1YA0A

Crystal structure of the n-terminal domain of human smg7
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
497
structure length
458
Chain Sequence
MSLQSAQYLRQAEVLKADMTDSKLGPAEVWTSRQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQITTLQGQAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTQSSSCSYICQHCLVHLGDIARYRNQTSQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNLQKALSKALESRDEVKTKWGVSDFIKAFIKFHGHVYLSKSLEKLSPLREKLEEQFKELLFQKAFNSQQLVHVTVINLFQLHHLRDFSNETEQHTYSQDEQLCWTQLLALFMSFLGILCKCPLQNSQEESYNAYPLPAVKVSMDWLRLRPRVFQEAVVDERQYIWPWLISLLNSFHPHEEDLSISATPLPEEFELQGFLALRPSFRNLDFSKGHKEGQQRRIRQQRLISIGKWIADNQPRLIQCENEVGKLLFITEIPELILEDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SMG7 Is a 14-3-3-like Adaptor in the Nonsense-Mediated mRNA Decay Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords SMG-7 transcript variant 2
total genus 166
structure length 458
sequence length 497
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10373 EST1_DNA_bind Est1 DNA/RNA binding domain
A PF10374 EST1 Telomerase activating protein Est1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1ya0A01
3FFLA 3CKCA 4YVQC 2FF4A 3ULQA 4G25A 4BT9A 5KJKA 4GZ5A 5LCWJ 2KC7A 4Y6CA 5M72A 2VGXB 5G04C 5HQ8A 5DBKA 3QWVA 5JJTA 3QOUA 5BNWA 5BW8C 2ONDA 4F3VA 5CCMA 2Y4UA 4I9EA 5FZRA 4BWRA 1KLXA 2WPVA 4J0UA 4U0UA 4GPKA 1NA0A 4JA7A 1KT1A 3GYZA 2LSUA 2PL2A 1B89A 4UQYA 4HORA 2FBNA 2HR2A 2Y4TA 1A17A 3Q15A 3Q4AB 2FEZA 4J8FA 4XIFA 3RIBA 4B94A 1ZU2A 3OXGA 2VSYA 3ASDA 3Q49B 3LCAA 3QKYA 4J8DA 4KXKB 5JJ6A 1IYGA 3LPZA 2VYIA 2LSVA 3ASHA 5FJYA 4U0ZA 2L6JA 4WNDA 3LY8A 3ESKA 4GCOA 4UQXA 5FZQA 4BT8A 2FI7A 4YVOA 2KATA 1PC2A 2FO7A 3K9IA 4G1TA 4WNGA 4XI0A 5BT1A 4G2VA 2UWJG 3RU0A 4GA2A 4UI9J 2LNIA 3CVPA 3MV3B 3SF4A 3ZHEA 4YNDA 3S7FA 5EX3A 5G05J 1W3BA 3GZ1A 4KBQA 3NF1A 2BUGA 5KJNA 3CVQA 2YQ8A 3KAEA 2HO1A 3Q47B 4AY6A 2NC9A 3MKRA 3IEGA 2XPIA 3R9AB 4HOSA 4UI9C 1Y8MA 2UY1A 3LY9A 4KYOB 4XI9A 5EX0A 3PE4A 3SZ7A 4WNEA 3CVNA 3CV0A 4GCNA 2XGOA 3U3WA 2XCBA 3ASGA 3CEQA 2PZIA 3N71A 4GYOA 2WQHA 4I9CA 2C0LA 2PQNA 3EDTB 2V5FA 4U04A 4WNFA 5A7DB 2XGSA 4BTAA 3FWVA 4I17A 3QWWA 5HI7A 3QDNA 5ARFA 2KCVA 2KCKA 4I2WA 3GW4A 1NZNA 5AYWD 3ZGQA 2DBAA 1YA0A 3AS8A 3AS4A 3E4BA 4WUYA 2QFCA 5A6CA 2YHCA 4CDRA 2HYZA 1KT0A 3O48A 4H7YA 3S7BA 4BTBA 2VGXA 2E2EA 3UUXA 4N5CA 3PDNA 5G04J 4G26A 4GZ6A 5FZSA 3CK9A 3FP3A 4NQ0A 3CK7A 4G23A 4GZ3A 3S7JA 1OUVA 5FTPA 5KJMA 4ME2A 4AY5A 2VSNA 4GA1A 3RO2A 1E96B 4UQZA 2VQ2A 1HH8A 2XEVA 3TAXA 2KCLA 4GYWA 3VTYA 3URZA 4RG9A 1TJCA 1NA3A 3ZHEB 4ABNA 3WXXA 3LY7A 5C1DA 4N2SA 4JL0A 4H7XA 4J8EA 1QQEA 3CK8A 3GZ2A 4W9RA 3ZPJA 4AIFA 4JHRA 4N2QA 3QWPA 2XGMA 4U0SA 5CCLA 3RKVA 3CKBA 3KD7A 3VTXA 3Q5MA 2UY1B 1WAO1 4Y6WA 3UQ3A 4AM9A 4CGVA 2MHKA 2OOEA 3OXLA 4HOTA 1FCHA 5CHEE 5EKQD 4IN3B 4A1SA 3KS2A 4APOA 4U07A 3AS5A 1ZBPA 3RO3A 1ELWA 2J9QA 3OXFA 2AVPA 1IHGA 1QZ2A 4HOQA 4I2ZA 4RG6A 3TG4A 3ZFWA 3ASFA 1HXIA 4EQFA 3HYMB 4CGWA 5D0QD 3MA5A 5ARGA 5KJLA 4N39A 4HOUA 2C2LA 4N3BA 1ELRA 4GYYA 1P5QA 4N3CA 2IFUA 3CVLA 1XNFA 1HZ4A 3LKUA 2VGYA 2JLBA 3PE3A 4G24A 3U4TA 3TGOA 2P58C 2XCCA 3S7DA 4UI9K 3ZN3A 3UPVA 2PQRA 3TG5A 4N3AA 5D0OD 4JA9A 4LEUA 2Q7FA 3JYSA 5DIZA 5FT9A 4GA0A 5G05C 3RJVA 3LYAA 3MEKA 5LCWC 1WM5A 3BEEA 4NRHB 4O6FA 2R5SA 3MV2B 5JJ7A 2IF4A 2GW1A 2I6HA 4I1AA 2C0MA
chains in the Genus database with same CATH superfamily
4A1GA 4BX9A 4BT9A 5B3SE 2AW6A 5AJDA 4U0UA 4GPKA 2NXPA 3FEYA 3TWWA 5FQ8A 3RRNB 5A23A 2R05A 4ZHBA 3U66A 4GTPA 4B0ZA 2X6JA 3B7RL 2X3MA 3DSVA 1SQMA 1INZA 4L9PA 1MX4A 4OYSA 4DUIA 1SVXA 5ENOD 2BF0X 3G2VA 1DCQA 4BX8A 4OVVA 3BQOA 4HI8A 1MQSA 5G04J 1HU3A 4NQ0A 1JUQA 3LY7A 4ZFHA 5J90A 4B93B 3TWSA 1EPUA 2OOEA 4GMJA 3KS2A 4HI9A 4HFGA 1HXIA 1OCRE 3MA5A 1E8WA 1EYHA 1TNUA 4TXPA 4N3AA 4LEUA 3JYSA 5DIZA 5CMYA 2I6HA 3UI2A 3L22A 5G04C 5HQ8A 3P2BA 3FEXA 2ONDA 2X38A 3GYZA 2RD0A 2H6FA 3SQVA 3SBSA 1MX6A 1ZU2A 5FQ4A 4J8DA 3ESKA 4RSYA 1H0AA 4WAFA 4WNGA 5BT1A 1K8KG 4C0MA 4GTRA 1Z3YA 2LO6A 1Y8MA 3CVNA 4E6HA 4U95D 3HXBA 4IULA 2HYZA 1DCEA 4H7YA 4GU5A 3SI5A 4B8CB 1HH8A 3AG3E 4GYWA 3FH5A 4O60A 4L23A 3HDXA 3JQ0A 3GZ2A 3ZU7B 1QYMA 3QK0A 3CGHA 2IOLA 1N0RA 2GRLA 4DX7D 4APOA 3CQGB 3ZFWA 1IHGA 2J08A 1N11A 3SFYA 3MX3A 3TWUA 2ZXWE 5LOZA 5ARGA 3T8MA 3D9JA 2PM6A 2XQ0A 4GA0A 4C0EA 2DBAA 2IF4A 2LUHA 2YHCA 3F6QA 2IOSA 4JPSA 3FFLA 3FTSA 1ZB1A 3T8KA 1SZAA 3AJIA 5AARA 2F8XK 5DBKA 2I2OA 4UWKA 4JZYA 3ZVVA 2QZAA 4K03A 3DSSA 1B89A 4ILHB 3V31A 3APCA 3E37A 3ASDA 3QKYA 1PC2A 3IKOB 3CIAA 2X6KA 3MV3B 4TUMA 3ZHEA 3S7FA 2VTBB 2XPIA 1N4PA 4HNAD 3ZYLA 1TR4A 4K5BA 1U2VG 3HXFA 4K5AB 3RSEG 3E4BA 1HS6A 2GRQB 3PUKA 3O48A 2WXIA 4G26A 5FZSA 2EIME 2VSNA 2CG3A 3FUMA 2QYJA 3KD7A 3OXLA 4EZKA 1JPLA 4I2ZA 2CG2A 3CHMA 3VLEA 1HG5A 3CHOA 1YMPA 3U4TA 3B7SA 4UI9K 1HO8A 1LTXA 1S64A 1JWFA 1O1SA 3HHMA 2IY0C 3RRMB 3BEEA 4I1AA 2FF4A 1FT2A 2KC7A 4PS7A 4KZCA 4HS2A 3ASOE 1Z5SC 4AVXA 4MKTA 4A63B 2HR2A 4KVOA 4N5QA 3PVLA 1N4SA 3L9TA 4YVOA 4D10C 3LJNA 4UI9J 1WY6A 3E34A 3FUNA 3SHFA 4RQIA 4ANUA 3CVQA 3Q47B 2NC9A 2V5QC 3GZSA 1N4QA 2J8SD 3C72A 3JCKC 4U8VD 3OAWA 5CMWA 4U04A 3IBEA 4I17A 1PAQA 1AWCB 3FU0A 4GTQA 4YDEA 4G8KA 2A5UA 2QYUA 4DJAA 2VGXA 2YHEA 4M7CA 3CK9A 3D9NA 3RO2A 4UQZA 3FY4A 3BG0B 4XX5A 2WXRA 3L54A 3MZLB 2X6FA 3CVXA 1WAO1 4AM9A 3LVQE 4EECA 4GZDA 4U8HA 1FVFA 2EILE 2IO2C 2R03A 4N3BA 2C2LA 4WUYA 3UTMA 2BEDA 4XEIG 5JA4D 2WM9A 1N0QA 4NRHB 1N9AA 5JHAA 1TYQG 4B8AA 3BUAA 3CVVA 3NZSA 2OEWA 1E90A 2XEHA 3ML9A 3EIJA 1KT1A 4FLBA 3AG1E 4GTVA 5BUZA 3PZDA 1A17A 3C5RA 2WXOA 2VSYA 5ENSD 3HRAA 3ASHA 2F0YA 3BU8A 3DRAA 4MS6A 4G1TA 1Q2ZA 4ATGA 4F6RD 3RAUA 3ASGA 2I1JA 3VTYA 3HIZA 3ABKE 1D8EA 2GRNB 2J4DA 4EPZA 3G2TA 3HG0D 5LX8A 3ZXSA 3S7BA 3PDNA 5AQ9A 3S7JA 2RG8A 3VLDA 2L9BA 3SFXA 2XENA 3PZ2A 3ZIMA 5C1DA 5HKPA 4AIFA 2L0IA 3NBNB 3ZPJA 4TUUA 3CVYA 2E0IA 4LNGA 3Q5MA 3PNLB 3CHQA 2MHKA 3LEWA 2ILRA 3AS5A 3FUFA 2AJAA 2X6IA 2MYOA 2XS1A 4GYYA 1N54A 1AP7A 5D66A 3P1UA 3R7QA 2OVFA 3ULYA 4ACLA 4AEZC 3ABME 5JMND 3MKQB 1WM5A 5CECB 3JUEA 4GZ5A 4Y6CA 4G11A 3L82A 3ESLA 5BNWA 5BW8C 1NA0A 4I43A 5IY5E 4UQYA 2FEZA 3OXGA 3AU5A 2VGEA 2WVIA 4FHJA 4ILIA 3PS6A 5G05J 4LNUD 4DLOA 3Q7AA 3AU4A 4KYOB 3E30A 1JCQA 3EDTB 2B0OE 4BY6A 3D9LA 3JXJA 2B6CA 3MKQA 3UM2A 3AS4A 2AXZA 4Q69A 3FUHA 4FU3A 3KSLA 4G23A 2XEVA 3TAXA 4JVSA 3FTXA 3FTUA 3ZYKA 2PNNA 3C3RA 1L5JA 3EHNA 4U0SA 4QQIA 4CGVA 1OCZE 3NQPA 1OWOA 1ELRA 1HZ4A 1JWGA 1WDYA 1N4RA 1RZ4A 2HM8A 3RJVA 4O1PA 2Y4TA 5BXUA 2KBXA 3G2SA 1DC2A 4U63A 2DWZA 4DI4A 1G3NB 5AQBA 4DLQA 4HRLA 4KXKB 3TXMA 4Q96A 2EINE 5ITZF 2WXPA 3SFZA 4BT8A 2KATA 2FO7A 5JHBA 2AXVA 2V4LA 1OWNA 3R9MA 3OTNA 5C2YA 2R2LA 2ZGDA 2GGFA 1QNFA 3T9KA 4P29A 5ANLA 5B1BE 4I9CA 4ILGA 4OVUA 5KNGA 4BTAA 1MZCA 2Y1LE 2VTBA 3GW4A 3U64A 3UM0A 5AYWD 3CHPA 5BV0A 1YA0A 5CEDB 5CRVA 3FUJA 3SY2A 2VJ8A 3MCXA 4EBAG 2EQXA 4U8YD 3W9GA 1U3DA 1O1RA 2VQ2A 4MRUA 4RG9A 3ZHEB 2CFUA 2I9CA 2WQ7A 3PEVB 3RKVA 3APFA 3ZW3A 4JHJA 4Y6WA 4GAAA 1FCHA 2GROB 5EYPF 3NAWA 1SA4A 3I4RB 3IHYA 2DYSE 2VGYA 4I1OB 5LCWC 2P9KG 5JJ7A 3MV2B 2GW1A 4TXQA 1O5MA 4I1MA 5M72A 4J7WA 5KNHD 4HXIA 3C98A 2F8YA 4J0UA 3QNKA 2ZGGA 1EF1C 4KZ0A 2PL2A 3V2OA 3AG4E 5FIOA 3Q49B 1OWMA 4MLPA 4ACKA 3C3QA 5EX3A 3NF1A 4AY6A 1UN8A 4JHKA 5CEAA 4L2YA 4APFA 4LSZE 2C0LA 1RW2A 3QDNA 4C9BB 4LERA 2OV8A 3QARA 3SGHA 5A6CA 2RFAA 4BETA 2XPZA 4JW1A 4NACA 2ETAA 2P2CP 3UM3A 3JUIA 4BEPA 1IKND 5D2MC 4JEHA 1MX2A 4XKCA 5FQ6A 3DEPA 3FHEA 4J8EA 4M3OA 3ZUVB 3QWPA 4CEMA 1E7UA 5T4YA 3TWRA 3ONLA 4U07A 2YINA 3DEOA 3ASFA 4N39A 3EHRA 4G8LA 1YYHA 1TJFA 4XE0A 4HVBA 3LVRE 1SW6A 5FQ7A 1X5BA 3FUEA 2R5SA 4AJWA 2XHEA 3CKCA 4FC8A 4DRXE 4LNBA 2IJGX 1JCRA 5CCMA 4I9EA 1KLXA 2WPVA 2XZDG 1S70B 1E8XA 2LSUA 4HORA 2FBNA 3Q73A 3RIBA 1EDUA 3I5PA 3C3OA 1LF8A 2LSVA 4RLYA 4PUCA 4O1OA 1HX8A 1TN7A 2BUGA 2LAHA 2ZIRA 2XPYA 4HOSA 5E76A 3PEUB 4UWGA 3EJNA 3HXDA 5AIJA 4GYOA 2AWIA 2PZIA 1S63A 2WQHA 2WXMA 4DX6D 5HI7A 2RFMA 2ZU6B 5ARFA 3ABLE 2DCPA 3DPDA 3G2WA 4K5CA 2MOWA 3UIOC 1OY3D 4FLHA 1V55E 4HLEA 2WXLA 4EHMA 3D9PA 1OT8A 4B89A 3J5PA 3PZ4A 3CK7A 3HXCA 4PH4B 2DVWA 4F53A 5AJLA 4BSXA 1BD8A 3KSQA 4WWOA 4DX1A 1QQEA 3UT8A 2RKKA 4HLLA 4AV7A 3TWXA 3G2UA 4X8QA 3RO3A 3QB2A 1N52A 3HYMB 2IFUA 3CVLA 3EIQC 2JLBA 2XCCA 2GRMA 2XZTG 1UJKA 3EHMA 1H6KA 1NFIE 1UG3A 2V8SE 4G25A 5KJKA 1K1AA 3ZXPA 1TN6A 2FO1E 4CT0A 4F3VA 2KZTB 4PS3A 5CRUA 3D9HA 2KXPC 4I6EA 4ANXA 1VDYA 2R59A 5LCWJ 3Q15A 4GB9A 2P9LG 4FA6A 2VYIA 4ANVA 1Z6TA 4G2VA 4YNDA 2WMOA 1SZ9A 3VLFA 2YQ8A 5LFAA 3FU5A 1H2TC 2P9UG 4XI9A 3LY9A 1N95A 3SZ7A 4GCNA 3QJZA 3R7RA 1MHQA 3EUVA 2IO3C 4I2WA 4MBGA 3V30A 3U9WA 4FHKA 5G55A 4A3TA 1UJJA 2E2EA 4U7EB 3FP3A 2MRIA 4ME2A 5FINA 3FH7A 1HG2A 3PNTB 3B7BA 5KWDA 2P9PG 4CYMD 4IN3B 2WXFA 3ZNGA 1FPPA 3PREA 3B7UX 3FU6A 1P5QA 3EU9A 1XNFA 3UPVA 2PQRA 3UM1A 1QBQA 1QZ2A 3FTVA 3PRZA 1HF8A 3HVEB 4UWFA 1DVPA 3CQCB 3ENEA 4HQDA 3LS8A 4C48B 2LXMA 4ATZD 1OWPA 1KZOA 3LCAA 3CR3A 1UW4B 3Q75A 2J09A 4WNDA 3UT7A 5BPPA 2F37A 4BSZB 3L6AA 1W3BA 5KJNA 2DZNA 3KAEA 3HXEA 2L0TB 4PDXA 4A3VA 4LG6A 3D9IA 3E32A 3FUDA 3PE4A 4K0RA 1TNYA 3NB2A 4AOFA 1E8YA 3AS8A 5CBOA 3RRUA 4FP7A 4XZ4A 1H6PA 3Q78A 4JD2G 4N5CA 3QAQA 3TXNA 2KZTA 3D9MA 1BU9A 1JCSA 3X2QE 2P9IG 4TRQA 3LJ3A 3V79K 2XGMA 2IONA 3FTYA 1NL4A 2XRZA 3Q7FA 4A1SA 3TG4A 4EQFA 3HVEA 5EDSA 5KJLA 4XKBA 2I1KA 3L16A 2GRRB 2XEEA 4E85A 4JXTA 3ULQA 3UX4A 5ANRA 2Y4UA 3ISMC 3L08A 4PS8A 2P9SG 1TN8A 5EN5D 2J49A 1ELKA 2KM4A 3DBSA 3CHSA 4FJZA 4GCOA 4UQXA 1K1BA 4XI0A 3CVUA 2LNIA 2H6IA 2Y3AA 4TV3A 3UINC 4RG6A 4GTTA 4WNFA 2XGSA 3FDHA 2KCVA 2KCKA 5FWQA 3S2AA 2DIWA 3ZGQA 1YCSB 4CDRA 4URKA 1BI8B 2Y0BG 2Y69E 4HRNA 4GZ3A 1BI7B 2V0PA 3NZUA 3SO8A 5EIBE 3DSTA 5ENNA 2XS8A 5CERB 3AAAC 1TJCA 5B1AE 4N2SA 2CFZA 4H7XA 4W9RA 3TJPA 3D9KA 4LRZA 1X81A 4L2LA 2UY1B 4J8SA 4KVMA 5CHEE 2PM7A 1ZBPA 3OXFA 4UUCA 3J5QB 5D0QD 4HOUA 1D9SA 4N3CA 4G24A 4I6JA 5D0OD 4JA9A 1D8DA 2Q7FA 3DSWA 5FT9A 4DI3A 2VSXE 3B95A 2C0MA 4V3IA 4I6GA 2ETCA 3QWVA 3JXIA 3APDA 2DZOA 3SD5A 3FUIA 3FULA 4UWLA 1NP7A 3MGBA 1IYGA 3DXMG 2ETBA 3T5XA 3LPZA 2QY7A 5AQ7A 3IXEA 3NOCD 3I3NA 5JJTA 4BESA 4CT4A 3SF4A 3CVPA 2IQCA 3FTZA 3KEAA 1H2VC 2FULA 3I4GA 3SNXA 1MJ0A 1LD8A 3LDZA 1H6OA 4DX2A 5ENQD 4OAVB 2A4ZA 3JQ1A 4CDNA 2DYRE 4IYPA 4YDYA 3UMVA 1KT0A 4F1SA 1DNPA 4BTBA 2JEKA 1A5EA 4Q94A 3WG7E 3ULEG 4WWNA 1E96B 4DX5D 2KCLA 1BPOA 4FJYA 3EHQA 1GW6A 2YNQA 4CZ2D 3MJWA 1NI1A 3DXKG 2EIKE 3V2XA 4HOTA 4L1BA 3DPYA 2AVPA 4QFVA 3QC1A 3ZKJA 2WQ6A 5EIDA 1U3CA 5ENTD 3Q79A 2P58C 2WMNA 2OVBA 5G05C 3D3MA 3PZ3A 1H19A 3SBTB 5KCMA 1UOHA 4BWRA 4DK5A 1TEZA 2WXHA 2XRYA 3DWLG 3MYVA 1N94A 5AENA 3L17A 4JB8P 1S0PA 5G2NA 3CHRA 4U96D 2WXJA 3B13A 2BTDA 3UKUG 2X6HA 1H2UA 1XGWA 5T3RA 3GZ1A 1K3ZD 1MYOA 2HO1A 2R17C 3MKRA 3IEGA 2LXLA 1FVHA 3CEQA 3FTWA 4GTOA 2PQNA 5A7DB 4CRWA 3Q9UC 4CCAA 4GMRA 3Q9NC 2P9NG 3ZRHA 3IHVA 2WB2A 3FU3A 1LD7A 2M63A 2WXGA 1HFAA 4GZ6A 3W9FA 3AG2E 1OUVA 3UXGA 4GA1A 1IQUA 5HRYA 1NA3A 4ABNA 3KEZA 4JL0A 3CK8A 5H7PA 3CVWA 4N2QA 4KMOA 2CHWA 3T5VA 2J9QA 1TNBA 3UT4A 2H6GA 1KZPA 1SA5A 4F7AA 5LP0A 5AN8A 4KT6B 4GZCA 4ANWA 3TGOA 2CHZA 1BLXB 1WG0A 4AXHA 4Z68A 4LCTA 4GPMA 4IRUA 4YVQC 4LUNU 3PH0C 4A55A 4TXRA 3TWTA 3EU5A 5FZRA 2J4BA 2AXUA 2WXQA 1UN9A 4J8FA 4B94A 4BFRA 1KPSB 5FJYA 2J07A 1TNOA 2L6JA 3BG1B 5KBAA 5FZQA 5HS0A 5BV1A 1FT1A 3TWQA 3DSUA 4JEUA 3IV0A 1OWLA 2OEVA 4CDMA 5E75A 3B7TA 5AQAA 4GTMA 4UI9C 5EX0A 2R02A 1HE8A 2XCBA 3QWWA 1E8ZA 5CBNA 2JABA 3RK6A 1NZNA 1TNZA 4EZJA 3LXUX 3DSXA 2ZISA 3URZA 1Y6IA 3WXXA 3D9OA 5BXOA 4AP2A 1PY1A 3UKRG 5CCLA 3VTXA 3UQ3A 5ENPD 5EKQD 2WXNA 3CLJA 2L6BA 2HE0A 5EYLA 4HBDA 2IEJA 5T8IA 3S7DA 1IQRA 4GMLA 1V54E 3LYAA 4O6FA 4RVBA 2VSOE 3O4ZA 2WXKA 2VGXB 3NOGD 3QOUA 5EILA 4DPRA 4JA7A 4F1PA 5ENRD 4XIFA 3Q4AB 3FUKA 4J6IA 5JJ6A 2NSZA 2QC9A 1OCOE 5AAOA 4U0ZA 3LY8A 2GRPB 2FI7A 3K9IA 4FULA 2UWJG 3RU0A 4GA2A 2BKGA 4KBQA 2LAIA 4GTSA 1IXVA 2CHXA 4YDOA 3R9AB 2UY1A 3ZYQA 3PUJA 4WNEA 3CV0A 2XGOA 3U3WA 3N71A 2V5FA 3FWVA 4HB5A 4EBAA 3ZEFA 2NYJA 3ML8A 4OAUC 4NIKA 1E7VA 2QFCA 2OCCE 4HRMB 2H6HA 3UUXA 4FADA 4J8YA 3ZYMA 5FTPA 3TWVA 5KJMA 4AY5A 1OCCE 4YDWA 4BERA 4UWHA 4EZLA 3L13A 3CSTA 2V4HC 5J08A 3CSFA 4JHRA 3FH8A 3E33A 4L7TA 3ONKA 1IHBA 3CKBA 1Z3XA 2IU1A 1ELWA 4HOQA 1O1TA 3ASNE 4CGWA 4WWPA 2EIJE 1OXJA 3PE3A 3LKUA 2A5EA 3ZN3A 4JC8A 3TG5A 4R7LA 4NURA 3UIPC 2BKKB 3TL5A 3PZ1A 3MEKA
chains in the Genus database with same CATH topology
3CKCA 4FC8A 4A1GA 4B8AA 3CVVA 4BX9A 4BT9A 2AW6A 3NZSA 4V3IA 1E90A 4I6GA 2IJGX 5AJDA 3QWVA 5CCMA 4I9EA 3ML9A 1KLXA 2WPVA 3EIJA 4U0UA 3APDA 4GPKA 1KT1A 2NXPA 1E8XA 3FEYA 4FLBA 5FQ8A 2LSUA 3SD5A 3FUIA 5BUZA 3FULA 3PZDA 2FBNA 4UWLA 1NP7A 1A17A 3MGBA 3RIBA 1EDUA 3RRNB 5A23A 2WXOA 1IYGA 3I5PA 2VSYA 3T5XA 3LPZA 2QY7A 1LF8A 2LSVA 3ASHA 4MS6A 3I3NA 3U66A 5JJTA 4PUCA 4G1TA 4CT4A 3SF4A 3CVPA 4ATGA 4B0ZA 2IQCA 2X6JA 3FTZA 1HX8A 1H2VC 2BUGA 2LAHA 3B7RL 2FULA 3I4GA 3SNXA 2XPYA 4HOSA 5E76A 3PEUB 2X3MA 4UWGA 3EJNA 3LDZA 5AIJA 4GYOA 3ASGA 2AWIA 2PZIA 1SQMA 2I1JA 2WQHA 2WXMA 3VTYA 3HIZA 5HI7A 2ZU6B 1INZA 5ARFA 2J4DA 4EPZA 3G2TA 4OYSA 2A4ZA 2DCPA 3DPDA 3G2WA 3JQ1A 2MOWA 4CDNA 2BF0X 3G2VA 5LX8A 4IYPA 4FLHA 3ZXSA 3UMVA 4BX8A 1KT0A 4OVVA 3S7BA 2WXLA 1DNPA 4F1SA 3D9PA 4HLEA 4BTBA 2JEKA 1MQSA 3PDNA 1HU3A 5G04J 4B89A 4Q94A 4NQ0A 3S7JA 3CK7A 2RG8A 4WWNA 4PH4B 3VLDA 2L9BA 4F53A 1E96B 1JUQA 5AJLA 2KCLA 4BSXA 1BPOA 4FJYA 3ZIMA 4WWOA 5C1DA 3LY7A 1GW6A 4AIFA 1QQEA 2L0IA 2YNQA 3UT8A 3ZPJA 4TUUA 5J90A 3MJWA 3CVYA 2E0IA 3Q5MA 3PNLB 1EPUA 3CHQA 2MHKA 4AV7A 2OOEA 4GMJA 4L1BA 4HOTA 3LEWA 3KS2A 2ILRA 3AS5A 3G2UA 3RO3A 2AVPA 3QB2A 4QFVA 3FUFA 4HFGA 3QC1A 1HXIA 1N52A 2WQ6A 3HYMB 2X6IA 3MA5A 1U3CA 1E8WA 4GYYA 1N54A 2IFUA 3CVLA 1EYHA 3EIQC 2JLBA 3P1UA 3R7QA 2OVFA 2P58C 2XCCA 2GRMA 1UJKA 2WMNA 2OVBA 4ACLA 4AEZC 4N3AA 3EHMA 1H6KA 4LEUA 3JYSA 5DIZA 5CMYA 5G05C 3MKQB 1WM5A 1UG3A 3D3MA 2V8SE 2I6HA 1H19A 4G25A 5KJKA 4GZ5A 4Y6CA 4G11A 3L22A 5G04C 5HQ8A 3ESLA 3SBTB 3P2BA 5BNWA 3FEXA 5BW8C 2ONDA 4CT0A 2KZTB 2X38A 5KCMA 4BWRA 4F3VA 4PS3A 1NA0A 4I43A 3GYZA 4I6EA 4ANXA 2RD0A 1VDYA 2R59A 4UQYA 5LCWJ 3SBSA 3Q15A 2FEZA 1ZU2A 3AU5A 3OXGA 2WXHA 2XRYA 3MYVA 4GB9A 4J8DA 5FQ4A 4DK5A 5AENA 4FA6A 2VYIA 3L17A 1S0PA 5G2NA 2WVIA 3CHRA 3ESKA 4RSYA 1H0AA 4WAFA 4FHJA 4ANVA 1Z6TA 2WXJA 4ILIA 4WNGA 3PS6A 4G2VA 5BT1A 1TEZA 3B13A 2BTDA 2X6HA 4YNDA 1H2UA 1XGWA 2WMOA 5G05J 5T3RA 3GZ1A 1SZ9A 4C0MA 3VLFA 2YQ8A 2HO1A 2R17C 5LFAA 3FU5A 3MKRA 4DLOA 3IEGA 1Z3YA 1H2TC 2LO6A 3AU4A 1Y8MA 4XI9A 3LY9A 4KYOB 1FVHA 3SZ7A 3CVNA 4GCNA 3QJZA 3CEQA 3FTWA 3R7RA 4E6HA 2PQNA 3EDTB 5A7DB 4BY6A 4CRWA 1MHQA 4CCAA 3D9LA 3ZRHA 4I2WA 3IHVA 3U9WA 3MKQA 4FHKA 2WB2A 4IULA 5G55A 3AS4A 4A3TA 3FU3A 2AXZA 1UJJA 2HYZA 4Q69A 2M63A 4H7YA 2WXGA 2E2EA 3FUHA 4FU3A 1HFAA 4GU5A 4GZ6A 3SI5A 3FP3A 4G23A 1OUVA 4B8CB 2MRIA 4ME2A 3FH7A 4GA1A 1HG2A 1HH8A 2XEVA 1IQUA 3TAXA 4JVSA 4GYWA 3FH5A 3PNTB 3FTXA 3FTUA 3ZYKA 1NA3A 4L23A 3KEZA 3HDXA 4ABNA 4JL0A 3CK8A 3GZ2A 3JQ0A 1L5JA 3CVWA 4N2QA 3EHNA 4KMOA 4U0SA 2CHWA 3QK0A 3CGHA 2IOLA 4CGVA 2GRLA 4IN3B 2WXFA 4APOA 3CQGB 3T5VA 2J9QA 3ZFWA 1IHGA 2J08A 3UT4A 3PREA 3MX3A 4F7AA 5LP0A 5LOZA 5ARGA 3B7UX 3NQPA 1OWOA 4KT6B 1ELRA 3D9JA 3FU6A 1P5QA 4GZCA 3T8MA 4ANWA 1XNFA 1HZ4A 1JWGA 3TGOA 3UPVA 2PQRA 2PM6A 2XQ0A 2CHZA 2HM8A 4AXHA 4GA0A 4C0EA 3RJVA 4LCTA 2DBAA 2IF4A 2YHCA 2Y4TA 4IRUA 2IOSA 1QZ2A 3FFLA 3FTSA 4JPSA 4YVQC 3FTVA 3PRZA 1SZAA 3PH0C 4LUNU 4A55A 5DBKA 3G2SA 1HF8A 2I2OA 4UWKA 3HVEB 5FZRA 2J4BA 4JZYA 3ZVVA 2AXUA 4UWFA 1DVPA 4U63A 3CQCB 4DI4A 4K03A 3ENEA 3LS8A 1B89A 2WXQA 4ILHB 1UN9A 4J8FA 1OWPA 3APCA 4B94A 4BFRA 4DLQA 3ASDA 4KXKB 3LCAA 3QKYA 3TXMA 3CR3A 1UW4B 5FJYA 4Q96A 2J07A 3UT7A 2J09A 2L6JA 4WNDA 3BG1B 2WXPA 3SFZA 5FZQA 4BT8A 5BPPA 1PC2A 2FO7A 2KATA 5BV1A 5JHBA 2AXVA 2V4LA 3CIAA 3IKOB 1OWNA 2X6KA 3MV3B 3ZHEA 3L6AA 3S7FA 4JEUA 3OTNA 1W3BA 5C2YA 3IV0A 1OWLA 2VTBB 5KJNA 3KAEA 4PDXA 2L0TB 4CDMA 5E75A 3B7TA 2XPIA 2GGFA 1QNFA 4A3VA 4UI9C 3D9IA 4P29A 5ANLA 5EX0A 3FUDA 3PE4A 1HE8A 2XCBA 4I9CA 3ZYLA 4ILGA 4OVUA 4K0RA 4BTAA 3QWWA 1E8ZA 2VTBA 3RK6A 3GW4A 3U64A 1NZNA 5AYWD 4EZJA 3CHPA 1E8YA 4AOFA 1YA0A 3AS8A 3E4BA 1HS6A 5BV0A 3LXUX 3FUJA 3RRUA 4FP7A 3PUKA 3O48A 4XZ4A 2WXIA 2VJ8A 3MCXA 4N5CA 4G26A 3QAQA 5FZSA 3TXNA 4EBAG 2KZTA 2EQXA 3D9MA 1U3DA 2VSNA 2VQ2A 4MRUA 2CG3A 3URZA 1Y6IA 4RG9A 3ZHEB 3WXXA 3FUMA 2CFUA 3D9OA 4TRQA 4AP2A 3LJ3A 1PY1A 2I9CA 2WQ7A 2XGMA 5CCLA 3PEVB 3RKVA 3APFA 3ZW3A 3KD7A 4JHJA 2IONA 3VTXA 4Y6WA 3UQ3A 3FTYA 4GAAA 3OXLA 1FCHA 2XRZA 5EKQD 4A1SA 4EZKA 1JPLA 2WXNA 3CLJA 4I2ZA 2CG2A 3TG4A 3CHMA 3I4RB 4EQFA 3HVEA 3VLEA 3IHYA 5EDSA 5KJLA 4XKBA 1HG5A 3CHOA 2VGYA 4I1OB 3U4TA 3B7SA 5T8IA 3S7DA 2I1KA 1HO8A 3L16A 4UI9K 1JWFA 3HHMA 1IQRA 4GMLA 3LYAA 3RRMB 5LCWC 4O6FA 3BEEA 4RVBA 4E85A 2VSOE 3MV2B 3O4ZA 5JJ7A 4HORA 2GW1A 4JXTA 4I1AA 3ULQA 2FF4A 4I1MA 2WXKA 5M72A 2KC7A 4HXIA 2VGXB 3C98A 4PS7A 4KZCA 5ANRA 3UX4A 4HS2A 3QOUA 4DPRA 2Y4UA 3L08A 4J0UA 4PS8A 4JA7A 3QNKA 1EF1C 4KZ0A 4AVXA 4MKTA 2PL2A 2HR2A 4KVOA 4XIFA 3Q4AB 3FUKA 3PVLA 4J6IA 3Q49B 5JJ6A 2J49A 1ELKA 3DBSA 2KM4A 2NSZA 3CHSA 4FJZA 1OWMA 4U0ZA 3LY8A 4GCOA 4MLPA 4UQXA 4ACKA 2FI7A 4YVOA 4D10C 3K9IA 4FULA 4XI0A 2UWJG 3RU0A 4GA2A 4UI9J 1WY6A 3CVUA 2LNIA 3FUNA 3SHFA 4ANUA 5EX3A 2Y3AA 4KBQA 4TV3A 3NF1A 4AY6A 1UN8A 3CVQA 4JHKA 3Q47B 2NC9A 2LAIA 4L2YA 2CHXA 3GZSA 3R9AB 4APFA 2UY1A 3ZYQA 3JCKC 3PUJA 4WNEA 3CV0A 3OAWA 2XGOA 3U3WA 4RG6A 3N71A 2C0LA 5CMWA 2V5FA 4U04A 3IBEA 4WNFA 2XGSA 3FDHA 3FWVA 4I17A 1PAQA 3QDNA 2KCVA 4C9BB 2KCKA 4LERA 4EBAA 3FU0A 3ZEFA 3ML8A 5FWQA 3S2AA 2OV8A 2DIWA 3ZGQA 3QARA 3SGHA 1E7VA 2QFCA 5A6CA 4CDRA 2A5UA 2XPZA 4JW1A 4URKA 4NACA 4DJAA 2VGXA 4FADA 3UUXA 2YHEA 3ZYMA 3CK9A 3JUIA 4GZ3A 5FTPA 5KJMA 4AY5A 2V0PA 3NZUA 4JEHA 3D9NA 3RO2A 4UQZA 5ENNA 4UWHA 4EZLA 3FY4A 4XKCA 5FQ6A 3BG0B 1TJCA 3L13A 4XX5A 2WXRA 3CSTA 3FHEA 2CFZA 4N2SA 3L54A 4H7XA 4J8EA 3MZLB 2X6FA 3D9KA 4LRZA 4W9RA 3TJPA 3CSFA 4JHRA 4M3OA 5J08A 3FH8A 4L2LA 3QWPA 4L7TA 3ONKA 4CEMA 3CKBA 1Z3XA 1E7UA 3CVXA 5T4YA 1WAO1 2UY1B 4J8SA 4AM9A 3LVQE 3ONLA 4KVMA 5CHEE 2IU1A 4EECA 2PM7A 4U07A 1ZBPA 2YINA 1ELWA 3OXFA 4HOQA 4GZDA 4U8HA 1FVFA 3ASFA 4CGWA 5D0QD 4N39A 4HOUA 2C2LA 4N3BA 4WWPA 4N3CA 4WUYA 3PE3A 3LKUA 4G24A 4I6JA 3ZN3A 4JC8A 3TG5A 1TJFA 2WM9A 4R7LA 4XE0A 4HVBA 3LVRE 4NURA 4JA9A 5D0OD 5FQ7A 2Q7FA 5FT9A 3TL5A 1X5BA 3FUEA 4NRHB 4DI3A 2R5SA 2VSXE 4AJWA 5JHAA 3MEKA 2XHEA 2C0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FFL A;  3CKC A;  4YVQ C;  2FF4 A;  3ULQ A;  4G25 A;  4BT9 A;  5KJK A;  4GZ5 A;  5LCW J;  2KC7 A;  4Y6C A;  5M72 A;  2VGX B;  5G04 C;  5HQ8 A;  5DBK A;  3QWV A;  5JJT A;  3QOU A;  5BNW A;  5BW8 C;  2OND A;  4F3V A;  5CCM A;  2Y4U A;  4I9E A;  5FZR A;  4BWR A;  1KLX A;  2WPV A;  4J0U A;  4U0U A;  4GPK A;  1NA0 A;  4JA7 A;  1KT1 A;  3GYZ A;  2LSU A;  2PL2 A;  1B89 A;  4UQY A;  4HOR A;  2FBN A;  2HR2 A;  2Y4T A;  1A17 A;  3Q15 A;  3Q4A B;  2FEZ A;  4J8F A;  4XIF A;  3RIB A;  4B94 A;  1ZU2 A;  3OXG A;  2VSY A;  3ASD A;  3Q49 B;  3LCA A;  3QKY A;  4J8D A;  4KXK B;  5JJ6 A;  1IYG A;  3LPZ A;  2VYI A;  2LSV A;  3ASH A;  5FJY A;  4U0Z A;  2L6J A;  4WND A;  3LY8 A;  3ESK A;  4GCO A;  4UQX A;  5FZQ A;  4BT8 A;  2FI7 A;  4YVO A;  2KAT A;  1PC2 A;  2FO7 A;  3K9I A;  4G1T A;  4WNG A;  4XI0 A;  5BT1 A;  4G2V A;  2UWJ G;  3RU0 A;  4GA2 A;  4UI9 J;  2LNI A;  3CVP A;  3MV3 B;  3SF4 A;  3ZHE A;  4YND A;  3S7F A;  5EX3 A;  5G05 J;  1W3B A;  3GZ1 A;  4KBQ A;  3NF1 A;  2BUG A;  5KJN A;  3CVQ A;  2YQ8 A;  3KAE A;  2HO1 A;  3Q47 B;  4AY6 A;  2NC9 A;  3MKR A;  3IEG A;  2XPI A;  3R9A B;  4HOS A;  4UI9 C;  1Y8M A;  2UY1 A;  3LY9 A;  4KYO B;  4XI9 A;  5EX0 A;  3PE4 A;  3SZ7 A;  4WNE A;  3CVN A;  3CV0 A;  4GCN A;  2XGO A;  3U3W A;  2XCB A;  3ASG A;  3CEQ A;  2PZI A;  3N71 A;  4GYO A;  2WQH A;  4I9C A;  2C0L A;  2PQN A;  3EDT B;  2V5F A;  4U04 A;  4WNF A;  5A7D B;  2XGS A;  4BTA A;  3FWV A;  4I17 A;  3QWW A;  5HI7 A;  3QDN A;  5ARF A;  2KCV A;  2KCK A;  4I2W A;  3GW4 A;  1NZN A;  5AYW D;  3ZGQ A;  2DBA A;  1YA0 A;  3AS8 A;  3AS4 A;  3E4B A;  4WUY A;  2QFC A;  5A6C A;  2YHC A;  4CDR A;  2HYZ A;  1KT0 A;  3O48 A;  4H7Y A;  3S7B A;  4BTB A;  2VGX A;  2E2E A;  3UUX A;  4N5C A;  3PDN A;  5G04 J;  4G26 A;  4GZ6 A;  5FZS A;  3CK9 A;  3FP3 A;  4NQ0 A;  3CK7 A;  4G23 A;  4GZ3 A;  3S7J A;  1OUV A;  5FTP A;  5KJM A;  4ME2 A;  4AY5 A;  2VSN A;  4GA1 A;  3RO2 A;  1E96 B;  4UQZ A;  2VQ2 A;  1HH8 A;  2XEV A;  3TAX A;  2KCL A;  4GYW A;  3VTY A;  3URZ A;  4RG9 A;  1TJC A;  1NA3 A;  3ZHE B;  4ABN A;  3WXX A;  3LY7 A;  5C1D A;  4N2S A;  4JL0 A;  4H7X A;  4J8E A;  1QQE A;  3CK8 A;  3GZ2 A;  4W9R A;  3ZPJ A;  4AIF A;  4JHR A;  4N2Q A;  3QWP A;  2XGM A;  4U0S A;  5CCL A;  3RKV A;  3CKB A;  3KD7 A;  3VTX A;  3Q5M A;  2UY1 B;  1WAO 1;  4Y6W A;  3UQ3 A;  4AM9 A;  4CGV A;  2MHK A;  2OOE A;  3OXL A;  4HOT A;  1FCH A;  5CHE E;  5EKQ D;  4IN3 B;  4A1S A;  3KS2 A;  4APO A;  4U07 A;  3AS5 A;  1ZBP A;  3RO3 A;  1ELW A;  2J9Q A;  3OXF A;  2AVP A;  1IHG A;  1QZ2 A;  4HOQ A;  4I2Z A;  4RG6 A;  3TG4 A;  3ZFW A;  3ASF A;  1HXI A;  4EQF A;  3HYM B;  4CGW A;  5D0Q D;  3MA5 A;  5ARG A;  5KJL A;  4N39 A;  4HOU A;  2C2L A;  4N3B A;  1ELR A;  4GYY A;  1P5Q A;  4N3C A;  2IFU A;  3CVL A;  1XNF A;  1HZ4 A;  3LKU A;  2VGY A;  2JLB A;  3PE3 A;  4G24 A;  3U4T A;  3TGO A;  2P58 C;  2XCC A;  3S7D A;  4UI9 K;  3ZN3 A;  3UPV A;  2PQR A;  3TG5 A;  4N3A A;  5D0O D;  4JA9 A;  4LEU A;  2Q7F A;  3JYS A;  5DIZ A;  5FT9 A;  4GA0 A;  5G05 C;  3RJV A;  3LYA A;  3MEK A;  5LCW C;  1WM5 A;  3BEE A;  4NRH B;  4O6F A;  2R5S A;  3MV2 B;  5JJ7 A;  2IF4 A;  2GW1 A;  2I6H A;  4I1A A;  2C0M A; 
#chains in the Genus database with same CATH topology
 4A1G A;  4BX9 A;  4BT9 A;  5B3S E;  2AW6 A;  5AJD A;  4U0U A;  4GPK A;  2NXP A;  3FEY A;  3TWW A;  5FQ8 A;  3RRN B;  5A23 A;  2R05 A;  4ZHB A;  3U66 A;  4GTP A;  4B0Z A;  2X6J A;  3B7R L;  2X3M A;  3DSV A;  1SQM A;  1INZ A;  4L9P A;  1MX4 A;  4OYS A;  4DUI A;  1SVX A;  5ENO D;  2BF0 X;  3G2V A;  1DCQ A;  4BX8 A;  4OVV A;  3BQO A;  4HI8 A;  1MQS A;  5G04 J;  1HU3 A;  4NQ0 A;  1JUQ A;  3LY7 A;  4ZFH A;  5J90 A;  4B93 B;  3TWS A;  1EPU A;  2OOE A;  4GMJ A;  3KS2 A;  4HI9 A;  4HFG A;  1HXI A;  1OCR E;  3MA5 A;  1E8W A;  1EYH A;  1TNU A;  4TXP A;  4N3A A;  4LEU A;  3JYS A;  5DIZ A;  5CMY A;  2I6H A;  3UI2 A;  3L22 A;  5G04 C;  5HQ8 A;  3P2B A;  3FEX A;  2OND A;  2X38 A;  3GYZ A;  2RD0 A;  2H6F A;  3SQV A;  3SBS A;  1MX6 A;  1ZU2 A;  5FQ4 A;  4J8D A;  3ESK A;  4RSY A;  1H0A A;  4WAF A;  4WNG A;  5BT1 A;  1K8K G;  4C0M A;  4GTR A;  1Z3Y A;  2LO6 A;  1Y8M A;  3CVN A;  4E6H A;  4U95 D;  3HXB A;  4IUL A;  2HYZ A;  1DCE A;  4H7Y A;  4GU5 A;  3SI5 A;  4B8C B;  1HH8 A;  3AG3 E;  4GYW A;  3FH5 A;  4O60 A;  4L23 A;  3HDX A;  3JQ0 A;  3GZ2 A;  3ZU7 B;  1QYM A;  3QK0 A;  3CGH A;  2IOL A;  1N0R A;  2GRL A;  4DX7 D;  4APO A;  3CQG B;  3ZFW A;  1IHG A;  2J08 A;  1N11 A;  3SFY A;  3MX3 A;  3TWU A;  2ZXW E;  5LOZ A;  5ARG A;  3T8M A;  3D9J A;  2PM6 A;  2XQ0 A;  4GA0 A;  4C0E A;  2DBA A;  2IF4 A;  2LUH A;  2YHC A;  3F6Q A;  2IOS A;  4JPS A;  3FFL A;  3FTS A;  1ZB1 A;  3T8K A;  1SZA A;  3AJI A;  5AAR A;  2F8X K;  5DBK A;  2I2O A;  4UWK A;  4JZY A;  3ZVV A;  2QZA A;  4K03 A;  3DSS A;  1B89 A;  4ILH B;  3V31 A;  3APC A;  3E37 A;  3ASD A;  3QKY A;  1PC2 A;  3IKO B;  3CIA A;  2X6K A;  3MV3 B;  4TUM A;  3ZHE A;  3S7F A;  2VTB B;  2XPI A;  1N4P A;  4HNA D;  3ZYL A;  1TR4 A;  4K5B A;  1U2V G;  3HXF A;  4K5A B;  3RSE G;  3E4B A;  1HS6 A;  2GRQ B;  3PUK A;  3O48 A;  2WXI A;  4G26 A;  5FZS A;  2EIM E;  2VSN A;  2CG3 A;  3FUM A;  2QYJ A;  3KD7 A;  3OXL A;  4EZK A;  1JPL A;  4I2Z A;  2CG2 A;  3CHM A;  3VLE A;  1HG5 A;  3CHO A;  1YMP A;  3U4T A;  3B7S A;  4UI9 K;  1HO8 A;  1LTX A;  1S64 A;  1JWF A;  1O1S A;  3HHM A;  2IY0 C;  3RRM B;  3BEE A;  4I1A A;  2FF4 A;  1FT2 A;  2KC7 A;  4PS7 A;  4KZC A;  4HS2 A;  3ASO E;  1Z5S C;  4AVX A;  4MKT A;  4A63 B;  2HR2 A;  4KVO A;  4N5Q A;  3PVL A;  1N4S A;  3L9T A;  4YVO A;  4D10 C;  3LJN A;  4UI9 J;  1WY6 A;  3E34 A;  3FUN A;  3SHF A;  4RQI A;  4ANU A;  3CVQ A;  3Q47 B;  2NC9 A;  2V5Q C;  3GZS A;  1N4Q A;  2J8S D;  3C72 A;  3JCK C;  4U8V D;  3OAW A;  5CMW A;  4U04 A;  3IBE A;  4I17 A;  1PAQ A;  1AWC B;  3FU0 A;  4GTQ A;  4YDE A;  4G8K A;  2A5U A;  2QYU A;  4DJA A;  2VGX A;  2YHE A;  4M7C A;  3CK9 A;  3D9N A;  3RO2 A;  4UQZ A;  3FY4 A;  3BG0 B;  4XX5 A;  2WXR A;  3L54 A;  3MZL B;  2X6F A;  3CVX A;  1WAO 1;  4AM9 A;  3LVQ E;  4EEC A;  4GZD A;  4U8H A;  1FVF A;  2EIL E;  2IO2 C;  2R03 A;  4N3B A;  2C2L A;  4WUY A;  3UTM A;  2BED A;  4XEI G;  5JA4 D;  2WM9 A;  1N0Q A;  4NRH B;  1N9A A;  5JHA A;  1TYQ G;  4B8A A;  3BUA A;  3CVV A;  3NZS A;  2OEW A;  1E90 A;  2XEH A;  3ML9 A;  3EIJ A;  1KT1 A;  4FLB A;  3AG1 E;  4GTV A;  5BUZ A;  3PZD A;  1A17 A;  3C5R A;  2WXO A;  2VSY A;  5ENS D;  3HRA A;  3ASH A;  2F0Y A;  3BU8 A;  3DRA A;  4MS6 A;  4G1T A;  1Q2Z A;  4ATG A;  4F6R D;  3RAU A;  3ASG A;  2I1J A;  3VTY A;  3HIZ A;  3ABK E;  1D8E A;  2GRN B;  2J4D A;  4EPZ A;  3G2T A;  3HG0 D;  5LX8 A;  3ZXS A;  3S7B A;  3PDN A;  5AQ9 A;  3S7J A;  2RG8 A;  3VLD A;  2L9B A;  3SFX A;  2XEN A;  3PZ2 A;  3ZIM A;  5C1D A;  5HKP A;  4AIF A;  2L0I A;  3NBN B;  3ZPJ A;  4TUU A;  3CVY A;  2E0I A;  4LNG A;  3Q5M A;  3PNL B;  3CHQ A;  2MHK A;  3LEW A;  2ILR A;  3AS5 A;  3FUF A;  2AJA A;  2X6I A;  2MYO A;  2XS1 A;  4GYY A;  1N54 A;  1AP7 A;  5D66 A;  3P1U A;  3R7Q A;  2OVF A;  3ULY A;  4ACL A;  4AEZ C;  3ABM E;  5JMN D;  3MKQ B;  1WM5 A;  5CEC B;  3JUE A;  4GZ5 A;  4Y6C A;  4G11 A;  3L82 A;  3ESL A;  5BNW A;  5BW8 C;  1NA0 A;  4I43 A;  5IY5 E;  4UQY A;  2FEZ A;  3OXG A;  3AU5 A;  2VGE A;  2WVI A;  4FHJ A;  4ILI A;  3PS6 A;  5G05 J;  4LNU D;  4DLO A;  3Q7A A;  3AU4 A;  4KYO B;  3E30 A;  1JCQ A;  3EDT B;  2B0O E;  4BY6 A;  3D9L A;  3JXJ A;  2B6C A;  3MKQ A;  3UM2 A;  3AS4 A;  2AXZ A;  4Q69 A;  3FUH A;  4FU3 A;  3KSL A;  4G23 A;  2XEV A;  3TAX A;  4JVS A;  3FTX A;  3FTU A;  3ZYK A;  2PNN A;  3C3R A;  1L5J A;  3EHN A;  4U0S A;  4QQI A;  4CGV A;  1OCZ E;  3NQP A;  1OWO A;  1ELR A;  1HZ4 A;  1JWG A;  1WDY A;  1N4R A;  1RZ4 A;  2HM8 A;  3RJV A;  4O1P A;  2Y4T A;  5BXU A;  2KBX A;  3G2S A;  1DC2 A;  4U63 A;  2DWZ A;  4DI4 A;  1G3N B;  5AQB A;  4DLQ A;  4HRL A;  4KXK B;  3TXM A;  4Q96 A;  2EIN E;  5ITZ F;  2WXP A;  3SFZ A;  4BT8 A;  2KAT A;  2FO7 A;  5JHB A;  2AXV A;  2V4L A;  1OWN A;  3R9M A;  3OTN A;  5C2Y A;  2R2L A;  2ZGD A;  2GGF A;  1QNF A;  3T9K A;  4P29 A;  5ANL A;  5B1B E;  4I9C A;  4ILG A;  4OVU A;  5KNG A;  4BTA A;  1MZC A;  2Y1L E;  2VTB A;  3GW4 A;  3U64 A;  3UM0 A;  5AYW D;  3CHP A;  5BV0 A;  1YA0 A;  5CED B;  5CRV A;  3FUJ A;  3SY2 A;  2VJ8 A;  3MCX A;  4EBA G;  2EQX A;  4U8Y D;  3W9G A;  1U3D A;  1O1R A;  2VQ2 A;  4MRU A;  4RG9 A;  3ZHE B;  2CFU A;  2I9C A;  2WQ7 A;  3PEV B;  3RKV A;  3APF A;  3ZW3 A;  4JHJ A;  4Y6W A;  4GAA A;  1FCH A;  2GRO B;  5EYP F;  3NAW A;  1SA4 A;  3I4R B;  3IHY A;  2DYS E;  2VGY A;  4I1O B;  5LCW C;  2P9K G;  5JJ7 A;  3MV2 B;  2GW1 A;  4TXQ A;  1O5M A;  4I1M A;  5M72 A;  4J7W A;  5KNH D;  4HXI A;  3C98 A;  2F8Y A;  4J0U A;  3QNK A;  2ZGG A;  1EF1 C;  4KZ0 A;  2PL2 A;  3V2O A;  3AG4 E;  5FIO A;  3Q49 B;  1OWM A;  4MLP A;  4ACK A;  3C3Q A;  5EX3 A;  3NF1 A;  4AY6 A;  1UN8 A;  4JHK A;  5CEA A;  4L2Y A;  4APF A;  4LSZ E;  2C0L A;  1RW2 A;  3QDN A;  4C9B B;  4LER A;  2OV8 A;  3QAR A;  3SGH A;  5A6C A;  2RFA A;  4BET A;  2XPZ A;  4JW1 A;  4NAC A;  2ETA A;  2P2C P;  3UM3 A;  3JUI A;  4BEP A;  1IKN D;  5D2M C;  4JEH A;  1MX2 A;  4XKC A;  5FQ6 A;  3DEP A;  3FHE A;  4J8E A;  4M3O A;  3ZUV B;  3QWP A;  4CEM A;  1E7U A;  5T4Y A;  3TWR A;  3ONL A;  4U07 A;  2YIN A;  3DEO A;  3ASF A;  4N39 A;  3EHR A;  4G8L A;  1YYH A;  1TJF A;  4XE0 A;  4HVB A;  3LVR E;  1SW6 A;  5FQ7 A;  1X5B A;  3FUE A;  2R5S A;  4AJW A;  2XHE A;  3CKC A;  4FC8 A;  4DRX E;  4LNB A;  2IJG X;  1JCR A;  5CCM A;  4I9E A;  1KLX A;  2WPV A;  2XZD G;  1S70 B;  1E8X A;  2LSU A;  4HOR A;  2FBN A;  3Q73 A;  3RIB A;  1EDU A;  3I5P A;  3C3O A;  1LF8 A;  2LSV A;  4RLY A;  4PUC A;  4O1O A;  1HX8 A;  1TN7 A;  2BUG A;  2LAH A;  2ZIR A;  2XPY A;  4HOS A;  5E76 A;  3PEU B;  4UWG A;  3EJN A;  3HXD A;  5AIJ A;  4GYO A;  2AWI A;  2PZI A;  1S63 A;  2WQH A;  2WXM A;  4DX6 D;  5HI7 A;  2RFM A;  2ZU6 B;  5ARF A;  3ABL E;  2DCP A;  3DPD A;  3G2W A;  4K5C A;  2MOW A;  3UIO C;  1OY3 D;  4FLH A;  1V55 E;  4HLE A;  2WXL A;  4EHM A;  3D9P A;  1OT8 A;  4B89 A;  3J5P A;  3PZ4 A;  3CK7 A;  3HXC A;  4PH4 B;  2DVW A;  4F53 A;  5AJL A;  4BSX A;  1BD8 A;  3KSQ A;  4WWO A;  4DX1 A;  1QQE A;  3UT8 A;  2RKK A;  4HLL A;  4AV7 A;  3TWX A;  3G2U A;  4X8Q A;  3RO3 A;  3QB2 A;  1N52 A;  3HYM B;  2IFU A;  3CVL A;  3EIQ C;  2JLB A;  2XCC A;  2GRM A;  2XZT G;  1UJK A;  3EHM A;  1H6K A;  1NFI E;  1UG3 A;  2V8S E;  4G25 A;  5KJK A;  1K1A A;  3ZXP A;  1TN6 A;  2FO1 E;  4CT0 A;  4F3V A;  2KZT B;  4PS3 A;  5CRU A;  3D9H A;  2KXP C;  4I6E A;  4ANX A;  1VDY A;  2R59 A;  5LCW J;  3Q15 A;  4GB9 A;  2P9L G;  4FA6 A;  2VYI A;  4ANV A;  1Z6T A;  4G2V A;  4YND A;  2WMO A;  1SZ9 A;  3VLF A;  2YQ8 A;  5LFA A;  3FU5 A;  1H2T C;  2P9U G;  4XI9 A;  3LY9 A;  1N95 A;  3SZ7 A;  4GCN A;  3QJZ A;  3R7R A;  1MHQ A;  3EUV A;  2IO3 C;  4I2W A;  4MBG A;  3V30 A;  3U9W A;  4FHK A;  5G55 A;  4A3T A;  1UJJ A;  2E2E A;  4U7E B;  3FP3 A;  2MRI A;  4ME2 A;  5FIN A;  3FH7 A;  1HG2 A;  3PNT B;  3B7B A;  5KWD A;  2P9P G;  4CYM D;  4IN3 B;  2WXF A;  3ZNG A;  1FPP A;  3PRE A;  3B7U X;  3FU6 A;  1P5Q A;  3EU9 A;  1XNF A;  3UPV A;  2PQR A;  3UM1 A;  1QBQ A;  1QZ2 A;  3FTV A;  3PRZ A;  1HF8 A;  3HVE B;  4UWF A;  1DVP A;  3CQC B;  3ENE A;  4HQD A;  3LS8 A;  4C48 B;  2LXM A;  4ATZ D;  1OWP A;  1KZO A;  3LCA A;  3CR3 A;  1UW4 B;  3Q75 A;  2J09 A;  4WND A;  3UT7 A;  5BPP A;  2F37 A;  4BSZ B;  3L6A A;  1W3B A;  5KJN A;  2DZN A;  3KAE A;  3HXE A;  2L0T B;  4PDX A;  4A3V A;  4LG6 A;  3D9I A;  3E32 A;  3FUD A;  3PE4 A;  4K0R A;  1TNY A;  3NB2 A;  4AOF A;  1E8Y A;  3AS8 A;  5CBO A;  3RRU A;  4FP7 A;  4XZ4 A;  1H6P A;  3Q78 A;  4JD2 G;  4N5C A;  3QAQ A;  3TXN A;  2KZT A;  3D9M A;  1BU9 A;  1JCS A;  3X2Q E;  2P9I G;  4TRQ A;  3LJ3 A;  3V79 K;  2XGM A;  2ION A;  3FTY A;  1NL4 A;  2XRZ A;  3Q7F A;  4A1S A;  3TG4 A;  4EQF A;  3HVE A;  5EDS A;  5KJL A;  4XKB A;  2I1K A;  3L16 A;  2GRR B;  2XEE A;  4E85 A;  4JXT A;  3ULQ A;  3UX4 A;  5ANR A;  2Y4U A;  3ISM C;  3L08 A;  4PS8 A;  2P9S G;  1TN8 A;  5EN5 D;  2J49 A;  1ELK A;  2KM4 A;  3DBS A;  3CHS A;  4FJZ A;  4GCO A;  4UQX A;  1K1B A;  4XI0 A;  3CVU A;  2LNI A;  2H6I A;  2Y3A A;  4TV3 A;  3UIN C;  4RG6 A;  4GTT A;  4WNF A;  2XGS A;  3FDH A;  2KCV A;  2KCK A;  5FWQ A;  3S2A A;  2DIW A;  3ZGQ A;  1YCS B;  4CDR A;  4URK A;  1BI8 B;  2Y0B G;  2Y69 E;  4HRN A;  4GZ3 A;  1BI7 B;  2V0P A;  3NZU A;  3SO8 A;  5EIB E;  3DST A;  5ENN A;  2XS8 A;  5CER B;  3AAA C;  1TJC A;  5B1A E;  4N2S A;  2CFZ A;  4H7X A;  4W9R A;  3TJP A;  3D9K A;  4LRZ A;  1X81 A;  4L2L A;  2UY1 B;  4J8S A;  4KVM A;  5CHE E;  2PM7 A;  1ZBP A;  3OXF A;  4UUC A;  3J5Q B;  5D0Q D;  4HOU A;  1D9S A;  4N3C A;  4G24 A;  4I6J A;  5D0O D;  4JA9 A;  1D8D A;  2Q7F A;  3DSW A;  5FT9 A;  4DI3 A;  2VSX E;  3B95 A;  2C0M A;  4V3I A;  4I6G A;  2ETC A;  3QWV A;  3JXI A;  3APD A;  2DZO A;  3SD5 A;  3FUI A;  3FUL A;  4UWL A;  1NP7 A;  3MGB A;  1IYG A;  3DXM G;  2ETB A;  3T5X A;  3LPZ A;  2QY7 A;  5AQ7 A;  3IXE A;  3NOC D;  3I3N A;  5JJT A;  4BES A;  4CT4 A;  3SF4 A;  3CVP A;  2IQC A;  3FTZ A;  3KEA A;  1H2V C;  2FUL A;  3I4G A;  3SNX A;  1MJ0 A;  1LD8 A;  3LDZ A;  1H6O A;  4DX2 A;  5ENQ D;  4OAV B;  2A4Z A;  3JQ1 A;  4CDN A;  2DYR E;  4IYP A;  4YDY A;  3UMV A;  1KT0 A;  4F1S A;  1DNP A;  4BTB A;  2JEK A;  1A5E A;  4Q94 A;  3WG7 E;  3ULE G;  4WWN A;  1E96 B;  4DX5 D;  2KCL A;  1BPO A;  4FJY A;  3EHQ A;  1GW6 A;  2YNQ A;  4CZ2 D;  3MJW A;  1NI1 A;  3DXK G;  2EIK E;  3V2X A;  4HOT A;  4L1B A;  3DPY A;  2AVP A;  4QFV A;  3QC1 A;  3ZKJ A;  2WQ6 A;  5EID A;  1U3C A;  5ENT D;  3Q79 A;  2P58 C;  2WMN A;  2OVB A;  5G05 C;  3D3M A;  3PZ3 A;  1H19 A;  3SBT B;  5KCM A;  1UOH A;  4BWR A;  4DK5 A;  1TEZ A;  2WXH A;  2XRY A;  3DWL G;  3MYV A;  1N94 A;  5AEN A;  3L17 A;  4JB8 P;  1S0P A;  5G2N A;  3CHR A;  4U96 D;  2WXJ A;  3B13 A;  2BTD A;  3UKU G;  2X6H A;  1H2U A;  1XGW A;  5T3R A;  3GZ1 A;  1K3Z D;  1MYO A;  2HO1 A;  2R17 C;  3MKR A;  3IEG A;  2LXL A;  1FVH A;  3CEQ A;  3FTW A;  4GTO A;  2PQN A;  5A7D B;  4CRW A;  3Q9U C;  4CCA A;  4GMR A;  3Q9N C;  2P9N G;  3ZRH A;  3IHV A;  2WB2 A;  3FU3 A;  1LD7 A;  2M63 A;  2WXG A;  1HFA A;  4GZ6 A;  3W9F A;  3AG2 E;  1OUV A;  3UXG A;  4GA1 A;  1IQU A;  5HRY A;  1NA3 A;  4ABN A;  3KEZ A;  4JL0 A;  3CK8 A;  5H7P A;  3CVW A;  4N2Q A;  4KMO A;  2CHW A;  3T5V A;  2J9Q A;  1TNB A;  3UT4 A;  2H6G A;  1KZP A;  1SA5 A;  4F7A A;  5LP0 A;  5AN8 A;  4KT6 B;  4GZC A;  4ANW A;  3TGO A;  2CHZ A;  1BLX B;  1WG0 A;  4AXH A;  4Z68 A;  4LCT A;  4GPM A;  4IRU A;  4YVQ C;  4LUN U;  3PH0 C;  4A55 A;  4TXR A;  3TWT A;  3EU5 A;  5FZR A;  2J4B A;  2AXU A;  2WXQ A;  1UN9 A;  4J8F A;  4B94 A;  4BFR A;  1KPS B;  5FJY A;  2J07 A;  1TNO A;  2L6J A;  3BG1 B;  5KBA A;  5FZQ A;  5HS0 A;  5BV1 A;  1FT1 A;  3TWQ A;  3DSU A;  4JEU A;  3IV0 A;  1OWL A;  2OEV A;  4CDM A;  5E75 A;  3B7T A;  5AQA A;  4GTM A;  4UI9 C;  5EX0 A;  2R02 A;  1HE8 A;  2XCB A;  3QWW A;  1E8Z A;  5CBN A;  2JAB A;  3RK6 A;  1NZN A;  1TNZ A;  4EZJ A;  3LXU X;  3DSX A;  2ZIS A;  3URZ A;  1Y6I A;  3WXX A;  3D9O A;  5BXO A;  4AP2 A;  1PY1 A;  3UKR G;  5CCL A;  3VTX A;  3UQ3 A;  5ENP D;  5EKQ D;  2WXN A;  3CLJ A;  2L6B A;  2HE0 A;  5EYL A;  4HBD A;  2IEJ A;  5T8I A;  3S7D A;  1IQR A;  4GML A;  1V54 E;  3LYA A;  4O6F A;  4RVB A;  2VSO E;  3O4Z A;  2WXK A;  2VGX B;  3NOG D;  3QOU A;  5EIL A;  4DPR A;  4JA7 A;  4F1P A;  5ENR D;  4XIF A;  3Q4A B;  3FUK A;  4J6I A;  5JJ6 A;  2NSZ A;  2QC9 A;  1OCO E;  5AAO A;  4U0Z A;  3LY8 A;  2GRP B;  2FI7 A;  3K9I A;  4FUL A;  2UWJ G;  3RU0 A;  4GA2 A;  2BKG A;  4KBQ A;  2LAI A;  4GTS A;  1IXV A;  2CHX A;  4YDO A;  3R9A B;  2UY1 A;  3ZYQ A;  3PUJ A;  4WNE A;  3CV0 A;  2XGO A;  3U3W A;  3N71 A;  2V5F A;  3FWV A;  4HB5 A;  4EBA A;  3ZEF A;  2NYJ A;  3ML8 A;  4OAU C;  4NIK A;  1E7V A;  2QFC A;  2OCC E;  4HRM B;  2H6H A;  3UUX A;  4FAD A;  4J8Y A;  3ZYM A;  5FTP A;  3TWV A;  5KJM A;  4AY5 A;  1OCC E;  4YDW A;  4BER A;  4UWH A;  4EZL A;  3L13 A;  3CST A;  2V4H C;  5J08 A;  3CSF A;  4JHR A;  3FH8 A;  3E33 A;  4L7T A;  3ONK A;  1IHB A;  3CKB A;  1Z3X A;  2IU1 A;  1ELW A;  4HOQ A;  1O1T A;  3ASN E;  4CGW A;  4WWP A;  2EIJ E;  1OXJ A;  3PE3 A;  3LKU A;  2A5E A;  3ZN3 A;  4JC8 A;  3TG5 A;  4R7L A;  4NUR A;  3UIP C;  2BKK B;  3TL5 A;  3PZ1 A;  3MEK A; 
#chains in the Genus database with same CATH homology
 3CKC A;  4FC8 A;  4A1G A;  4B8A A;  3CVV A;  4BX9 A;  4BT9 A;  2AW6 A;  3NZS A;  4V3I A;  1E90 A;  4I6G A;  2IJG X;  5AJD A;  3QWV A;  5CCM A;  4I9E A;  3ML9 A;  1KLX A;  2WPV A;  3EIJ A;  4U0U A;  3APD A;  4GPK A;  1KT1 A;  2NXP A;  1E8X A;  3FEY A;  4FLB A;  5FQ8 A;  2LSU A;  3SD5 A;  3FUI A;  5BUZ A;  3FUL A;  3PZD A;  2FBN A;  4UWL A;  1NP7 A;  1A17 A;  3MGB A;  3RIB A;  1EDU A;  3RRN B;  5A23 A;  2WXO A;  1IYG A;  3I5P A;  2VSY A;  3T5X A;  3LPZ A;  2QY7 A;  1LF8 A;  2LSV A;  3ASH A;  4MS6 A;  3I3N A;  3U66 A;  5JJT A;  4PUC A;  4G1T A;  4CT4 A;  3SF4 A;  3CVP A;  4ATG A;  4B0Z A;  2IQC A;  2X6J A;  3FTZ A;  1HX8 A;  1H2V C;  2BUG A;  2LAH A;  3B7R L;  2FUL A;  3I4G A;  3SNX A;  2XPY A;  4HOS A;  5E76 A;  3PEU B;  2X3M A;  4UWG A;  3EJN A;  3LDZ A;  5AIJ A;  4GYO A;  3ASG A;  2AWI A;  2PZI A;  1SQM A;  2I1J A;  2WQH A;  2WXM A;  3VTY A;  3HIZ A;  5HI7 A;  2ZU6 B;  1INZ A;  5ARF A;  2J4D A;  4EPZ A;  3G2T A;  4OYS A;  2A4Z A;  2DCP A;  3DPD A;  3G2W A;  3JQ1 A;  2MOW A;  4CDN A;  2BF0 X;  3G2V A;  5LX8 A;  4IYP A;  4FLH A;  3ZXS A;  3UMV A;  4BX8 A;  1KT0 A;  4OVV A;  3S7B A;  2WXL A;  1DNP A;  4F1S A;  3D9P A;  4HLE A;  4BTB A;  2JEK A;  1MQS A;  3PDN A;  1HU3 A;  5G04 J;  4B89 A;  4Q94 A;  4NQ0 A;  3S7J A;  3CK7 A;  2RG8 A;  4WWN A;  4PH4 B;  3VLD A;  2L9B A;  4F53 A;  1E96 B;  1JUQ A;  5AJL A;  2KCL A;  4BSX A;  1BPO A;  4FJY A;  3ZIM A;  4WWO A;  5C1D A;  3LY7 A;  1GW6 A;  4AIF A;  1QQE A;  2L0I A;  2YNQ A;  3UT8 A;  3ZPJ A;  4TUU A;  5J90 A;  3MJW A;  3CVY A;  2E0I A;  3Q5M A;  3PNL B;  1EPU A;  3CHQ A;  2MHK A;  4AV7 A;  2OOE A;  4GMJ A;  4L1B A;  4HOT A;  3LEW A;  3KS2 A;  2ILR A;  3AS5 A;  3G2U A;  3RO3 A;  2AVP A;  3QB2 A;  4QFV A;  3FUF A;  4HFG A;  3QC1 A;  1HXI A;  1N52 A;  2WQ6 A;  3HYM B;  2X6I A;  3MA5 A;  1U3C A;  1E8W A;  4GYY A;  1N54 A;  2IFU A;  3CVL A;  1EYH A;  3EIQ C;  2JLB A;  3P1U A;  3R7Q A;  2OVF A;  2P58 C;  2XCC A;  2GRM A;  1UJK A;  2WMN A;  2OVB A;  4ACL A;  4AEZ C;  4N3A A;  3EHM A;  1H6K A;  4LEU A;  3JYS A;  5DIZ A;  5CMY A;  5G05 C;  3MKQ B;  1WM5 A;  1UG3 A;  3D3M A;  2V8S E;  2I6H A;  1H19 A;  4G25 A;  5KJK A;  4GZ5 A;  4Y6C A;  4G11 A;  3L22 A;  5G04 C;  5HQ8 A;  3ESL A;  3SBT B;  3P2B A;  5BNW A;  3FEX A;  5BW8 C;  2OND A;  4CT0 A;  2KZT B;  2X38 A;  5KCM A;  4BWR A;  4F3V A;  4PS3 A;  1NA0 A;  4I43 A;  3GYZ A;  4I6E A;  4ANX A;  2RD0 A;  1VDY A;  2R59 A;  4UQY A;  5LCW J;  3SBS A;  3Q15 A;  2FEZ A;  1ZU2 A;  3AU5 A;  3OXG A;  2WXH A;  2XRY A;  3MYV A;  4GB9 A;  4J8D A;  5FQ4 A;  4DK5 A;  5AEN A;  4FA6 A;  2VYI A;  3L17 A;  1S0P A;  5G2N A;  2WVI A;  3CHR A;  3ESK A;  4RSY A;  1H0A A;  4WAF A;  4FHJ A;  4ANV A;  1Z6T A;  2WXJ A;  4ILI A;  4WNG A;  3PS6 A;  4G2V A;  5BT1 A;  1TEZ A;  3B13 A;  2BTD A;  2X6H A;  4YND A;  1H2U A;  1XGW A;  2WMO A;  5G05 J;  5T3R A;  3GZ1 A;  1SZ9 A;  4C0M A;  3VLF A;  2YQ8 A;  2HO1 A;  2R17 C;  5LFA A;  3FU5 A;  3MKR A;  4DLO A;  3IEG A;  1Z3Y A;  1H2T C;  2LO6 A;  3AU4 A;  1Y8M A;  4XI9 A;  3LY9 A;  4KYO B;  1FVH A;  3SZ7 A;  3CVN A;  4GCN A;  3QJZ A;  3CEQ A;  3FTW A;  3R7R A;  4E6H A;  2PQN A;  3EDT B;  5A7D B;  4BY6 A;  4CRW A;  1MHQ A;  4CCA A;  3D9L A;  3ZRH A;  4I2W A;  3IHV A;  3U9W A;  3MKQ A;  4FHK A;  2WB2 A;  4IUL A;  5G55 A;  3AS4 A;  4A3T A;  3FU3 A;  2AXZ A;  1UJJ A;  2HYZ A;  4Q69 A;  2M63 A;  4H7Y A;  2WXG A;  2E2E A;  3FUH A;  4FU3 A;  1HFA A;  4GU5 A;  4GZ6 A;  3SI5 A;  3FP3 A;  4G23 A;  1OUV A;  4B8C B;  2MRI A;  4ME2 A;  3FH7 A;  4GA1 A;  1HG2 A;  1HH8 A;  2XEV A;  1IQU A;  3TAX A;  4JVS A;  4GYW A;  3FH5 A;  3PNT B;  3FTX A;  3FTU A;  3ZYK A;  1NA3 A;  4L23 A;  3KEZ A;  3HDX A;  4ABN A;  4JL0 A;  3CK8 A;  3GZ2 A;  3JQ0 A;  1L5J A;  3CVW A;  4N2Q A;  3EHN A;  4KMO A;  4U0S A;  2CHW A;  3QK0 A;  3CGH A;  2IOL A;  4CGV A;  2GRL A;  4IN3 B;  2WXF A;  4APO A;  3CQG B;  3T5V A;  2J9Q A;  3ZFW A;  1IHG A;  2J08 A;  3UT4 A;  3PRE A;  3MX3 A;  4F7A A;  5LP0 A;  5LOZ A;  5ARG A;  3B7U X;  3NQP A;  1OWO A;  4KT6 B;  1ELR A;  3D9J A;  3FU6 A;  1P5Q A;  4GZC A;  3T8M A;  4ANW A;  1XNF A;  1HZ4 A;  1JWG A;  3TGO A;  3UPV A;  2PQR A;  2PM6 A;  2XQ0 A;  2CHZ A;  2HM8 A;  4AXH A;  4GA0 A;  4C0E A;  3RJV A;  4LCT A;  2DBA A;  2IF4 A;  2YHC A;  2Y4T A;  4IRU A;  2IOS A;  1QZ2 A;  3FFL A;  3FTS A;  4JPS A;  4YVQ C;  3FTV A;  3PRZ A;  1SZA A;  3PH0 C;  4LUN U;  4A55 A;  5DBK A;  3G2S A;  1HF8 A;  2I2O A;  4UWK A;  3HVE B;  5FZR A;  2J4B A;  4JZY A;  3ZVV A;  2AXU A;  4UWF A;  1DVP A;  4U63 A;  3CQC B;  4DI4 A;  4K03 A;  3ENE A;  3LS8 A;  1B89 A;  2WXQ A;  4ILH B;  1UN9 A;  4J8F A;  1OWP A;  3APC A;  4B94 A;  4BFR A;  4DLQ A;  3ASD A;  4KXK B;  3LCA A;  3QKY A;  3TXM A;  3CR3 A;  1UW4 B;  5FJY A;  4Q96 A;  2J07 A;  3UT7 A;  2J09 A;  2L6J A;  4WND A;  3BG1 B;  2WXP A;  3SFZ A;  5FZQ A;  4BT8 A;  5BPP A;  1PC2 A;  2FO7 A;  2KAT A;  5BV1 A;  5JHB A;  2AXV A;  2V4L A;  3CIA A;  3IKO B;  1OWN A;  2X6K A;  3MV3 B;  3ZHE A;  3L6A A;  3S7F A;  4JEU A;  3OTN A;  1W3B A;  5C2Y A;  3IV0 A;  1OWL A;  2VTB B;  5KJN A;  3KAE A;  4PDX A;  2L0T B;  4CDM A;  5E75 A;  3B7T A;  2XPI A;  2GGF A;  1QNF A;  4A3V A;  4UI9 C;  3D9I A;  4P29 A;  5ANL A;  5EX0 A;  3FUD A;  3PE4 A;  1HE8 A;  2XCB A;  4I9C A;  3ZYL A;  4ILG A;  4OVU A;  4K0R A;  4BTA A;  3QWW A;  1E8Z A;  2VTB A;  3RK6 A;  3GW4 A;  3U64 A;  1NZN A;  5AYW D;  4EZJ A;  3CHP A;  1E8Y A;  4AOF A;  1YA0 A;  3AS8 A;  3E4B A;  1HS6 A;  5BV0 A;  3LXU X;  3FUJ A;  3RRU A;  4FP7 A;  3PUK A;  3O48 A;  4XZ4 A;  2WXI A;  2VJ8 A;  3MCX A;  4N5C A;  4G26 A;  3QAQ A;  5FZS A;  3TXN A;  4EBA G;  2KZT A;  2EQX A;  3D9M A;  1U3D A;  2VSN A;  2VQ2 A;  4MRU A;  2CG3 A;  3URZ A;  1Y6I A;  4RG9 A;  3ZHE B;  3WXX A;  3FUM A;  2CFU A;  3D9O A;  4TRQ A;  4AP2 A;  3LJ3 A;  1PY1 A;  2I9C A;  2WQ7 A;  2XGM A;  5CCL A;  3PEV B;  3RKV A;  3APF A;  3ZW3 A;  3KD7 A;  4JHJ A;  2ION A;  3VTX A;  4Y6W A;  3UQ3 A;  3FTY A;  4GAA A;  3OXL A;  1FCH A;  2XRZ A;  5EKQ D;  4A1S A;  4EZK A;  1JPL A;  2WXN A;  3CLJ A;  4I2Z A;  2CG2 A;  3TG4 A;  3CHM A;  3I4R B;  4EQF A;  3HVE A;  3VLE A;  3IHY A;  5EDS A;  5KJL A;  4XKB A;  1HG5 A;  3CHO A;  2VGY A;  4I1O B;  3U4T A;  3B7S A;  5T8I A;  3S7D A;  2I1K A;  1HO8 A;  3L16 A;  4UI9 K;  1JWF A;  3HHM A;  1IQR A;  4GML A;  3LYA A;  3RRM B;  5LCW C;  4O6F A;  3BEE A;  4RVB A;  4E85 A;  2VSO E;  3MV2 B;  3O4Z A;  5JJ7 A;  4HOR A;  2GW1 A;  4JXT A;  4I1A A;  3ULQ A;  2FF4 A;  4I1M A;  2WXK A;  5M72 A;  2KC7 A;  4HXI A;  2VGX B;  3C98 A;  4PS7 A;  4KZC A;  5ANR A;  3UX4 A;  4HS2 A;  3QOU A;  4DPR A;  2Y4U A;  3L08 A;  4J0U A;  4PS8 A;  4JA7 A;  3QNK A;  1EF1 C;  4KZ0 A;  4AVX A;  4MKT A;  2PL2 A;  2HR2 A;  4KVO A;  4XIF A;  3Q4A B;  3FUK A;  3PVL A;  4J6I A;  3Q49 B;  5JJ6 A;  2J49 A;  1ELK A;  3DBS A;  2KM4 A;  2NSZ A;  3CHS A;  4FJZ A;  1OWM A;  4U0Z A;  3LY8 A;  4GCO A;  4MLP A;  4UQX A;  4ACK A;  2FI7 A;  4YVO A;  4D10 C;  3K9I A;  4FUL A;  4XI0 A;  2UWJ G;  3RU0 A;  4GA2 A;  4UI9 J;  1WY6 A;  3CVU A;  2LNI A;  3FUN A;  3SHF A;  4ANU A;  5EX3 A;  2Y3A A;  4KBQ A;  4TV3 A;  3NF1 A;  4AY6 A;  1UN8 A;  3CVQ A;  4JHK A;  3Q47 B;  2NC9 A;  2LAI A;  4L2Y A;  2CHX A;  3GZS A;  3R9A B;  4APF A;  2UY1 A;  3ZYQ A;  3JCK C;  3PUJ A;  4WNE A;  3CV0 A;  3OAW A;  2XGO A;  3U3W A;  4RG6 A;  3N71 A;  2C0L A;  5CMW A;  2V5F A;  4U04 A;  3IBE A;  4WNF A;  2XGS A;  3FDH A;  3FWV A;  4I17 A;  1PAQ A;  3QDN A;  2KCV A;  4C9B B;  2KCK A;  4LER A;  4EBA A;  3FU0 A;  3ZEF A;  3ML8 A;  5FWQ A;  3S2A A;  2OV8 A;  2DIW A;  3ZGQ A;  3QAR A;  3SGH A;  1E7V A;  2QFC A;  5A6C A;  4CDR A;  2A5U A;  2XPZ A;  4JW1 A;  4URK A;  4NAC A;  4DJA A;  2VGX A;  4FAD A;  3UUX A;  2YHE A;  3ZYM A;  3CK9 A;  3JUI A;  4GZ3 A;  5FTP A;  5KJM A;  4AY5 A;  2V0P A;  3NZU A;  4JEH A;  3D9N A;  3RO2 A;  4UQZ A;  5ENN A;  4UWH A;  4EZL A;  3FY4 A;  4XKC A;  5FQ6 A;  3BG0 B;  1TJC A;  3L13 A;  4XX5 A;  2WXR A;  3CST A;  3FHE A;  2CFZ A;  4N2S A;  3L54 A;  4H7X A;  4J8E A;  3MZL B;  2X6F A;  3D9K A;  4LRZ A;  4W9R A;  3TJP A;  3CSF A;  4JHR A;  4M3O A;  5J08 A;  3FH8 A;  4L2L A;  3QWP A;  4L7T A;  3ONK A;  4CEM A;  3CKB A;  1Z3X A;  1E7U A;  3CVX A;  5T4Y A;  1WAO 1;  2UY1 B;  4J8S A;  4AM9 A;  3LVQ E;  3ONL A;  4KVM A;  5CHE E;  2IU1 A;  4EEC A;  2PM7 A;  4U07 A;  1ZBP A;  2YIN A;  1ELW A;  3OXF A;  4HOQ A;  4GZD A;  4U8H A;  1FVF A;  3ASF A;  4CGW A;  5D0Q D;  4N39 A;  4HOU A;  2C2L A;  4N3B A;  4WWP A;  4N3C A;  4WUY A;  3PE3 A;  3LKU A;  4G24 A;  4I6J A;  3ZN3 A;  4JC8 A;  3TG5 A;  1TJF A;  2WM9 A;  4R7L A;  4XE0 A;  4HVB A;  3LVR E;  4NUR A;  4JA9 A;  5D0O D;  5FQ7 A;  2Q7F A;  5FT9 A;  3TL5 A;  1X5B A;  3FUE A;  4NRH B;  4DI3 A;  2R5S A;  2VSX E;  4AJW A;  5JHA A;  3MEK A;  2XHE A;  2C0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...