1YA0A

Crystal structure of the n-terminal domain of human smg7
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
497
structure length
458
Chain Sequence
b'MSLQSAQYLRQAEVLKADMTDSKLGPAEVWTSRQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQITTLQGQAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTQSSSCSYICQHCLVHLGDIARYRNQTSQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNLQKALSKALESRDEVKTKWGVSDFIKAFIKFHGHVYLSKSLEKLSPLREKLEEQFKELLFQKAFNSQQLVHVTVINLFQLHHLRDFSNETEQHTYSQDEQLCWTQLLALFMSFLGILCKCPLQNSQEESYNAYPLPAVKVSMDWLRLRPRVFQEAVVDERQYIWPWLISLLNSFHPHEEDLSISATPLPEEFELQGFLALRPSFRNLDFSKGHKEGQQRRIRQQRLISIGKWIADNQPRLIQCENEVGKLLFITEIPELILEDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SMG-7 transcript variant 2
publication title SMG7 Is a 14-3-3-like Adaptor in the Nonsense-Mediated mRNA Decay Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 166
structure length 458
sequence length 497
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10373 EST1_DNA_bind Est1 DNA/RNA binding domain
A PF10374 EST1 Telomerase activating protein Est1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1ya0A01
4UQZA 5FTPA 4HOUA 5JJ6A 4I2WA 4BTAA 2LSUA 5BT1A 5LCWC 4B94A 2LNIA 4GA1A 4HORA 2VGXA 4GYWA 3S7FA 3CV0A 1WAO1 2UWJG 2XCBA 2KCVA 2KATA 3CKCA 2XEVA 3UPVA 4N39A 3OXFA 4BWRA 4JHRA 2UY1A 4UI9J 1HH8A 2DBAA 3TAXA 2FO7A 1E96B 4HOSA 3MA5A 2J9QA 4GZ5A 4NQ0A 4U04A 3AS5A 3QKYA 4G26A 3LYAA 3LPZA 1A17A 3CKBA 4F3VA 4H7YA 4GCNA 2C0LA 3CVQA 2Y4UA 1NA0A 4YVQC 5KJLA 3NF1A 3RO3A 5KJMA 5G04J 5M72A 3U4TA 3FWVA 4XI0A 3IEGA 5JJTA 3CK7A 2ONDA 3ZHEA 4KYOB 5D0QD 3KD7A 4HOTA 2Y4TA 4Y6CA 5LCWJ 4J0UA 4GA0A 5D0OD 1XNFA 4G24A 2IF4A 3AS4A 3PE4A 2QFCA 4G1TA 1QZ2A 1IHGA 2VSNA 4WNGA 3TG4A 3R9AB 4Y6WA 3FP3A 4GCOA 4AY5A 2YQ8A 4U0SA 3LKUA 1W3BA 5FZQA 2VSYA 3WXXA 3MEKA 3U3WA 3EDTB 3O48A 1NA3A 3KAEA 5CCLA 2LSVA 5G04C 5EKQD 4GZ6A 4WNEA 2PQRA 4J8DA 4ME2A 4AIFA 3LY8A 3URZA 3CK9A 3RJVA 4JA9A 5A6CA 1ELRA 4I2ZA 4N3BA 1OUVA 1YA0A 3Q4AB 2NC9A 4EQFA 3CVPA 4XI9A 3MV2B 2YHCA 3CVNA 3ZPJA 3TG5A 4G25A 3GZ2A 3CVLA 4N2SA 3QOUA 4UI9K 4JL0A 4N5CA 3RU0A 3CEQA 1B89A 2MHKA 5BNWA 2IFUA 5HI7A 3SZ7A 3Q15A 2R5SA 1IYGA 4IN3B 3FFLA 4I9EA 1KT1A 3QWVA 3ASDA 5DBKA 5G05J 4UQYA 3QWWA 4I9CA 4RG9A 3KS2A 2GW1A 2WQHA 1NZNA 3RIBA 3GYZA 3ZGQA 4KXKB 4N3AA 3ZN3A 2VQ2A 2HR2A 4G2VA 3S7DA 4YVOA 4KBQA 3BEEA 2XCCA 3GW4A 3ULQA 1ZU2A 3MKRA 4JA7A 3ZHEB 4WNFA 5G05C 5KJNA 1Y8MA 5KJKA 4BT8A 2KCKA 2PQNA 2PZIA 3OXLA 1HXIA 3UUXA 4CGVA 3K9IA 4CGWA 3HYMB 5FZSA 2PL2A 2XGSA 3N71A 2HO1A 3VTXA 3S7BA 4RG6A 4GPKA 5DIZA 4N2QA 3ESKA 4I17A 3RKVA 4W9RA 2BUGA 2VGXB 1ZBPA 5ARGA 4AM9A 5AYWD 2AVPA 4GZ3A 5BW8C 3RO2A 4I1AA 4WUYA 3PE3A 5FT9A 1KT0A 3Q5MA 2UY1B 3TGOA 1TJCA 3S7JA 1KLXA 5CCMA 4YNDA 3SF4A 3JYSA 4J8EA 2HYZA 4BT9A 4XIFA 2FF4A 3UQ3A 2WPVA 3ASFA 4GYYA 2C0MA 2FEZA 4H7XA 4BTBA 3E4BA 5HQ8A 2KC7A 3MV3B 4WNDA 1QQEA 4J8FA 5JJ7A 2E2EA 5EX0A 2V5FA 3GZ1A 2OOEA 2FI7A 3PDNA 4UI9C 4AY6A 4LEUA 4G23A 4N3CA 3QWPA 4O6FA 4APOA 3ASGA 1PC2A 4UQXA 4HOQA 3Q47B 5C1DA 2XGOA 3ASHA 4A1SA 2L6JA 3CK8A 1WM5A 5CHEE 4U0UA 4ABNA 2VGYA 2P58C 4U0ZA 2JLBA 4GYOA 3ZFWA 2I6HA 4CDRA 2FBNA 2XGMA 3VTYA 1ELWA 2KCLA 3Q49B 5ARFA 5FZRA 4GA2A 3LY9A 4NRHB 5EX3A 3LY7A 1P5QA 3OXGA 2VYIA 3QDNA 4U07A 2C2LA 3LCAA 5FJYA 2Q7FA 3AS8A 5A7DB 1FCHA 1HZ4A 2XPIA
chains in the Genus database with same CATH superfamily
3FTZA 4AV7A 3CVUA 5FINA 3PZ2A 4HOUA 4DX5D 4QFVA 5BT1A 1JCRA 3UM1A 4B94A 3C3QA 1Z3YA 4GA1A 4FU3A 3EJNA 4NIKA 3UX4A 4TV3A 4LG6A 1WAO1 3FDHA 3Q9UC 4I43A 4N39A 3OXFA 2UY1A 4UI9J 3I3NA 3TAXA 4TRQA 1NFIE 2X6JA 1E96B 4I6GA 4N5QA 4FULA 4AXHA 2J9QA 2GRLA 4PDXA 2CFUA 2NXPA 4U04A 3AS5A 3ZXSA 4Q69A 2MOWA 3LPZA 1HG5A 3BQOA 4HRMB 3I4RB 1MX4A 5BXUA 2I1KA 3RSEG 4BESA 2LAHA 2Y4UA 3CHOA 3FTUA 1BI8B 1NA0A 3SGHA 5KJLA 4EPZA 4BEPA 5JJTA 2ZGGA 1HS6A 5D0QD 4NURA 1EDUA 2I9CA 4A55A 3Q79A 1HE8A 4FJZA 4B89A 4J0UA 4G24A 4A3TA 3AS4A 2QFCA 3JQ0A 3SQVA 3TWRA 4G1TA 2VTBB 3IBEA 4UWFA 4WNGA 3UI2A 3R9AB 4GCOA 4DLQA 2YQ8A 1W3BA 5FZQA 3MEKA 3U3WA 3EHRA 3ZEFA 2WXFA 1JWFA 3KAEA 1E8YA 2LSVA 5EKQD 5ITZF 2PQRA 3AG1E 4HI8A 4ME2A 2XENA 4HFGA 4HNAD 3VLDA 1ELRA 4I2ZA 3C5RA 4DI4A 4N3BA 3EU5A 4GTPA 3LVRE 1YA0A 3QJZA 5JHAA 3HXFA 1N0QA 1LD7A 2DWZA 3F6QA 2AXUA 1DC2A 4A3VA 5G2NA 5BUZA 3C98A 4IULA 4APFA 3EHQA 2KZTB 1OCZE 2X6KA 2MHKA 2DZOA 3LJNA 1O1RA 5HI7A 4KZCA 1N4QA 2R5SA 1UOHA 4BY6A 3FFLA 5CMWA 4I9EA 3ASDA 1IHBA 1MX2A 4B0ZA 1YCSB 2XRZA 1SZAA 4I9CA 4O1PA 3U9WA 4EZLA 3I4GA 1NZNA 1V55E 4L23A 3RIBA 2Y0BG 3R9MA 1WDYA 2F8YA 3ZHEB 3ASOE 4J6IA 3FTYA 2F37A 2XS1A 2WM9A 4DPRA 4U8YD 4GTSA 4CEMA 3UTMA 2KCKA 2WMNA 4MBGA 3SHFA 3NB2A 3L16A 4CGVA 3FUHA 3EHMA 2IOSA 2IY0C 2WMOA 4JHKA 3Q78A 4EECA 5JA4D 3AAAC 1TNOA 1E90A 4HQDA 3MKQB 4I17A 3RKVA 3G2WA 4HI9A 3HDXA 5ARGA 1AWCB 4JEUA 2LAIA 5KCMA 3RO2A 2X3MA 3UMVA 3L08A 4I1AA 5C2YA 2UY1B 5CEAA 5AARA 4CT0A 3TGOA 1TJCA 3CHRA 4YNDA 2H6GA 2P9SG 3B7BA 3TWUA 3IHVA 3HG0D 4AVXA 2L0TB 4GPMA 2CHXA 3G2TA 1HU3A 2XHEA 2H6IA 2AXVA 1SQMA 1K1AA 2C0MA 3CSFA 3ML9A 1H0AA 4BTBA 1IQRA 1OCOE 5HQ8A 2KC7A 3V79K 3SFXA 1FPPA 5KNGA 4LCTA 1H2VC 3J5QB 5AQAA 3CSTA 3C3OA 2V5FA 3ABLE 5ENOD 3GZ1A 4AY6A 3MJWA 4YDYA 4APOA 4KVOA 2P9KG 1PC2A 4HOQA 3HHMA 5C1DA 3CK8A 2BF0X 3S2AA 4U0UA 1Z6TA 2P58C 1BPOA 1ELWA 3B13A 1E8XA 5ARFA 4GA2A 3CHQA 4NRHB 4GMLA 1HG2A 3NOCD 5EYLA 4CT4A 3QDNA 2WXQA 3FEYA 4PS8A 4C0MA 4UQZA 5FTPA 2EIME 2LSUA 3C72A 3LJ3A 1FT1A 4HLEA 3Q73A 4GYWA 3S7FA 1H6PA 3CV0A 2KZTA 2EILE 2WXPA 1DCEA 3ISMC 2JEKA 2OV8A 3V2XA 4BX9A 1UJJA 4KMOA 1D8DA 3CKCA 2XEVA 3ENEA 2F0YA 4B8CB 4XKCA 4U96D 4HOSA 2AW6A 2AWIA 4GTQA 4M7CA 3E32A 1PAQA 2B6CA 4A63B 4UWKA 3FUDA 3X2QE 3ZRHA 3D9NA 3QKYA 3P2BA 3UKRG 3FHEA 1N95A 3UT4A 3SD5A 4K5AB 2C0LA 3PVLA 3W9FA 3ZYMA 3JUIA 3LS8A 3NF1A 3RO3A 5G04J 3FWVA 4XI0A 3CK7A 3ZHEA 3PREA 4UWGA 2WXOA 1UJKA 2Y4TA 2A4ZA 4GA0A 3D9OA 1L5JA 5D0OD 3FUJA 1XNFA 1UW4B 4U95D 2IF4A 3OAWA 4ATZD 1U3CA 4PS3A 1ELKA 3ABME 1IHGA 3J5PA 1QBQA 3NQPA 1HO8A 3TG4A 2XS8A 4Y6WA 3R7QA 1TN8A 2OVBA 4DLOA 4TXPA 2VSYA 3AU4A 2WXMA 3FU6A 2GRNB 3L6AA 3O48A 1NA3A 2RG8A 5CCLA 1ZB1A 5G04C 2H6HA 4HBDA 3URZA 5A6CA 3MKQA 3ZIMA 2B0OE 1DNPA 4GB9A 3GZSA 2X6FA 5B1AE 5LOZA 3FEXA 2J49A 4EQFA 2VGEA 3UT8A 2M63A 3KSQA 3DSXA 2X38A 2WB2A 4I6JA 4G25A 4KZ0A 1TNUA 3CVLA 4JXTA 3CGHA 3QOUA 3APCA 5CECB 4UI9K 3FTXA 3PEUB 4ILGA 1K1BA 5ENNA 4JPSA 2J4BA 3CEQA 1OWOA 1B89A 1S70B 1A5EA 4E85A 2IFUA 4DJAA 3TWWA 3SZ7A 4F6RD 4WWPA 4DI3A 3MGBA 4OYSA 3C3RA 3QC1A 3KSLA 4IN3B 4Q94A 3HVEB 3E33A 2FULA 3ONLA 4DK5A 5DBKA 5G05J 5BV1A 2Y69E 4YDEA 2ZIRA 4EZKA 4ANVA 2IU1A 2X6HA 5D2MC 5FQ8A 2CHZA 4RG9A 5T3RA 4L7TA 3KS2A 3JXIA 3OTNA 2ETAA 2WQHA 3UKUG 2I2OA 5AQBA 4GMRA 4ATGA 5KBAA 3ZGQA 3QB2A 2VSXE 4ILIA 2HR2A 4TUUA 4G2VA 3S7DA 4YVOA 2XCCA 2QY7A 3TWVA 3GW4A 4J7WA 3NOGD 3MKRA 1LD8A 2ILRA 4WNFA 2V0PA 5G05C 3FUMA 3FTSA 2RKKA 5KJNA 2NYJA 5KJKA 3UM0A 4BT8A 2PQNA 3OXLA 1Z3XA 3UUXA 4R7LA 5FQ7A 2PNNA 3FTWA 3R7RA 1DVPA 3K9IA 3PS6A 5CEDB 4I1OB 1H6KA 1OCCE 5FZSA 4TXRA 2R17C 1SW6A 4L1BA 3AG2E 2EQXA 4GZCA 3G2SA 2WXIA 2AXZA 4U8VD 1NP7A 3VTXA 4P29A 1UN9A 5G55A 1E7VA 1JPLA 5DIZA 2WQ6A 2V8SE 2E0IA 2J07A 4BX8A 1N54A 3ZNGA 2BUGA 3HXCA 2KM4A 5IY5E 3QK0A 1ZBPA 1N52A 2WXNA 5AYWD 4GZ3A 5BW8C 4B93B 2WXKA 3B7SA 2I1JA 3FH8A 3ASNE 5KNHD 3Q75A 4XEIG 2GRQB 2XPYA 3NZSA 3Q5MA 4F7AA 1U2VG 3L13A 3UT7A 3SF4A 2ZISA 3JYSA 4J8EA 2HYZA 4BT9A 2LXLA 3CIAA 1Q2ZA 2FF4A 2X6IA 1RZ4A 2WPVA 3U66A 2BTDA 2RD0A 1JUQA 2FEZA 5LX8A 1D8EA 3E4BA 2DZNA 4HXIA 4GTMA 1TNBA 5EIDA 1NL4A 3PDNA 3Q9NC 3ZVVA 4JB8P 4JD2G 4O6FA 4A1SA 2P9UG 3B95A 3HXBA 4U0ZA 4G11A 3SFYA 3CHMA 3HXDA 1UG3A 3DBSA 2J08A 3VTYA 3E34A 2KCLA 3LEWA 2YHEA 2MRIA 3LY9A 3RRUA 5JHBA 5CBNA 4RQIA 1U3DA 3PUKA 5FQ4A 2NSZA 4JZYA 1SA5A 3VLEA 1P5QA 4J8YA 3OXGA 3TWTA 2GGFA 4U07A 4LRZA 1NI1A 2XRYA 2Q7FA 4WWOA 4XX5A 1FCHA 1HZ4A 3RAUA 4PS7A 2J09A 4L2YA 4I2WA 4GTOA 4BTAA 1VDYA 5AJLA 4BFRA 1JWGA 5LCWC 4HORA 2VGXA 3UIOC 4XKBA 4GMJA 2XCBA 2KCVA 2KATA 5B3SE 2IO2C 3EIQC 3D9IA 1E8ZA 5T8IA 4JHRA 4BWRA 4KT6B 3SO8A 2DBAA 4JEHA 4O1OA 2RFAA 1LF8A 2VJ8A 3HVEA 2KXPC 4QQIA 4RSYA 4GZ5A 1XGWA 4NACA 1SZ9A 3FU5A 5EYPF 2IONA 5AQ9A 2DYSE 2QYJA 1FVFA 1V54E 4H7YA 4BSZB 3DXKG 3DSVA 4PUCA 4RVBA 3NAWA 4GCNA 3B7TA 5AJDA 3SNXA 1N0RA 3DPDA 3MYVA 1SVXA 3U4TA 5M72A 3PNLB 1AP7A 2ONDA 4KYOB 1YYHA 5B1BE 2P9LG 3KEZA 4HOTA 4Y6CA 2R2LA 2XEHA 4A1GA 2P9IG 1O1SA 4GTRA 3BG0B 1K8KG 4DX6D 5KWDA 4K5CA 4DX2A 1S64A 3T5XA 4OAVB 3PZDA 1BI7B 3FP3A 1MHQA 3ZYQA 3WXXA 2AJAA 4K03A 3CR3A 2P9PG 5ENRD 3ULYA 3EDTB 4EBAA 2OEWA 4WNEA 5CBOA 4AIFA 5CERB 3ZW3A 3CK9A 3RJVA 3UM2A 3ML8A 3CQCB 3L82A 1OUVA 3ESLA 3ZXPA 3CVPA 1BD8A 2YHCA 3CVNA 3CHSA 3TXMA 4CRWA 5BPPA 3TXNA 3VLFA 4FP7A 3GZ2A 4N2SA 4CYMD 2GRPB 2Y3AA 3WG7E 3CVXA 4JL0A 3UINC 5J08A 3ZYLA 4Q96A 4CDMA 3CVVA 2XZDG 2IOLA 5ENPD 3QWVA 4UQYA 2YINA 3PEVB 5LFAA 3QWWA 2VSOE 5EN5D 2CG3A 5AIJA 3CHPA 2WXHA 1TN6A 2V4HC 3FH5A 4MKTA 5FQ6A 2DIWA 1E7UA 3GYZA 1EYHA 4KXKB 4K5BA 4N3AA 3UXGA 1KZPA 3BEEA 3DSWA 3MZLB 4FJYA 1MJ0A 4ANUA 2ETCA 3FULA 4HRLA 4U7EB 1Y8MA 3PRZA 3UM3A 2WXRA 3AG3E 2PZIA 4HLLA 1HXIA 3UIPC 4HS2A 4I6EA 2L0IA 4CGWA 2MYOA 2R59A 5HKPA 2R02A 3BG1B 3T9KA 4G8KA 2XPZA 4MRUA 1N4RA 3DEOA 2ZXWE 3N71A 1TNYA 2HO1A 4UUCA 4WWNA 5E75A 3S7BA 3LVQE 3CQGB 1OXJA 4MS6A 3DRAA 3TWQA 2P9NG 2OCCE 1RW2A 2J4DA 1KZOA 4W9RA 2VGXB 3FU3A 4AM9A 1SA4A 5ENQD 2AVPA 2HE0A 1O5MA 2JABA 4OVUA 1INZA 2CFZA 3CLJA 2WVIA 3S7JA 4U8HA 2YNQA 1KLXA 4BSXA 4EHMA 1PY1A 3P1UA 1MQSA 4GYYA 4DRXE 3D9KA 4H7XA 3SBSA 1N9AA 3MV3B 4L2LA 4WNDA 2FO1E 4J8FA 5AENA 2P2CP 4XE0A 5D66A 4ACLA 2FI7A 4UI9C 1LTXA 1JCQA 3V30A 5EIBE 1H2TC 3O4ZA 5ENSD 2LUHA 3SY2A 1X5BA 2XGOA 4AJWA 3JQ1A 3PUJA 3IXEA 1H2UA 4D10C 2WXGA 1N4PA 5CHEE 4FADA 4JVSA 1MX6A 2RFMA 4ABNA 2VGYA 2Y1LE 4CZ2D 1HF8A 2JLBA 4CDRA 2FBNA 3ONKA 3Q49B 3EIJA 1OY3D 2QYUA 3SBTB 4B8AA 3PH0C 2KBXA 3LY7A 3D9LA 3IKOB 4U63A 3JUEA 2VYIA 2DYRE 3EU9A 2GRRB 5FJYA 1H6OA 2DCPA 3B7RL 1G3NB 5A7DB 4ZFHA 3PZ3A 2EIJE 2XPIA 5JJ6A 2IQCA 3W9GA 2LNIA 4C48B 4M3OA 1TJFA 4AEZC 3QAQA 4TXQA 4JW1A 2UWJG 2IO3C 3APFA 2CG2A 5HS0A 2BKGA 3UPVA 1HH8A 5CRVA 2F8XK 2FO7A 1WY6A 4GTVA 3L54A 4GZDA 2PM7A 3FU0A 4FLBA 3MA5A 1O1TA 3ZUVB 1D9SA 3PZ1A 4C0EA 3V2OA 4ACKA 1YMPA 3FH7A 2L9BA 4NQ0A 1IKND 1QYMA 3B7UX 4G26A 2A5UA 4UWLA 3LYAA 5T4YA 1Z5SC 3ZKJA 3AG4E 1A17A 3CKBA 4F3VA 1MZCA 4XZ4A 4PH4B 1EPUA 5LP0A 1N94A 3DEPA 1OWLA 3T8MA 4MLPA 4DX1A 4YDWA 3BUAA 5AQ7A 3CVQA 4E6HA 4EZJA 4YDOA 3ABKE 4YVQC 4LUNU 5KJMA 1OCRE 1WG0A 3QNKA 4JC8A 4F53A 3DXMG 3IEGA 4J8SA 3DSSA 1BU9A 5HRYA 3PNTB 3KD7A 4DX7D 3IHYA 1TN7A 3L9TA 4FLHA 5LCWJ 5AAOA 3QARA 3D9MA 4FHKA 4ANXA 3PE4A 1IQUA 1QZ2A 2VSNA 4JHJA 3EUVA 3U64A 4IRUA 4AY5A 4LNBA 3IV0A 4U0SA 1OT8A 3LKUA 1GW6A 2LXMA 4OAUC 3AU5A 2BKKB 2V5QC 4GZ6A 4CDNA 4J8DA 1X81A 3LY8A 5CRUA 3V31A 2EINE 4JA9A 1H19A 3Q7FA 5FWQA 2HM8A 3Q4AB 2NC9A 2A5EA 3DSUA 4XI9A 4ANWA 1FVHA 3MV2B 1TR4A 4BERA 3ZU7B 1UN8A 1EF1C 3ZPJA 1TYQG 3TG5A 1HX8A 4G8LA 2ETBA 4TUMA 2IEJA 4N5CA 3RU0A 4RLYA 2R05A 2EIKE 2PM6A 5BNWA 3L17A 5BV0A 2XEEA 3T5VA 3Q15A 5J90A 3APDA 5ANLA 4LERA 4UWHA 1IYGA 4DUIA 1KT1A 3HXEA 1N11A 2LO6A 4F1PA 2GROB 4FHJA 2ZU6B 2H6FA 2OVFA 3HRAA 3L22A 2GW1A 3JCKC 3FY4A 4HVBA 3JXJA 3ZYKA 1MYOA 3Q7AA 3ZN3A 2VQ2A 3FUEA 2VTBA 4F1SA 3BU8A 4KBQA 3E37A 4ZHBA 5ENTD 3ULQA 2XZTG 1ZU2A 4JA7A 3DWLG 3SFZA 2ZGDA 4GU5A 4FA6A 3ULEG 3FUNA 4IYPA 4GTTA 4GAAA 2J8SD 3MCXA 3KEAA 3CVYA 3NZUA 2V4LA 3RK6A 3HIZA 3HYMB 3D9PA 3LDZA 2BEDA 1TNZA 1IXVA 1OWPA 4Z68A 2PL2A 2XGSA 3FUIA 5EILA 4ILHB 2WQ7A 4RG6A 4GPKA 1K3ZD 3T8KA 2WXJA 4N2QA 1OWNA 3ESKA 4AOFA 1DCQA 4EBAG 1BLXB 3FUKA 2L6BA 3D9HA 4LSZE 4WUYA 3PE3A 3MX3A 5FT9A 5H7PA 3TJPA 1KT0A 2R03A 3SI5A 4FC8A 3G2VA 3AJIA 5CCMA 4AP2A 3TWXA 5FIOA 4X8QA 4XIFA 1FT2A 3D3MA 1TEZA 3UQ3A 3RRMB 3ASFA 4CCAA 4BETA 5AN8A 4K0RA 3RRNB 2QC9A 4HB5A 2WXLA 3TWSA 2DVWA 4KVMA 5BXOA 5ANRA 1QQEA 2XQ0A 4V3IA 5JMND 2QZAA 2E2EA 5JJ7A 5EX0A 4LNUD 3D9JA 3EHNA 3CVWA 1HFAA 2OOEA 3FUFA 2CHWA 3LXUX 4LEUA 4G23A 4N3CA 1Y6IA 4C9BB 3QWPA 1S0PA 3DPYA 4I1MA 3ASGA 4UQXA 3Q47B 3ASHA 1E8WA 1N4SA 2L6JA 4URKA 5CMYA 1WM5A 3FTVA 3I5PA 2IJGX 4OVVA 4HRNA 4GYOA 3ZFWA 3NBNB 2I6HA 4L9PA 2XGMA 3G2UA 3PZ4A 4O60A 4LNGA 1JCSA 5FZRA 1S63A 2OEVA 5EX3A 3TL5A 5A23A 1QNFA 5EDSA 3DSTA 4WAFA 1OWMA 1KPSB 5E76A 3E30A 2C2LA 3LCAA 3AS8A 2GRMA
chains in the Genus database with same CATH topology
4UQZA 3FTZA 5FTPA 4AV7A 3CVUA 4HOUA 5JJ6A 4L2YA 2IQCA 4I2WA 4BTAA 2LSUA 1VDYA 4QFVA 3LJ3A 5BT1A 5AJLA 4BFRA 1JWGA 5LCWC 4HLEA 4B94A 2LNIA 1Z3YA 4GA1A 4FU3A 4M3OA 4HORA 2VGXA 4GYWA 1TJFA 3EJNA 3S7FA 4AEZC 3CV0A 2KZTA 3QAQA 4XKBA 2WXPA 3UX4A 4TV3A 4JW1A 2JEKA 1WAO1 2OV8A 4BX9A 1UJJA 2UWJG 4KMOA 4GMJA 2XCBA 2KCVA 3APFA 2KATA 3FDHA 2CG2A 3CKCA 4PS7A 2XEVA 3EIQC 3D9IA 1E8ZA 3ENEA 4B8CB 5T8IA 4I43A 3UPVA 4N39A 3OXFA 4JHRA 4BWRA 2UY1A 4UI9J 1HH8A 4KT6B 2DBAA 4JEHA 3I3NA 3TAXA 2FO7A 4TRQA 1WY6A 3L54A 2X6JA 4GZDA 2PM7A 3FU0A 4XKCA 1E96B 4FLBA 4I6GA 4HOSA 1LF8A 2VJ8A 3MA5A 4FULA 2AW6A 4AXHA 2AWIA 2J9QA 2GRLA 3HVEA 4PDXA 2CFUA 2NXPA 1PAQA 4C0EA 4RSYA 4ACKA 4GZ5A 3FH7A 1XGWA 4UWKA 2L9BA 4NQ0A 4NACA 1SZ9A 3FU5A 3FUDA 4U04A 3AS5A 3B7UX 3ZRHA 3D9NA 3QKYA 4G26A 3ZXSA 2A5UA 4UWLA 2IONA 4Q69A 3LYAA 3P2BA 5T4YA 2MOWA 3LPZA 1HG5A 3I4RB 3FHEA 1FVFA 3UT4A 1A17A 3SD5A 3CKBA 4F3VA 4XZ4A 4H7YA 4PH4B 4PUCA 1EPUA 4RVBA 5LP0A 4GCNA 2I1KA 1OWLA 3T8MA 4MLPA 3B7TA 2C0LA 3CVQA 2LAHA 2Y4UA 4E6HA 4EZJA 3CHOA 5AJDA 3PVLA 3FTUA 1NA0A 4YVQC 3SGHA 3SNXA 3JUIA 4LUNU 3LS8A 3ZYMA 3DPDA 5KJLA 3NF1A 3RO3A 4EPZA 5KJMA 3QNKA 3MYVA 5G04J 4JC8A 5M72A 3U4TA 3FWVA 4F53A 3PNLB 3IEGA 4J8SA 3CK7A 4XI0A 5JJTA 2ONDA 3ZHEA 1HS6A 4KYOB 5D0QD 3PREA 3PNTB 4UWGA 4NURA 1EDUA 2WXOA 3KD7A 1UJKA 3KEZA 2I9CA 3IHYA 4A55A 4HOTA 2Y4TA 4Y6CA 1HE8A 4FJZA 4FLHA 2A4ZA 4J0UA 4B89A 5LCWJ 3QARA 3D9OA 1L5JA 3D9MA 4GA0A 3FUJA 1XNFA 5D0OD 4A1GA 1UW4B 4FHKA 4ANXA 4G24A 2IF4A 3AS4A 3PE4A 1IQUA 4A3TA 2QFCA 3JQ0A 3OAWA 3BG0B 1U3CA 4PS3A 4G1TA 1QZ2A 2VTBB 1ELKA 1IHGA 3IBEA 3NQPA 2VSNA 3T5XA 4JHJA 4UWFA 4WNGA 1HO8A 3TG4A 3PZDA 3R9AB 4Y6WA 3R7QA 3FP3A 3U64A 4GCOA 4IRUA 4AY5A 4DLQA 2OVBA 2YQ8A 1MHQA 3ZYQA 3IV0A 4U0SA 4DLOA 3LKUA 1W3BA 5FZQA 2VSYA 3AU4A 1GW6A 3WXXA 3MEKA 4K03A 3CR3A 3U3WA 2WXMA 3ZEFA 3FU6A 3AU5A 3EDTB 3L6AA 2WXFA 3O48A 1NA3A 4EBAA 1JWFA 2RG8A 3KAEA 5CCLA 1E8YA 2LSVA 5G04C 5EKQD 4GZ6A 4WNEA 2PQRA 4CDNA 4J8DA 2J09A 4ME2A 4AIFA 3LY8A 4HFGA 3URZA 3ZW3A 3CK9A 3RJVA 4JA9A 5A6CA 1H19A 3MKQA 1ELRA 3ML8A 4I2ZA 5FWQA 3VLDA 3ZIMA 3CQCB 4DI4A 4N3BA 3LVRE 1DNPA 1OUVA 2HM8A 1YA0A 3Q4AB 3GZSA 4GB9A 2X6FA 2NC9A 5LOZA 3FEXA 2J49A 3QJZA 5JHAA 3ESLA 4EQFA 3UT8A 3CVPA 2M63A 4XI9A 1FVHA 4ANWA 3MV2B 1UN8A 2YHCA 3CVNA 1EF1C 3ZPJA 2X38A 3CHSA 3TG5A 1HX8A 3TXMA 2WB2A 4CRWA 4I6JA 5BPPA 3TXNA 3VLFA 2AXUA 4G25A 4A3VA 4FP7A 4KZ0A 5G2NA 5BUZA 3GZ2A 3CVLA 4N2SA 3C98A 4JXTA 3CGHA 3QOUA 4IULA 3APCA 2Y3AA 4UI9K 4APFA 3FTXA 3PEUB 2KZTB 4ILGA 3CVXA 4JL0A 5ENNA 5J08A 4JPSA 2J4BA 3ZYLA 4N5CA 4Q96A 3RU0A 3CEQA 1OWOA 1B89A 2X6KA 2MHKA 4E85A 2PM6A 5BNWA 3L17A 2IFUA 5BV0A 4DJAA 4CDMA 3CVVA 5HI7A 4KZCA 3SZ7A 3T5VA 3Q15A 4WWPA 5J90A 3APDA 5ANLA 4DI3A 3MGBA 4LERA 2IOLA 2R5SA 4OYSA 4UWHA 3QC1A 1IYGA 4IN3B 4Q94A 4BY6A 3FFLA 5CMWA 3HVEB 4I9EA 2FULA 3ONLA 4DK5A 1KT1A 3QWVA 3ASDA 5DBKA 5G05J 5BV1A 4UQYA 2YINA 4B0ZA 2LO6A 3PEVB 4EZKA 4ANVA 2IU1A 5LFAA 3QWWA 2VSOE 2X6HA 5FQ8A 4FHJA 2CHZA 2CG3A 2XRZA 2ZU6B 1SZAA 5AIJA 4I9CA 2OVFA 3CHPA 4RG9A 2WXHA 5T3RA 4L7TA 3KS2A 3FH5A 3OTNA 4MKTA 3L22A 3U9WA 2GW1A 4EZLA 5FQ6A 3I4GA 2DIWA 3JCKC 2WQHA 3FY4A 1E7UA 1NZNA 2I2OA 4L23A 3RIBA 3GYZA 4ATGA 4HVBA 3ZGQA 1EYHA 3QB2A 3ZYKA 4KXKB 4N3AA 3ZN3A 2VSXE 2VQ2A 4ILIA 2HR2A 3FUEA 2VTBA 4F1SA 4TUUA 4G2VA 3S7DA 4YVOA 4KBQA 3MZLB 3BEEA 4FJYA 2XCCA 2QY7A 3GW4A 3ULQA 1ZU2A 3MKRA 4JA7A 3ZHEB 4ANUA 3SFZA 2ILRA 4J6IA 3FTYA 4WNFA 3FULA 4GU5A 2V0PA 2WM9A 5G05C 3FUMA 3FTSA 4FA6A 5KJNA 4DPRA 3FUNA 1Y8MA 4IYPA 4CEMA 5KJKA 4BT8A 3PRZA 2KCKA 2WXRA 2WMNA 2PQNA 3SHFA 2PZIA 4GAAA 3OXLA 1HXIA 4HS2A 1Z3XA 3UUXA 4I6EA 4R7LA 3L16A 3MCXA 2L0IA 5FQ7A 3FTWA 3FUHA 4CGVA 3R7RA 3CVYA 1DVPA 3K9IA 3NZUA 3PS6A 2V4LA 4CGWA 3RK6A 3HIZA 2R59A 1H6KA 3D9PA 3HYMB 4I1OB 3BG1B 3LDZA 3EHMA 5FZSA 2R17C 2IOSA 2XPZA 4L1BA 4MRUA 2WMOA 1OWPA 2EQXA 2PL2A 2XGSA 4GZCA 4JHKA 3G2SA 3FUIA 2WXIA 2AXZA 3N71A 2HO1A 4ILHB 4EECA 1NP7A 3VTXA 4WWNA 5E75A 4P29A 1UN9A 3LVQE 3S7BA 3CQGB 5G55A 2WQ7A 4RG6A 4GPKA 4MS6A 1E7VA 1JPLA 5DIZA 2WQ6A 2WXJA 4N2QA 2V8SE 1OWNA 2J4DA 1E90A 3ESKA 3MKQB 4I17A 4AOFA 3RKVA 2E0IA 2J07A 4BX8A 4EBAG 4W9RA 1N54A 2BUGA 2KM4A 2VGXB 3QK0A 3G2WA 1ZBPA 3FU3A 3HDXA 1N52A 5ARGA 4AM9A 3FUKA 2WXNA 2LAIA 4JEUA 5AYWD 2AVPA 4GZ3A 5BW8C 5KCMA 3RO2A 2X3MA 3UMVA 2WXKA 3B7SA 2I1JA 3FH8A 3L08A 3MX3A 3PE3A 4I1AA 4WUYA 5C2YA 5FT9A 3TJPA 1KT0A 4OVUA 1INZA 2XPYA 3NZSA 3Q5MA 2UY1B 3SI5A 4FC8A 2CFZA 4CT0A 3CLJA 3G2VA 4F7AA 3TGOA 1TJCA 3L13A 2WVIA 3S7JA 4U8HA 2YNQA 1KLXA 3CHRA 3UT7A 4YNDA 5CCMA 4AP2A 4BSXA 3SF4A 3IHVA 3JYSA 4J8EA 2HYZA 2L0TB 4AVXA 4BT9A 4XIFA 1PY1A 2CHXA 3CIAA 3D3MA 3P1UA 3G2TA 2FF4A 2X6IA 1MQSA 3UQ3A 1TEZA 1HU3A 2XHEA 3RRMB 2WPVA 3ASFA 4GYYA 2AXVA 1SQMA 3U66A 4CCAA 2BTDA 2C0MA 2RD0A 3CSFA 1JUQA 3D9KA 1H0AA 2FEZA 3ML9A 5LX8A 4K0RA 4H7XA 3RRNB 3SBSA 4BTBA 1IQRA 3E4BA 4HXIA 2KC7A 2WXLA 5HQ8A 4KVMA 4LCTA 5ANRA 3MV3B 4L2LA 4WNDA 1QQEA 1H2VC 2XQ0A 4J8FA 5AENA 4V3IA 3CSTA 5JJ7A 2E2EA 4XE0A 5EX0A 2V5FA 4ACLA 3D9JA 3EHNA 3CVWA 1HFAA 3GZ1A 2OOEA 2FI7A 3PDNA 3FUFA 4UI9C 4AY6A 2CHWA 3LXUX 3ZVVA 4LEUA 4G23A 4N3CA 1Y6IA 3MJWA 3QWPA 4C9BB 1H2TC 3O4ZA 1S0PA 4I1MA 4O6FA 4APOA 4KVOA 3ASGA 1PC2A 4UQXA 4HOQA 1X5BA 3HHMA 3Q47B 2XGOA 1E8WA 3ASHA 4A1SA 2L6JA 5C1DA 4URKA 3CK8A 5CMYA 1WM5A 3JQ1A 3PUJA 4AJWA 2BF0X 1H2UA 4D10C 2WXGA 5CHEE 4FADA 3FTVA 3S2AA 4JVSA 3I5PA 4U0UA 1Z6TA 4ABNA 2IJGX 2P58C 2VGYA 1HF8A 4G11A 4OVVA 2JLBA 4GYOA 4U0ZA 3ZFWA 2I6HA 4CDRA 3CHMA 1BPOA 2FBNA 1UG3A 2XGMA 3DBSA 2J08A 3G2UA 3ONKA 3VTYA 1ELWA 2KCLA 3LEWA 3B13A 2YHEA 3Q49B 3EIJA 3SBTB 2MRIA 4B8AA 1E8XA 5ARFA 5FZRA 4GA2A 3LY9A 3RRUA 3CHQA 4NRHB 5JHBA 3PH0C 4GMLA 1HG2A 5EX3A 3LY7A 3TL5A 3D9LA 1U3DA 3PUKA 5A23A 5FQ4A 2NSZA 4JZYA 3IKOB 1QNFA 4U63A 3VLEA 1P5QA 5EDSA 3OXGA 4WAFA 2VYIA 4CT4A 1OWMA 3QDNA 2GGFA 4U07A 4LRZA 5E76A 2WXQA 2C2LA 3FEYA 3LCAA 5FJYA 2XRYA 2Q7FA 4PS8A 3AS8A 4WWOA 2DCPA 3B7RL 4XX5A 5A7DB 1FCHA 4C0MA 1HZ4A 2GRMA 2XPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UQZ A;  5FTP A;  4HOU A;  5JJ6 A;  4I2W A;  4BTA A;  2LSU A;  5BT1 A;  5LCW C;  4B94 A;  2LNI A;  4GA1 A;  4HOR A;  2VGX A;  4GYW A;  3S7F A;  3CV0 A;  1WAO 1;  2UWJ G;  2XCB A;  2KCV A;  2KAT A;  3CKC A;  2XEV A;  3UPV A;  4N39 A;  3OXF A;  4BWR A;  4JHR A;  2UY1 A;  4UI9 J;  1HH8 A;  2DBA A;  3TAX A;  2FO7 A;  1E96 B;  4HOS A;  3MA5 A;  2J9Q A;  4GZ5 A;  4NQ0 A;  4U04 A;  3AS5 A;  3QKY A;  4G26 A;  3LYA A;  3LPZ A;  1A17 A;  3CKB A;  4F3V A;  4H7Y A;  4GCN A;  2C0L A;  3CVQ A;  2Y4U A;  1NA0 A;  4YVQ C;  5KJL A;  3NF1 A;  3RO3 A;  5KJM A;  5G04 J;  5M72 A;  3U4T A;  3FWV A;  4XI0 A;  3IEG A;  5JJT A;  3CK7 A;  2OND A;  3ZHE A;  4KYO B;  5D0Q D;  3KD7 A;  4HOT A;  2Y4T A;  4Y6C A;  5LCW J;  4J0U A;  4GA0 A;  5D0O D;  1XNF A;  4G24 A;  2IF4 A;  3AS4 A;  3PE4 A;  2QFC A;  4G1T A;  1QZ2 A;  1IHG A;  2VSN A;  4WNG A;  3TG4 A;  3R9A B;  4Y6W A;  3FP3 A;  4GCO A;  4AY5 A;  2YQ8 A;  4U0S A;  3LKU A;  1W3B A;  5FZQ A;  2VSY A;  3WXX A;  3MEK A;  3U3W A;  3EDT B;  3O48 A;  1NA3 A;  3KAE A;  5CCL A;  2LSV A;  5G04 C;  5EKQ D;  4GZ6 A;  4WNE A;  2PQR A;  4J8D A;  4ME2 A;  4AIF A;  3LY8 A;  3URZ A;  3CK9 A;  3RJV A;  4JA9 A;  5A6C A;  1ELR A;  4I2Z A;  4N3B A;  1OUV A;  1YA0 A;  3Q4A B;  2NC9 A;  4EQF A;  3CVP A;  4XI9 A;  3MV2 B;  2YHC A;  3CVN A;  3ZPJ A;  3TG5 A;  4G25 A;  3GZ2 A;  3CVL A;  4N2S A;  3QOU A;  4UI9 K;  4JL0 A;  4N5C A;  3RU0 A;  3CEQ A;  1B89 A;  2MHK A;  5BNW A;  2IFU A;  5HI7 A;  3SZ7 A;  3Q15 A;  2R5S A;  1IYG A;  4IN3 B;  3FFL A;  4I9E A;  1KT1 A;  3QWV A;  3ASD A;  5DBK A;  5G05 J;  4UQY A;  3QWW A;  4I9C A;  4RG9 A;  3KS2 A;  2GW1 A;  2WQH A;  1NZN A;  3RIB A;  3GYZ A;  3ZGQ A;  4KXK B;  4N3A A;  3ZN3 A;  2VQ2 A;  2HR2 A;  4G2V A;  3S7D A;  4YVO A;  4KBQ A;  3BEE A;  2XCC A;  3GW4 A;  3ULQ A;  1ZU2 A;  3MKR A;  4JA7 A;  3ZHE B;  4WNF A;  5G05 C;  5KJN A;  1Y8M A;  5KJK A;  4BT8 A;  2KCK A;  2PQN A;  2PZI A;  3OXL A;  1HXI A;  3UUX A;  4CGV A;  3K9I A;  4CGW A;  3HYM B;  5FZS A;  2PL2 A;  2XGS A;  3N71 A;  2HO1 A;  3VTX A;  3S7B A;  4RG6 A;  4GPK A;  5DIZ A;  4N2Q A;  3ESK A;  4I17 A;  3RKV A;  4W9R A;  2BUG A;  2VGX B;  1ZBP A;  5ARG A;  4AM9 A;  5AYW D;  2AVP A;  4GZ3 A;  5BW8 C;  3RO2 A;  4I1A A;  4WUY A;  3PE3 A;  5FT9 A;  1KT0 A;  3Q5M A;  2UY1 B;  3TGO A;  1TJC A;  3S7J A;  1KLX A;  5CCM A;  4YND A;  3SF4 A;  3JYS A;  4J8E A;  2HYZ A;  4BT9 A;  4XIF A;  2FF4 A;  3UQ3 A;  2WPV A;  3ASF A;  4GYY A;  2C0M A;  2FEZ A;  4H7X A;  4BTB A;  3E4B A;  5HQ8 A;  2KC7 A;  3MV3 B;  4WND A;  1QQE A;  4J8F A;  5JJ7 A;  2E2E A;  5EX0 A;  2V5F A;  3GZ1 A;  2OOE A;  2FI7 A;  3PDN A;  4UI9 C;  4AY6 A;  4LEU A;  4G23 A;  4N3C A;  3QWP A;  4O6F A;  4APO A;  3ASG A;  1PC2 A;  4UQX A;  4HOQ A;  3Q47 B;  5C1D A;  2XGO A;  3ASH A;  4A1S A;  2L6J A;  3CK8 A;  1WM5 A;  5CHE E;  4U0U A;  4ABN A;  2VGY A;  2P58 C;  4U0Z A;  2JLB A;  4GYO A;  3ZFW A;  2I6H A;  4CDR A;  2FBN A;  2XGM A;  3VTY A;  1ELW A;  2KCL A;  3Q49 B;  5ARF A;  5FZR A;  4GA2 A;  3LY9 A;  4NRH B;  5EX3 A;  3LY7 A;  1P5Q A;  3OXG A;  2VYI A;  3QDN A;  4U07 A;  2C2L A;  3LCA A;  5FJY A;  2Q7F A;  3AS8 A;  5A7D B;  1FCH A;  1HZ4 A;  2XPI A; 
#chains in the Genus database with same CATH topology
 3FTZ A;  4AV7 A;  3CVU A;  5FIN A;  3PZ2 A;  4HOU A;  4DX5 D;  4QFV A;  5BT1 A;  1JCR A;  3UM1 A;  4B94 A;  3C3Q A;  1Z3Y A;  4GA1 A;  4FU3 A;  3EJN A;  4NIK A;  3UX4 A;  4TV3 A;  4LG6 A;  1WAO 1;  3FDH A;  3Q9U C;  4I43 A;  4N39 A;  3OXF A;  2UY1 A;  4UI9 J;  3I3N A;  3TAX A;  4TRQ A;  1NFI E;  2X6J A;  1E96 B;  4I6G A;  4N5Q A;  4FUL A;  4AXH A;  2J9Q A;  2GRL A;  4PDX A;  2CFU A;  2NXP A;  4U04 A;  3AS5 A;  3ZXS A;  4Q69 A;  2MOW A;  3LPZ A;  1HG5 A;  3BQO A;  4HRM B;  3I4R B;  1MX4 A;  5BXU A;  2I1K A;  3RSE G;  4BES A;  2LAH A;  2Y4U A;  3CHO A;  3FTU A;  1BI8 B;  1NA0 A;  3SGH A;  5KJL A;  4EPZ A;  4BEP A;  5JJT A;  2ZGG A;  1HS6 A;  5D0Q D;  4NUR A;  1EDU A;  2I9C A;  4A55 A;  3Q79 A;  1HE8 A;  4FJZ A;  4B89 A;  4J0U A;  4G24 A;  4A3T A;  3AS4 A;  2QFC A;  3JQ0 A;  3SQV A;  3TWR A;  4G1T A;  2VTB B;  3IBE A;  4UWF A;  4WNG A;  3UI2 A;  3R9A B;  4GCO A;  4DLQ A;  2YQ8 A;  1W3B A;  5FZQ A;  3MEK A;  3U3W A;  3EHR A;  3ZEF A;  2WXF A;  1JWF A;  3KAE A;  1E8Y A;  2LSV A;  5EKQ D;  5ITZ F;  2PQR A;  3AG1 E;  4HI8 A;  4ME2 A;  2XEN A;  4HFG A;  4HNA D;  3VLD A;  1ELR A;  4I2Z A;  3C5R A;  4DI4 A;  4N3B A;  3EU5 A;  4GTP A;  3LVR E;  1YA0 A;  3QJZ A;  5JHA A;  3HXF A;  1N0Q A;  1LD7 A;  2DWZ A;  3F6Q A;  2AXU A;  1DC2 A;  4A3V A;  5G2N A;  5BUZ A;  3C98 A;  4IUL A;  4APF A;  3EHQ A;  2KZT B;  1OCZ E;  2X6K A;  2MHK A;  2DZO A;  3LJN A;  1O1R A;  5HI7 A;  4KZC A;  1N4Q A;  2R5S A;  1UOH A;  4BY6 A;  3FFL A;  5CMW A;  4I9E A;  3ASD A;  1IHB A;  1MX2 A;  4B0Z A;  1YCS B;  2XRZ A;  1SZA A;  4I9C A;  4O1P A;  3U9W A;  4EZL A;  3I4G A;  1NZN A;  1V55 E;  4L23 A;  3RIB A;  2Y0B G;  3R9M A;  1WDY A;  2F8Y A;  3ZHE B;  3ASO E;  4J6I A;  3FTY A;  2F37 A;  2XS1 A;  2WM9 A;  4DPR A;  4U8Y D;  4GTS A;  4CEM A;  3UTM A;  2KCK A;  2WMN A;  4MBG A;  3SHF A;  3NB2 A;  3L16 A;  4CGV A;  3FUH A;  3EHM A;  2IOS A;  2IY0 C;  2WMO A;  4JHK A;  3Q78 A;  4EEC A;  5JA4 D;  3AAA C;  1TNO A;  1E90 A;  4HQD A;  3MKQ B;  4I17 A;  3RKV A;  3G2W A;  4HI9 A;  3HDX A;  5ARG A;  1AWC B;  4JEU A;  2LAI A;  5KCM A;  3RO2 A;  2X3M A;  3UMV A;  3L08 A;  4I1A A;  5C2Y A;  2UY1 B;  5CEA A;  5AAR A;  4CT0 A;  3TGO A;  1TJC A;  3CHR A;  4YND A;  2H6G A;  2P9S G;  3B7B A;  3TWU A;  3IHV A;  3HG0 D;  4AVX A;  2L0T B;  4GPM A;  2CHX A;  3G2T A;  1HU3 A;  2XHE A;  2H6I A;  2AXV A;  1SQM A;  1K1A A;  2C0M A;  3CSF A;  3ML9 A;  1H0A A;  4BTB A;  1IQR A;  1OCO E;  5HQ8 A;  2KC7 A;  3V79 K;  3SFX A;  1FPP A;  5KNG A;  4LCT A;  1H2V C;  3J5Q B;  5AQA A;  3CST A;  3C3O A;  2V5F A;  3ABL E;  5ENO D;  3GZ1 A;  4AY6 A;  3MJW A;  4YDY A;  4APO A;  4KVO A;  2P9K G;  1PC2 A;  4HOQ A;  3HHM A;  5C1D A;  3CK8 A;  2BF0 X;  3S2A A;  4U0U A;  1Z6T A;  2P58 C;  1BPO A;  1ELW A;  3B13 A;  1E8X A;  5ARF A;  4GA2 A;  3CHQ A;  4NRH B;  4GML A;  1HG2 A;  3NOC D;  5EYL A;  4CT4 A;  3QDN A;  2WXQ A;  3FEY A;  4PS8 A;  4C0M A;  4UQZ A;  5FTP A;  2EIM E;  2LSU A;  3C72 A;  3LJ3 A;  1FT1 A;  4HLE A;  3Q73 A;  4GYW A;  3S7F A;  1H6P A;  3CV0 A;  2KZT A;  2EIL E;  2WXP A;  1DCE A;  3ISM C;  2JEK A;  2OV8 A;  3V2X A;  4BX9 A;  1UJJ A;  4KMO A;  1D8D A;  3CKC A;  2XEV A;  3ENE A;  2F0Y A;  4B8C B;  4XKC A;  4U96 D;  4HOS A;  2AW6 A;  2AWI A;  4GTQ A;  4M7C A;  3E32 A;  1PAQ A;  2B6C A;  4A63 B;  4UWK A;  3FUD A;  3X2Q E;  3ZRH A;  3D9N A;  3QKY A;  3P2B A;  3UKR G;  3FHE A;  1N95 A;  3UT4 A;  3SD5 A;  4K5A B;  2C0L A;  3PVL A;  3W9F A;  3ZYM A;  3JUI A;  3LS8 A;  3NF1 A;  3RO3 A;  5G04 J;  3FWV A;  4XI0 A;  3CK7 A;  3ZHE A;  3PRE A;  4UWG A;  2WXO A;  1UJK A;  2Y4T A;  2A4Z A;  4GA0 A;  3D9O A;  1L5J A;  5D0O D;  3FUJ A;  1XNF A;  1UW4 B;  4U95 D;  2IF4 A;  3OAW A;  4ATZ D;  1U3C A;  4PS3 A;  1ELK A;  3ABM E;  1IHG A;  3J5P A;  1QBQ A;  3NQP A;  1HO8 A;  3TG4 A;  2XS8 A;  4Y6W A;  3R7Q A;  1TN8 A;  2OVB A;  4DLO A;  4TXP A;  2VSY A;  3AU4 A;  2WXM A;  3FU6 A;  2GRN B;  3L6A A;  3O48 A;  1NA3 A;  2RG8 A;  5CCL A;  1ZB1 A;  5G04 C;  2H6H A;  4HBD A;  3URZ A;  5A6C A;  3MKQ A;  3ZIM A;  2B0O E;  1DNP A;  4GB9 A;  3GZS A;  2X6F A;  5B1A E;  5LOZ A;  3FEX A;  2J49 A;  4EQF A;  2VGE A;  3UT8 A;  2M63 A;  3KSQ A;  3DSX A;  2X38 A;  2WB2 A;  4I6J A;  4G25 A;  4KZ0 A;  1TNU A;  3CVL A;  4JXT A;  3CGH A;  3QOU A;  3APC A;  5CEC B;  4UI9 K;  3FTX A;  3PEU B;  4ILG A;  1K1B A;  5ENN A;  4JPS A;  2J4B A;  3CEQ A;  1OWO A;  1B89 A;  1S70 B;  1A5E A;  4E85 A;  2IFU A;  4DJA A;  3TWW A;  3SZ7 A;  4F6R D;  4WWP A;  4DI3 A;  3MGB A;  4OYS A;  3C3R A;  3QC1 A;  3KSL A;  4IN3 B;  4Q94 A;  3HVE B;  3E33 A;  2FUL A;  3ONL A;  4DK5 A;  5DBK A;  5G05 J;  5BV1 A;  2Y69 E;  4YDE A;  2ZIR A;  4EZK A;  4ANV A;  2IU1 A;  2X6H A;  5D2M C;  5FQ8 A;  2CHZ A;  4RG9 A;  5T3R A;  4L7T A;  3KS2 A;  3JXI A;  3OTN A;  2ETA A;  2WQH A;  3UKU G;  2I2O A;  5AQB A;  4GMR A;  4ATG A;  5KBA A;  3ZGQ A;  3QB2 A;  2VSX E;  4ILI A;  2HR2 A;  4TUU A;  4G2V A;  3S7D A;  4YVO A;  2XCC A;  2QY7 A;  3TWV A;  3GW4 A;  4J7W A;  3NOG D;  3MKR A;  1LD8 A;  2ILR A;  4WNF A;  2V0P A;  5G05 C;  3FUM A;  3FTS A;  2RKK A;  5KJN A;  2NYJ A;  5KJK A;  3UM0 A;  4BT8 A;  2PQN A;  3OXL A;  1Z3X A;  3UUX A;  4R7L A;  5FQ7 A;  2PNN A;  3FTW A;  3R7R A;  1DVP A;  3K9I A;  3PS6 A;  5CED B;  4I1O B;  1H6K A;  1OCC E;  5FZS A;  4TXR A;  2R17 C;  1SW6 A;  4L1B A;  3AG2 E;  2EQX A;  4GZC A;  3G2S A;  2WXI A;  2AXZ A;  4U8V D;  1NP7 A;  3VTX A;  4P29 A;  1UN9 A;  5G55 A;  1E7V A;  1JPL A;  5DIZ A;  2WQ6 A;  2V8S E;  2E0I A;  2J07 A;  4BX8 A;  1N54 A;  3ZNG A;  2BUG A;  3HXC A;  2KM4 A;  5IY5 E;  3QK0 A;  1ZBP A;  1N52 A;  2WXN A;  5AYW D;  4GZ3 A;  5BW8 C;  4B93 B;  2WXK A;  3B7S A;  2I1J A;  3FH8 A;  3ASN E;  5KNH D;  3Q75 A;  4XEI G;  2GRQ B;  2XPY A;  3NZS A;  3Q5M A;  4F7A A;  1U2V G;  3L13 A;  3UT7 A;  3SF4 A;  2ZIS A;  3JYS A;  4J8E A;  2HYZ A;  4BT9 A;  2LXL A;  3CIA A;  1Q2Z A;  2FF4 A;  2X6I A;  1RZ4 A;  2WPV A;  3U66 A;  2BTD A;  2RD0 A;  1JUQ A;  2FEZ A;  5LX8 A;  1D8E A;  3E4B A;  2DZN A;  4HXI A;  4GTM A;  1TNB A;  5EID A;  1NL4 A;  3PDN A;  3Q9N C;  3ZVV A;  4JB8 P;  4JD2 G;  4O6F A;  4A1S A;  2P9U G;  3B95 A;  3HXB A;  4U0Z A;  4G11 A;  3SFY A;  3CHM A;  3HXD A;  1UG3 A;  3DBS A;  2J08 A;  3VTY A;  3E34 A;  2KCL A;  3LEW A;  2YHE A;  2MRI A;  3LY9 A;  3RRU A;  5JHB A;  5CBN A;  4RQI A;  1U3D A;  3PUK A;  5FQ4 A;  2NSZ A;  4JZY A;  1SA5 A;  3VLE A;  1P5Q A;  4J8Y A;  3OXG A;  3TWT A;  2GGF A;  4U07 A;  4LRZ A;  1NI1 A;  2XRY A;  2Q7F A;  4WWO A;  4XX5 A;  1FCH A;  1HZ4 A;  3RAU A;  4PS7 A;  2J09 A;  4L2Y A;  4I2W A;  4GTO A;  4BTA A;  1VDY A;  5AJL A;  4BFR A;  1JWG A;  5LCW C;  4HOR A;  2VGX A;  3UIO C;  4XKB A;  4GMJ A;  2XCB A;  2KCV A;  2KAT A;  5B3S E;  2IO2 C;  3EIQ C;  3D9I A;  1E8Z A;  5T8I A;  4JHR A;  4BWR A;  4KT6 B;  3SO8 A;  2DBA A;  4JEH A;  4O1O A;  2RFA A;  1LF8 A;  2VJ8 A;  3HVE A;  2KXP C;  4QQI A;  4RSY A;  4GZ5 A;  1XGW A;  4NAC A;  1SZ9 A;  3FU5 A;  5EYP F;  2ION A;  5AQ9 A;  2DYS E;  2QYJ A;  1FVF A;  1V54 E;  4H7Y A;  4BSZ B;  3DXK G;  3DSV A;  4PUC A;  4RVB A;  3NAW A;  4GCN A;  3B7T A;  5AJD A;  3SNX A;  1N0R A;  3DPD A;  3MYV A;  1SVX A;  3U4T A;  5M72 A;  3PNL B;  1AP7 A;  2OND A;  4KYO B;  1YYH A;  5B1B E;  2P9L G;  3KEZ A;  4HOT A;  4Y6C A;  2R2L A;  2XEH A;  4A1G A;  2P9I G;  1O1S A;  4GTR A;  3BG0 B;  1K8K G;  4DX6 D;  5KWD A;  4K5C A;  4DX2 A;  1S64 A;  3T5X A;  4OAV B;  3PZD A;  1BI7 B;  3FP3 A;  1MHQ A;  3ZYQ A;  3WXX A;  2AJA A;  4K03 A;  3CR3 A;  2P9P G;  5ENR D;  3ULY A;  3EDT B;  4EBA A;  2OEW A;  4WNE A;  5CBO A;  4AIF A;  5CER B;  3ZW3 A;  3CK9 A;  3RJV A;  3UM2 A;  3ML8 A;  3CQC B;  3L82 A;  1OUV A;  3ESL A;  3ZXP A;  3CVP A;  1BD8 A;  2YHC A;  3CVN A;  3CHS A;  3TXM A;  4CRW A;  5BPP A;  3TXN A;  3VLF A;  4FP7 A;  3GZ2 A;  4N2S A;  4CYM D;  2GRP B;  2Y3A A;  3WG7 E;  3CVX A;  4JL0 A;  3UIN C;  5J08 A;  3ZYL A;  4Q96 A;  4CDM A;  3CVV A;  2XZD G;  2IOL A;  5ENP D;  3QWV A;  4UQY A;  2YIN A;  3PEV B;  5LFA A;  3QWW A;  2VSO E;  5EN5 D;  2CG3 A;  5AIJ A;  3CHP A;  2WXH A;  1TN6 A;  2V4H C;  3FH5 A;  4MKT A;  5FQ6 A;  2DIW A;  1E7U A;  3GYZ A;  1EYH A;  4KXK B;  4K5B A;  4N3A A;  3UXG A;  1KZP A;  3BEE A;  3DSW A;  3MZL B;  4FJY A;  1MJ0 A;  4ANU A;  2ETC A;  3FUL A;  4HRL A;  4U7E B;  1Y8M A;  3PRZ A;  3UM3 A;  2WXR A;  3AG3 E;  2PZI A;  4HLL A;  1HXI A;  3UIP C;  4HS2 A;  4I6E A;  2L0I A;  4CGW A;  2MYO A;  2R59 A;  5HKP A;  2R02 A;  3BG1 B;  3T9K A;  4G8K A;  2XPZ A;  4MRU A;  1N4R A;  3DEO A;  2ZXW E;  3N71 A;  1TNY A;  2HO1 A;  4UUC A;  4WWN A;  5E75 A;  3S7B A;  3LVQ E;  3CQG B;  1OXJ A;  4MS6 A;  3DRA A;  3TWQ A;  2P9N G;  2OCC E;  1RW2 A;  2J4D A;  1KZO A;  4W9R A;  2VGX B;  3FU3 A;  4AM9 A;  1SA4 A;  5ENQ D;  2AVP A;  2HE0 A;  1O5M A;  2JAB A;  4OVU A;  1INZ A;  2CFZ A;  3CLJ A;  2WVI A;  3S7J A;  4U8H A;  2YNQ A;  1KLX A;  4BSX A;  4EHM A;  1PY1 A;  3P1U A;  1MQS A;  4GYY A;  4DRX E;  3D9K A;  4H7X A;  3SBS A;  1N9A A;  3MV3 B;  4L2L A;  4WND A;  2FO1 E;  4J8F A;  5AEN A;  2P2C P;  4XE0 A;  5D66 A;  4ACL A;  2FI7 A;  4UI9 C;  1LTX A;  1JCQ A;  3V30 A;  5EIB E;  1H2T C;  3O4Z A;  5ENS D;  2LUH A;  3SY2 A;  1X5B A;  2XGO A;  4AJW A;  3JQ1 A;  3PUJ A;  3IXE A;  1H2U A;  4D10 C;  2WXG A;  1N4P A;  5CHE E;  4FAD A;  4JVS A;  1MX6 A;  2RFM A;  4ABN A;  2VGY A;  2Y1L E;  4CZ2 D;  1HF8 A;  2JLB A;  4CDR A;  2FBN A;  3ONK A;  3Q49 B;  3EIJ A;  1OY3 D;  2QYU A;  3SBT B;  4B8A A;  3PH0 C;  2KBX A;  3LY7 A;  3D9L A;  3IKO B;  4U63 A;  3JUE A;  2VYI A;  2DYR E;  3EU9 A;  2GRR B;  5FJY A;  1H6O A;  2DCP A;  3B7R L;  1G3N B;  5A7D B;  4ZFH A;  3PZ3 A;  2EIJ E;  2XPI A;  5JJ6 A;  2IQC A;  3W9G A;  2LNI A;  4C48 B;  4M3O A;  1TJF A;  4AEZ C;  3QAQ A;  4TXQ A;  4JW1 A;  2UWJ G;  2IO3 C;  3APF A;  2CG2 A;  5HS0 A;  2BKG A;  3UPV A;  1HH8 A;  5CRV A;  2F8X K;  2FO7 A;  1WY6 A;  4GTV A;  3L54 A;  4GZD A;  2PM7 A;  3FU0 A;  4FLB A;  3MA5 A;  1O1T A;  3ZUV B;  1D9S A;  3PZ1 A;  4C0E A;  3V2O A;  4ACK A;  1YMP A;  3FH7 A;  2L9B A;  4NQ0 A;  1IKN D;  1QYM A;  3B7U X;  4G26 A;  2A5U A;  4UWL A;  3LYA A;  5T4Y A;  1Z5S C;  3ZKJ A;  3AG4 E;  1A17 A;  3CKB A;  4F3V A;  1MZC A;  4XZ4 A;  4PH4 B;  1EPU A;  5LP0 A;  1N94 A;  3DEP A;  1OWL A;  3T8M A;  4MLP A;  4DX1 A;  4YDW A;  3BUA A;  5AQ7 A;  3CVQ A;  4E6H A;  4EZJ A;  4YDO A;  3ABK E;  4YVQ C;  4LUN U;  5KJM A;  1OCR E;  1WG0 A;  3QNK A;  4JC8 A;  4F53 A;  3DXM G;  3IEG A;  4J8S A;  3DSS A;  1BU9 A;  5HRY A;  3PNT B;  3KD7 A;  4DX7 D;  3IHY A;  1TN7 A;  3L9T A;  4FLH A;  5LCW J;  5AAO A;  3QAR A;  3D9M A;  4FHK A;  4ANX A;  3PE4 A;  1IQU A;  1QZ2 A;  2VSN A;  4JHJ A;  3EUV A;  3U64 A;  4IRU A;  4AY5 A;  4LNB A;  3IV0 A;  4U0S A;  1OT8 A;  3LKU A;  1GW6 A;  2LXM A;  4OAU C;  3AU5 A;  2BKK B;  2V5Q C;  4GZ6 A;  4CDN A;  4J8D A;  1X81 A;  3LY8 A;  5CRU A;  3V31 A;  2EIN E;  4JA9 A;  1H19 A;  3Q7F A;  5FWQ A;  2HM8 A;  3Q4A B;  2NC9 A;  2A5E A;  3DSU A;  4XI9 A;  4ANW A;  1FVH A;  3MV2 B;  1TR4 A;  4BER A;  3ZU7 B;  1UN8 A;  1EF1 C;  3ZPJ A;  1TYQ G;  3TG5 A;  1HX8 A;  4G8L A;  2ETB A;  4TUM A;  2IEJ A;  4N5C A;  3RU0 A;  4RLY A;  2R05 A;  2EIK E;  2PM6 A;  5BNW A;  3L17 A;  5BV0 A;  2XEE A;  3T5V A;  3Q15 A;  5J90 A;  3APD A;  5ANL A;  4LER A;  4UWH A;  1IYG A;  4DUI A;  1KT1 A;  3HXE A;  1N11 A;  2LO6 A;  4F1P A;  2GRO B;  4FHJ A;  2ZU6 B;  2H6F A;  2OVF A;  3HRA A;  3L22 A;  2GW1 A;  3JCK C;  3FY4 A;  4HVB A;  3JXJ A;  3ZYK A;  1MYO A;  3Q7A A;  3ZN3 A;  2VQ2 A;  3FUE A;  2VTB A;  4F1S A;  3BU8 A;  4KBQ A;  3E37 A;  4ZHB A;  5ENT D;  3ULQ A;  2XZT G;  1ZU2 A;  4JA7 A;  3DWL G;  3SFZ A;  2ZGD A;  4GU5 A;  4FA6 A;  3ULE G;  3FUN A;  4IYP A;  4GTT A;  4GAA A;  2J8S D;  3MCX A;  3KEA A;  3CVY A;  3NZU A;  2V4L A;  3RK6 A;  3HIZ A;  3HYM B;  3D9P A;  3LDZ A;  2BED A;  1TNZ A;  1IXV A;  1OWP A;  4Z68 A;  2PL2 A;  2XGS A;  3FUI A;  5EIL A;  4ILH B;  2WQ7 A;  4RG6 A;  4GPK A;  1K3Z D;  3T8K A;  2WXJ A;  4N2Q A;  1OWN A;  3ESK A;  4AOF A;  1DCQ A;  4EBA G;  1BLX B;  3FUK A;  2L6B A;  3D9H A;  4LSZ E;  4WUY A;  3PE3 A;  3MX3 A;  5FT9 A;  5H7P A;  3TJP A;  1KT0 A;  2R03 A;  3SI5 A;  4FC8 A;  3G2V A;  3AJI A;  5CCM A;  4AP2 A;  3TWX A;  5FIO A;  4X8Q A;  4XIF A;  1FT2 A;  3D3M A;  1TEZ A;  3UQ3 A;  3RRM B;  3ASF A;  4CCA A;  4BET A;  5AN8 A;  4K0R A;  3RRN B;  2QC9 A;  4HB5 A;  2WXL A;  3TWS A;  2DVW A;  4KVM A;  5BXO A;  5ANR A;  1QQE A;  2XQ0 A;  4V3I A;  5JMN D;  2QZA A;  2E2E A;  5JJ7 A;  5EX0 A;  4LNU D;  3D9J A;  3EHN A;  3CVW A;  1HFA A;  2OOE A;  3FUF A;  2CHW A;  3LXU X;  4LEU A;  4G23 A;  4N3C A;  1Y6I A;  4C9B B;  3QWP A;  1S0P A;  3DPY A;  4I1M A;  3ASG A;  4UQX A;  3Q47 B;  3ASH A;  1E8W A;  1N4S A;  2L6J A;  4URK A;  5CMY A;  1WM5 A;  3FTV A;  3I5P A;  2IJG X;  4OVV A;  4HRN A;  4GYO A;  3ZFW A;  3NBN B;  2I6H A;  4L9P A;  2XGM A;  3G2U A;  3PZ4 A;  4O60 A;  4LNG A;  1JCS A;  5FZR A;  1S63 A;  2OEV A;  5EX3 A;  3TL5 A;  5A23 A;  1QNF A;  5EDS A;  3DST A;  4WAF A;  1OWM A;  1KPS B;  5E76 A;  3E30 A;  2C2L A;  3LCA A;  3AS8 A;  2GRM A; 
#chains in the Genus database with same CATH homology
 4UQZ A;  3FTZ A;  5FTP A;  4AV7 A;  3CVU A;  4HOU A;  5JJ6 A;  4L2Y A;  2IQC A;  4I2W A;  4BTA A;  2LSU A;  1VDY A;  4QFV A;  3LJ3 A;  5BT1 A;  5AJL A;  4BFR A;  1JWG A;  5LCW C;  4HLE A;  4B94 A;  2LNI A;  1Z3Y A;  4GA1 A;  4FU3 A;  4M3O A;  4HOR A;  2VGX A;  4GYW A;  1TJF A;  3EJN A;  3S7F A;  4AEZ C;  3CV0 A;  2KZT A;  3QAQ A;  4XKB A;  2WXP A;  3UX4 A;  4TV3 A;  4JW1 A;  2JEK A;  1WAO 1;  2OV8 A;  4BX9 A;  1UJJ A;  2UWJ G;  4KMO A;  4GMJ A;  2XCB A;  2KCV A;  3APF A;  2KAT A;  3FDH A;  2CG2 A;  3CKC A;  4PS7 A;  2XEV A;  3EIQ C;  3D9I A;  1E8Z A;  3ENE A;  4B8C B;  5T8I A;  4I43 A;  3UPV A;  4N39 A;  3OXF A;  4JHR A;  4BWR A;  2UY1 A;  4UI9 J;  1HH8 A;  4KT6 B;  2DBA A;  4JEH A;  3I3N A;  3TAX A;  2FO7 A;  4TRQ A;  1WY6 A;  3L54 A;  2X6J A;  4GZD A;  2PM7 A;  3FU0 A;  4XKC A;  1E96 B;  4FLB A;  4I6G A;  4HOS A;  1LF8 A;  2VJ8 A;  3MA5 A;  4FUL A;  2AW6 A;  4AXH A;  2AWI A;  2J9Q A;  2GRL A;  3HVE A;  4PDX A;  2CFU A;  2NXP A;  1PAQ A;  4C0E A;  4RSY A;  4ACK A;  4GZ5 A;  3FH7 A;  1XGW A;  4UWK A;  2L9B A;  4NQ0 A;  4NAC A;  1SZ9 A;  3FU5 A;  3FUD A;  4U04 A;  3AS5 A;  3B7U X;  3ZRH A;  3D9N A;  3QKY A;  4G26 A;  3ZXS A;  2A5U A;  4UWL A;  2ION A;  4Q69 A;  3LYA A;  3P2B A;  5T4Y A;  2MOW A;  3LPZ A;  1HG5 A;  3I4R B;  3FHE A;  1FVF A;  3UT4 A;  1A17 A;  3SD5 A;  3CKB A;  4F3V A;  4XZ4 A;  4H7Y A;  4PH4 B;  4PUC A;  1EPU A;  4RVB A;  5LP0 A;  4GCN A;  2I1K A;  1OWL A;  3T8M A;  4MLP A;  3B7T A;  2C0L A;  3CVQ A;  2LAH A;  2Y4U A;  4E6H A;  4EZJ A;  3CHO A;  5AJD A;  3PVL A;  3FTU A;  1NA0 A;  4YVQ C;  3SGH A;  3SNX A;  3JUI A;  4LUN U;  3LS8 A;  3ZYM A;  3DPD A;  5KJL A;  3NF1 A;  3RO3 A;  4EPZ A;  5KJM A;  3QNK A;  3MYV A;  5G04 J;  4JC8 A;  5M72 A;  3U4T A;  3FWV A;  4F53 A;  3PNL B;  3IEG A;  4J8S A;  3CK7 A;  4XI0 A;  5JJT A;  2OND A;  3ZHE A;  1HS6 A;  4KYO B;  5D0Q D;  3PRE A;  3PNT B;  4UWG A;  4NUR A;  1EDU A;  2WXO A;  3KD7 A;  1UJK A;  3KEZ A;  2I9C A;  3IHY A;  4A55 A;  4HOT A;  2Y4T A;  4Y6C A;  1HE8 A;  4FJZ A;  4FLH A;  2A4Z A;  4J0U A;  4B89 A;  5LCW J;  3QAR A;  3D9O A;  1L5J A;  3D9M A;  4GA0 A;  3FUJ A;  1XNF A;  5D0O D;  4A1G A;  1UW4 B;  4FHK A;  4ANX A;  4G24 A;  2IF4 A;  3AS4 A;  3PE4 A;  1IQU A;  4A3T A;  2QFC A;  3JQ0 A;  3OAW A;  3BG0 B;  1U3C A;  4PS3 A;  4G1T A;  1QZ2 A;  2VTB B;  1ELK A;  1IHG A;  3IBE A;  3NQP A;  2VSN A;  3T5X A;  4JHJ A;  4UWF A;  4WNG A;  1HO8 A;  3TG4 A;  3PZD A;  3R9A B;  4Y6W A;  3R7Q A;  3FP3 A;  3U64 A;  4GCO A;  4IRU A;  4AY5 A;  4DLQ A;  2OVB A;  2YQ8 A;  1MHQ A;  3ZYQ A;  3IV0 A;  4U0S A;  4DLO A;  3LKU A;  1W3B A;  5FZQ A;  2VSY A;  3AU4 A;  1GW6 A;  3WXX A;  3MEK A;  4K03 A;  3CR3 A;  3U3W A;  2WXM A;  3ZEF A;  3FU6 A;  3AU5 A;  3EDT B;  3L6A A;  2WXF A;  3O48 A;  1NA3 A;  4EBA A;  1JWF A;  2RG8 A;  3KAE A;  5CCL A;  1E8Y A;  2LSV A;  5G04 C;  5EKQ D;  4GZ6 A;  4WNE A;  2PQR A;  4CDN A;  4J8D A;  2J09 A;  4ME2 A;  4AIF A;  3LY8 A;  4HFG A;  3URZ A;  3ZW3 A;  3CK9 A;  3RJV A;  4JA9 A;  5A6C A;  1H19 A;  3MKQ A;  1ELR A;  3ML8 A;  4I2Z A;  5FWQ A;  3VLD A;  3ZIM A;  3CQC B;  4DI4 A;  4N3B A;  3LVR E;  1DNP A;  1OUV A;  2HM8 A;  1YA0 A;  3Q4A B;  3GZS A;  4GB9 A;  2X6F A;  2NC9 A;  5LOZ A;  3FEX A;  2J49 A;  3QJZ A;  5JHA A;  3ESL A;  4EQF A;  3UT8 A;  3CVP A;  2M63 A;  4XI9 A;  1FVH A;  4ANW A;  3MV2 B;  1UN8 A;  2YHC A;  3CVN A;  1EF1 C;  3ZPJ A;  2X38 A;  3CHS A;  3TG5 A;  1HX8 A;  3TXM A;  2WB2 A;  4CRW A;  4I6J A;  5BPP A;  3TXN A;  3VLF A;  2AXU A;  4G25 A;  4A3V A;  4FP7 A;  4KZ0 A;  5G2N A;  5BUZ A;  3GZ2 A;  3CVL A;  4N2S A;  3C98 A;  4JXT A;  3CGH A;  3QOU A;  4IUL A;  3APC A;  2Y3A A;  4UI9 K;  4APF A;  3FTX A;  3PEU B;  2KZT B;  4ILG A;  3CVX A;  4JL0 A;  5ENN A;  5J08 A;  4JPS A;  2J4B A;  3ZYL A;  4N5C A;  4Q96 A;  3RU0 A;  3CEQ A;  1OWO A;  1B89 A;  2X6K A;  2MHK A;  4E85 A;  2PM6 A;  5BNW A;  3L17 A;  2IFU A;  5BV0 A;  4DJA A;  4CDM A;  3CVV A;  5HI7 A;  4KZC A;  3SZ7 A;  3T5V A;  3Q15 A;  4WWP A;  5J90 A;  3APD A;  5ANL A;  4DI3 A;  3MGB A;  4LER A;  2IOL A;  2R5S A;  4OYS A;  4UWH A;  3QC1 A;  1IYG A;  4IN3 B;  4Q94 A;  4BY6 A;  3FFL A;  5CMW A;  3HVE B;  4I9E A;  2FUL A;  3ONL A;  4DK5 A;  1KT1 A;  3QWV A;  3ASD A;  5DBK A;  5G05 J;  5BV1 A;  4UQY A;  2YIN A;  4B0Z A;  2LO6 A;  3PEV B;  4EZK A;  4ANV A;  2IU1 A;  5LFA A;  3QWW A;  2VSO E;  2X6H A;  5FQ8 A;  4FHJ A;  2CHZ A;  2CG3 A;  2XRZ A;  2ZU6 B;  1SZA A;  5AIJ A;  4I9C A;  2OVF A;  3CHP A;  4RG9 A;  2WXH A;  5T3R A;  4L7T A;  3KS2 A;  3FH5 A;  3OTN A;  4MKT A;  3L22 A;  3U9W A;  2GW1 A;  4EZL A;  5FQ6 A;  3I4G A;  2DIW A;  3JCK C;  2WQH A;  3FY4 A;  1E7U A;  1NZN A;  2I2O A;  4L23 A;  3RIB A;  3GYZ A;  4ATG A;  4HVB A;  3ZGQ A;  1EYH A;  3QB2 A;  3ZYK A;  4KXK B;  4N3A A;  3ZN3 A;  2VSX E;  2VQ2 A;  4ILI A;  2HR2 A;  3FUE A;  2VTB A;  4F1S A;  4TUU A;  4G2V A;  3S7D A;  4YVO A;  4KBQ A;  3MZL B;  3BEE A;  4FJY A;  2XCC A;  2QY7 A;  3GW4 A;  3ULQ A;  1ZU2 A;  3MKR A;  4JA7 A;  3ZHE B;  4ANU A;  3SFZ A;  2ILR A;  4J6I A;  3FTY A;  4WNF A;  3FUL A;  4GU5 A;  2V0P A;  2WM9 A;  5G05 C;  3FUM A;  3FTS A;  4FA6 A;  5KJN A;  4DPR A;  3FUN A;  1Y8M A;  4IYP A;  4CEM A;  5KJK A;  4BT8 A;  3PRZ A;  2KCK A;  2WXR A;  2WMN A;  2PQN A;  3SHF A;  2PZI A;  4GAA A;  3OXL A;  1HXI A;  4HS2 A;  1Z3X A;  3UUX A;  4I6E A;  4R7L A;  3L16 A;  3MCX A;  2L0I A;  5FQ7 A;  3FTW A;  3FUH A;  4CGV A;  3R7R A;  3CVY A;  1DVP A;  3K9I A;  3NZU A;  3PS6 A;  2V4L A;  4CGW A;  3RK6 A;  3HIZ A;  2R59 A;  1H6K A;  3D9P A;  3HYM B;  4I1O B;  3BG1 B;  3LDZ A;  3EHM A;  5FZS A;  2R17 C;  2IOS A;  2XPZ A;  4L1B A;  4MRU A;  2WMO A;  1OWP A;  2EQX A;  2PL2 A;  2XGS A;  4GZC A;  4JHK A;  3G2S A;  3FUI A;  2WXI A;  2AXZ A;  3N71 A;  2HO1 A;  4ILH B;  4EEC A;  1NP7 A;  3VTX A;  4WWN A;  5E75 A;  4P29 A;  1UN9 A;  3LVQ E;  3S7B A;  3CQG B;  5G55 A;  2WQ7 A;  4RG6 A;  4GPK A;  4MS6 A;  1E7V A;  1JPL A;  5DIZ A;  2WQ6 A;  2WXJ A;  4N2Q A;  2V8S E;  1OWN A;  2J4D A;  1E90 A;  3ESK A;  3MKQ B;  4I17 A;  4AOF A;  3RKV A;  2E0I A;  2J07 A;  4BX8 A;  4EBA G;  4W9R A;  1N54 A;  2BUG A;  2KM4 A;  2VGX B;  3QK0 A;  3G2W A;  1ZBP A;  3FU3 A;  3HDX A;  1N52 A;  5ARG A;  4AM9 A;  3FUK A;  2WXN A;  2LAI A;  4JEU A;  5AYW D;  2AVP A;  4GZ3 A;  5BW8 C;  5KCM A;  3RO2 A;  2X3M A;  3UMV A;  2WXK A;  3B7S A;  2I1J A;  3FH8 A;  3L08 A;  3MX3 A;  3PE3 A;  4I1A A;  4WUY A;  5C2Y A;  5FT9 A;  3TJP A;  1KT0 A;  4OVU A;  1INZ A;  2XPY A;  3NZS A;  3Q5M A;  2UY1 B;  3SI5 A;  4FC8 A;  2CFZ A;  4CT0 A;  3CLJ A;  3G2V A;  4F7A A;  3TGO A;  1TJC A;  3L13 A;  2WVI A;  3S7J A;  4U8H A;  2YNQ A;  1KLX A;  3CHR A;  3UT7 A;  4YND A;  5CCM A;  4AP2 A;  4BSX A;  3SF4 A;  3IHV A;  3JYS A;  4J8E A;  2HYZ A;  2L0T B;  4AVX A;  4BT9 A;  4XIF A;  1PY1 A;  2CHX A;  3CIA A;  3D3M A;  3P1U A;  3G2T A;  2FF4 A;  2X6I A;  1MQS A;  3UQ3 A;  1TEZ A;  1HU3 A;  2XHE A;  3RRM B;  2WPV A;  3ASF A;  4GYY A;  2AXV A;  1SQM A;  3U66 A;  4CCA A;  2BTD A;  2C0M A;  2RD0 A;  3CSF A;  1JUQ A;  3D9K A;  1H0A A;  2FEZ A;  3ML9 A;  5LX8 A;  4K0R A;  4H7X A;  3RRN B;  3SBS A;  4BTB A;  1IQR A;  3E4B A;  4HXI A;  2KC7 A;  2WXL A;  5HQ8 A;  4KVM A;  4LCT A;  5ANR A;  3MV3 B;  4L2L A;  4WND A;  1QQE A;  1H2V C;  2XQ0 A;  4J8F A;  5AEN A;  4V3I A;  3CST A;  5JJ7 A;  2E2E A;  4XE0 A;  5EX0 A;  2V5F A;  4ACL A;  3D9J A;  3EHN A;  3CVW A;  1HFA A;  3GZ1 A;  2OOE A;  2FI7 A;  3PDN A;  3FUF A;  4UI9 C;  4AY6 A;  2CHW A;  3LXU X;  3ZVV A;  4LEU A;  4G23 A;  4N3C A;  1Y6I A;  3MJW A;  3QWP A;  4C9B B;  1H2T C;  3O4Z A;  1S0P A;  4I1M A;  4O6F A;  4APO A;  4KVO A;  3ASG A;  1PC2 A;  4UQX A;  4HOQ A;  1X5B A;  3HHM A;  3Q47 B;  2XGO A;  1E8W A;  3ASH A;  4A1S A;  2L6J A;  5C1D A;  4URK A;  3CK8 A;  5CMY A;  1WM5 A;  3JQ1 A;  3PUJ A;  4AJW A;  2BF0 X;  1H2U A;  4D10 C;  2WXG A;  5CHE E;  4FAD A;  3FTV A;  3S2A A;  4JVS A;  3I5P A;  4U0U A;  1Z6T A;  4ABN A;  2IJG X;  2P58 C;  2VGY A;  1HF8 A;  4G11 A;  4OVV A;  2JLB A;  4GYO A;  4U0Z A;  3ZFW A;  2I6H A;  4CDR A;  3CHM A;  1BPO A;  2FBN A;  1UG3 A;  2XGM A;  3DBS A;  2J08 A;  3G2U A;  3ONK A;  3VTY A;  1ELW A;  2KCL A;  3LEW A;  3B13 A;  2YHE A;  3Q49 B;  3EIJ A;  3SBT B;  2MRI A;  4B8A A;  1E8X A;  5ARF A;  5FZR A;  4GA2 A;  3LY9 A;  3RRU A;  3CHQ A;  4NRH B;  5JHB A;  3PH0 C;  4GML A;  1HG2 A;  5EX3 A;  3LY7 A;  3TL5 A;  3D9L A;  1U3D A;  3PUK A;  5A23 A;  5FQ4 A;  2NSZ A;  4JZY A;  3IKO B;  1QNF A;  4U63 A;  3VLE A;  1P5Q A;  5EDS A;  3OXG A;  4WAF A;  2VYI A;  4CT4 A;  1OWM A;  3QDN A;  2GGF A;  4U07 A;  4LRZ A;  5E76 A;  2WXQ A;  2C2L A;  3FEY A;  3LCA A;  5FJY A;  2XRY A;  2Q7F A;  4PS8 A;  3AS8 A;  4WWO A;  2DCP A;  3B7R L;  4XX5 A;  5A7D B;  1FCH A;  4C0M A;  1HZ4 A;  2GRM A;  2XPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...