1DCQ A;  4GTS A;  5AEN A;  1K1B A;  3TWV A;  1MX2 A;  5IY5 E;  3PH0 C;  3CVU A;  3ZU7 B;  3TWU A;  2ETC A;  1N95 A;  4G1T A;  3NB2 A;  2WQH A;  4I6J A;  3ZYM A;  4F6R D;  3G2S A;  3B13 A;  4Q96 A;  2Y3A A;  3NAW A;  4HQD A;  5KWD A;  4HOS A;  1N52 A;  4JEH A;  3ENE A;  2CFZ A;  3LY9 A;  3KSL A;  2VSN A;  4DI3 A;  1E8X A;  4EZJ A;  4RQI A;  4A3T A;  4L7T A;  5ENO D;  3SY2 A;  3UIO C;  4J8D A;  4LNG A;  2WMN A;  1QZ2 A;  2R02 A;  2XEE A;  5DBK A;  3TWT A;  1A17 A;  2GW1 A;  3FEX A;  3ZKJ A;  2P9P G;  3CVY A;  3ZUV B;  4MRU A;  2NYJ A;  4BES A;  2RFM A;  1SVX A;  1N54 A;  3S7D A;  4PUC A;  4TXQ A;  4MBG A;  2GRP B;  2A5U A;  2XEV A;  3TJP A;  3DBS A;  3SBT B;  3UUX A;  1IQR A;  2QC9 A;  3ZHE B;  2WXH A;  2DZO A;  5B1A E;  1BPO A;  2ETB A;  3NQP A;  1MYO A;  2DCP A;  4FJY A;  4DX2 A;  3KD7 A;  5CBN A;  4G2V A;  4DJA A;  2IOS A;  2XCC A;  1IKN D;  3FTS A;  1NI1 A;  2XPY A;  4N2Q A;  2GGF A;  3L54 A;  3CQG B;  3ABM E;  4GML A;  1KT1 A;  2C0L A;  3AU5 A;  3DPY A;  3NF1 A;  4JL0 A;  1SZA A;  3Q9N C;  2J8S D;  3UTM A;  4ANX A;  5DIZ A;  3V31 A;  5J08 A;  3PZ1 A;  5ARG A;  3AU4 A;  1IQU A;  2OCC E;  1Z6T A;  2GRQ B;  2PM7 A;  4HRN A;  4L2Y A;  3PVL A;  2UY1 B;  4PS7 A;  3BUA A;  2YHC A;  2QYU A;  5G04 C;  3MYV A;  4J7W A;  3B7S A;  1YA0 A;  4DLQ A;  3MKR A;  2WQ6 A;  4BEP A;  5A6C A;  3UXG A;  2BUG A;  3LY7 A;  4HBD A;  2YNQ A;  4XX5 A;  3URZ A;  4B0Z A;  4GYW A;  3SNX A;  4KZC A;  3CHO A;  3ZYK A;  4TV3 A;  2OV8 A;  2CG2 A;  4AY5 A;  4CCA A;  2ZXW E;  3MX3 A;  2QFC A;  2V4L A;  3JXJ A;  5B3S E;  2LO6 A;  3ZYL A;  4F1P A;  1N11 A;  4Q69 A;  4N3A A;  4I9E A;  2AXU A;  3ASD A;  1SW6 A;  3AS4 A;  2P9S G;  3NOG D;  1O1T A;  2ZIS A;  2XEH A;  4I6G A;  5G2N A;  2LSV A;  2VQ2 A;  5AJD A;  3TWQ A;  2OVF A;  3OAW A;  2CFU A;  3P1U A;  3PZ4 A;  5CCM A;  3IEG A;  4UI9 K;  5A23 A;  4EZL A;  5BNW A;  2A4Z A;  1TNU A;  3D9H A;  4DPR A;  4GZ5 A;  1KT0 A;  1Z5S C;  5EID A;  4F1S A;  2I1J A;  4I6E A;  4GTQ A;  5JA4 D;  2Y1L E;  4K03 A;  3SFZ A;  1LD8 A;  4QFV A;  3DSS A;  3V79 K;  3TXM A;  5FQ7 A;  4GYY A;  2L6B A;  3U9W A;  4EPZ A;  5FQ8 A;  2VYI A;  4I1M A;  3JUI A;  2BKG A;  3FTV A;  4AM9 A;  2LSU A;  2KC7 A;  3SBS A;  1E7V A;  3MJW A;  3D3M A;  4GAA A;  5EYP F;  1HX8 A;  1HG2 A;  3CSF A;  2B6C A;  5CEC B;  3FU0 A;  4GPM A;  4GA1 A;  3NBN B;  3FP3 A;  4A3V A;  4CDN A;  2ZGG A;  3CQC B;  4CT0 A;  3HVE A;  4N3B A;  2BED A;  3ZEF A;  3Q15 A;  2VSX E;  3EHQ A;  2X3M A;  1N4S A;  4WND A;  4GA2 A;  1E8Y A;  3LDZ A;  3CK9 A;  4U63 A;  3VLD A;  1JWG A;  3DXM G;  4N5C A;  2M63 A;  3EIJ A;  4ATZ D;  1BU9 A;  1UW4 B;  4YVO A;  4GZ3 A;  3C5R A;  4HNA D;  2KZT A;  4V3I A;  3MA5 A;  1UN9 A;  3TWR A;  4BT9 A;  4UWH A;  4ILG A;  3K9I A;  1U2V G;  4LUN U;  2Q7F A;  4CRW A;  2WXJ A;  3AG2 E;  1S0P A;  3U64 A;  5ITZ F;  3AJI A;  2Y0B G;  1MHQ A;  4WNE A;  3WG7 E;  2V5Q C;  5ENS D;  4BSX A;  4JB8 P;  2YQ8 A;  2FF4 A;  3F6Q A;  4OVU A;  3C98 A;  3PZD A;  1EDU A;  4MS6 A;  4LCT A;  4OVV A;  3UM2 A;  1BD8 A;  3B95 A;  5FIO A;  4B94 A;  4GCO A;  3APD A;  2J4D A;  3V2O A;  2NSZ A;  4OAV B;  1BI7 B;  4X8Q A;  3RAU A;  4K5B A;  1O1S A;  2XQ0 A;  5EYL A;  4HS2 A;  3QC1 A;  2PQR A;  4H7Y A;  3UT4 A;  1OWO A;  2ILR A;  1AP7 A;  1LD7 A;  3Q4A B;  2WXN A;  3L13 A;  1HXI A;  1OY3 D;  3G2V A;  4CEM A;  4JA7 A;  1HS6 A;  3SGH A;  3ZNG A;  4FUL A;  5KJL A;  1D9S A;  2XRZ A;  3IHV A;  4GTR A;  2R2L A;  2P58 C;  4C9B B;  3RU0 A;  1QYM A;  2F37 A;  2RG8 A;  1QBQ A;  4JVS A;  5KNH D;  2I6H A;  3CKB A;  3JQ0 A;  4NAC A;  3RSE G;  4AEZ C;  2J9Q A;  2WXP A;  3Q78 A;  4HB5 A;  2IO2 C;  3IV0 A;  1Y8M A;  3ABK E;  4EEC A;  4G25 A;  2NC9 A;  4JEU A;  3PDN A;  4DUI A;  3JCK C;  2GRM A;  1WM5 A;  4OYS A;  2ETA A;  3WXX A;  4J6I A;  2XZT G;  3UI2 A;  4U7E B;  2F8X K;  4PS3 A;  5FZS A;  5CCL A;  1MX6 A;  4LSZ E;  2P2C P;  2QYJ A;  1HH8 A;  4HOQ A;  3FUL A;  1YYH A;  1TNB A;  5JJ7 A;  5BV1 A;  3FWV A;  5CHE E;  3AG4 E;  3JXI A;  4APO A;  4G8L A;  1X5B A;  2H6H A;  3LY8 A;  2HM8 A;  3FTZ A;  2IFU A;  1E90 A;  3CVW A;  3Q75 A;  4FJZ A;  4U8H A;  3R9A B;  2VTB A;  3ESL A;  4AP2 A;  4N2S A;  5FQ4 A;  4L1B A;  2XPZ A;  3ML9 A;  4Y6W A;  4HOU A;  2XZD G;  3SD5 A; 
#chains in the Genus database with same CATH homology
 2JLB A;  2X6J A;  2WXI A;  4GZD A;  3RRN B;  1Z6T A;  2PM7 A;  3I5P A;  4ILI A;  4L2Y A;  3CGH A;  3PVL A;  4FA6 A;  4NQ0 A;  4DI4 A;  3QWW A;  4CT4 A;  2UY1 B;  4YVQ C;  4PS8 A;  3BG0 B;  1FVF A;  2NXP A;  4PS7 A;  4J8E A;  3HIZ A;  3RO2 A;  5JHA A;  4UQZ A;  2KZT B;  3SI5 A;  4MKT A;  4U04 A;  2YHC A;  2RD0 A;  4APF A;  2UY1 A;  5G04 C;  2CHZ A;  4GYO A;  3MYV A;  4G11 A;  4JZY A;  4HLE A;  3B7S A;  3G2W A;  4GPK A;  2XGO A;  3EHN A;  5A7D B;  4BFR A;  3TL5 A;  4JXT A;  3FH5 A;  2VSO E;  1YA0 A;  4DLQ A;  2ZU6 B;  3MKR A;  2WQ6 A;  2FBN A;  1ZBP A;  3QNK A;  3QJZ A;  3RJV A;  5E76 A;  4MLP A;  5A6C A;  3UX4 A;  4ATG A;  3BEE A;  1OWM A;  2BUG A;  5HI7 A;  3GZ1 A;  3L22 A;  3OTN A;  1H19 A;  4I2W A;  1HU3 A;  3B7U X;  3IBE A;  2X38 A;  2I2O A;  2HR2 A;  2WVI A;  3LY7 A;  2IU1 A;  2V5F A;  4BX9 A;  2YNQ A;  4XX5 A;  3G2U A;  3URZ A;  4KVO A;  4B0Z A;  3PRZ A;  4I1O B;  2IQC A;  5ARF A;  1TEZ A;  4GYW A;  4HXI A;  3SNX A;  4KZC A;  3CHO A;  4LRZ A;  3ZYK A;  4TV3 A;  4JA9 A;  2OV8 A;  1OWP A;  2CG2 A;  2PZI A;  1H6K A;  4AY5 A;  1WAO 1;  1Y6I A;  3FUJ A;  4CCA A;  5CMY A;  4EBA A;  3MX3 A;  1EPU A;  4FAD A;  3L17 A;  4NUR A;  5EKQ D;  2OVB A;  2QFC A;  2XPI A;  2V4L A;  2E2E A;  4XKC A;  2KCL A;  4G23 A;  2LO6 A;  4ACK A;  3ZYL A;  3O4Z A;  3KAE A;  4JHR A;  3L16 A;  5D0O D;  5EX3 A;  2I9C A;  5G05 J;  4Q69 A;  4F3V A;  4TUU A;  1WY6 A;  4N3A A;  2L0I A;  3QKY A;  3CR3 A;  4I9E A;  4XKB A;  3ULQ A;  3T5V A;  3FUN A;  2AXU A;  3GW4 A;  4I2Z A;  5C1D A;  3PEV B;  3ASD A;  5LP0 A;  2HYZ A;  2WXM A;  3AS4 A;  3CHM A;  3CVQ A;  3CHP A;  4WNF A;  3RK6 A;  2PM6 A;  4I6G A;  5G2N A;  2JEK A;  2LSV A;  3FUF A;  2MOW A;  3D9I A;  1DVP A;  3ZPJ A;  2VQ2 A;  4FLB A;  5AJD A;  1E8Z A;  2OVF A;  3KEZ A;  1ELW A;  4ACL A;  3OAW A;  4FU3 A;  4IN3 B;  4U0Z A;  2CFU A;  3FTW A;  4HOT A;  4ILH B;  2X6K A;  3TAX A;  2LNI A;  3MKQ B;  3P1U A;  4RG9 A;  3T8M A;  3CST A;  2BTD A;  5CCM A;  1E96 B;  4FHJ A;  1UN8 A;  5JHB A;  3IEG A;  3QAR A;  4UI9 K;  5A23 A;  4H7X A;  4KVM A;  3Q49 B;  5E75 A;  4B89 A;  2Y4U A;  4EZL A;  2A4Z A;  4IRU A;  5BNW A;  1U3D A;  3U66 A;  4I43 A;  4DPR A;  1PC2 A;  4LEU A;  4GZ5 A;  1KT0 A;  3FDH A;  3HDX A;  4RSY A;  4URK A;  3I4G A;  5EX0 A;  3FUH A;  5C2Y A;  4UWG A;  4F1S A;  3D9J A;  2I1J A;  2L6J A;  5KJK A;  3GZS A;  3I4R B;  4I6E A;  3S7F A;  2J49 A;  4A1S A;  1EYH A;  1ELK A;  3CVX A;  4HOR A;  4XI9 A;  4K03 A;  2J07 A;  1FCH A;  3LCA A;  3RIB A;  3SFZ A;  5JJ6 A;  1SQM A;  2UWJ G;  2KCK A;  1HG5 A;  1TJC A;  3CIA A;  3CHS A;  4ANV A;  4C0M A;  4PDX A;  4ANW A;  2XRY A;  5LCW C;  3UQ3 A;  1OUV A;  3PRE A;  3ZGQ A;  4QFV A;  3ZYQ A;  1E8W A;  5ENN A;  3CK8 A;  3TXM A;  3D9O A;  4KBQ A;  5KJM A;  3N71 A;  5FQ7 A;  1HFA A;  2L0T B;  4GYY A;  2AXV A;  1INZ A;  5BV0 A;  2FI7 A;  3U9W A;  3FU5 A;  3TG4 A;  4A1G A;  3ZW3 A;  2VGX B;  3FTY A;  4HFG A;  5FQ8 A;  4EPZ A;  2VYI A;  2WXK A;  4I1M A;  4UWL A;  3JUI A;  1QNF A;  1JUQ A;  3FTV A;  2LAH A;  4K0R A;  3RKV A;  4KZ0 A;  2WB2 A;  2LSU A;  3LPZ A;  4U07 A;  4U0U A;  4AM9 A;  2KC7 A;  3SBS A;  2WXQ A;  3UT8 A;  1E7V A;  4HVB A;  5HQ8 A;  2XHE A;  3HHM A;  3MJW A;  4AY6 A;  1U3C A;  2CG3 A;  3VLF A;  3D3M A;  4GAA A;  5ANR A;  3Q5M A;  1Z3X A;  3OXL A;  3LS8 A;  1HX8 A;  1HG2 A;  3CSF A;  3G2T A;  3FH7 A;  5FT9 A;  3TG5 A;  1NP7 A;  3FU0 A;  3R7Q A;  1KLX A;  4LER A;  3QAQ A;  4GA1 A;  2X6F A;  3PNT B;  3FP3 A;  4A3V A;  4CDN A;  5T3R A;  2R59 A;  3ESK A;  3CQC B;  4FHK A;  4KMO A;  4GB9 A;  4WWN A;  3ONL A;  4L2L A;  1HO8 A;  2DBA A;  3VLE A;  4CT0 A;  4EBA G;  3HVE A;  3CHQ A;  1OWN A;  4N3B A;  3QOU A;  3ZXS A;  4AV7 A;  4CDR A;  4WAF A;  4GZC A;  3ZEF A;  3Q15 A;  4N39 A;  1H2T C;  2VSX E;  3QB2 A;  2FEZ A;  3PUJ A;  4EQF A;  2X3M A;  4CDM A;  3ML8 A;  4WND A;  4P29 A;  3EIQ C;  4GA2 A;  2KCV A;  1Z3Y A;  4A55 A;  3LYA A;  4AXH A;  1E8Y A;  2E0I A;  3I3N A;  3OXG A;  3LDZ A;  4KYO B;  5G04 J;  1FVH A;  3CK9 A;  2XCB A;  2WXG A;  4GA0 A;  4U63 A;  3S7B A;  3CVN A;  3CKC A;  3S2A A;  3SHF A;  3VLD A;  2WPV A;  1LF8 A;  1JWG A;  4O6F A;  4UI9 C;  3ASG A;  3OXF A;  4N5C A;  4WWO A;  3SZ7 A;  3D9N A;  3CLJ A;  3UPV A;  2M63 A;  2OND A;  3EIJ A;  2AWI A;  3IKO B;  1UW4 B;  3JYS A;  4B8C B;  4YVO A;  3D9L A;  3FUM A;  4GZ3 A;  4GU5 A;  1JWF A;  3EDT B;  3QWV A;  1QQE A;  1PY1 A;  2KZT A;  4AOF A;  3FH8 A;  4V3I A;  3MA5 A;  2I1K A;  3MCX A;  3L08 A;  1PAQ A;  4UI9 J;  1UN9 A;  4BT9 A;  1DNP A;  4I1A A;  3B7T A;  1VDY A;  5KCM A;  4XI0 A;  2VJ8 A;  5LFA A;  2KAT A;  4E6H A;  2CHW A;  3UMV A;  5BPP A;  1EF1 C;  2VTB B;  3PNL B;  4UWH A;  4ILG A;  4F53 A;  4Y6C A;  1H0A A;  3VTX A;  3E4B A;  3K9I A;  4LUN U;  4GMJ A;  2Q7F A;  3LXU X;  4CRW A;  1W3B A;  2WXJ A;  4AIF A;  3IHY A;  4AJW A;  4J8S A;  3ZVV A;  5EDS A;  4ANU A;  1S0P A;  4AVX A;  1L5J A;  3L6A A;  3PEU B;  3U64 A;  2ION A;  4GZ6 A;  3CVP A;  4BWR A;  2PQN A;  4WNG A;  2V8S E;  2WMO A;  4XZ4 A;  3Q47 B;  1B89 A;  1JPL A;  3CV0 A;  2R5S A;  4ME2 A;  3AS5 A;  3ASF A;  5JJT A;  3TGO A;  3FTU A;  2IOL A;  1MHQ A;  3QWP A;  4WNE A;  2VSY A;  5FZQ A;  3TXN A;  4I9C A;  3FUI A;  4UWF A;  3NZU A;  1SZ9 A;  4G26 A;  3R7R A;  2C0M A;  4BY6 A;  5BT1 A;  2AW6 A;  2WQ7 A;  1IYG A;  3HYM B;  5KJN A;  1IHG A;  2FUL A;  4BSX A;  3RRU A;  2YHE A;  5J90 A;  3VTY A;  1GW6 A;  2WXO A;  2YQ8 A;  1H2U A;  1HE8 A;  2FF4 A;  4OVU A;  4DLO A;  3C98 A;  4KXK B;  5LX8 A;  3PZD A;  4DK5 A;  4B8A A;  3D9M A;  1EDU A;  4J8F A;  2KM4 A;  4E85 A;  3PE4 A;  2XGS A;  2GRL A;  4LCT A;  4MS6 A;  4OVV A;  5D0Q D;  3U3W A;  1NA3 A;  2MRI A;  3ZN3 A;  5AEN A;  5FQ6 A;  4B94 A;  3FY4 A;  4GCO A;  3P2B A;  4BX8 A;  1H2V C;  3APD A;  2J4D A;  3PH0 C;  5FTP A;  3CVU A;  2MHK A;  4UQX A;  2NSZ A;  5AJL A;  3CK7 A;  3O48 A;  4G1T A;  2IJG X;  2WQH A;  4I6J A;  4Q96 A;  3APC A;  3G2S A;  3B13 A;  5FJY A;  3ZYM A;  4F7A A;  2XQ0 A;  2Y3A A;  1XGW A;  4JHK A;  4HS2 A;  2X6H A;  3EHM A;  3KS2 A;  5LCW J;  3QC1 A;  4HOS A;  1N52 A;  4JEH A;  3U4T A;  2PQR A;  3ENE A;  3QDN A;  4PH4 B;  4H7Y A;  2CFZ A;  3LY9 A;  3MKQ A;  4BTA A;  3PUK A;  4Q94 A;  3UT4 A;  1OWO A;  2ILR A;  3CVL A;  2VSN A;  4GCN A;  3BG1 B;  1E8X A;  4DI3 A;  3Q4A B;  2OOE A;  4FC8 A;  2J09 A;  2WXN A;  3L13 A;  4C0E A;  4EZJ A;  4U0S A;  4I17 A;  1HXI A;  5LOZ A;  4A3T A;  4BT8 A;  2V0P A;  4L7T A;  3G2V A;  4J8D A;  3MEK A;  5AIJ A;  1ELR A;  4G24 A;  2C2L A;  4CEM A;  4EZK A;  1HF8 A;  4JA7 A;  1HS6 A;  2J4B A;  3SGH A;  2WMN A;  3HVE B;  1QZ2 A;  4FUL A;  2XGM A;  5KJL A;  4WUY A;  2X6I A;  3S7J A;  1ZU2 A;  5DBK A;  3SF4 A;  2XRZ A;  2QY7 A;  1A17 A;  3IHV A;  3LEW A;  4RVB A;  1UJJ A;  2R17 C;  2GW1 A;  5G05 C;  4JHJ A;  2P58 C;  5FZR A;  4C9B B;  5BW8 C;  3RU0 A;  3FEX A;  4L23 A;  3UT7 A;  3FEY A;  2IF4 A;  4JC8 A;  3LVQ E;  2WM9 A;  2RG8 A;  2YIN A;  4N3C A;  4IYP A;  3RO3 A;  3ZRH A;  3D9K A;  5T4Y A;  4JVS A;  4CGV A;  3CVY A;  4YND A;  3NZS A;  3FUK A;  2I6H A;  3CEQ A;  4JW1 A;  3CKB A;  3JQ0 A;  2PL2 A;  3MV2 B;  4NAC A;  4UWK A;  4MRU A;  1HZ4 A;  4AEZ C;  3JQ1 A;  3ZIM A;  4XE0 A;  2J9Q A;  3FU3 A;  3T5X A;  2L9B A;  1N54 A;  3MV3 B;  2WXP A;  1TJF A;  1P5Q A;  3IV0 A;  1Y8M A;  4EEC A;  4G25 A;  3S7D A;  2NC9 A;  4JEU A;  4TRQ A;  4PUC A;  1OWL A;  3ASH A;  3CVV A;  3CHR A;  2WXR A;  2A5U A;  2XEV A;  3TJP A;  2WXF A;  3DBS A;  2HO1 A;  3GZ2 A;  4FLH A;  3PDN A;  3SBT B;  1IQR A;  3UUX A;  4WWP A;  4RG6 A;  2LAI A;  3JCK C;  2GRM A;  1WM5 A;  4KT6 B;  4OYS A;  3ZHE B;  2EQX A;  2WXH A;  3D9P A;  3WXX A;  4J6I A;  5FWQ A;  1BPO A;  3FHE A;  5CMW A;  3ONK A;  3NQP A;  4CGW A;  3ZHE A;  4ABN A;  3B7R L;  4D10 C;  4PS3 A;  2DCP A;  5FZS A;  2AVP A;  5CCL A;  2VGX A;  4FJY A;  3QK0 A;  1NA0 A;  1XNF A;  4J0U A;  3KD7 A;  2J08 A;  4G2V A;  4DJA A;  2WXL A;  3EJN A;  1HH8 A;  2IOS A;  4HOQ A;  3FUL A;  1NZN A;  2Y4T A;  5JJ7 A;  2BF0 X;  2XCC A;  3FUE A;  5ANL A;  4W9R A;  5BV1 A;  3FWV A;  4JPS A;  3GYZ A;  4XIF A;  5CHE E;  3FTS A;  4APO A;  3RRM B;  2CHX A;  2XPY A;  3FFL A;  1X5B A;  4N2Q A;  3FU6 A;  5M72 A;  3FUD A;  4NRH B;  2GGF A;  3LY8 A;  5T8I A;  3L54 A;  2HM8 A;  3FTZ A;  3CQG B;  1E7U A;  2IFU A;  4M3O A;  4GML A;  3DPD A;  1E90 A;  1KT1 A;  5BUZ A;  2C0L A;  2DIW A;  3AU5 A;  4IUL A;  4R7L A;  3ZFW A;  3NF1 A;  4JL0 A;  1SZA A;  3CVW A;  1MQS A;  3AS8 A;  3LJ3 A;  4FJZ A;  4U8H A;  5AYW D;  3R9A B;  4BTB A;  2VTB A;  2FO7 A;  4ANX A;  3ESL A;  5DIZ A;  4AP2 A;  3FTX A;  4N2S A;  3MGB A;  5FQ4 A;  4FP7 A;  4L1B A;  5J08 A;  2VGY A;  2XPZ A;  3ML9 A;  4Y6W A;  5ARG A;  2AXZ A;  5G55 A;  3PS6 A;  3LKU A;  3PE3 A;  3AU4 A;  3LVR E;  3MZL B;  3APF A;  4HOU A;  4UQY A;  1IQU A;  1UG3 A;  3SD5 A;  1UJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...