1YAXA

Cystal structure analysis of s.typhimurium phoq sensor domain with calcium
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
153
structure length
153
Chain Sequence
b'MDKTTFRLLRGESNLFYTLAKWENNKISVELPENLDMQSPTMTLIYDETGKLLWTQRNIPWLIKSIQPEWLKTNGFHEIETNVDATSTLLSEDHSAQEKLKEVREDDDDAEMTHSVAVNIYPATARMPQLTIVVVDTIPIELKRSYMHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Virulence sensor protein phoQ, sensor domain
publication title Metal bridges between the PhoQ sensor domain and the membrane regulate transmembrane signaling.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase, signaling protein
total genus 30
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.140 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1yaxA00
3BQ8A 4UEYA 3BQAA 1YAXA
chains in the Genus database with same CATH superfamily
5GL9A 3VOLA 2FZ0A 4FTXA 3C38A 4IUKA 4BL3A 1Y4OA 3CJMA 3SS5A 3P09A 4Y2FA 1ODVA 4KZ5A 3IWQA 1XP4A 2Y55A 4ZJ2A 5M19A 5KMWA 3OCNA 1S67L 4KQOA 4I39A 1ONGA 5TJJA 2DNSA 3HVFA 3ZG5A 2OSUA 1XX2A 3D4FA 5HZHA 4WBGA 2WAEA 4IBXA 1ZG6A 3LYXA 2OAQ1 2UWXA 1SDNA 1Z09A 1NJ4A 4H6JB 4OPYA 4MEZA 2VK3A 2WAFA 4MDZA 1GSWA 1HVBA 4WN5A 5EVIA 3HLFA 1VHMA 2E8IA 2L4RA 1W8QA 4KUKA 4JF5A 3IXGA 4KQRA 4OVDA 3QNCA 5FQKA 3G35A 4KUOA 3ZCZA 3OCLA 3JVUA 1L3LA 4EERA 1VQQA 1BLCA 2M7VA 2W0NA 4FH2A 1MPLA 5FDHA 2DRWA 2JN7A 5U47A 4JGRA 2XEPA 2XFSA 1DP9A 2Z2LB 4X56A 5DF8A 3DTEA 5GLDA 3TOIA 1LL9A 1PW1A 5G4ZA 4RYEA 5EVIB 1OTIA 5E2HA 2P08A 4ESPA 2VV8A 4QPRA 3R7WB 2Y2JA 4DJ2A 5HPFA 2JKGA 3BLSA 3PBTA 3A3DA 4KZBA 3MQ0A 4L9EA 2ZC7A 1Q2QA 2Y2MA 3NULA 1K55C 1WYBA 1TDGA 3A0RA 3QHYA 3F1NA 3C4PA 2ZM2A 1OTBA 4CLCC 2D02A 3IF6C 4R3AA 2HF6A 3TSGA 4HH3A 4DF6A 4K0XA 4FOFA 5DKKA 4E3JA 1I5QA 5HDSA 3PBQA 4G3KA 4BMWA 1SCWA 1OMEA 1W7FA 1ZC2A 1S6RA 1JWVA 4B88A 1GA0A 5HL1A 5FEFA 1V9YA 3FWLA 3MMHA 3E4QA 5HAQA 2XK1A 2Y79A 3ISGA 5TBMA 4BQMA 2W3DA 4BL2A 3E4OA 1Z6FA 3T1SA 1PYYA 1Y28A 5CERA 4GOGA 1DRMA 1J9MA 1IYSA 3HREA 2ZQDA 1YLTA 1L0FA 1K56A 2XGNA 3PYPA 4NG2A 2R9XA 4KG6A 1L2SA 5A92A 2A3UA 1Y54A 3IX4A 3G32A 4KZ8A 5K5BA 1BULA 3LY4A 3EGXC 3LR0A 3F1PA 3FPVA 3IF6B 1MWTA 3IX3A 3ZNTA 4Y0OA 1P0ZA 2XA7M 3BFCA 5HSQA 4X25A 2PBDP 3LO7A 3HL9A 3OOVA 3RXWA 3T4KA 2V2FF 1YPRA 2V9AA 1BUEA 2V8CA 1E4DA 2PD8A 3KYQA 4WELA 3BECA 5TFQA 2V1AA 3VP4A 4K91A 2PD7A 3KX0X 3ZFZA 4ZBEA 4WMCD 4I38A 1KE3A 1F98A 3W4OA 5IT5A 2ZQCA 3S22A 2A2LA 3S1YA 3B47A 5A91A 3LR3A 1YMSA 3BQ8A 3W4PA 1GSXA 1K57A 1W5DA 4X6TA 2A24A 2PBYA 1J3WA 2VJWA 3VFFA 3L7HA 4HBUA 3MXQA 3A0VA 2G2WA 4BLMA 1FSWA 2VGLS 4P6ZS 4HY8A 3VSKA 3C2WA 4S2LA 4OQ0A 5FAPA 5HWTA 4LRYC 5HAIA 3IH8A 1XPBA 1SKOA 2C6WB 4GDBA 2V1ZA 4EESA 4L9GA 2QJ7A 2QKPA 2V20A 1G68A 3LCEA 3GVBA 5FI7A 4L9FA 2HDUA 5E2GA 4YFMA 4GZBA 4DE3A 4LV3A 4X55A 4KZ3A 1MWSA 2M7UA 4C75A 1IKIA 4CPKA 4E6WA 4PAUA 1W63M 5FEGA 2OAP1 2X02A 2PYRA 2WGWA 5AQAA 3VP3A 1JTDA 3UMDA 3RTYA 3N4IA 3A3FA 3HLCA 2ZD8A 5HD5A 4F94A 3OPLA 3S7PA 2GDNA 3IQAA 4EWFA 1XA1A 4Y17A 4R4RA 3V67A 2XDMA 3M6HA 4GB7A 5FAOA 2IA2A 1G6OA 3MJQA 4O7DA 4JXWA 2A49A 2IWCA 4ETZA 1XJ4A 4DN0A 3HUOA 2OWJA 3PBSA 1KGEA 2WKPA 5J7EA 3G2YA 2Z6CA 4WF0A 3KYZA 1MXOA 4NXGA 3ICYA 1RGYA 3HLDA 1XJ6A 5IHVA 1ESUA 3N6IA 2YKFA 1EWZA 4EETB 3NC8A 2Q9NA 3MZDA 2R9WA 2NUPC 2EX6A 5FQJA 3CPTB 4BBVA 1LLBA 3TJZC 1LI0A 4R4SA 3N7WA 4Y3IA 1CI9A 4Q0HA 2W27A 3P01A 1CJFA 1YLYA 1UWPX 5I94A 3GQZA 2EFXA 3AGDA 1DJBA 1K54C 4ARZA 2WUQA 1TS0A 1H3QA 3UE1A 3IBRA 2OV5A 3B3XA 2JKTM 3ZDJA 4IUHA 3UPOA 1NY0A 2D01A 1CK3A 4ZRRA 3DWZA 1ESIA 4O8GA 3ZG0A 1VEUB 2I9VA 2YKHA 1KDSA 3MFDA 4LRXC 3NHQA 1ES2A 3KYEA 1CEFA 2VX8A 3KSIA 2Y2PA 2GNXA 1K0KA 1WE4A 2K7SA 3UB6A 2FH5A 4F3LB 2V0UA 3DAVA 1L0GA 1XKZA 1ERQA 2JKTI 2VEAA 3KSFA 3BWLA 2OLUA 1S1YA 3U4LP 3ZVTA 4O01A 1W79A 5CEDA 5TR7A 2H0YA 4DRTA 4JGPA 2H10A 2Y2LA 1GHMA 1BSGA 1O07A 2Y2QA 5CHUA 1TD5A 2Y2OA 1ERMA 1O7EA 1ZKJA 4RX2A 2CMNA 3MZFA 3SOIA 4S2NC 1N9OA 4PKYA 2P04A 3W4QA 4E04A 3ULFA 1OJGA 4HHDA 5KIZA 4FSFA 2BASA 3FV7A 3PBOA 4KG5A 4IHQA 3JVVA 5EOEA 4KZ4A 4KENB 4OP5A 1GHPA 4IEDA 3ITAA 4JXVA 4HESA 4MBKA 1TS7A 1L0DA 2GZAA 2PT7A 2WKEA 4UQIM 1E3UD 4LGWA 1UGUA 4E3KA 3NY4A 3G2ZA 4H6JA 4MN7A 4YINA 2V8FA 1H8YA 2VLGA 4Y7PA 3WS5A 2W3HA 2V0WA 1IYPA 3UE0A 4UA9A 2K2NA 4YNRA 4NKPA 2J9PA 2B18A 1OPXA 1WA9A 1L0EA 3GECA 1KOUA 3N8SA 4JXGA 3QP1A 4PMAA 4U0TA 1XXMA 4E3IA 1G28A 3SS4A 5KSCA 3RJUA 3MR0A 5HPIA 2WKHA 3G4PA 3E0YA 3UE6A 4KG2A 3JPUA 1YM1A 1NWZA 3QP4A 4X68A 1YQSA 5J3WA 1NZOA 3I7JA 1PNEA 4FD8A 4QWOA 4XT2A 4LCLA 2J3TD 2O0YA 3ZVWA 3Q7VA 4CQHA 3OBFA 3PXPA 3CI6A 1VETB 1S66L 1PFLA 4PM8A 1KGGA 2E8JA 1N9NA 3NOPC 4WZ5C 2KOIA 3R4KA 4L0LA 3PAGA 4PPRA 3UPPA 4UA6A 3R7WA 1H0MA 4X1MA 1KE4A 1FCNA 2P9VB 2J8YA 1NYMA 1MC0A 4OP8A 3DTIA 2XRNA 3NDGA 3T1QB 3FKVA 2B02A 3HJIA 4KZ9A 3S7NA 1T19A 3MFXA 4LFUA 5EVID 2VV7A 3BM6A 1HZOA 4XT2B 1OTAA 2PHYA 3Q7VB 1XFQA 2J9OA 4BD0A 2Y2IA 2JHEA 5EE8A 1RCJA 3LEQA 4O0PA 3VP2A 1U60A 1ONHA 2WK0A 3LR4A 5HDCA 2WKIA 1TS8A 4MBFA 4GLQA 1JNUA 2EX9A 5GHXA 5HW3A 3QP8A 1YLPA 1YKDA 3P7NA 4UEYA 4CLCE 1SKFA 4U3TA 4Z9QA 3LICA 3RH8B 1ACFA 2XROA 1FILA 2Y2GA 4BJPA 5CTMA 1W8YA 2ZJ9A 3Q1FA 3WS4A 1K55A 3IS2B 3OLOA 2HJEA 4BENA 3T50A 3IF6A 2XD1A 1AXBA 2ZC6B 4QHCA 2JC7A 1K6RA 5CGXA 1KGFA 3WS0A 4XUXA 4HBTA 1FCMA 2EX8A 1PWGA 4YWZA 1KVMA 2ZL1A 3V50A 3T4JA 5DJTA 5M18A 5E43A 2QMIA 4EBPA 5HAPA 3RXXA 3EQUA 5DTTA 1GA9A 1PI4A 2NUTC 2VGJA 3HLGA 4WYYA 5EOOA 3ZGAB 4CLCB 1FSYA 3ZQ5A 2JBFA 5FAQA 1D06A 5FL3A 1D7EA 2ZOIA 1P9RA 2EA9A 5EECA 3ITBA 3BEBA 3DTMA 2PU4A 5M1AA 5CHMA 4AFIA 1K56D 3GSGA 2LB5A 4GCZA 2ZL1B 4G3WA 1FIKA 1JVJA 2ZMFA 3C7UA 3QP5A 5DFYA 4HP9A 4N9KA 1YLJA 3EEHA 4B4ZA 5CX7A 2XLNA 4DMZA 1IKGA 2IWBA 4EUZA 3IXBA 4GS9A 4WEKA 2XH9A 2Y8HA 3FG8A 1NYYA 2Z2MB 3RFBA 4WEJA 5CEBA 4JLFA 4I3AA 5F5YA 3LFVA 2J7VA 4JKTA 3V39A 4OOLA 2JKRM 2R78A 5AQBA 4DKIA 5FSRA 3HUNA 4NEED 4MBHA 2MJ6A 4IBRA 1PZPA 4ETXA 5CXWA 3IT9A 2JKFA 4P6BA 3HBRA 1N9LA 1JTGA 3LEZA 3Q07A 5EVLA 5GLCA 3OPHA 4JF4A 1XFNA 4HOIA 4PKYG 2WGIA 4B4XA 1DJAA 4GS9B 1XGIA 1CI8A 5G18A 2JKRI 2WKRA 2J80A 3UPNA 4HQAA 1OTEA 3CUEC 4HNBA 4CJNA 4JBFA 3NCKA 4R6LA 1BZAA 1STZA 5F68A 4S2MA 3G34A 2XD5A 4E3NA 2K31A 3HLBA 1XJ2A 3MKEA 2EWWA 1MKIA 4PHTA 2Q9MA 1ZG4A 1PIOA 1ES4A 3MS6A 4ZTKA 1FR1A 1NLYA 3BFGA 3CPTA 2HJ9C 3D9YA 1IEMA 3K2NA 2HP9A 4LCMA 3FZCA 4EBNA 2HZ5A 2VKSA 1OJ5A 1GSVA 4M3KA 1T18A 3G31A 2B95A 1BT5A 4NK3A 3SH8A 3QP2A 1JWZA 2W3EA 4MLLA 1H5XA 1PI5A 4I5SA 5HWWA 2QPNA 1A0KA 4DE0A 2HPBA 4HI4A 3LIAA 1FCOA 3IBJA 1OTDA 4Z1WA 1YT4A 4DXCA 4C6YA 4S2KA 4LRZE 5J8XA 2KX6A 1FQGA 5EUAA 1VEUA 3G6OA 3S7QA 4N1HA 3SZTA 3NOTC 3C7VA 1KDWA 5CGWA 2ZM8A 3E2KA 2ACGA 3IF5A 1PWDA 3VP0A 1EROA 2ZQ9A 5AVEA 1MZUA 3MF0A 2HDRA 4GDNA 4F3LA 4ZAMA 4N92A 5FA7A 4HH2A 4RQ9A 3AGEA 2GX5A 2XR0A 3LIBA 3CHWP 2JCHA 4H8RA 3LR5A 2VGLM 4S2IA 4P6ZM 4X1LA 5FQQA 1ZTUA 3F1OB 1N4OA 4X69A 5CECA 1SHVA 2AVXA 3H82B 2BG1A 2XF3A 4WUJA 2LB9A 2O9BA 1Q2PA 2B5RA 4LV0A 1K54A 3HCYA 2PRFA 4GJ4A 4HJ6A 2WYXA 3C4OA 4BD1A 4NXEA 4NXBA 3T4SA 4E3MA 5DTSA 1LT0A 2ZQ7A 4P87A 3JYIA 2J3WA 3UNWA 2PU2A 3OPRA 1GCEA 1NZUA 2EX2A 3NOUC 3AGFA 4P85A 4EUVA 3CZDA 4EQ1A 1IFQA 3PBNA 4EU0A 3UE3A 1LSWA 2PDRA 3T4QA 3Q81A 4LLOB 3SS3A 2I72A 2VGKA 4QY5A 5EM0A 4MNRA 2P7JA 3DW0A 1PZOA 3P98A 4Y0TA 5EFWA 4GW9A 3T1XA 2HP5A 2HV1A 3MKFA 1M40A 3UB7A 3FC7A 4HIAA 4NXFA 1YSQA 2C5WB 3EEAA 5DF7A 4R23A 2ZQAA 4UHUA 2H28A 3O86A 1LL8A 3MQQA 3IHBA 4E6XA 1SDEA 3UN7A 4R70A 3Q7ZA 4OH0A 5DFXA 2Q0OA 2Y91A 1VM1A 3MBZA 1LHYA 3BJNA 3W8KA 4DDSA 2FFYA 3E4PA 5GLBA 4PM5A 1IOUA 3GRJA 3C8CA 3LI9A 1CF0A 4XXRA 5GHYA 5AJGA 1VETA 1S4RA 2J3TC 5L07A 1NXYA 5FATA 4LENA 1MKMA 2P9VA 1MY8A 4GN2A 1G5UA 4R3BA 4QU3A 1H8MA 3M2JA 4GHIB 2VZWA 2WZXA 5CHJA 3O87A 4LV2A 5F82A 1NLZA 4U0XA 4HJ4A 3GTCA 1ES3A 2Z6DA 3IHAA 4Q8IA 3LIDA 1MBLA 3KO6A 5AQ7A 2PYPA 2CC1A 2ZOHA 1RGZA 4ZJ3A 1LSVA 3T4OA 2EFUA 2Y2HA 3H7WA 4WL9A 5EVIC 1PRQA 4X53A 3ZNYA 4E3LA 1K4FA 5L09A 1YLWA 3EOIA 3HUMA 4OQHA 3M2KA 1TVFA 5F1FA 2RL3A 1TS6A 5E2EA 1YAXA 1FOFA 2L1MA 2PR5A 2VA0A 3VE4A 4R38A 3NIAA 4KZ6A 2V1BA 3BFEA 2FFFB 4Y0UA 4WLAA 2DMWA 4GD6A 5DJUA 1XGJA 4BWIA 5KSHA 1XA7A 1DJCA 2UV0E 1T1CA 3LGOA 2W3GA 4S2JA 3BY8A 2WKQA 3BFDA 4WZ5A 1F5MA 4OKPA 3S4XA 3EWKA 5EVEA 4HP4A 3H7WB 1K4EA 2XA7S 3V3SA 1C3BA 3IS2A 5F6AA 1MWUA 4OQIA 4P0MA 5HWVA 4OLDA 2G7UA 2VV6A 3OC2A 1JWPA 4IVKA 2Y4AA 3LY3A 2ZMAA 3CWFA 5A93A 1QMFA 3PBRA 3WRZA 2P74A 3OZHA 3G30A 3UDIA 3T12B 1UWNX 3QP6A 2Y59A 4N9LA 2XSSA 2ZC5B 4JPMA 4Y5FA 4EQIA 3LUQA 1PWCA 2ZM0A 1D1JA 3GR2A 4JF6A 5CGSA 2ZBBA 1FR6A 3WRTA 1K6SA 1KE0A 3VV4A 2EXBA 1K38A 2GJ3A 2XFTA 4CLCA 5HL6A 3UO9A 3OPPA 4QY6A 1EI5A 4HJ3A 5GHZA 4B93A 5DVAA 4LPZA 1MWRA 2WGVA 2BLSA 4Y13A 2X01A 2INWA 2XQZA 5C5KA 2M1CA 2ZLYA 1W63Q 4Y15A 4IVIA 4R1GA 3BQAA 1BLSA 4OPRA 4DJ3A 3HLEA 5L10A 4CLCD 5F1GA 3F1NB 3CITA 1QMEA 1YMXA 1PW8A 2L0WA 1XJ3A 4MN6A 1N9BA 4NETA 4QD4A 3QNBA 4MMNA 1F2KA 5E2FA 1OT9A 1H8ZA 3B42A 3ZYTA 2PAVP 3EQVA 4UA7A 3TRCA 2DCFA 3SH7A 3V5MA 5GLAA 3N8LA 2Y2KA 1T1AA 1G6AA 1WYCA 2H0TA 4WMCA 2O99A 4D60A 1IELA 3IXHA 1X0OA 3NDEA 5TBMB 3GV9A 3NJAA 4DDYA 3NECA 3NBLA 4UAAA 2HDSA 4PM6A 5EM1A 3DTKA 1YLZA 4ZDXA 3ZG8B 2HP6A 2EWVA 3A3EA 3A3IA 1K57C 4RA7A 3VOZA 2KDKA 5DF9A 4EEUA 3K3DA 5L2FA 3BRMA 2ZC4B 4HEFA 4S2OA 1KVLA 4DE1A 4EV4A 4MCWA 4DE2A 2QHKA 3F1PB 1CQAA 5DTKA 1M6KA 4QB8A 4KZ7A 3KSGA 3IXDA 5BOHA 4S2PA 4GKUA 4KZAA 3FKWA 1I2SA 3L9KA 3A3JA 3CLOA 3UMEA 3T1RA 3W2ZA 1ZHHB 2HDQA 3ZG7B 3O5YA 2H5SA 5HARA 3MSHA 3IWOA 1DP8A 4WZ4A 5A90A 4Q0IA 1LI9A 3M6BA 1YSPA 3SW1A 5F69A 1VB6A 2QYBA 3BLMA 5TGFA 2PR6A 1ES5A 1GHIA 3FYZA 2RCXA 3E98A 2ZQ8A 5CRFA 1TF1A 4FH4A 5FQMA 3PHYA 3BYDA 2QZ6A 4ZJ1A 2A24B 5AQ9A 4YOFA 1BTLA 3DBAA 3TE8A 4R3JA 2OOLA 1S4SA 4KQDA 3WWXA 3CUEA 3PAEA 4K0WA 4C3QA 3IX8A 3TW8A 5EPHA 2QWSA 1P9WA 4I3IA 3NI9A 5FI6A 4MN5A 4RX3A 4QJGA 3BW6A 1SKOB 3ZG9B 3HLWA 3UB8A 3B33A 3D72A 1RP5A 3O3VA 3MXSA 5CTNA 4R0QA 5FASA 3K3CA 5L8MA 4ME4A 3F1OA 3CAXA 1K25A 2OWHA 4WM9A 3E2LA 3HJKA 3H82A 3IWIA 3N8RA 3VP1A 3U2AA 4D2OA 3TG9A 4EBLA 1CEGA 4GNUA 1BYWA 4OOMA 3O88A 2WGWB 3IH9A 4PM7A 5FI2A 3LIEA 3FPWA 2O9AA 4DXBA 4LV1A 5IU1A 3VOYA 1T1BA 3CG5A 4I3JA 4II7A 1S0WA 5I5LA 5FQ9A 2G2UA 4G3VA 4E3OA 4JGOA 4UQIS 3C30A 3VMAA 3VSLA 1NRFA 2HGVA 3KSHA 5HD3A 5KZHA 2IWDA 1S1ZA 3UB9A 3A0SA 3S7OA 4N1XA 1TEMA 2O9CA 2WADA 4EW7A 3T4TA 3PTEA 1LL5A 4PM9A 1EW0A 1NRJA 2W1TA 2ZC3B 4JGQA 4A5RA 1E25A 3LIFA 3DWKA 1SZVA 3PR6A 4ID4A 5DKLA 3BFFA 2EXAA 3UY6A 2ZMVA 3LI8A 3Q82A 5HFOA 4ARZB 1HTZA 5JYPA 3MQOA 2Y2NA 3MZEA 5J4EA 4EXOA 3BY9A 4BBUA 1HD8A 1OT6A 5HX9A 2W1TB 1V9ZA 4OPZA 1BLPA 2QJ5A 4OOYA 5F83A 3UB5P 3ZHHA 4B9OA 3VFHA 4FUWA 3D3OA 5JYOA 1DY6A 5FDSA 3V3RA 3VE3A 3T4LA 1DP6A 1ALQA 4OLGA 4GHIA 2X71A 3SH9A 1LSXA 4EEPA 4RVAA 2WZZA 4XUZA 1IYQA 3CMZA 1P97A 4S2NA 1E3UA 3UDXA 4Q0JA 1TDLA 4JXSA 4K08A 2OLVA 5FQIA 2BTFP 4KQQA 4OPQA 3EGDC 5G4YA 4FCFA 5MC7A 3MXRA 3C5AA 4IJGA 5LBRA 4OONA 3UDFA 3WS1A 4GD8A 5A8BA 1BLHA 2W1RA 2JE5A 4BBTA 3GMWA 2W3FA 3WS2A 1I2WA 5D3OA 5EV0A 2KLIA 3H9WA 1AWIA 4M4XA 1HLUP 3GDIA 5AVFA 5IS1A 1F9IA 1IYOA 4OQGA 5HDDA
chains in the Genus database with same CATH topology
1N9LA 3VOLA 4HJ3A 2JKTM 2FZ0A 4B93A 3C38A 4IUKA 4LPZA 1XFNA 4HOIA 4IUHA 4PKYG 2D01A 4Y2FA 1ODVA 4ZRRA 4O8GA 2INWA 5C5KA 2I9VA 4GS9B 2M1CA 2YKHA 1S67L 3OCNA 4KQOA 1W63Q 4I39A 4LRXC 5TJJA 3NHQA 2JKRI 2WKRA 3BQAA 2J80A 4DJ3A 4CLCD 4HQAA 1OTEA 3CUEC 4HNBA 5HZHA 2VX8A 3KSIA 4R6LA 3F1NB 2GNXA 3CITA 1STZA 5F68A 2K7SA 3UB6A 2FH5A 3LYXA 2K31A 2OAQ1 2L0WA 2V0UA 4F3LB 1XJ3A 4MN6A 1XJ2A 2EWWA 4H6JB 2JKTI 4MDZA 1GSWA 2VEAA 3KSFA 4PHTA 3BWLA 4WN5A 4MMNA 1VHMA 2L4RA 1OT9A 1S1YA 3B42A 4KUKA 4O01A 3ZYTA 1NLYA 2HJ9C 3EQVA 4JGPA 3K2NA 4KUOA 3TRCA 2VKSA 1OJ5A 1GSVA 3JVUA 3OCLA 1T18A 4EERA 1TD5A 1T1AA 2W3EA 2M7VA 2O99A 2W0NA 4I5SA 5HWWA 2CMNA 2JN7A 4JGRA 1X0OA 1N9OA 4PKYA 4HI4A 5TBMB 3LIAA 2P04A 1DP9A 4E04A 3IBJA 3ULFA 1OTDA 4Z1WA 3NJAA 1OJGA 4HHDA 5KIZA 4FSFA 2BASA 3PBOA 5G4ZA 4IHQA 4LRZE 3JVVA 2KX6A 1OTIA 3G6OA 3S7QA 2P08A 3NOTC 2VV8A 2EWVA 4QPRA 3R7WB 4DJ2A 5HPFA 2KDKA 3PBTA 5DF9A 4EEUA 3K3DA 1TS7A 3MQ0A 4L9EA 2GZAA 4MCWA 2QHKA 3A0RA 3F1PB 3F1NA 2PT7A 5AVEA 1OTBA 4UQIM 1MZUA 3MF0A 4CLCC 2D02A 4F3LA 4R3AA 1UGUA 4HH2A 2HF6A 4RQ9A 4HH3A 2GX5A 3LIBA 4H6JA 3KSGA 4MN7A 4FOFA 5DKKA 2VLGA 5HDSA 3PBQA 4G3KA 4BMWA 2W3HA 3LR5A 2VGLM 2V0WA 4P6ZM 1ZTUA 3CLOA 3UMEA 3F1OB 2K2NA 3W2ZA 4YNRA 1ZHHB 3O5YA 4NKPA 2B18A 3H82B 1OPXA 1WA9A 3GECA 1KOUA 4WUJA 1DP8A 2LB9A 2O9BA 4Q0IA 1G28A 1V9YA 3MR0A 3HCYA 5HPIA 4GJ4A 4HJ6A 3MMHA 1YSPA 3E0YA 3SW1A 3UE6A 5F69A 1VB6A 2QYBA 3E4QA 4NXEA 4NXBA 1NWZA 5J3WA 2Y79A 5TBMA 3T4SA 4XT2A 2PR6A 2W3DA 3E98A 2J3TD 3E4OA 2O0YA 1LT0A 1Y28A 4CQHA 1TF1A 3OBFA 2J3WA 3PXPA 3CI6A 1DRMA 1S66L 3PHYA 1N9NA 3NOPC 2KOIA 3R4KA 4L0LA 2A24B 4YOFA 3NOUC 3R7WA 3DBAA 3TE8A 3PYPA 4EUVA 2OOLA 1S4SA 4KQDA 4EQ1A 1IFQA 3PBNA 1MC0A 3CUEA 4EU0A 2XRNA 3UE3A 3TW8A 5K5BA 1LSWA 2PDRA 3T4QA 3EGXC 3LR0A 3F1PA 2QWSA 1P9WA 3FPVA 2B02A 3HJIA 4LLOB 2P7JA 3S7NA 1T19A 3MFXA 4I3IA 1P0ZA 4MN5A 2XA7M 3BW6A 5EFWA 4GW9A 5HSQA 2VV7A 2HV1A 3UB8A 3B33A 3D72A 4XT2B 1OTAA 3UB7A 3FC7A 4HIAA 2PHYA 3K3CA 3OOVA 5L8MA 3T4KA 1XFQA 4ME4A 4NXFA 1YSQA 3CAXA 3F1OA 2OWHA 3EEAA 2V9AA 3HJKA 2H28A 3H82A 1LL8A 2PD8A 3MQQA 2JHEA 3KYQA 4WELA 3U2AA 4R70A 4O0PA 2V1AA 2PD7A 3KX0X 3LR4A 5HDCA 1BYWA 4OOMA 5DFXA 1TS8A 4GLQA 4I38A 1F98A 1JNUA 5IT5A 3LIEA 3FPWA 2O9AA 2A2LA 3BJNA 1YKDA 3B47A 3P7NA 4UEYA 3E4PA 4CLCE 3LR3A 1IOUA 5IU1A 1T1BA 3C8CA 4I3JA 3LICA 3LI9A 4II7A 3RH8B 5I5LA 5AJGA 3BQ8A 2XROA 1S4RA 2J3TC 4G3VA 4JGOA 4UQIS 3C30A 1GSXA 2A24A 2VJWA 1MKMA 4BJPA 2HGVA 3KSHA 3MXQA 5HD3A 1S1ZA 3UB9A 3A0VA 3IS2B 3OLOA 3A0SA 3S7OA 2VGLS 4P6ZS 4HY8A 1H8MA 2HJEA 4GHIB 3C2WA 2VZWA 3T50A 2O9CA 4EW7A 3T4TA 1NLZA 5HWTA 4HJ4A 4LRYC 2Z6DA 1EW0A 3LIDA 4EESA 1NRJA 2W1TA 2QJ7A 3KO6A 2QKPA 4L9GA 2PYPA 2ZOHA 4JGQA 1LSVA 3T4OA 4L9FA 3H7WA 4WL9A 3LIFA 4YWZA 3T4JA 3EOIA 3PR6A 5DJTA 2M7UA 1TS6A 1YAXA 2L1MA 5DKLA 2PR5A 4PAUA 3EQUA 1W63M 2VA0A 3VE4A 2OAP1 4R38A 2PYRA 2ZMVA 2V1BA 3LI8A 2NUTC 3UMDA 3RTYA 4ARZB 4WLAA 3MQOA 2DMWA 5DJUA 4CLCB 5HD5A 4BWIA 5J4EA 5KSHA 4EXOA 3BY9A 3ZQ5A 3S7PA 4BBUA 1D06A 1T1CA 5FL3A 1D7EA 2ZOIA 1P9RA 1OT6A 2EA9A 2W3GA 3BY8A 2W1TB 1V9ZA 2WKQA 1F5MA 3V67A 2QJ5A 4AFIA 3EWKA 4HP4A 2LB5A 3H7WB 4B9OA 2IA2A 2XA7S 1G6OA 4GCZA 3MJQA 4G3WA 3D3OA 3IS2A 5F6AA 2ZMFA 3VE3A 4ETZA 5HWVA 1XJ4A 4DN0A 3T4LA 2OWJA 1DP6A 3PBSA 2G7UA 2VV6A 5DFYA 4GHIA 4HP9A 2WKPA 3OC2A 1LSXA 5J7EA 4EEPA 2Z6CA 4WF0A 3KYZA 3EEHA 4NXGA 1P97A 3ICYA 3CWFA 1XJ6A 5CX7A 3PBRA 4Q0JA 4DMZA 4K08A 2YKFA 4EETB 3EGDC 4GS9A 4WEKA 5G4YA 2Y8HA 1UWNX 5MC7A 3FG8A 2NUPC 4IJGA 3RFBA 2XSSA 5LBRA 4WEJA 4I3AA 4Y5FA 4BBVA 5F5YA 3LFVA 3LUQA 3TJZC 5A8BA 4OOLA 2W1RA 2JKRM 2R78A 4Y3IA 2ZBBA 4Q0HA 4BBTA 2W27A 2W3FA 3P01A 4NEED 3VV4A 1UWPX 2KLIA 2MJ6A 3H9WA 4M4XA 4ETXA 3GDIA 4ARZA 5AVFA 1TS0A 1H3QA 2GJ3A 5IS1A 4CLCA 1F9IA 3IBRA 5HL6A 5HDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BQ8 A;  4UEY A;  3BQA A;  1YAX A; 
#chains in the Genus database with same CATH topology
 5GL9 A;  3VOL A;  2FZ0 A;  4FTX A;  3C38 A;  4IUK A;  4BL3 A;  1Y4O A;  3CJM A;  3SS5 A;  3P09 A;  4Y2F A;  1ODV A;  4KZ5 A;  3IWQ A;  1XP4 A;  2Y55 A;  4ZJ2 A;  5M19 A;  5KMW A;  3OCN A;  1S67 L;  4KQO A;  4I39 A;  1ONG A;  5TJJ A;  2DNS A;  3HVF A;  3ZG5 A;  2OSU A;  1XX2 A;  3D4F A;  5HZH A;  4WBG A;  2WAE A;  4IBX A;  1ZG6 A;  3LYX A;  2OAQ 1;  2UWX A;  1SDN A;  1Z09 A;  1NJ4 A;  4H6J B;  4OPY A;  4MEZ A;  2VK3 A;  2WAF A;  4MDZ A;  1GSW A;  1HVB A;  4WN5 A;  5EVI A;  3HLF A;  1VHM A;  2E8I A;  2L4R A;  1W8Q A;  4KUK A;  4JF5 A;  3IXG A;  4KQR A;  4OVD A;  3QNC A;  5FQK A;  3G35 A;  4KUO A;  3ZCZ A;  3OCL A;  3JVU A;  1L3L A;  4EER A;  1VQQ A;  1BLC A;  2M7V A;  2W0N A;  4FH2 A;  1MPL A;  5FDH A;  2DRW A;  2JN7 A;  5U47 A;  4JGR A;  2XEP A;  2XFS A;  1DP9 A;  2Z2L B;  4X56 A;  5DF8 A;  3DTE A;  5GLD A;  3TOI A;  1LL9 A;  1PW1 A;  5G4Z A;  4RYE A;  5EVI B;  1OTI A;  5E2H A;  2P08 A;  4ESP A;  2VV8 A;  4QPR A;  3R7W B;  2Y2J A;  4DJ2 A;  5HPF A;  2JKG A;  3BLS A;  3PBT A;  3A3D A;  4KZB A;  3MQ0 A;  4L9E A;  2ZC7 A;  1Q2Q A;  2Y2M A;  3NUL A;  1K55 C;  1WYB A;  1TDG A;  3A0R A;  3QHY A;  3F1N A;  3C4P A;  2ZM2 A;  1OTB A;  4CLC C;  2D02 A;  3IF6 C;  4R3A A;  2HF6 A;  3TSG A;  4HH3 A;  4DF6 A;  4K0X A;  4FOF A;  5DKK A;  4E3J A;  1I5Q A;  5HDS A;  3PBQ A;  4G3K A;  4BMW A;  1SCW A;  1OME A;  1W7F A;  1ZC2 A;  1S6R A;  1JWV A;  4B88 A;  1GA0 A;  5HL1 A;  5FEF A;  1V9Y A;  3FWL A;  3MMH A;  3E4Q A;  5HAQ A;  2XK1 A;  2Y79 A;  3ISG A;  5TBM A;  4BQM A;  2W3D A;  4BL2 A;  3E4O A;  1Z6F A;  3T1S A;  1PYY A;  1Y28 A;  5CER A;  4GOG A;  1DRM A;  1J9M A;  1IYS A;  3HRE A;  2ZQD A;  1YLT A;  1L0F A;  1K56 A;  2XGN A;  3PYP A;  4NG2 A;  2R9X A;  4KG6 A;  1L2S A;  5A92 A;  2A3U A;  1Y54 A;  3IX4 A;  3G32 A;  4KZ8 A;  5K5B A;  1BUL A;  3LY4 A;  3EGX C;  3LR0 A;  3F1P A;  3FPV A;  3IF6 B;  1MWT A;  3IX3 A;  3ZNT A;  4Y0O A;  1P0Z A;  2XA7 M;  3BFC A;  5HSQ A;  4X25 A;  2PBD P;  3LO7 A;  3HL9 A;  3OOV A;  3RXW A;  3T4K A;  2V2F F;  1YPR A;  2V9A A;  1BUE A;  2V8C A;  1E4D A;  2PD8 A;  3KYQ A;  4WEL A;  3BEC A;  5TFQ A;  2V1A A;  3VP4 A;  4K91 A;  2PD7 A;  3KX0 X;  3ZFZ A;  4ZBE A;  4WMC D;  4I38 A;  1KE3 A;  1F98 A;  3W4O A;  5IT5 A;  2ZQC A;  3S22 A;  2A2L A;  3S1Y A;  3B47 A;  5A91 A;  3LR3 A;  1YMS A;  3BQ8 A;  3W4P A;  1GSX A;  1K57 A;  1W5D A;  4X6T A;  2A24 A;  2PBY A;  1J3W A;  2VJW A;  3VFF A;  3L7H A;  4HBU A;  3MXQ A;  3A0V A;  2G2W A;  4BLM A;  1FSW A;  2VGL S;  4P6Z S;  4HY8 A;  3VSK A;  3C2W A;  4S2L A;  4OQ0 A;  5FAP A;  5HWT A;  4LRY C;  5HAI A;  3IH8 A;  1XPB A;  1SKO A;  2C6W B;  4GDB A;  2V1Z A;  4EES A;  4L9G A;  2QJ7 A;  2QKP A;  2V20 A;  1G68 A;  3LCE A;  3GVB A;  5FI7 A;  4L9F A;  2HDU A;  5E2G A;  4YFM A;  4GZB A;  4DE3 A;  4LV3 A;  4X55 A;  4KZ3 A;  1MWS A;  2M7U A;  4C75 A;  1IKI A;  4CPK A;  4E6W A;  4PAU A;  1W63 M;  5FEG A;  2OAP 1;  2X02 A;  2PYR A;  2WGW A;  5AQA A;  3VP3 A;  1JTD A;  3UMD A;  3RTY A;  3N4I A;  3A3F A;  3HLC A;  2ZD8 A;  5HD5 A;  4F94 A;  3OPL A;  3S7P A;  2GDN A;  3IQA A;  4EWF A;  1XA1 A;  4Y17 A;  4R4R A;  3V67 A;  2XDM A;  3M6H A;  4GB7 A;  5FAO A;  2IA2 A;  1G6O A;  3MJQ A;  4O7D A;  4JXW A;  2A49 A;  2IWC A;  4ETZ A;  1XJ4 A;  4DN0 A;  3HUO A;  2OWJ A;  3PBS A;  1KGE A;  2WKP A;  5J7E A;  3G2Y A;  2Z6C A;  4WF0 A;  3KYZ A;  1MXO A;  4NXG A;  3ICY A;  1RGY A;  3HLD A;  1XJ6 A;  5IHV A;  1ESU A;  3N6I A;  2YKF A;  1EWZ A;  4EET B;  3NC8 A;  2Q9N A;  3MZD A;  2R9W A;  2NUP C;  2EX6 A;  5FQJ A;  3CPT B;  4BBV A;  1LLB A;  3TJZ C;  1LI0 A;  4R4S A;  3N7W A;  4Y3I A;  1CI9 A;  4Q0H A;  2W27 A;  3P01 A;  1CJF A;  1YLY A;  1UWP X;  5I94 A;  3GQZ A;  2EFX A;  3AGD A;  1DJB A;  1K54 C;  4ARZ A;  2WUQ A;  1TS0 A;  1H3Q A;  3UE1 A;  3IBR A;  2OV5 A;  3B3X A;  2JKT M;  3ZDJ A;  4IUH A;  3UPO A;  1NY0 A;  2D01 A;  1CK3 A;  4ZRR A;  3DWZ A;  1ESI A;  4O8G A;  3ZG0 A;  1VEU B;  2I9V A;  2YKH A;  1KDS A;  3MFD A;  4LRX C;  3NHQ A;  1ES2 A;  3KYE A;  1CEF A;  2VX8 A;  3KSI A;  2Y2P A;  2GNX A;  1K0K A;  1WE4 A;  2K7S A;  3UB6 A;  2FH5 A;  4F3L B;  2V0U A;  3DAV A;  1L0G A;  1XKZ A;  1ERQ A;  2JKT I;  2VEA A;  3KSF A;  3BWL A;  2OLU A;  1S1Y A;  3U4L P;  3ZVT A;  4O01 A;  1W79 A;  5CED A;  5TR7 A;  2H0Y A;  4DRT A;  4JGP A;  2H10 A;  2Y2L A;  1GHM A;  1BSG A;  1O07 A;  2Y2Q A;  5CHU A;  1TD5 A;  2Y2O A;  1ERM A;  1O7E A;  1ZKJ A;  4RX2 A;  2CMN A;  3MZF A;  3SOI A;  4S2N C;  1N9O A;  4PKY A;  2P04 A;  3W4Q A;  4E04 A;  3ULF A;  1OJG A;  4HHD A;  5KIZ A;  4FSF A;  2BAS A;  3FV7 A;  3PBO A;  4KG5 A;  4IHQ A;  3JVV A;  5EOE A;  4KZ4 A;  4KEN B;  4OP5 A;  1GHP A;  4IED A;  3ITA A;  4JXV A;  4HES A;  4MBK A;  1TS7 A;  1L0D A;  2GZA A;  2PT7 A;  2WKE A;  4UQI M;  1E3U D;  4LGW A;  1UGU A;  4E3K A;  3NY4 A;  3G2Z A;  4H6J A;  4MN7 A;  4YIN A;  2V8F A;  1H8Y A;  2VLG A;  4Y7P A;  3WS5 A;  2W3H A;  2V0W A;  1IYP A;  3UE0 A;  4UA9 A;  2K2N A;  4YNR A;  4NKP A;  2J9P A;  2B18 A;  1OPX A;  1WA9 A;  1L0E A;  3GEC A;  1KOU A;  3N8S A;  4JXG A;  3QP1 A;  4PMA A;  4U0T A;  1XXM A;  4E3I A;  1G28 A;  3SS4 A;  5KSC A;  3RJU A;  3MR0 A;  5HPI A;  2WKH A;  3G4P A;  3E0Y A;  3UE6 A;  4KG2 A;  3JPU A;  1YM1 A;  1NWZ A;  3QP4 A;  4X68 A;  1YQS A;  5J3W A;  1NZO A;  3I7J A;  1PNE A;  4FD8 A;  4QWO A;  4XT2 A;  4LCL A;  2J3T D;  2O0Y A;  3ZVW A;  3Q7V A;  4CQH A;  3OBF A;  3PXP A;  3CI6 A;  1VET B;  1S66 L;  1PFL A;  4PM8 A;  1KGG A;  2E8J A;  1N9N A;  3NOP C;  4WZ5 C;  2KOI A;  3R4K A;  4L0L A;  3PAG A;  4PPR A;  3UPP A;  4UA6 A;  3R7W A;  1H0M A;  4X1M A;  1KE4 A;  1FCN A;  2P9V B;  2J8Y A;  1NYM A;  1MC0 A;  4OP8 A;  3DTI A;  2XRN A;  3NDG A;  3T1Q B;  3FKV A;  2B02 A;  3HJI A;  4KZ9 A;  3S7N A;  1T19 A;  3MFX A;  4LFU A;  5EVI D;  2VV7 A;  3BM6 A;  1HZO A;  4XT2 B;  1OTA A;  2PHY A;  3Q7V B;  1XFQ A;  2J9O A;  4BD0 A;  2Y2I A;  2JHE A;  5EE8 A;  1RCJ A;  3LEQ A;  4O0P A;  3VP2 A;  1U60 A;  1ONH A;  2WK0 A;  3LR4 A;  5HDC A;  2WKI A;  1TS8 A;  4MBF A;  4GLQ A;  1JNU A;  2EX9 A;  5GHX A;  5HW3 A;  3QP8 A;  1YLP A;  1YKD A;  3P7N A;  4UEY A;  4CLC E;  1SKF A;  4U3T A;  4Z9Q A;  3LIC A;  3RH8 B;  1ACF A;  2XRO A;  1FIL A;  2Y2G A;  4BJP A;  5CTM A;  1W8Y A;  2ZJ9 A;  3Q1F A;  3WS4 A;  1K55 A;  3IS2 B;  3OLO A;  2HJE A;  4BEN A;  3T50 A;  3IF6 A;  2XD1 A;  1AXB A;  2ZC6 B;  4QHC A;  2JC7 A;  1K6R A;  5CGX A;  1KGF A;  3WS0 A;  4XUX A;  4HBT A;  1FCM A;  2EX8 A;  1PWG A;  4YWZ A;  1KVM A;  2ZL1 A;  3V50 A;  3T4J A;  5DJT A;  5M18 A;  5E43 A;  2QMI A;  4EBP A;  5HAP A;  3RXX A;  3EQU A;  5DTT A;  1GA9 A;  1PI4 A;  2NUT C;  2VGJ A;  3HLG A;  4WYY A;  5EOO A;  3ZGA B;  4CLC B;  1FSY A;  3ZQ5 A;  2JBF A;  5FAQ A;  1D06 A;  5FL3 A;  1D7E A;  2ZOI A;  1P9R A;  2EA9 A;  5EEC A;  3ITB A;  3BEB A;  3DTM A;  2PU4 A;  5M1A A;  5CHM A;  4AFI A;  1K56 D;  3GSG A;  2LB5 A;  4GCZ A;  2ZL1 B;  4G3W A;  1FIK A;  1JVJ A;  2ZMF A;  3C7U A;  3QP5 A;  5DFY A;  4HP9 A;  4N9K A;  1YLJ A;  3EEH A;  4B4Z A;  5CX7 A;  2XLN A;  4DMZ A;  1IKG A;  2IWB A;  4EUZ A;  3IXB A;  4GS9 A;  4WEK A;  2XH9 A;  2Y8H A;  3FG8 A;  1NYY A;  2Z2M B;  3RFB A;  4WEJ A;  5CEB A;  4JLF A;  4I3A A;  5F5Y A;  3LFV A;  2J7V A;  4JKT A;  3V39 A;  4OOL A;  2JKR M;  2R78 A;  5AQB A;  4DKI A;  5FSR A;  3HUN A;  4NEE D;  4MBH A;  2MJ6 A;  4IBR A;  1PZP A;  4ETX A;  5CXW A;  3IT9 A;  2JKF A;  4P6B A;  3HBR A;  1N9L A;  1JTG A;  3LEZ A;  3Q07 A;  5EVL A;  5GLC A;  3OPH A;  4JF4 A;  1XFN A;  4HOI A;  4PKY G;  2WGI A;  4B4X A;  1DJA A;  4GS9 B;  1XGI A;  1CI8 A;  5G18 A;  2JKR I;  2WKR A;  2J80 A;  3UPN A;  4HQA A;  1OTE A;  3CUE C;  4HNB A;  4CJN A;  4JBF A;  3NCK A;  4R6L A;  1BZA A;  1STZ A;  5F68 A;  4S2M A;  3G34 A;  2XD5 A;  4E3N A;  2K31 A;  3HLB A;  1XJ2 A;  3MKE A;  2EWW A;  1MKI A;  4PHT A;  2Q9M A;  1ZG4 A;  1PIO A;  1ES4 A;  3MS6 A;  4ZTK A;  1FR1 A;  1NLY A;  3BFG A;  3CPT A;  2HJ9 C;  3D9Y A;  1IEM A;  3K2N A;  2HP9 A;  4LCM A;  3FZC A;  4EBN A;  2HZ5 A;  2VKS A;  1OJ5 A;  1GSV A;  4M3K A;  1T18 A;  3G31 A;  2B95 A;  1BT5 A;  4NK3 A;  3SH8 A;  3QP2 A;  1JWZ A;  2W3E A;  4MLL A;  1H5X A;  1PI5 A;  4I5S A;  5HWW A;  2QPN A;  1A0K A;  4DE0 A;  2HPB A;  4HI4 A;  3LIA A;  1FCO A;  3IBJ A;  1OTD A;  4Z1W A;  1YT4 A;  4DXC A;  4C6Y A;  4S2K A;  4LRZ E;  5J8X A;  2KX6 A;  1FQG A;  5EUA A;  1VEU A;  3G6O A;  3S7Q A;  4N1H A;  3SZT A;  3NOT C;  3C7V A;  1KDW A;  5CGW A;  2ZM8 A;  3E2K A;  2ACG A;  3IF5 A;  1PWD A;  3VP0 A;  1ERO A;  2ZQ9 A;  5AVE A;  1MZU A;  3MF0 A;  2HDR A;  4GDN A;  4F3L A;  4ZAM A;  4N92 A;  5FA7 A;  4HH2 A;  4RQ9 A;  3AGE A;  2GX5 A;  2XR0 A;  3LIB A;  3CHW P;  2JCH A;  4H8R A;  3LR5 A;  2VGL M;  4S2I A;  4P6Z M;  4X1L A;  5FQQ A;  1ZTU A;  3F1O B;  1N4O A;  4X69 A;  5CEC A;  1SHV A;  2AVX A;  3H82 B;  2BG1 A;  2XF3 A;  4WUJ A;  2LB9 A;  2O9B A;  1Q2P A;  2B5R A;  4LV0 A;  1K54 A;  3HCY A;  2PRF A;  4GJ4 A;  4HJ6 A;  2WYX A;  3C4O A;  4BD1 A;  4NXE A;  4NXB A;  3T4S A;  4E3M A;  5DTS A;  1LT0 A;  2ZQ7 A;  4P87 A;  3JYI A;  2J3W A;  3UNW A;  2PU2 A;  3OPR A;  1GCE A;  1NZU A;  2EX2 A;  3NOU C;  3AGF A;  4P85 A;  4EUV A;  3CZD A;  4EQ1 A;  1IFQ A;  3PBN A;  4EU0 A;  3UE3 A;  1LSW A;  2PDR A;  3T4Q A;  3Q81 A;  4LLO B;  3SS3 A;  2I72 A;  2VGK A;  4QY5 A;  5EM0 A;  4MNR A;  2P7J A;  3DW0 A;  1PZO A;  3P98 A;  4Y0T A;  5EFW A;  4GW9 A;  3T1X A;  2HP5 A;  2HV1 A;  3MKF A;  1M40 A;  3UB7 A;  3FC7 A;  4HIA A;  4NXF A;  1YSQ A;  2C5W B;  3EEA A;  5DF7 A;  4R23 A;  2ZQA A;  4UHU A;  2H28 A;  3O86 A;  1LL8 A;  3MQQ A;  3IHB A;  4E6X A;  1SDE A;  3UN7 A;  4R70 A;  3Q7Z A;  4OH0 A;  5DFX A;  2Q0O A;  2Y91 A;  1VM1 A;  3MBZ A;  1LHY A;  3BJN A;  3W8K A;  4DDS A;  2FFY A;  3E4P A;  5GLB A;  4PM5 A;  1IOU A;  3GRJ A;  3C8C A;  3LI9 A;  1CF0 A;  4XXR A;  5GHY A;  5AJG A;  1VET A;  1S4R A;  2J3T C;  5L07 A;  1NXY A;  5FAT A;  4LEN A;  1MKM A;  2P9V A;  1MY8 A;  4GN2 A;  1G5U A;  4R3B A;  4QU3 A;  1H8M A;  3M2J A;  4GHI B;  2VZW A;  2WZX A;  5CHJ A;  3O87 A;  4LV2 A;  5F82 A;  1NLZ A;  4U0X A;  4HJ4 A;  3GTC A;  1ES3 A;  2Z6D A;  3IHA A;  4Q8I A;  3LID A;  1MBL A;  3KO6 A;  5AQ7 A;  2PYP A;  2CC1 A;  2ZOH A;  1RGZ A;  4ZJ3 A;  1LSV A;  3T4O A;  2EFU A;  2Y2H A;  3H7W A;  4WL9 A;  5EVI C;  1PRQ A;  4X53 A;  3ZNY A;  4E3L A;  1K4F A;  5L09 A;  1YLW A;  3EOI A;  3HUM A;  4OQH A;  3M2K A;  1TVF A;  5F1F A;  2RL3 A;  1TS6 A;  5E2E A;  1YAX A;  1FOF A;  2L1M A;  2PR5 A;  2VA0 A;  3VE4 A;  4R38 A;  3NIA A;  4KZ6 A;  2V1B A;  3BFE A;  2FFF B;  4Y0U A;  4WLA A;  2DMW A;  4GD6 A;  5DJU A;  1XGJ A;  4BWI A;  5KSH A;  1XA7 A;  1DJC A;  2UV0 E;  1T1C A;  3LGO A;  2W3G A;  4S2J A;  3BY8 A;  2WKQ A;  3BFD A;  4WZ5 A;  1F5M A;  4OKP A;  3S4X A;  3EWK A;  5EVE A;  4HP4 A;  3H7W B;  1K4E A;  2XA7 S;  3V3S A;  1C3B A;  3IS2 A;  5F6A A;  1MWU A;  4OQI A;  4P0M A;  5HWV A;  4OLD A;  2G7U A;  2VV6 A;  3OC2 A;  1JWP A;  4IVK A;  2Y4A A;  3LY3 A;  2ZMA A;  3CWF A;  5A93 A;  1QMF A;  3PBR A;  3WRZ A;  2P74 A;  3OZH A;  3G30 A;  3UDI A;  3T12 B;  1UWN X;  3QP6 A;  2Y59 A;  4N9L A;  2XSS A;  2ZC5 B;  4JPM A;  4Y5F A;  4EQI A;  3LUQ A;  1PWC A;  2ZM0 A;  1D1J A;  3GR2 A;  4JF6 A;  5CGS A;  2ZBB A;  1FR6 A;  3WRT A;  1K6S A;  1KE0 A;  3VV4 A;  2EXB A;  1K38 A;  2GJ3 A;  2XFT A;  4CLC A;  5HL6 A;  3UO9 A;  3OPP A;  4QY6 A;  1EI5 A;  4HJ3 A;  5GHZ A;  4B93 A;  5DVA A;  4LPZ A;  1MWR A;  2WGV A;  2BLS A;  4Y13 A;  2X01 A;  2INW A;  2XQZ A;  5C5K A;  2M1C A;  2ZLY A;  1W63 Q;  4Y15 A;  4IVI A;  4R1G A;  3BQA A;  1BLS A;  4OPR A;  4DJ3 A;  3HLE A;  5L10 A;  4CLC D;  5F1G A;  3F1N B;  3CIT A;  1QME A;  1YMX A;  1PW8 A;  2L0W A;  1XJ3 A;  4MN6 A;  1N9B A;  4NET A;  4QD4 A;  3QNB A;  4MMN A;  1F2K A;  5E2F A;  1OT9 A;  1H8Z A;  3B42 A;  3ZYT A;  2PAV P;  3EQV A;  4UA7 A;  3TRC A;  2DCF A;  3SH7 A;  3V5M A;  5GLA A;  3N8L A;  2Y2K A;  1T1A A;  1G6A A;  1WYC A;  2H0T A;  4WMC A;  2O99 A;  4D60 A;  1IEL A;  3IXH A;  1X0O A;  3NDE A;  5TBM B;  3GV9 A;  3NJA A;  4DDY A;  3NEC A;  3NBL A;  4UAA A;  2HDS A;  4PM6 A;  5EM1 A;  3DTK A;  1YLZ A;  4ZDX A;  3ZG8 B;  2HP6 A;  2EWV A;  3A3E A;  3A3I A;  1K57 C;  4RA7 A;  3VOZ A;  2KDK A;  5DF9 A;  4EEU A;  3K3D A;  5L2F A;  3BRM A;  2ZC4 B;  4HEF A;  4S2O A;  1KVL A;  4DE1 A;  4EV4 A;  4MCW A;  4DE2 A;  2QHK A;  3F1P B;  1CQA A;  5DTK A;  1M6K A;  4QB8 A;  4KZ7 A;  3KSG A;  3IXD A;  5BOH A;  4S2P A;  4GKU A;  4KZA A;  3FKW A;  1I2S A;  3L9K A;  3A3J A;  3CLO A;  3UME A;  3T1R A;  3W2Z A;  1ZHH B;  2HDQ A;  3ZG7 B;  3O5Y A;  2H5S A;  5HAR A;  3MSH A;  3IWO A;  1DP8 A;  4WZ4 A;  5A90 A;  4Q0I A;  1LI9 A;  3M6B A;  1YSP A;  3SW1 A;  5F69 A;  1VB6 A;  2QYB A;  3BLM A;  5TGF A;  2PR6 A;  1ES5 A;  1GHI A;  3FYZ A;  2RCX A;  3E98 A;  2ZQ8 A;  5CRF A;  1TF1 A;  4FH4 A;  5FQM A;  3PHY A;  3BYD A;  2QZ6 A;  4ZJ1 A;  2A24 B;  5AQ9 A;  4YOF A;  1BTL A;  3DBA A;  3TE8 A;  4R3J A;  2OOL A;  1S4S A;  4KQD A;  3WWX A;  3CUE A;  3PAE A;  4K0W A;  4C3Q A;  3IX8 A;  3TW8 A;  5EPH A;  2QWS A;  1P9W A;  4I3I A;  3NI9 A;  5FI6 A;  4MN5 A;  4RX3 A;  4QJG A;  3BW6 A;  1SKO B;  3ZG9 B;  3HLW A;  3UB8 A;  3B33 A;  3D72 A;  1RP5 A;  3O3V A;  3MXS A;  5CTN A;  4R0Q A;  5FAS A;  3K3C A;  5L8M A;  4ME4 A;  3F1O A;  3CAX A;  1K25 A;  2OWH A;  4WM9 A;  3E2L A;  3HJK A;  3H82 A;  3IWI A;  3N8R A;  3VP1 A;  3U2A A;  4D2O A;  3TG9 A;  4EBL A;  1CEG A;  4GNU A;  1BYW A;  4OOM A;  3O88 A;  2WGW B;  3IH9 A;  4PM7 A;  5FI2 A;  3LIE A;  3FPW A;  2O9A A;  4DXB A;  4LV1 A;  5IU1 A;  3VOY A;  1T1B A;  3CG5 A;  4I3J A;  4II7 A;  1S0W A;  5I5L A;  5FQ9 A;  2G2U A;  4G3V A;  4E3O A;  4JGO A;  4UQI S;  3C30 A;  3VMA A;  3VSL A;  1NRF A;  2HGV A;  3KSH A;  5HD3 A;  5KZH A;  2IWD A;  1S1Z A;  3UB9 A;  3A0S A;  3S7O A;  4N1X A;  1TEM A;  2O9C A;  2WAD A;  4EW7 A;  3T4T A;  3PTE A;  1LL5 A;  4PM9 A;  1EW0 A;  1NRJ A;  2W1T A;  2ZC3 B;  4JGQ A;  4A5R A;  1E25 A;  3LIF A;  3DWK A;  1SZV A;  3PR6 A;  4ID4 A;  5DKL A;  3BFF A;  2EXA A;  3UY6 A;  2ZMV A;  3LI8 A;  3Q82 A;  5HFO A;  4ARZ B;  1HTZ A;  5JYP A;  3MQO A;  2Y2N A;  3MZE A;  5J4E A;  4EXO A;  3BY9 A;  4BBU A;  1HD8 A;  1OT6 A;  5HX9 A;  2W1T B;  1V9Z A;  4OPZ A;  1BLP A;  2QJ5 A;  4OOY A;  5F83 A;  3UB5 P;  3ZHH A;  4B9O A;  3VFH A;  4FUW A;  3D3O A;  5JYO A;  1DY6 A;  5FDS A;  3V3R A;  3VE3 A;  3T4L A;  1DP6 A;  1ALQ A;  4OLG A;  4GHI A;  2X71 A;  3SH9 A;  1LSX A;  4EEP A;  4RVA A;  2WZZ A;  4XUZ A;  1IYQ A;  3CMZ A;  1P97 A;  4S2N A;  1E3U A;  3UDX A;  4Q0J A;  1TDL A;  4JXS A;  4K08 A;  2OLV A;  5FQI A;  2BTF P;  4KQQ A;  4OPQ A;  3EGD C;  5G4Y A;  4FCF A;  5MC7 A;  3MXR A;  3C5A A;  4IJG A;  5LBR A;  4OON A;  3UDF A;  3WS1 A;  4GD8 A;  5A8B A;  1BLH A;  2W1R A;  2JE5 A;  4BBT A;  3GMW A;  2W3F A;  3WS2 A;  1I2W A;  5D3O A;  5EV0 A;  2KLI A;  3H9W A;  1AWI A;  4M4X A;  1HLU P;  3GDI A;  5AVF A;  5IS1 A;  1F9I A;  1IYO A;  4OQG A;  5HDD A; 
#chains in the Genus database with same CATH homology
 1N9L A;  3VOL A;  4HJ3 A;  2JKT M;  2FZ0 A;  4B93 A;  3C38 A;  4IUK A;  4LPZ A;  1XFN A;  4HOI A;  4IUH A;  4PKY G;  2D01 A;  4Y2F A;  1ODV A;  4ZRR A;  4O8G A;  2INW A;  5C5K A;  2I9V A;  4GS9 B;  2M1C A;  2YKH A;  1S67 L;  3OCN A;  4KQO A;  1W63 Q;  4I39 A;  4LRX C;  5TJJ A;  3NHQ A;  2JKR I;  2WKR A;  3BQA A;  2J80 A;  4DJ3 A;  4CLC D;  4HQA A;  1OTE A;  3CUE C;  4HNB A;  5HZH A;  2VX8 A;  3KSI A;  4R6L A;  3F1N B;  2GNX A;  3CIT A;  1STZ A;  5F68 A;  2K7S A;  3UB6 A;  2FH5 A;  3LYX A;  2K31 A;  2OAQ 1;  2L0W A;  2V0U A;  4F3L B;  1XJ3 A;  4MN6 A;  1XJ2 A;  2EWW A;  4H6J B;  2JKT I;  4MDZ A;  1GSW A;  2VEA A;  3KSF A;  4PHT A;  3BWL A;  4WN5 A;  4MMN A;  1VHM A;  2L4R A;  1OT9 A;  1S1Y A;  3B42 A;  4KUK A;  4O01 A;  3ZYT A;  1NLY A;  2HJ9 C;  3EQV A;  4JGP A;  3K2N A;  4KUO A;  3TRC A;  2VKS A;  1OJ5 A;  1GSV A;  3JVU A;  3OCL A;  1T18 A;  4EER A;  1TD5 A;  1T1A A;  2W3E A;  2M7V A;  2O99 A;  2W0N A;  4I5S A;  5HWW A;  2CMN A;  2JN7 A;  4JGR A;  1X0O A;  1N9O A;  4PKY A;  4HI4 A;  5TBM B;  3LIA A;  2P04 A;  1DP9 A;  4E04 A;  3IBJ A;  3ULF A;  1OTD A;  4Z1W A;  3NJA A;  1OJG A;  4HHD A;  5KIZ A;  4FSF A;  2BAS A;  3PBO A;  5G4Z A;  4IHQ A;  4LRZ E;  3JVV A;  2KX6 A;  1OTI A;  3G6O A;  3S7Q A;  2P08 A;  3NOT C;  2VV8 A;  2EWV A;  4QPR A;  3R7W B;  4DJ2 A;  5HPF A;  2KDK A;  3PBT A;  5DF9 A;  4EEU A;  3K3D A;  1TS7 A;  3MQ0 A;  4L9E A;  2GZA A;  4MCW A;  2QHK A;  3A0R A;  3F1P B;  3F1N A;  2PT7 A;  5AVE A;  1OTB A;  4UQI M;  1MZU A;  3MF0 A;  4CLC C;  2D02 A;  4F3L A;  4R3A A;  1UGU A;  4HH2 A;  2HF6 A;  4RQ9 A;  4HH3 A;  2GX5 A;  3LIB A;  4H6J A;  3KSG A;  4MN7 A;  4FOF A;  5DKK A;  2VLG A;  5HDS A;  3PBQ A;  4G3K A;  4BMW A;  2W3H A;  3LR5 A;  2VGL M;  2V0W A;  4P6Z M;  1ZTU A;  3CLO A;  3UME A;  3F1O B;  2K2N A;  3W2Z A;  4YNR A;  1ZHH B;  3O5Y A;  4NKP A;  2B18 A;  3H82 B;  1OPX A;  1WA9 A;  3GEC A;  1KOU A;  4WUJ A;  1DP8 A;  2LB9 A;  2O9B A;  4Q0I A;  1G28 A;  1V9Y A;  3MR0 A;  3HCY A;  5HPI A;  4GJ4 A;  4HJ6 A;  3MMH A;  1YSP A;  3E0Y A;  3SW1 A;  3UE6 A;  5F69 A;  1VB6 A;  2QYB A;  3E4Q A;  4NXE A;  4NXB A;  1NWZ A;  5J3W A;  2Y79 A;  5TBM A;  3T4S A;  4XT2 A;  2PR6 A;  2W3D A;  3E98 A;  2J3T D;  3E4O A;  2O0Y A;  1LT0 A;  1Y28 A;  4CQH A;  1TF1 A;  3OBF A;  2J3W A;  3PXP A;  3CI6 A;  1DRM A;  1S66 L;  3PHY A;  1N9N A;  3NOP C;  2KOI A;  3R4K A;  4L0L A;  2A24 B;  4YOF A;  3NOU C;  3R7W A;  3DBA A;  3TE8 A;  3PYP A;  4EUV A;  2OOL A;  1S4S A;  4KQD A;  4EQ1 A;  1IFQ A;  3PBN A;  1MC0 A;  3CUE A;  4EU0 A;  2XRN A;  3UE3 A;  3TW8 A;  5K5B A;  1LSW A;  2PDR A;  3T4Q A;  3EGX C;  3LR0 A;  3F1P A;  2QWS A;  1P9W A;  3FPV A;  2B02 A;  3HJI A;  4LLO B;  2P7J A;  3S7N A;  1T19 A;  3MFX A;  4I3I A;  1P0Z A;  4MN5 A;  2XA7 M;  3BW6 A;  5EFW A;  4GW9 A;  5HSQ A;  2VV7 A;  2HV1 A;  3UB8 A;  3B33 A;  3D72 A;  4XT2 B;  1OTA A;  3UB7 A;  3FC7 A;  4HIA A;  2PHY A;  3K3C A;  3OOV A;  5L8M A;  3T4K A;  1XFQ A;  4ME4 A;  4NXF A;  1YSQ A;  3CAX A;  3F1O A;  2OWH A;  3EEA A;  2V9A A;  3HJK A;  2H28 A;  3H82 A;  1LL8 A;  2PD8 A;  3MQQ A;  2JHE A;  3KYQ A;  4WEL A;  3U2A A;  4R70 A;  4O0P A;  2V1A A;  2PD7 A;  3KX0 X;  3LR4 A;  5HDC A;  1BYW A;  4OOM A;  5DFX A;  1TS8 A;  4GLQ A;  4I38 A;  1F98 A;  1JNU A;  5IT5 A;  3LIE A;  3FPW A;  2O9A A;  2A2L A;  3BJN A;  1YKD A;  3B47 A;  3P7N A;  4UEY A;  3E4P A;  4CLC E;  3LR3 A;  1IOU A;  5IU1 A;  1T1B A;  3C8C A;  4I3J A;  3LIC A;  3LI9 A;  4II7 A;  3RH8 B;  5I5L A;  5AJG A;  3BQ8 A;  2XRO A;  1S4R A;  2J3T C;  4G3V A;  4JGO A;  4UQI S;  3C30 A;  1GSX A;  2A24 A;  2VJW A;  1MKM A;  4BJP A;  2HGV A;  3KSH A;  3MXQ A;  5HD3 A;  1S1Z A;  3UB9 A;  3A0V A;  3IS2 B;  3OLO A;  3A0S A;  3S7O A;  2VGL S;  4P6Z S;  4HY8 A;  1H8M A;  2HJE A;  4GHI B;  3C2W A;  2VZW A;  3T50 A;  2O9C A;  4EW7 A;  3T4T A;  1NLZ A;  5HWT A;  4HJ4 A;  4LRY C;  2Z6D A;  1EW0 A;  3LID A;  4EES A;  1NRJ A;  2W1T A;  2QJ7 A;  3KO6 A;  2QKP A;  4L9G A;  2PYP A;  2ZOH A;  4JGQ A;  1LSV A;  3T4O A;  4L9F A;  3H7W A;  4WL9 A;  3LIF A;  4YWZ A;  3T4J A;  3EOI A;  3PR6 A;  5DJT A;  2M7U A;  1TS6 A;  1YAX A;  2L1M A;  5DKL A;  2PR5 A;  4PAU A;  3EQU A;  1W63 M;  2VA0 A;  3VE4 A;  2OAP 1;  4R38 A;  2PYR A;  2ZMV A;  2V1B A;  3LI8 A;  2NUT C;  3UMD A;  3RTY A;  4ARZ B;  4WLA A;  3MQO A;  2DMW A;  5DJU A;  4CLC B;  5HD5 A;  4BWI A;  5J4E A;  5KSH A;  4EXO A;  3BY9 A;  3ZQ5 A;  3S7P A;  4BBU A;  1D06 A;  1T1C A;  5FL3 A;  1D7E A;  2ZOI A;  1P9R A;  1OT6 A;  2EA9 A;  2W3G A;  3BY8 A;  2W1T B;  1V9Z A;  2WKQ A;  1F5M A;  3V67 A;  2QJ5 A;  4AFI A;  3EWK A;  4HP4 A;  2LB5 A;  3H7W B;  4B9O A;  2IA2 A;  2XA7 S;  1G6O A;  4GCZ A;  3MJQ A;  4G3W A;  3D3O A;  3IS2 A;  5F6A A;  2ZMF A;  3VE3 A;  4ETZ A;  5HWV A;  1XJ4 A;  4DN0 A;  3T4L A;  2OWJ A;  1DP6 A;  3PBS A;  2G7U A;  2VV6 A;  5DFY A;  4GHI A;  4HP9 A;  2WKP A;  3OC2 A;  1LSX A;  5J7E A;  4EEP A;  2Z6C A;  4WF0 A;  3KYZ A;  3EEH A;  4NXG A;  1P97 A;  3ICY A;  3CWF A;  1XJ6 A;  5CX7 A;  3PBR A;  4Q0J A;  4DMZ A;  4K08 A;  2YKF A;  4EET B;  3EGD C;  4GS9 A;  4WEK A;  5G4Y A;  2Y8H A;  1UWN X;  5MC7 A;  3FG8 A;  2NUP C;  4IJG A;  3RFB A;  2XSS A;  5LBR A;  4WEJ A;  4I3A A;  4Y5F A;  4BBV A;  5F5Y A;  3LFV A;  3LUQ A;  3TJZ C;  5A8B A;  4OOL A;  2W1R A;  2JKR M;  2R78 A;  4Y3I A;  2ZBB A;  4Q0H A;  4BBT A;  2W27 A;  2W3F A;  3P01 A;  4NEE D;  3VV4 A;  1UWP X;  2KLI A;  2MJ6 A;  3H9W A;  4M4X A;  4ETX A;  3GDI A;  4ARZ A;  5AVF A;  1TS0 A;  1H3Q A;  2GJ3 A;  5IS1 A;  4CLC A;  1F9I A;  3IBR A;  5HL6 A;  5HDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...