1YAXA

Cystal structure analysis of s.typhimurium phoq sensor domain with calcium
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
153
structure length
153
Chain Sequence
MDKTTFRLLRGESNLFYTLAKWENNKISVELPENLDMQSPTMTLIYDETGKLLWTQRNIPWLIKSIQPEWLKTNGFHEIETNVDATSTLLSEDHSAQEKLKEVREDDDDAEMTHSVAVNIYPATARMPQLTIVVVDTIPIELKRSYMHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Virulence sensor protein phoQ, sensor domain
publication title Metal bridges between the PhoQ sensor domain and the membrane regulate transmembrane signaling.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase, signaling protein
total genus 30
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.140 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1yaxA00
3BQ8A 1YAXA 4UEYA 3BQAA
chains in the Genus database with same CATH superfamily
4DJ3A 1SKOA 5CTMA 5FQQA 5FSRA 3D72A 3G31A 1H8MA 2W1TA 3CPTA 2JKFA 3BEBA 3LIEA 1RGYA 3HLCA 3WS5A 3OPPA 4CJNA 4L9GA 4JPMA 4P87A 1PFLA 4Y17A 4GN2A 3EOIA 3OZHA 4Q8IA 2E8IA 3C7UA 3A0VA 1YLPA 1XFQA 3MSHA 3DBAA 3FKWA 5AVFA 5L2FA 4FCFA 3BECA 1K54A 3CUEC 3LCEA 4WYYA 5BOHA 5TGFA 4S2OA 3G4PA 4OVDA 5LBRA 1XJ6A 4E3LA 3N8LA 4LCMA 5D3OA 2PU2A 5FEFA 5FL3A 5K5BA 4IVIA 4KG5A 5E2GA 1E25A 5DFYA 2Y8HA 5KIZA 3HLDA 3KYQA 2LB9A 1GHMA 4M3KA 4G3VA 4ZJ3A 1DJBA 5DJTA 1Y28A 3T4TA 3PBQA 1RGZA 4OPZA 2XR0A 4LGWA 3BW6A 3HUNA 2BLSA 3A0RA 3ISGA 3JVVA 5M18A 3MS6A 4LLOB 3DW0A 3BLSA 4PMAA 3ZG8B 1M40A 2Y2IA 5CTNA 4EQ1A 4KQDA 1MXOA 3LEQA 2J7VA 2OWHA 2A49A 2VX8A 4P6ZM 4QY5A 1BSGA 4OP8A 2W0NA 2HZ5A 3HVFA 2EX6A 4PM6A 3SW1A 3VSLA 1CEGA 1N9BA 3HBRA 5FASA 4BL2A 5EFWA 4O7DA 3LIDA 4JGRA 2WAEA 4MDZA 3IWOA 1GCEA 2Y2KA 5DTTA 3PBTA 2AVXA 4JF6A 5J3WA 2INWA 3PXPA 3Q1FA 1XA1A 1NXYA 5KMWA 3LUQA 4RX2A 1XGJA 1L3LA 3E2LA 4AFIA 4ZJ1A 3P01A 4RQ9A 1ONHA 4R4SA 1MKIA 3M6BA 1ES4A 2P08A 1T19A 2XSSA 2A24B 5DTSA 2PT7A 1S0WA 2O9BA 1PZOA 5DKKA 2UV0E 2OAQ1 3PR6A 1NYMA 1H8YA 5FDSA 3V50A 1P0ZA 4KZ7A 1VB6A 3S4XA 4YWZA 3ZG7B 4S2LA 2QMIA 2H28A 2WGVA 2H5SA 1XFNA 3IS2A 1JVJA 5FI2A 3BQAA 1VM1A 4UA6A 3ZCZA 1WE4A 5A93A 5CEBA 2RL3A 3BFEA 3G32A 4WEKA 5CGSA 4QPRA 5CX7A 3ZG9B 3C2WA 4RA7A 1K57A 4LRYC 4YNRA 5GL9A 1N9NA 3T1RA 3RTYA 4R38A 1G6AA 1DRMA 5EPHA 1U60A 3EQUA 3LICA 4GDNA 3T1QB 3DAVA 4H6JB 1XPBA 3NOTC 2ZOHA 5F69A 1WA9A 4DKIA 4Q0JA 3P98A 5HL1A 2Q9MA 1QMEA 4WBGA 5F68A 2JCHA 2KOIA 1IEMA 1E3UA 1LI9A 3RXXA 3BYDA 3E4PA 3UMDA 3LR5A 2Y2HA 2WGIA 5HAQA 4ZDXA 1AXBA 1G6OA 4C6YA 1ESIA 2HDSA 4S2KA 1GSVA 4R70A 2V0WA 3PAEA 2DNSA 3KO6A 2V9AA 3CZDA 1BLCA 3B42A 1TS0A 4IUHA 5G18A 3P7NA 1DJCA 4N1HA 2HJEA 1VEUB 3NBLA 1P97A 3K3DA 5F1GA 3H7WB 4QWOA 2Y2PA 1YLWA 2V1ZA 1G68A 3OBFA 4E6XA 1W8YA 4GKUA 4H6JA 1KE4A 1WYBA 2FFYA 4HOIA 2H0TA 4RVAA 3UPOA 1IYOA 3IX8A 4JXVA 4L9FA 1DY6A 3Q7VB 4FD8A 4MN6A 3U2AA 2J3WA 2PAVP 2XD5A 4ME4A 3NDGA 5CHUA 2PD7A 2XF3A 3BM6A 1S1YA 3TSGA 5F82A 2CMNA 3B47A 3S1YA 2HP5A 4DDSA 1CJFA 1L0FA 3FV7A 3HREA 5DTKA 2VLGA 2O9AA 4HH2A 4KZ6A 3OPHA 2ACGA 3ZHHA 1P9RA 3GV9A 1OT6A 1CI9A 4YOFA 1EWZA 1NWZA 4EV4A 1NZUA 3LGOA 3F1OB 1TEMA 1VQQA 3RH8B 2HP9A 4KQQA 4ESPA 2HGVA 3BFFA 1VEUA 3VOZA 4NKPA 2W27A 5EECA 4BLMA 3ZDJA 5FQ9A 4QD4A 1OJ5A 4NETA 3PBSA 4DE2A 1FCNA 1N4OA 2HF6A 2JKRI 4U0TA 4IUKA 2RCXA 3IXHA 4JKTA 1PI4A 3IBRA 4PM9A 3HLBA 2VZWA 4N9LA 3UPNA 1BLHA 4IBRA 4DDYA 3FWLA 4Y15A 3CLOA 5GLCA 4R3BA 1YM1A 2HPBA 3W2ZA 3T1SA 4QB8A 1BLPA 4WEJA 5FA7A 1L2SA 4F94A 3C30A 4DE0A 1SDEA 5DF9A 5DKLA 1D06A 2Y2QA 3AGFA 4EWFA 4F3LA 3LEZA 4OPRA 4E3MA 4M4XA 3MXSA 3IHAA 4N9KA 2ZQDA 3NULA 3QP1A 3IQAA 2V1AA 2V8FA 5E2HA 1OTEA 3MKFA 5A92A 3QP6A 1IKIA 3T4SA 3G34A 4JBFA 2ZM8A 5CHMA 3GECA 3QHYA 2Y55A 3MQQA 3A3IA 3LI9A 2Y2GA 4EETB 4Z9QA 1ALQA 2FFFB 3VP1A 4X1LA 1ODVA 4UQIS 3T4JA 3WRTA 4BBTA 1HD8A 3A0SA 4EBNA 2YKHA 1TD5A 5GLAA 2JHEA 2J8YA 3WS4A 1HZOA 3FG8A 4NXBA 4ZRRA 2WUQA 2VV8A 3UE6A 3TJZC 1NRJA 4I38A 4NXFA 1O07A 2JKTM 3ZGAB 1NZOA 2EX8A 3B33A 3OPRA 3DTEA 4K0XA 2KLIA 4IBXA 1FIKA 1XGIA 2ZL1B 2VGKA 4KZBA 4JGOA 4Y0OA 3LY3A 3MZDA 5GHZA 3VP2A 1MZUA 2XGNA 4R6LA 2JE5A 2O0YA 1LSVA 3CG5A 1ZG6A 2GNXA 4ARZB 4PM7A 4JF4A 4LPZA 3ICYA 3EWKA 3KSFA 1OTBA 3TRCA 3O3VA 5CHJA 2DCFA 4P6BA 4LV0A 4JXGA 2Y59A 2VGLS 1K55C 3S22A 1EI5A 3KSIA 4CLCB 4B93A 3T1XA 3GSGA 2W3EA 1PW8A 1XKZA 4MMNA 2J3TC 1W5DA 1Z09A 3VV4A 4I5SA 5HSQA 3NI9A 4S2NA 1N9LA 4U0XA 4P85A 4ETZA 1LT0A 3A3JA 1MWUA 1AWIA 4OQIA 1PWDA 3UY6A 1TS6A 3UDFA 2X01A 3DTKA 2WKHA 3MQ0A 4K0WA 4P0MA 1ZKJA 5DFXA 3CITA 1NRFA 1ES5A 1OTIA 1XXMA 2WZZA 3T4LA 3VFHA 2ZL1A 4RX3A 1L0DA 2OOLA 1JWPA 2G7UA 3AGEA 4KZ5A 4WN5A 4E3NA 3MZEA 5HARA 4Y0UA 2O99A 1VETA 1KDWA 3Q07A 4B4ZA 5HWTA 1IFQA 2DRWA 3MJQA 1UWNX 3SS4A 2ZC7A 2FH5A 1C3BA 3R7WA 2ZMAA 4HNBA 3HLEA 3N7WA 4HEFA 4U3TA 3F1NB 2VK3A 5TBMB 4BENA 1V9ZA 3G35A 3BY8A 3JYIA 3M6HA 4DRTA 3VOLA 1BYWA 2V1BA 2DMWA 1ONGA 3LI8A 4EESA 1UWPX 2XH9A 2EWWA 4CLCA 2ZM0A 4Y0TA 3MKEA 4BL3A 1GSWA 3Q81A 1FSWA 4WMCA 3V5MA 3V67A 3EQVA 5J7EA 1S6RA 4RYEA 1GHIA 2EX9A 5AJGA 3MFXA 2K2NA 3E2KA 5M19A 4CLCE 4II7A 1N9OA 2PR5A 2WAFA 1PWCA 4N1XA 1FCMA 4EERA 1Z6FA 1DP9A 4WZ5C 3SH7A 2WADA 4EEPA 5FATA 1CQAA 1TDGA 1OT9A 3IF6C 4GHIB 5FI7A 3LY4A 2ZLYA 1DP8A 3WS2A 1I5QA 4FH2A 4LV1A 1FCOA 4MBFA 4UQIM 1L0EA 2UWXA 1YSQA 3M2JA 2B95A 5G4YA 2P74A 4HY8A 1YPRA 2E8JA 3ZG0A 3O86A 4UHUA 5FI6A 2K7SA 5EVIC 4XUXA 2ZQ7A 4BD1A 3K3CA 1YSPA 3ZVWA 4WELA 5F6AA 2EA9A 3UO9A 4E3IA 5CGWA 3VP0A 2ZC6B 2ZQ9A 1HLUP 1NY0A 3MBZA 3FPVA 5HX9A 1LHYA 3OPLA 4GS9B 4DXBA 1KGEA 3DWKA 1JWVA 3LFVA 4HP9A 1E4DA 3VP3A 3LIFA 2QYBA 4KZ4A 4HIAA 2Q9NA 2Q0OA 1LL8A 4CLCD 2W3GA 3IBJA 3NCKA 1X0OA 3C5AA 3UB5P 3PBNA 2ZMFA 5HFOA 5A8BA 3FYZA 4WMCD 2VGLM 3UPPA 1TF1A 3CAXA 3O88A 4GB7A 2V8CA 1Q2PA 2I72A 4YINA 4OPQA 3T4OA 5MC7A 4DE1A 1W7FA 4OLDA 3BFCA 2QJ7A 2Z2MB 1YLTA 5HAPA 5KZHA 2YKFA 3ZVTA 4PM8A 2XD1A 4L9EA 3UE0A 4IVKA 3S7QA 3IH8A 4IJGA 2BASA 2VJWA 4MNRA 3HJIA 5HDSA 4ZTKA 2WKPA 3BRMA 3N4IA 2W3HA 1H8ZA 2PYRA 2VGJA 2EWVA 3RFBA 1YQSA 4DMZA 2D01A 4IEDA 5L8MA 1K38A 2QHKA 2A24A 1YLYA 5IS1A 1K4EA 5EE8A 4GD8A 4OKPA 3LIAA 1BZAA 4X6TA 1YMXA 2J3TD 3ZFZA 3IHBA 2D02A 2HDUA 2PRFA 3O5YA 4UAAA 3HJKA 3VP4A 4NG2A 4MLLA 5FQMA 1GA9A 4X1MA 2G2WA 4GCZA 2PHYA 4HHDA 2J80A 3BWLA 3NDEA 5E2EA 3KSGA 4XT2B 3AGDA 4OPYA 1PIOA 4BWIA 5DVAA 1FILA 4MN7A 3H82B 3NOPC 5J8XA 1STZA 2V20A 3IH9A 5KSCA 3Q82A 4OOYA 4BBVA 4PAUA 3H9WA 2XFSA 2JN7A 1ERMA 3VFFA 3E4OA 2V0UA 1K0KA 4WL9A 2ZQAA 2P9VB 4CPKA 3DTIA 1SDNA 3CI6A 4Q0HA 1K56A 4B9OA 5JYOA 4C3QA 2MJ6A 2M7VA 1YKDA 3L7HA 5KSHA 3IX3A 2XA7S 4X55A 5EM1A 1D7EA 4ZJ2A 1JNUA 1MY8A 1TDLA 4HBTA 3TG9A 3SOIA 2GDNA 3KYEA 4GNUA 2ZQCA 4WUJA 3ITAA 4KUKA 3FKVA 3VOYA 1XA7A 4WLAA 1LSWA 4OQ0A 4LRXC 5GHXA 3WRZA 2WKQA 3GVBA 4GLQA 2EXBA 2EFUA 2ZJ9A 1WYCA 3DWZA 1NYYA 2EXAA 4OH0A 1TS8A 1YT4A 3DTMA 5F83A 4OP5A 3H7WA 1KE3A 3H82A 5A90A 5C5KA 4S2JA 1IYQA 2VV6A 4Y5FA 3LR4A 3MFDA 4GD6A 4EUZA 5A91A 2ZOIA 3BQ8A 1TS7A 3OCLA 4X25A 1OTAA 3LR3A 4KZ9A 2PBDP 3Q7VA 3LR0A 2B02A 4R0QA 1FR6A 1J9MA 4S2NC 3W8KA 4MEZA 3OC2A 4R3AA 4Y7PA 2XEPA 2HJ9C 3A3DA 1K56D 4LENA 2CC1A 4B4XA 1S4SA 5CGXA 2L1MA 4BBUA 4E6WA 1XJ4A 3F1OA 2G2UA 4KUOA 3ULFA 3O87A 2Y2OA 2OV5A 2X71A 2GZAA 2QZ6A 1K54C 3KSHA 4D2OA 1BT5A 4WM9A 4HESA 2HV1A 4FUWA 1MKMA 4JXWA 1ES2A 2W3FA 2WGWB 4HJ6A 2C5WB 4HBUA 5CEDA 3F1PB 2BTFP 3M2KA 1S66L 4O8GA 2J9OA 1T1CA 4HH3A 4DJ2A 1ESUA 2XDMA 4KQOA 4IHQA 3R4KA 1SKOB 4KZ8A 1OPXA 1GSXA 5EVLA 3NC8A 3QP2A 4Y13A 4R3JA 5M1AA 4UEYA 1V9YA 3UNWA 4KG2A 1G28A 1KE0A 5DJUA 3T4KA 5U47A 3QP8A 4K91A 3VMAA 1ERQA 2WKEA 3A3EA 3HLWA 3IT9A 4EBLA 4JXSA 5HWVA 2L0WA 3W4QA 2P04A 2ZMVA 1KOUA 5FAPA 3ZNTA 4Y3IA 3RXWA 3BFDA 3NJAA 2ZC4B 5HAIA 3UB8A 5F5YA 1ZTUA 1SCWA 2VEAA 1O7EA 3PBRA 3NY4A 1RP5A 3IF5A 2WGWA 1W63Q 3G2YA 3GMWA 4G3KA 4GOGA 4X69A 4ZBEA 4DE3A 1ZC2A 3PHYA 2P7JA 2R78A 2ZD8A 2W1RA 1KGGA 3E4QA 2ZC5B 3P09A 2OLUA 3UB7A 2A3UA 2FZ0A 4EW7A 1KVLA 5EUAA 1ACFA 2XQZA 1OTDA 5J4EA 2GX5A 3EEAA 3GDIA 3HLFA 1GHPA 1VHMA 4PHTA 3SZTA 4ARZA 1BLSA 3HCYA 3JVUA 4GZBA 1UGUA 2B18A 4GDBA 5E2FA 5FAQA 1F9IA 3T50A 3BFGA 1FSYA 5L09A 3SH8A 4L0LA 1OJGA 1PW1A 2Y2LA 3EGDC 1BULA 4G3WA 1OMEA 4Z1WA 2WK0A 2X02A 3BY9A 3Q7ZA 5L10A 5FAOA 1M6KA 4PKYG 4D60A 4HP4A 1W8QA 4JLFA 5CECA 4R1GA 4JGQA 3OLOA 4OOMA 3MZFA 2Z6CA 1ZG4A 1K4FA 1K57C 4BMWA 2GJ3A 4KZ3A 2IWCA 3GR2A 4HI4A 4E3OA 4QHCA 1PI5A 3N8SA 3GRJA 1DP6A 3QNCA 3TW8A 3WS0A 2HDRA 1ES3A 1IELA 2PDRA 4R4RA 1I2WA 2QJ5A 1YMSA 4HJ3A 3UE3A 2OAP1 5CRFA 4B88A 3IX4A 1FQGA 3L9KA 1NLZA 5IT5A 3UDXA 4FOFA 4EU0A 5FEGA 3ITBA 2PR6A 3T4QA 5EVEA 1W63M 1MPLA 1K55A 4H8RA 3IS2B 4XUZA 3F1NA 5TBMA 3FZCA 3NHQA 3PYPA 3CMZA 3MXRA 1BTLA 3C7VA 4KZAA 4EXOA 1EW0A 1LSXA 3I7JA 5HPFA 2IA2A 3ZNYA 2Z2LB 2JKTI 3VE4A 4OQGA 3LIBA 3PBOA 1DJAA 4LRZE 1FOFA 3PTEA 4QU3A 2JBFA 5HPIA 3MF0A 3IF6B 3HUMA 2Y2NA 4JF5A 3TOIA 2JKRM 3A3FA 3LO7A 1T1AA 4JGPA 4ZAMA 1H3QA 3CUEA 3G6OA 3W4PA 4UA9A 1G5UA 1PRQA 2QPNA 4FH4A 4GHIA 4OOLA 1LLBA 4PPRA 4I3JA 3KX0X 2KDKA 3FPWA 3QNBA 5TFQA 5FQIA 2WZXA 5E43A 3UMEA 1IYSA 2Y2JA 3IWIA 2HDQA 3IXGA 3D3OA 5EVIB 4MBKA 3U4LP 3MXQA 2W3DA 1CI8A 3MMHA 2OWJA 4HJ4A 1T18A 4YFMA 2H0YA 1MBLA 1FR1A 5TR7A 1YLJA 3HLGA 2A2LA 3UDIA 5I94A 3NECA 4GS9A 2Y91A 1MWSA 3EEHA 1S1ZA 3C4PA 4WZ5A 1KGFA 1Q2QA 2XK1A 1H0MA 3IF6A 3D4FA 3S7OA 3C8CA 5HW3A 2J9PA 5CXWA 4BD0A 1F98A 4BJPA 4DN0A 3V39A 1K6SA 2PBYA 1A0KA 2JKGA 3C38A 3V3RA 2XFTA 1MWRA 2M1CA 3SH9A 3LYXA 2Y79A 4LFUA 4ID4A 4EQIA 3IXBA 4EBPA 1Y4OA 3G30A 2NUTC 2WYXA 5EVIA 4FTXA 4XXRA 2R9XA 3WS1A 5HD3A 1LL5A 4LV3A 4NK3A 3IXDA 1XJ2A 2ZM2A 4C75A 1IYPA 3QP5A 1S4RA 4HQAA 3IWQA 4BQMA 2HP6A 5HWWA 4S2IA 2BG1A 2VA0A 3BJNA 4OLGA 1TVFA 2PYPA 5FQKA 1CEFA 2NUPC 3CJMA 1JTDA 3B3XA 5HZHA 4FSFA 2K31A 3K2NA 4OONA 4EEUA 3VE3A 1Y54A 2PU4A 4Q0IA 4KQRA 1PZPA 2M7UA 4F3LB 5GHYA 5IHVA 1L0GA 1SKFA 4XT2A 5HL6A 4I3IA 3FC7A 1HTZA 1PYYA 2VV7A 1W79A 2XRNA 1E3UD 5GLDA 1LI0A 3OOVA 1ZHHB 1S67L 3W4OA 1EROA 1IOUA 2OLVA 4EUVA 2H10A 3GQZA 4NXEA 4O0PA 2ZC3B 3ZG5A 3MQOA 5EOOA 3KYZA 2P9VA 1P9WA 5EVID 5EM0A 3HL9A 3SS5A 4QJGA 4MCWA 5FQJA 1NJ4A 2KX6A 4QY6A 5FDHA 3CHWP 4DF6A 3ZQ5A 2QKPA 4WF0A 3TE8A 3NIAA 1YAXA 2OSUA 5EV0A 3E98A 3C4OA 4R23A 2I9VA 1XX2A 4A5RA 5HD5A 5DF7A 3RJUA 1T1BA 3E0YA 4S2MA 3T12B 3BLMA 4N92A 3UE1A 3OCNA 2ZBBA 2B5RA 2QWSA 4O01A 5CERA 1LL9A 4E3JA 2IWDA 1XP4A 4LCLA 5EOEA 3QP4A 1GA0A 2Z6DA 3S7PA 1K6RA 4S2PA 4GW9A 2R9WA 4P6ZS 5F1FA 2Y4AA 1CK3A 1F5MA 1I2SA 2O9CA 4NXGA 1RCJA 1F2KA 2JC7A 3UN7A 1IKGA 4WZ4A 1J3WA 5L07A 3N8RA 3GTCA 2Y2MA 1JWZA 4ETXA 1QMFA 3UB6A 4I39A 3G2ZA 3N6IA 4GJ4A 4CLCC 4PM5A 1JTGA 4KG6A 4MBHA 1D1JA 3SS3A 5JYPA 1PNEA 2EFXA 2V2FF 3PAGA 2W1TB 3MR0A 3CPTB 2C6WB 1K25A 1SZVA 5I5LA 4X68A 5HDCA 1PWGA 4E04A 4X56A 1XJ3A 3UB9A 1NLYA 4UA7A 4PKYA 5AVEA 3EGXC 2XROA 5HDDA 2WKRA 5DF8A 2WKIA 5AQAA 5AQBA 2L4RA 1H5XA 1VETB 3V3SA 3NOUC 3S7NA 3ZYTA 4LV2A 1KVMA 2LB5A 4K08A 2ZQ8A 1SHVA 4Y2FA 4NEED 5G4ZA 2PD8A 4OQHA 5GLBA 3R7WB 4DXCA 1MWTA 3HUOA 3WWXA 3VSKA 4E3KA 2XA7M 4CQHA 1CF0A 1KDSA 5AQ9A 3CWFA 2EX2A 3JPUA 4KENB 1BUEA 2IWBA 3D9YA 1MC0A 3F1PA 4X53A 2XLNA 4I3AA 5IU1A 5TJJA 5AQ7A 2VKSA 1HVBA 1YLZA 4MN5A
chains in the Genus database with same CATH topology
4DJ3A 4BWIA 3D72A 4MN7A 1H8MA 4F3LA 2JKTI 2W1TA 3VE4A 3H82B 3NOPC 3LIEA 1STZA 3LIBA 3PBOA 4L9GA 4LRZE 4M4XA 4BBVA 5HPIA 4PAUA 3MF0A 3H9WA 2V1AA 3EOIA 1OTEA 2JN7A 3E4OA 3T4SA 2V0UA 4WL9A 3A0VA 1XFQA 2JKRM 1T1AA 3DBAA 3CI6A 3GECA 4JGPA 5AVFA 3MQQA 4Q0HA 1H3QA 3CUEA 3G6OA 4B9OA 2MJ6A 3CUEC 2M7VA 3LI9A 1YKDA 4GHIA 4EETB 4OOLA 4I3JA 3KX0X 2KDKA 3FPWA 1ODVA 5KSHA 4UQIS 3T4JA 5LBRA 1XJ6A 2XA7S 3UMEA 1D7EA 4BBTA 3A0SA 1JNUA 5FL3A 5K5BA 3D3OA 1TD5A 2YKHA 2JHEA 3FG8A 4NXBA 4ZRRA 2VV8A 5DFYA 2Y8HA 3MXQA 5KIZA 2W3DA 3UE6A 3TJZC 1NRJA 4I38A 3KYQA 2LB9A 3MMHA 2OWJA 4HJ4A 4WUJA 4G3VA 4NXFA 4KUKA 1T18A 5DJTA 1Y28A 3T4TA 2JKTM 3PBQA 3B33A 4WLAA 1LSWA 4LRXC 2KLIA 4JGOA 2WKQA 3BW6A 4GLQA 3A0RA 1MZUA 3JVVA 4R6LA 2O0YA 2A2LA 1LSVA 1TS8A 4LLOB 2GNXA 3H7WA 4GS9A 4ARZB 3H82A 5C5KA 4EQ1A 4LPZA 3ICYA 4KQDA 3EEHA 3EWKA 1S1ZA 3KSFA 1OTBA 2OWHA 3TRCA 2VV6A 4Y5FA 3LR4A 4P6ZM 2VX8A 2W0NA 2ZOIA 3S7OA 3C8CA 3BQ8A 1TS7A 3OCLA 3SW1A 2VGLS 1F98A 3KSIA 1OTAA 3LR3A 4BJPA 4DN0A 4CLCB 4B93A 5EFWA 3LR0A 2W3EA 2B02A 3C38A 3LIDA 4JGRA 4MDZA 4MMNA 2J3TC 2M1CA 3VV4A 4I5SA 3LYXA 2Y79A 5HSQA 3PBTA 1N9LA 4ETZA 5J3WA 1LT0A 2INWA 3OC2A 2NUTC 4R3AA 3PXPA 1TS6A 2HJ9C 3LUQA 3MQ0A 5DFXA 5HD3A 4AFIA 3P01A 4RQ9A 1S4SA 3CITA 1OTIA 2L1MA 4BBUA 3T4LA 1XJ4A 2P08A 1T19A 1XJ2A 2XSSA 2A24B 2OOLA 2G7UA 4WN5A 2PT7A 2O99A 3F1OA 2O9BA 4KUOA 1S4RA 4HQAA 5HWTA 1IFQA 3ULFA 5HWWA 5DKKA 2OAQ1 3PR6A 2VA0A 3BJNA 2PYPA 2GZAA 3KSHA 3MJQA 1UWNX 2NUPC 2FH5A 1P0ZA 2HV1A 3R7WA 1VB6A 1MKMA 4YWZA 4HNBA 2W3FA 4HJ6A 3F1NB 5TBMB 1V9ZA 2H28A 3BY8A 5HZHA 3VOLA 1BYWA 3F1PB 1S66L 2V1BA 2DMWA 4FSFA 1XFNA 3LI8A 2K31A 3IS2A 4EESA 4O8GA 1UWPX 1T1CA 4HH3A 4DJ2A 3BQAA 2EWWA 3K2NA 4EEUA 4CLCA 4KQOA 3VE3A 4Q0IA 4IHQA 3R4KA 1GSWA 1OPXA 1GSXA 4WEKA 2M7UA 4QPRA 4F3LB 5CX7A 3C2WA 3V67A 3EQVA 4LRYC 5J7EA 4YNRA 4UEYA 4XT2A 1N9NA 1V9YA 5AJGA 3MFXA 5HL6A 3RTYA 4I3IA 4R38A 2K2NA 1DRMA 1G28A 3FC7A 3EQUA 2VV7A 3LICA 4CLCE 4II7A 2XRNA 4H6JB 1N9OA 2PR5A 3OOVA 5DJUA 1ZHHB 3T4KA 1S67L 1IOUA 4EERA 3NOTC 4EUVA 2ZOHA 5F69A 1DP9A 1WA9A 4Q0JA 4NXEA 4EEPA 4O0PA 3MQOA 5F68A 1OT9A 5HWVA 2L0WA 2KOIA 4GHIB 2P04A 2ZMVA 3KYZA 1KOUA 4Y3IA 1P9WA 1DP8A 3E4PA 3UMDA 3LR5A 3NJAA 4MCWA 4UQIM 1G6OA 5F5YA 1ZTUA 2VEAA 3UB8A 3PBRA 2KX6A 1YSQA 1GSVA 4R70A 2V0WA 3KO6A 3ZQ5A 2QKPA 5G4YA 1W63Q 4G3KA 4HY8A 4WF0A 3TE8A 2V9AA 3PHYA 2P7JA 2K7SA 2R78A 3K3CA 1YAXA 1TS0A 3B42A 1YSPA 2W1RA 3E4QA 4IUHA 3E98A 2I9VA 4WELA 5HD5A 5F6AA 2EA9A 3P7NA 3UB7A 2FZ0A 2HJEA 4EW7A 1T1BA 3E0YA 3FPVA 1OTDA 1P97A 3OCNA 3K3DA 2ZBBA 5J4EA 3H7WB 4GS9B 2QWSA 4O01A 2GX5A 3EEAA 3GDIA 3LFVA 3OBFA 4HP9A 2Z6DA 3S7PA 1VHMA 4PHTA 4GW9A 4H6JA 3LIFA 2QYBA 4ARZA 4HIAA 4P6ZS 4HOIA 1LL8A 3HCYA 1F5MA 4CLCD 3JVUA 2W3GA 3IBJA 1UGUA 2B18A 1X0OA 2O9CA 1F9IA 3T50A 4NXGA 3PBNA 2ZMFA 5A8BA 4L9FA 4L0LA 1OJGA 2VGLM 4MN6A 3U2AA 1TF1A 2J3WA 3CAXA 3EGDC 4G3WA 4Z1WA 3BY9A 4ME4A 4ETXA 2PD7A 3T4OA 4PKYG 3UB6A 4I39A 4HP4A 5MC7A 1S1YA 4GJ4A 4CLCC 2CMNA 2QJ7A 3B47A 4JGQA 3OLOA 4OOMA 2YKFA 2Z6CA 2W1TB 3MR0A 4L9EA 5HDCA 5I5LA 4E04A 2VLGA 2O9AA 4BMWA 4HH2A 2GJ3A 3S7QA 4IJGA 4HI4A 2BASA 2VJWA 3HJIA 5HDSA 1XJ3A 3UB9A 1NLYA 2WKPA 1P9RA 4PKYA 5AVEA 1DP6A 3EGXC 3TW8A 2XROA 1OT6A 2W3HA 5HDDA 4YOFA 2WKRA 2PYRA 1NWZA 2EWVA 2L4RA 3F1OB 2PDRA 3NOUC 3RFBA 3S7NA 3ZYTA 3RH8B 2QJ5A 4DMZA 2HGVA 2D01A 4HJ3A 2LB5A 5L8MA 3UE3A 2QHKA 4K08A 4NKPA 4Y2FA 4NEED 2A24A 2OAP1 5IS1A 2W27A 5G4ZA 2PD8A 3LIAA 3R7WB 1OJ5A 1NLZA 5IT5A 3PBSA 4FOFA 4EU0A 2J3TD 2HF6A 2JKRI 2PR6A 4IUKA 3T4QA 2D02A 3O5YA 1W63M 2XA7M 3HJKA 4CQHA 3IBRA 3CWFA 2VZWA 3IS2B 3F1NA 5TBMA 3NHQA 4GCZA 2PHYA 3PYPA 1MC0A 3CLOA 3F1PA 4HHDA 3W2ZA 2J80A 4I3AA 3BWLA 4WEJA 5IU1A 5TJJA 4EXOA 1EW0A 1LSXA 2VKSA 5HPFA 3KSGA 3C30A 4XT2B 5DF9A 5DKLA 2IA2A 1D06A 4MN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BQ8 A;  1YAX A;  4UEY A;  3BQA A; 
#chains in the Genus database with same CATH topology
 4DJ3 A;  1SKO A;  5CTM A;  5FQQ A;  5FSR A;  3D72 A;  3G31 A;  1H8M A;  2W1T A;  3CPT A;  2JKF A;  3BEB A;  3LIE A;  1RGY A;  3HLC A;  3WS5 A;  3OPP A;  4CJN A;  4L9G A;  4JPM A;  4P87 A;  1PFL A;  4Y17 A;  4GN2 A;  3EOI A;  3OZH A;  4Q8I A;  2E8I A;  3C7U A;  3A0V A;  1YLP A;  1XFQ A;  3MSH A;  3DBA A;  3FKW A;  5AVF A;  5L2F A;  4FCF A;  3BEC A;  1K54 A;  3CUE C;  3LCE A;  4WYY A;  5BOH A;  5TGF A;  4S2O A;  3G4P A;  4OVD A;  5LBR A;  1XJ6 A;  4E3L A;  3N8L A;  4LCM A;  5D3O A;  2PU2 A;  5FEF A;  5FL3 A;  5K5B A;  4IVI A;  4KG5 A;  5E2G A;  1E25 A;  5DFY A;  2Y8H A;  5KIZ A;  3HLD A;  3KYQ A;  2LB9 A;  1GHM A;  4M3K A;  4G3V A;  4ZJ3 A;  1DJB A;  5DJT A;  1Y28 A;  3T4T A;  3PBQ A;  1RGZ A;  4OPZ A;  2XR0 A;  4LGW A;  3BW6 A;  3HUN A;  2BLS A;  3A0R A;  3ISG A;  3JVV A;  5M18 A;  3MS6 A;  4LLO B;  3DW0 A;  3BLS A;  4PMA A;  3ZG8 B;  1M40 A;  2Y2I A;  5CTN A;  4EQ1 A;  4KQD A;  1MXO A;  3LEQ A;  2J7V A;  2OWH A;  2A49 A;  2VX8 A;  4P6Z M;  4QY5 A;  1BSG A;  4OP8 A;  2W0N A;  2HZ5 A;  3HVF A;  2EX6 A;  4PM6 A;  3SW1 A;  3VSL A;  1CEG A;  1N9B A;  3HBR A;  5FAS A;  4BL2 A;  5EFW A;  4O7D A;  3LID A;  4JGR A;  2WAE A;  4MDZ A;  3IWO A;  1GCE A;  2Y2K A;  5DTT A;  3PBT A;  2AVX A;  4JF6 A;  5J3W A;  2INW A;  3PXP A;  3Q1F A;  1XA1 A;  1NXY A;  5KMW A;  3LUQ A;  4RX2 A;  1XGJ A;  1L3L A;  3E2L A;  4AFI A;  4ZJ1 A;  3P01 A;  4RQ9 A;  1ONH A;  4R4S A;  1MKI A;  3M6B A;  1ES4 A;  2P08 A;  1T19 A;  2XSS A;  2A24 B;  5DTS A;  2PT7 A;  1S0W A;  2O9B A;  1PZO A;  5DKK A;  2UV0 E;  2OAQ 1;  3PR6 A;  1NYM A;  1H8Y A;  5FDS A;  3V50 A;  1P0Z A;  4KZ7 A;  1VB6 A;  3S4X A;  4YWZ A;  3ZG7 B;  4S2L A;  2QMI A;  2H28 A;  2WGV A;  2H5S A;  1XFN A;  3IS2 A;  1JVJ A;  5FI2 A;  3BQA A;  1VM1 A;  4UA6 A;  3ZCZ A;  1WE4 A;  5A93 A;  5CEB A;  2RL3 A;  3BFE A;  3G32 A;  4WEK A;  5CGS A;  4QPR A;  5CX7 A;  3ZG9 B;  3C2W A;  4RA7 A;  1K57 A;  4LRY C;  4YNR A;  5GL9 A;  1N9N A;  3T1R A;  3RTY A;  4R38 A;  1G6A A;  1DRM A;  5EPH A;  1U60 A;  3EQU A;  3LIC A;  4GDN A;  3T1Q B;  3DAV A;  4H6J B;  1XPB A;  3NOT C;  2ZOH A;  5F69 A;  1WA9 A;  4DKI A;  4Q0J A;  3P98 A;  5HL1 A;  2Q9M A;  1QME A;  4WBG A;  5F68 A;  2JCH A;  2KOI A;  1IEM A;  1E3U A;  1LI9 A;  3RXX A;  3BYD A;  3E4P A;  3UMD A;  3LR5 A;  2Y2H A;  2WGI A;  5HAQ A;  4ZDX A;  1AXB A;  1G6O A;  4C6Y A;  1ESI A;  2HDS A;  4S2K A;  1GSV A;  4R70 A;  2V0W A;  3PAE A;  2DNS A;  3KO6 A;  2V9A A;  3CZD A;  1BLC A;  3B42 A;  1TS0 A;  4IUH A;  5G18 A;  3P7N A;  1DJC A;  4N1H A;  2HJE A;  1VEU B;  3NBL A;  1P97 A;  3K3D A;  5F1G A;  3H7W B;  4QWO A;  2Y2P A;  1YLW A;  2V1Z A;  1G68 A;  3OBF A;  4E6X A;  1W8Y A;  4GKU A;  4H6J A;  1KE4 A;  1WYB A;  2FFY A;  4HOI A;  2H0T A;  4RVA A;  3UPO A;  1IYO A;  3IX8 A;  4JXV A;  4L9F A;  1DY6 A;  3Q7V B;  4FD8 A;  4MN6 A;  3U2A A;  2J3W A;  2PAV P;  2XD5 A;  4ME4 A;  3NDG A;  5CHU A;  2PD7 A;  2XF3 A;  3BM6 A;  1S1Y A;  3TSG A;  5F82 A;  2CMN A;  3B47 A;  3S1Y A;  2HP5 A;  4DDS A;  1CJF A;  1L0F A;  3FV7 A;  3HRE A;  5DTK A;  2VLG A;  2O9A A;  4HH2 A;  4KZ6 A;  3OPH A;  2ACG A;  3ZHH A;  1P9R A;  3GV9 A;  1OT6 A;  1CI9 A;  4YOF A;  1EWZ A;  1NWZ A;  4EV4 A;  1NZU A;  3LGO A;  3F1O B;  1TEM A;  1VQQ A;  3RH8 B;  2HP9 A;  4KQQ A;  4ESP A;  2HGV A;  3BFF A;  1VEU A;  3VOZ A;  4NKP A;  2W27 A;  5EEC A;  4BLM A;  3ZDJ A;  5FQ9 A;  4QD4 A;  1OJ5 A;  4NET A;  3PBS A;  4DE2 A;  1FCN A;  1N4O A;  2HF6 A;  2JKR I;  4U0T A;  4IUK A;  2RCX A;  3IXH A;  4JKT A;  1PI4 A;  3IBR A;  4PM9 A;  3HLB A;  2VZW A;  4N9L A;  3UPN A;  1BLH A;  4IBR A;  4DDY A;  3FWL A;  4Y15 A;  3CLO A;  5GLC A;  4R3B A;  1YM1 A;  2HPB A;  3W2Z A;  3T1S A;  4QB8 A;  1BLP A;  4WEJ A;  5FA7 A;  1L2S A;  4F94 A;  3C30 A;  4DE0 A;  1SDE A;  5DF9 A;  5DKL A;  1D06 A;  2Y2Q A;  3AGF A;  4EWF A;  4F3L A;  3LEZ A;  4OPR A;  4E3M A;  4M4X A;  3MXS A;  3IHA A;  4N9K A;  2ZQD A;  3NUL A;  3QP1 A;  3IQA A;  2V1A A;  2V8F A;  5E2H A;  1OTE A;  3MKF A;  5A92 A;  3QP6 A;  1IKI A;  3T4S A;  3G34 A;  4JBF A;  2ZM8 A;  5CHM A;  3GEC A;  3QHY A;  2Y55 A;  3MQQ A;  3A3I A;  3LI9 A;  2Y2G A;  4EET B;  4Z9Q A;  1ALQ A;  2FFF B;  3VP1 A;  4X1L A;  1ODV A;  4UQI S;  3T4J A;  3WRT A;  4BBT A;  1HD8 A;  3A0S A;  4EBN A;  2YKH A;  1TD5 A;  5GLA A;  2JHE A;  2J8Y A;  3WS4 A;  1HZO A;  3FG8 A;  4NXB A;  4ZRR A;  2WUQ A;  2VV8 A;  3UE6 A;  3TJZ C;  1NRJ A;  4I38 A;  4NXF A;  1O07 A;  2JKT M;  3ZGA B;  1NZO A;  2EX8 A;  3B33 A;  3OPR A;  3DTE A;  4K0X A;  2KLI A;  4IBX A;  1FIK A;  1XGI A;  2ZL1 B;  2VGK A;  4KZB A;  4JGO A;  4Y0O A;  3LY3 A;  3MZD A;  5GHZ A;  3VP2 A;  1MZU A;  2XGN A;  4R6L A;  2JE5 A;  2O0Y A;  1LSV A;  3CG5 A;  1ZG6 A;  2GNX A;  4ARZ B;  4PM7 A;  4JF4 A;  4LPZ A;  3ICY A;  3EWK A;  3KSF A;  1OTB A;  3TRC A;  3O3V A;  5CHJ A;  2DCF A;  4P6B A;  4LV0 A;  4JXG A;  2Y59 A;  2VGL S;  1K55 C;  3S22 A;  1EI5 A;  3KSI A;  4CLC B;  4B93 A;  3T1X A;  3GSG A;  2W3E A;  1PW8 A;  1XKZ A;  4MMN A;  2J3T C;  1W5D A;  1Z09 A;  3VV4 A;  4I5S A;  5HSQ A;  3NI9 A;  4S2N A;  1N9L A;  4U0X A;  4P85 A;  4ETZ A;  1LT0 A;  3A3J A;  1MWU A;  1AWI A;  4OQI A;  1PWD A;  3UY6 A;  1TS6 A;  3UDF A;  2X01 A;  3DTK A;  2WKH A;  3MQ0 A;  4K0W A;  4P0M A;  1ZKJ A;  5DFX A;  3CIT A;  1NRF A;  1ES5 A;  1OTI A;  1XXM A;  2WZZ A;  3T4L A;  3VFH A;  2ZL1 A;  4RX3 A;  1L0D A;  2OOL A;  1JWP A;  2G7U A;  3AGE A;  4KZ5 A;  4WN5 A;  4E3N A;  3MZE A;  5HAR A;  4Y0U A;  2O99 A;  1VET A;  1KDW A;  3Q07 A;  4B4Z A;  5HWT A;  1IFQ A;  2DRW A;  3MJQ A;  1UWN X;  3SS4 A;  2ZC7 A;  2FH5 A;  1C3B A;  3R7W A;  2ZMA A;  4HNB A;  3HLE A;  3N7W A;  4HEF A;  4U3T A;  3F1N B;  2VK3 A;  5TBM B;  4BEN A;  1V9Z A;  3G35 A;  3BY8 A;  3JYI A;  3M6H A;  4DRT A;  3VOL A;  1BYW A;  2V1B A;  2DMW A;  1ONG A;  3LI8 A;  4EES A;  1UWP X;  2XH9 A;  2EWW A;  4CLC A;  2ZM0 A;  4Y0T A;  3MKE A;  4BL3 A;  1GSW A;  3Q81 A;  1FSW A;  4WMC A;  3V5M A;  3V67 A;  3EQV A;  5J7E A;  1S6R A;  4RYE A;  1GHI A;  2EX9 A;  5AJG A;  3MFX A;  2K2N A;  3E2K A;  5M19 A;  4CLC E;  4II7 A;  1N9O A;  2PR5 A;  2WAF A;  1PWC A;  4N1X A;  1FCM A;  4EER A;  1Z6F A;  1DP9 A;  4WZ5 C;  3SH7 A;  2WAD A;  4EEP A;  5FAT A;  1CQA A;  1TDG A;  1OT9 A;  3IF6 C;  4GHI B;  5FI7 A;  3LY4 A;  2ZLY A;  1DP8 A;  3WS2 A;  1I5Q A;  4FH2 A;  4LV1 A;  1FCO A;  4MBF A;  4UQI M;  1L0E A;  2UWX A;  1YSQ A;  3M2J A;  2B95 A;  5G4Y A;  2P74 A;  4HY8 A;  1YPR A;  2E8J A;  3ZG0 A;  3O86 A;  4UHU A;  5FI6 A;  2K7S A;  5EVI C;  4XUX A;  2ZQ7 A;  4BD1 A;  3K3C A;  1YSP A;  3ZVW A;  4WEL A;  5F6A A;  2EA9 A;  3UO9 A;  4E3I A;  5CGW A;  3VP0 A;  2ZC6 B;  2ZQ9 A;  1HLU P;  1NY0 A;  3MBZ A;  3FPV A;  5HX9 A;  1LHY A;  3OPL A;  4GS9 B;  4DXB A;  1KGE A;  3DWK A;  1JWV A;  3LFV A;  4HP9 A;  1E4D A;  3VP3 A;  3LIF A;  2QYB A;  4KZ4 A;  4HIA A;  2Q9N A;  2Q0O A;  1LL8 A;  4CLC D;  2W3G A;  3IBJ A;  3NCK A;  1X0O A;  3C5A A;  3UB5 P;  3PBN A;  2ZMF A;  5HFO A;  5A8B A;  3FYZ A;  4WMC D;  2VGL M;  3UPP A;  1TF1 A;  3CAX A;  3O88 A;  4GB7 A;  2V8C A;  1Q2P A;  2I72 A;  4YIN A;  4OPQ A;  3T4O A;  5MC7 A;  4DE1 A;  1W7F A;  4OLD A;  3BFC A;  2QJ7 A;  2Z2M B;  1YLT A;  5HAP A;  5KZH A;  2YKF A;  3ZVT A;  4PM8 A;  2XD1 A;  4L9E A;  3UE0 A;  4IVK A;  3S7Q A;  3IH8 A;  4IJG A;  2BAS A;  2VJW A;  4MNR A;  3HJI A;  5HDS A;  4ZTK A;  2WKP A;  3BRM A;  3N4I A;  2W3H A;  1H8Z A;  2PYR A;  2VGJ A;  2EWV A;  3RFB A;  1YQS A;  4DMZ A;  2D01 A;  4IED A;  5L8M A;  1K38 A;  2QHK A;  2A24 A;  1YLY A;  5IS1 A;  1K4E A;  5EE8 A;  4GD8 A;  4OKP A;  3LIA A;  1BZA A;  4X6T A;  1YMX A;  2J3T D;  3ZFZ A;  3IHB A;  2D02 A;  2HDU A;  2PRF A;  3O5Y A;  4UAA A;  3HJK A;  3VP4 A;  4NG2 A;  4MLL A;  5FQM A;  1GA9 A;  4X1M A;  2G2W A;  4GCZ A;  2PHY A;  4HHD A;  2J80 A;  3BWL A;  3NDE A;  5E2E A;  3KSG A;  4XT2 B;  3AGD A;  4OPY A;  1PIO A;  4BWI A;  5DVA A;  1FIL A;  4MN7 A;  3H82 B;  3NOP C;  5J8X A;  1STZ A;  2V20 A;  3IH9 A;  5KSC A;  3Q82 A;  4OOY A;  4BBV A;  4PAU A;  3H9W A;  2XFS A;  2JN7 A;  1ERM A;  3VFF A;  3E4O A;  2V0U A;  1K0K A;  4WL9 A;  2ZQA A;  2P9V B;  4CPK A;  3DTI A;  1SDN A;  3CI6 A;  4Q0H A;  1K56 A;  4B9O A;  5JYO A;  4C3Q A;  2MJ6 A;  2M7V A;  1YKD A;  3L7H A;  5KSH A;  3IX3 A;  2XA7 S;  4X55 A;  5EM1 A;  1D7E A;  4ZJ2 A;  1JNU A;  1MY8 A;  1TDL A;  4HBT A;  3TG9 A;  3SOI A;  2GDN A;  3KYE A;  4GNU A;  2ZQC A;  4WUJ A;  3ITA A;  4KUK A;  3FKV A;  3VOY A;  1XA7 A;  4WLA A;  1LSW A;  4OQ0 A;  4LRX C;  5GHX A;  3WRZ A;  2WKQ A;  3GVB A;  4GLQ A;  2EXB A;  2EFU A;  2ZJ9 A;  1WYC A;  3DWZ A;  1NYY A;  2EXA A;  4OH0 A;  1TS8 A;  1YT4 A;  3DTM A;  5F83 A;  4OP5 A;  3H7W A;  1KE3 A;  3H82 A;  5A90 A;  5C5K A;  4S2J A;  1IYQ A;  2VV6 A;  4Y5F A;  3LR4 A;  3MFD A;  4GD6 A;  4EUZ A;  5A91 A;  2ZOI A;  3BQ8 A;  1TS7 A;  3OCL A;  4X25 A;  1OTA A;  3LR3 A;  4KZ9 A;  2PBD P;  3Q7V A;  3LR0 A;  2B02 A;  4R0Q A;  1FR6 A;  1J9M A;  4S2N C;  3W8K A;  4MEZ A;  3OC2 A;  4R3A A;  4Y7P A;  2XEP A;  2HJ9 C;  3A3D A;  1K56 D;  4LEN A;  2CC1 A;  4B4X A;  1S4S A;  5CGX A;  2L1M A;  4BBU A;  4E6W A;  1XJ4 A;  3F1O A;  2G2U A;  4KUO A;  3ULF A;  3O87 A;  2Y2O A;  2OV5 A;  2X71 A;  2GZA A;  2QZ6 A;  1K54 C;  3KSH A;  4D2O A;  1BT5 A;  4WM9 A;  4HES A;  2HV1 A;  4FUW A;  1MKM A;  4JXW A;  1ES2 A;  2W3F A;  2WGW B;  4HJ6 A;  2C5W B;  4HBU A;  5CED A;  3F1P B;  2BTF P;  3M2K A;  1S66 L;  4O8G A;  2J9O A;  1T1C A;  4HH3 A;  4DJ2 A;  1ESU A;  2XDM A;  4KQO A;  4IHQ A;  3R4K A;  1SKO B;  4KZ8 A;  1OPX A;  1GSX A;  5EVL A;  3NC8 A;  3QP2 A;  4Y13 A;  4R3J A;  5M1A A;  4UEY A;  1V9Y A;  3UNW A;  4KG2 A;  1G28 A;  1KE0 A;  5DJU A;  3T4K A;  5U47 A;  3QP8 A;  4K91 A;  3VMA A;  1ERQ A;  2WKE A;  3A3E A;  3HLW A;  3IT9 A;  4EBL A;  4JXS A;  5HWV A;  2L0W A;  3W4Q A;  2P04 A;  2ZMV A;  1KOU A;  5FAP A;  3ZNT A;  4Y3I A;  3RXW A;  3BFD A;  3NJA A;  2ZC4 B;  5HAI A;  3UB8 A;  5F5Y A;  1ZTU A;  1SCW A;  2VEA A;  1O7E A;  3PBR A;  3NY4 A;  1RP5 A;  3IF5 A;  2WGW A;  1W63 Q;  3G2Y A;  3GMW A;  4G3K A;  4GOG A;  4X69 A;  4ZBE A;  4DE3 A;  1ZC2 A;  3PHY A;  2P7J A;  2R78 A;  2ZD8 A;  2W1R A;  1KGG A;  3E4Q A;  2ZC5 B;  3P09 A;  2OLU A;  3UB7 A;  2A3U A;  2FZ0 A;  4EW7 A;  1KVL A;  5EUA A;  1ACF A;  2XQZ A;  1OTD A;  5J4E A;  2GX5 A;  3EEA A;  3GDI A;  3HLF A;  1GHP A;  1VHM A;  4PHT A;  3SZT A;  4ARZ A;  1BLS A;  3HCY A;  3JVU A;  4GZB A;  1UGU A;  2B18 A;  4GDB A;  5E2F A;  5FAQ A;  1F9I A;  3T50 A;  3BFG A;  1FSY A;  5L09 A;  3SH8 A;  4L0L A;  1OJG A;  1PW1 A;  2Y2L A;  3EGD C;  1BUL A;  4G3W A;  1OME A;  4Z1W A;  2WK0 A;  2X02 A;  3BY9 A;  3Q7Z A;  5L10 A;  5FAO A;  1M6K A;  4PKY G;  4D60 A;  4HP4 A;  1W8Q A;  4JLF A;  5CEC A;  4R1G A;  4JGQ A;  3OLO A;  4OOM A;  3MZF A;  2Z6C A;  1ZG4 A;  1K4F A;  1K57 C;  4BMW A;  2GJ3 A;  4KZ3 A;  2IWC A;  3GR2 A;  4HI4 A;  4E3O A;  4QHC A;  1PI5 A;  3N8S A;  3GRJ A;  1DP6 A;  3QNC A;  3TW8 A;  3WS0 A;  2HDR A;  1ES3 A;  1IEL A;  2PDR A;  4R4R A;  1I2W A;  2QJ5 A;  1YMS A;  4HJ3 A;  3UE3 A;  2OAP 1;  5CRF A;  4B88 A;  3IX4 A;  1FQG A;  3L9K A;  1NLZ A;  5IT5 A;  3UDX A;  4FOF A;  4EU0 A;  5FEG A;  3ITB A;  2PR6 A;  3T4Q A;  5EVE A;  1W63 M;  1MPL A;  1K55 A;  4H8R A;  3IS2 B;  4XUZ A;  3F1N A;  5TBM A;  3FZC A;  3NHQ A;  3PYP A;  3CMZ A;  3MXR A;  1BTL A;  3C7V A;  4KZA A;  4EXO A;  1EW0 A;  1LSX A;  3I7J A;  5HPF A;  2IA2 A;  3ZNY A;  2Z2L B;  2JKT I;  3VE4 A;  4OQG A;  3LIB A;  3PBO A;  1DJA A;  4LRZ E;  1FOF A;  3PTE A;  4QU3 A;  2JBF A;  5HPI A;  3MF0 A;  3IF6 B;  3HUM A;  2Y2N A;  4JF5 A;  3TOI A;  2JKR M;  3A3F A;  3LO7 A;  1T1A A;  4JGP A;  4ZAM A;  1H3Q A;  3CUE A;  3G6O A;  3W4P A;  4UA9 A;  1G5U A;  1PRQ A;  2QPN A;  4FH4 A;  4GHI A;  4OOL A;  1LLB A;  4PPR A;  4I3J A;  3KX0 X;  2KDK A;  3FPW A;  3QNB A;  5TFQ A;  5FQI A;  2WZX A;  5E43 A;  3UME A;  1IYS A;  2Y2J A;  3IWI A;  2HDQ A;  3IXG A;  3D3O A;  5EVI B;  4MBK A;  3U4L P;  3MXQ A;  2W3D A;  1CI8 A;  3MMH A;  2OWJ A;  4HJ4 A;  1T18 A;  4YFM A;  2H0Y A;  1MBL A;  1FR1 A;  5TR7 A;  1YLJ A;  3HLG A;  2A2L A;  3UDI A;  5I94 A;  3NEC A;  4GS9 A;  2Y91 A;  1MWS A;  3EEH A;  1S1Z A;  3C4P A;  4WZ5 A;  1KGF A;  1Q2Q A;  2XK1 A;  1H0M A;  3IF6 A;  3D4F A;  3S7O A;  3C8C A;  5HW3 A;  2J9P A;  5CXW A;  4BD0 A;  1F98 A;  4BJP A;  4DN0 A;  3V39 A;  1K6S A;  2PBY A;  1A0K A;  2JKG A;  3C38 A;  3V3R A;  2XFT A;  1MWR A;  2M1C A;  3SH9 A;  3LYX A;  2Y79 A;  4LFU A;  4ID4 A;  4EQI A;  3IXB A;  4EBP A;  1Y4O A;  3G30 A;  2NUT C;  2WYX A;  5EVI A;  4FTX A;  4XXR A;  2R9X A;  3WS1 A;  5HD3 A;  1LL5 A;  4LV3 A;  4NK3 A;  3IXD A;  1XJ2 A;  2ZM2 A;  4C75 A;  1IYP A;  3QP5 A;  1S4R A;  4HQA A;  3IWQ A;  4BQM A;  2HP6 A;  5HWW A;  4S2I A;  2BG1 A;  2VA0 A;  3BJN A;  4OLG A;  1TVF A;  2PYP A;  5FQK A;  1CEF A;  2NUP C;  3CJM A;  1JTD A;  3B3X A;  5HZH A;  4FSF A;  2K31 A;  3K2N A;  4OON A;  4EEU A;  3VE3 A;  1Y54 A;  2PU4 A;  4Q0I A;  4KQR A;  1PZP A;  2M7U A;  4F3L B;  5GHY A;  5IHV A;  1L0G A;  1SKF A;  4XT2 A;  5HL6 A;  4I3I A;  3FC7 A;  1HTZ A;  1PYY A;  2VV7 A;  1W79 A;  2XRN A;  1E3U D;  5GLD A;  1LI0 A;  3OOV A;  1ZHH B;  1S67 L;  3W4O A;  1ERO A;  1IOU A;  2OLV A;  4EUV A;  2H10 A;  3GQZ A;  4NXE A;  4O0P A;  2ZC3 B;  3ZG5 A;  3MQO A;  5EOO A;  3KYZ A;  2P9V A;  1P9W A;  5EVI D;  5EM0 A;  3HL9 A;  3SS5 A;  4QJG A;  4MCW A;  5FQJ A;  1NJ4 A;  2KX6 A;  4QY6 A;  5FDH A;  3CHW P;  4DF6 A;  3ZQ5 A;  2QKP A;  4WF0 A;  3TE8 A;  3NIA A;  1YAX A;  2OSU A;  5EV0 A;  3E98 A;  3C4O A;  4R23 A;  2I9V A;  1XX2 A;  4A5R A;  5HD5 A;  5DF7 A;  3RJU A;  1T1B A;  3E0Y A;  4S2M A;  3T12 B;  3BLM A;  4N92 A;  3UE1 A;  3OCN A;  2ZBB A;  2B5R A;  2QWS A;  4O01 A;  5CER A;  1LL9 A;  4E3J A;  2IWD A;  1XP4 A;  4LCL A;  5EOE A;  3QP4 A;  1GA0 A;  2Z6D A;  3S7P A;  1K6R A;  4S2P A;  4GW9 A;  2R9W A;  4P6Z S;  5F1F A;  2Y4A A;  1CK3 A;  1F5M A;  1I2S A;  2O9C A;  4NXG A;  1RCJ A;  1F2K A;  2JC7 A;  3UN7 A;  1IKG A;  4WZ4 A;  1J3W A;  5L07 A;  3N8R A;  3GTC A;  2Y2M A;  1JWZ A;  4ETX A;  1QMF A;  3UB6 A;  4I39 A;  3G2Z A;  3N6I A;  4GJ4 A;  4CLC C;  4PM5 A;  1JTG A;  4KG6 A;  4MBH A;  1D1J A;  3SS3 A;  5JYP A;  1PNE A;  2EFX A;  2V2F F;  3PAG A;  2W1T B;  3MR0 A;  3CPT B;  2C6W B;  1K25 A;  1SZV A;  5I5L A;  4X68 A;  5HDC A;  1PWG A;  4E04 A;  4X56 A;  1XJ3 A;  3UB9 A;  1NLY A;  4UA7 A;  4PKY A;  5AVE A;  3EGX C;  2XRO A;  5HDD A;  2WKR A;  5DF8 A;  2WKI A;  5AQA A;  5AQB A;  2L4R A;  1H5X A;  1VET B;  3V3S A;  3NOU C;  3S7N A;  3ZYT A;  4LV2 A;  1KVM A;  2LB5 A;  4K08 A;  2ZQ8 A;  1SHV A;  4Y2F A;  4NEE D;  5G4Z A;  2PD8 A;  4OQH A;  5GLB A;  3R7W B;  4DXC A;  1MWT A;  3HUO A;  3WWX A;  3VSK A;  4E3K A;  2XA7 M;  4CQH A;  1CF0 A;  1KDS A;  5AQ9 A;  3CWF A;  2EX2 A;  3JPU A;  4KEN B;  1BUE A;  2IWB A;  3D9Y A;  1MC0 A;  3F1P A;  4X53 A;  2XLN A;  4I3A A;  5IU1 A;  5TJJ A;  5AQ7 A;  2VKS A;  1HVB A;  1YLZ A;  4MN5 A; 
#chains in the Genus database with same CATH homology
 4DJ3 A;  4BWI A;  3D72 A;  4MN7 A;  1H8M A;  4F3L A;  2JKT I;  2W1T A;  3VE4 A;  3H82 B;  3NOP C;  3LIE A;  1STZ A;  3LIB A;  3PBO A;  4L9G A;  4LRZ E;  4M4X A;  4BBV A;  5HPI A;  4PAU A;  3MF0 A;  3H9W A;  2V1A A;  3EOI A;  1OTE A;  2JN7 A;  3E4O A;  3T4S A;  2V0U A;  4WL9 A;  3A0V A;  1XFQ A;  2JKR M;  1T1A A;  3DBA A;  3CI6 A;  3GEC A;  4JGP A;  5AVF A;  3MQQ A;  4Q0H A;  1H3Q A;  3CUE A;  3G6O A;  4B9O A;  2MJ6 A;  3CUE C;  2M7V A;  3LI9 A;  1YKD A;  4GHI A;  4EET B;  4OOL A;  4I3J A;  3KX0 X;  2KDK A;  3FPW A;  1ODV A;  5KSH A;  4UQI S;  3T4J A;  5LBR A;  1XJ6 A;  2XA7 S;  3UME A;  1D7E A;  4BBT A;  3A0S A;  1JNU A;  5FL3 A;  5K5B A;  3D3O A;  1TD5 A;  2YKH A;  2JHE A;  3FG8 A;  4NXB A;  4ZRR A;  2VV8 A;  5DFY A;  2Y8H A;  3MXQ A;  5KIZ A;  2W3D A;  3UE6 A;  3TJZ C;  1NRJ A;  4I38 A;  3KYQ A;  2LB9 A;  3MMH A;  2OWJ A;  4HJ4 A;  4WUJ A;  4G3V A;  4NXF A;  4KUK A;  1T18 A;  5DJT A;  1Y28 A;  3T4T A;  2JKT M;  3PBQ A;  3B33 A;  4WLA A;  1LSW A;  4LRX C;  2KLI A;  4JGO A;  2WKQ A;  3BW6 A;  4GLQ A;  3A0R A;  1MZU A;  3JVV A;  4R6L A;  2O0Y A;  2A2L A;  1LSV A;  1TS8 A;  4LLO B;  2GNX A;  3H7W A;  4GS9 A;  4ARZ B;  3H82 A;  5C5K A;  4EQ1 A;  4LPZ A;  3ICY A;  4KQD A;  3EEH A;  3EWK A;  1S1Z A;  3KSF A;  1OTB A;  2OWH A;  3TRC A;  2VV6 A;  4Y5F A;  3LR4 A;  4P6Z M;  2VX8 A;  2W0N A;  2ZOI A;  3S7O A;  3C8C A;  3BQ8 A;  1TS7 A;  3OCL A;  3SW1 A;  2VGL S;  1F98 A;  3KSI A;  1OTA A;  3LR3 A;  4BJP A;  4DN0 A;  4CLC B;  4B93 A;  5EFW A;  3LR0 A;  2W3E A;  2B02 A;  3C38 A;  3LID A;  4JGR A;  4MDZ A;  4MMN A;  2J3T C;  2M1C A;  3VV4 A;  4I5S A;  3LYX A;  2Y79 A;  5HSQ A;  3PBT A;  1N9L A;  4ETZ A;  5J3W A;  1LT0 A;  2INW A;  3OC2 A;  2NUT C;  4R3A A;  3PXP A;  1TS6 A;  2HJ9 C;  3LUQ A;  3MQ0 A;  5DFX A;  5HD3 A;  4AFI A;  3P01 A;  4RQ9 A;  1S4S A;  3CIT A;  1OTI A;  2L1M A;  4BBU A;  3T4L A;  1XJ4 A;  2P08 A;  1T19 A;  1XJ2 A;  2XSS A;  2A24 B;  2OOL A;  2G7U A;  4WN5 A;  2PT7 A;  2O99 A;  3F1O A;  2O9B A;  4KUO A;  1S4R A;  4HQA A;  5HWT A;  1IFQ A;  3ULF A;  5HWW A;  5DKK A;  2OAQ 1;  3PR6 A;  2VA0 A;  3BJN A;  2PYP A;  2GZA A;  3KSH A;  3MJQ A;  1UWN X;  2NUP C;  2FH5 A;  1P0Z A;  2HV1 A;  3R7W A;  1VB6 A;  1MKM A;  4YWZ A;  4HNB A;  2W3F A;  4HJ6 A;  3F1N B;  5TBM B;  1V9Z A;  2H28 A;  3BY8 A;  5HZH A;  3VOL A;  1BYW A;  3F1P B;  1S66 L;  2V1B A;  2DMW A;  4FSF A;  1XFN A;  3LI8 A;  2K31 A;  3IS2 A;  4EES A;  4O8G A;  1UWP X;  1T1C A;  4HH3 A;  4DJ2 A;  3BQA A;  2EWW A;  3K2N A;  4EEU A;  4CLC A;  4KQO A;  3VE3 A;  4Q0I A;  4IHQ A;  3R4K A;  1GSW A;  1OPX A;  1GSX A;  4WEK A;  2M7U A;  4QPR A;  4F3L B;  5CX7 A;  3C2W A;  3V67 A;  3EQV A;  4LRY C;  5J7E A;  4YNR A;  4UEY A;  4XT2 A;  1N9N A;  1V9Y A;  5AJG A;  3MFX A;  5HL6 A;  3RTY A;  4I3I A;  4R38 A;  2K2N A;  1DRM A;  1G28 A;  3FC7 A;  3EQU A;  2VV7 A;  3LIC A;  4CLC E;  4II7 A;  2XRN A;  4H6J B;  1N9O A;  2PR5 A;  3OOV A;  5DJU A;  1ZHH B;  3T4K A;  1S67 L;  1IOU A;  4EER A;  3NOT C;  4EUV A;  2ZOH A;  5F69 A;  1DP9 A;  1WA9 A;  4Q0J A;  4NXE A;  4EEP A;  4O0P A;  3MQO A;  5F68 A;  1OT9 A;  5HWV A;  2L0W A;  2KOI A;  4GHI B;  2P04 A;  2ZMV A;  3KYZ A;  1KOU A;  4Y3I A;  1P9W A;  1DP8 A;  3E4P A;  3UMD A;  3LR5 A;  3NJA A;  4MCW A;  4UQI M;  1G6O A;  5F5Y A;  1ZTU A;  2VEA A;  3UB8 A;  3PBR A;  2KX6 A;  1YSQ A;  1GSV A;  4R70 A;  2V0W A;  3KO6 A;  3ZQ5 A;  2QKP A;  5G4Y A;  1W63 Q;  4G3K A;  4HY8 A;  4WF0 A;  3TE8 A;  2V9A A;  3PHY A;  2P7J A;  2K7S A;  2R78 A;  3K3C A;  1YAX A;  1TS0 A;  3B42 A;  1YSP A;  2W1R A;  3E4Q A;  4IUH A;  3E98 A;  2I9V A;  4WEL A;  5HD5 A;  5F6A A;  2EA9 A;  3P7N A;  3UB7 A;  2FZ0 A;  2HJE A;  4EW7 A;  1T1B A;  3E0Y A;  3FPV A;  1OTD A;  1P97 A;  3OCN A;  3K3D A;  2ZBB A;  5J4E A;  3H7W B;  4GS9 B;  2QWS A;  4O01 A;  2GX5 A;  3EEA A;  3GDI A;  3LFV A;  3OBF A;  4HP9 A;  2Z6D A;  3S7P A;  1VHM A;  4PHT A;  4GW9 A;  4H6J A;  3LIF A;  2QYB A;  4ARZ A;  4HIA A;  4P6Z S;  4HOI A;  1LL8 A;  3HCY A;  1F5M A;  4CLC D;  3JVU A;  2W3G A;  3IBJ A;  1UGU A;  2B18 A;  1X0O A;  2O9C A;  1F9I A;  3T50 A;  4NXG A;  3PBN A;  2ZMF A;  5A8B A;  4L9F A;  4L0L A;  1OJG A;  2VGL M;  4MN6 A;  3U2A A;  1TF1 A;  2J3W A;  3CAX A;  3EGD C;  4G3W A;  4Z1W A;  3BY9 A;  4ME4 A;  4ETX A;  2PD7 A;  3T4O A;  4PKY G;  3UB6 A;  4I39 A;  4HP4 A;  5MC7 A;  1S1Y A;  4GJ4 A;  4CLC C;  2CMN A;  2QJ7 A;  3B47 A;  4JGQ A;  3OLO A;  4OOM A;  2YKF A;  2Z6C A;  2W1T B;  3MR0 A;  4L9E A;  5HDC A;  5I5L A;  4E04 A;  2VLG A;  2O9A A;  4BMW A;  4HH2 A;  2GJ3 A;  3S7Q A;  4IJG A;  4HI4 A;  2BAS A;  2VJW A;  3HJI A;  5HDS A;  1XJ3 A;  3UB9 A;  1NLY A;  2WKP A;  1P9R A;  4PKY A;  5AVE A;  1DP6 A;  3EGX C;  3TW8 A;  2XRO A;  1OT6 A;  2W3H A;  5HDD A;  4YOF A;  2WKR A;  2PYR A;  1NWZ A;  2EWV A;  2L4R A;  3F1O B;  2PDR A;  3NOU C;  3RFB A;  3S7N A;  3ZYT A;  3RH8 B;  2QJ5 A;  4DMZ A;  2HGV A;  2D01 A;  4HJ3 A;  2LB5 A;  5L8M A;  3UE3 A;  2QHK A;  4K08 A;  4NKP A;  4Y2F A;  4NEE D;  2A24 A;  2OAP 1;  5IS1 A;  2W27 A;  5G4Z A;  2PD8 A;  3LIA A;  3R7W B;  1OJ5 A;  1NLZ A;  5IT5 A;  3PBS A;  4FOF A;  4EU0 A;  2J3T D;  2HF6 A;  2JKR I;  2PR6 A;  4IUK A;  3T4Q A;  2D02 A;  3O5Y A;  1W63 M;  2XA7 M;  3HJK A;  4CQH A;  3IBR A;  3CWF A;  2VZW A;  3IS2 B;  3F1N A;  5TBM A;  3NHQ A;  4GCZ A;  2PHY A;  3PYP A;  1MC0 A;  3CLO A;  3F1P A;  4HHD A;  3W2Z A;  2J80 A;  4I3A A;  3BWL A;  4WEJ A;  5IU1 A;  5TJJ A;  4EXO A;  1EW0 A;  1LSX A;  2VKS A;  5HPF A;  3KSG A;  3C30 A;  4XT2 B;  5DF9 A;  5DKL A;  2IA2 A;  1D06 A;  4MN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...