1YAXA

Cystal structure analysis of s.typhimurium phoq sensor domain with calcium
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
153
structure length
153
Chain Sequence
MDKTTFRLLRGESNLFYTLAKWENNKISVELPENLDMQSPTMTLIYDETGKLLWTQRNIPWLIKSIQPEWLKTNGFHEIETNVDATSTLLSEDHSAQEKLKEVREDDDDAEMTHSVAVNIYPATARMPQLTIVVVDTIPIELKRSYMHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal bridges between the PhoQ sensor domain and the membrane regulate transmembrane signaling.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase, signaling protein
molecule keywords Virulence sensor protein phoQ, sensor domain
total genus 30
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.140 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1yaxA00
3BQAA 3BQ8A 4UEYA 1YAXA
chains in the Genus database with same CATH superfamily
2PT7A 1CK3A 2PD7A 2WUQA 3HLWA 2ZC3B 2Z2MB 4DF6A 3F1OA 2H5SA 4UAAA 2KOIA 4R70A 1H8MA 1PI5A 5A93A 3WS0A 5FI2A 1UWPX 1SCWA 2P7JA 2JCHA 3E4QA 2O9BA 2VLGA 1ES5A 3IH8A 3IQAA 2V1ZA 3JYIA 1PZOA 4E3OA 3MJQA 3MZFA 3ZHHA 3IF5A 4DN0A 5FATA 3A3IA 1MKIA 2B5RA 1S66L 5DFYA 4OLGA 3FC7A 5E2GA 5EM1A 4KG6A 4DE0A 5F6AA 1BLPA 2A2LA 3KYQA 1S6RA 2XEPA 3PBRA 5TBMB 5J7EA 1H3QA 4MMNA 1N4OA 3HLGA 4BBVA 3QNCA 4BD0A 1DJAA 1XKZA 4HP4A 5HFOA 4HH3A 5CERA 2Z6CA 4DE3A 1F9IA 2MJ6A 3UB8A 3HLCA 3TOIA 4QB8A 1E25A 2C5WB 4DJ2A 2XK1A 3NBLA 1CF0A 4HIAA 1JVJA 1K56A 1XJ2A 5EV0A 1E3UA 3CLOA 5F1GA 3EQUA 4Y15A 5G4YA 3CHWP 3IXDA 1BSGA 3PXPA 4UA9A 2VK3A 1OTDA 2XFTA 1PYYA 2INWA 4HY8A 1MWSA 2E8JA 5HD5A 3SH7A 1PRQA 2ZM2A 2WKPA 1IKIA 5TBMA 3Q81A 2Q9MA 5DF8A 2B02A 3EGXC 3G35A 4BQMA 2WAFA 3M2JA 3TSGA 2P74A 2VV6A 2ZL1B 1OTBA 2XH9A 3O87A 3VOYA 3GQZA 1DP6A 2PBYA 2Y2GA 2W1TB 1WA9A 3IF6A 3G32A 1YLWA 3LI9A 1VEUA 4LV2A 2VGLM 4HJ6A 3HL9A 2OAQ1 3BJNA 5CEBA 2Y2HA 4IBRA 2PYRA 5F1FA 1S0WA 4QWOA 4MCWA 3JVVA 3LO7A 4ZBEA 3DWZA 1N9NA 2JN7A 2KDKA 3O88A 1BTLA 1GA9A 4YINA 3SS5A 4NG2A 1KE4A 3BYDA 4WUJA 2HP9A 2QJ7A 5JYPA 1DP8A 3UMDA 2O9AA 3CJMA 1IYOA 1L0EA 1K54C 5CGSA 3OZHA 3CITA 1BT5A 4GCZA 1FILA 4MN6A 1QMEA 2HDSA 4Q0HA 4B93A 3TJZC 3WRTA 3SW1A 3KSHA 3Q07A 3ZG9B 3HREA 1G6OA 1CI9A 1K56D 4ETXA 4A5RA 4N1XA 2KX6A 3VE4A 4QHCA 5DTSA 2Y2QA 4OQHA 3HBRA 3PBNA 3LY4A 1ACFA 3IH9A 3RTYA 4JGRA 4KUOA 4F94A 2PBDP 1JTGA 3NOPC 1V9YA 4II7A 3GECA 1W8YA 3IWIA 3FZCA 1W7FA 2XF3A 3LIDA 4EQIA 3LIFA 1OTIA 5GLBA 4WMCD 4GS9B 4XUZA 1LSVA 4OOLA 4OPRA 3T50A 1E4DA 1OPXA 4C3QA 3N7WA 3F1NB 3H7WA 4R38A 1KGEA 3BY9A 3E2LA 3O5YA 2Y8HA 5TGFA 2ZL1A 1FIKA 4X53A 3T4QA 5EUAA 5F5YA 1LI0A 3UDIA 2VV7A 2G7UA 2XA7S 1Q2QA 4DE2A 1O07A 4WLAA 2ZMFA 2DNSA 4YNRA 4B4XA 1XJ6A 1CI8A 1NZUA 5TJJA 3QNBA 2HDRA 3W4PA 4CPKA 2HP5A 1PIOA 2E8IA 3VOZA 1L0DA 4I5SA 5HPIA 3KX0X 4ZTKA 3TW8A 4IVIA 4GDBA 5AQ7A 1J3WA 1BYWA 3VMAA 2QJ5A 3S1YA 3DTEA 2V9AA 3NULA 4HH2A 1GHIA 4I38A 2VGLS 1W63M 4KZ9A 1MY8A 3SS3A 3MMHA 2WZZA 2JKGA 2XROA 2VGKA 3D72A 4GZBA 3C38A 1E3UD 4NXEA 3QP2A 2FH5A 5J8XA 4K0XA 2ZMAA 4H8RA 2K2NA 1LT0A 3PYPA 4QD4A 1ERQA 5HDCA 5CHMA 1L3LA 1H8YA 2JE5A 5DKKA 1I5QA 3GRJA 1TS7A 3MFXA 4ID4A 1IYSA 4E3LA 5CXWA 1P9WA 2Y55A 4O8GA 2Y2KA 3MXRA 1K6SA 2O0YA 4UQIS 4KZ3A 4OPYA 3U2AA 3NDGA 3H7WB 1TS6A 3V67A 5KMWA 3BFFA 3FWLA 4OVDA 2DMWA 3S7QA 3G34A 5FAQA 2EWVA 4UHUA 4R3AA 5HL1A 2R9XA 4X6TA 3BRMA 5HD3A 2EA9A 3BW6A 4S2IA 1T1BA 5MC7A 5HW3A 4WZ5A 2UWXA 2EFXA 3ZDJA 3D4FA 2VKSA 3A3DA 1RGZA 1I2WA 3U4LP 3NECA 4CLCB 2J9OA 2QZ6A 5DFXA 3T4KA 5EPHA 1LI9A 2J7VA 1D06A 1F5MA 3I7JA 1KE0A 4UA7A 1PW1A 4RX3A 4PM9A 1ERMA 3HCYA 1S4SA 4OONA 3O86A 3LR0A 5EVEA 3MQ0A 1BLCA 3K2NA 4GOGA 4KENB 2Y2OA 3ITBA 3ZYTA 4EW7A 3BQ8A 5EM0A 4YOFA 3FG8A 1N9LA 1GSWA 5M18A 1MBLA 3NI9A 3UB7A 2L0WA 4H6JA 5HDDA 5FDHA 2J3TD 1HLUP 4E6WA 2IWCA 3P98A 2X71A 3F1OB 4P85A 3K3DA 1FCMA 2EX6A 4BMWA 4DE1A 4DJ3A 2H28A 3W4QA 3HUOA 1HVBA 1Z6FA 3JVUA 3AGEA 4BWIA 3IXGA 3T4OA 4CLCC 4LFUA 3OCLA 3IX4A 3WRZA 2CC1A 1F98A 1XJ4A 4GW9A 4S2JA 4S2LA 2GZAA 2A24A 3H82B 4HESA 3LEZA 3P09A 3OOVA 4IJGA 5KSHA 2WADA 3ZVWA 4MBFA 3ITAA 5AQBA 4R23A 3UE0A 4PMAA 1VETA 1L2SA 2WKQA 2M7VA 4EEUA 4K91A 3NY4A 4WZ5C 4XT2B 2OV5A 3BY8A 3BECA 3LIBA 4C6YA 4ZAMA 3C8CA 3PAEA 1K4EA 3FKVA 4Q8IA 1PZPA 1T18A 1OT9A 5G4ZA 5EVIC 1NLYA 1K38A 4Y2FA 1YMXA 5U47A 4OOMA 1LHYA 4CLCA 3UY6A 3F1PB 5EVIA 5FASA 5L8MA 2HDUA 3RH8B 3IHBA 2ZMVA 4NXBA 1FR1A 1Y54A 4Z9QA 1NRJA 5DTTA 1TS0A 4RA7A 2WZXA 2A24B 3S7PA 2V2FF 4ZJ1A 5HAPA 2WKEA 4PAUA 2GJ3A 2WGWB 1YLYA 5HWVA 4ZDXA 3IF6B 2EX9A 5E2HA 4H6JB 4LV0A 1XFQA 3E98A 4NXGA 1K54A 3OBFA 2Q0OA 1TDGA 4U0XA 1H8ZA 5F68A 5FA7A 5L09A 2YKHA 1AXBA 1XJ3A 1M6KA 4KQOA 3C4PA 3Q82A 5TFQA 4NEED 2A49A 1ZC2A 4KZ6A 2ZC5B 2Y91A 1I2SA 1LSWA 3CWFA 5FQIA 2NUTC 4DDYA 3UPPA 3WWXA 5A91A 4B4ZA 3UPNA 1BLHA 4JGPA 2W3HA 1ES4A 4KQQA 1HZOA 2HP6A 4E3IA 4KQRA 4MEZA 1J9MA 2W3EA 4DXCA 3M6BA 5DF7A 1K6RA 4HI4A 1TVFA 1CEFA 4LRXC 1OMEA 2CMNA 2OAP1 3DAVA 1ZTUA 1NYMA 3EEHA 5GLAA 4GHIA 4JKTA 4HJ4A 1RCJA 4DKIA 4P6BA 4S2OA 3SZTA 5KZHA 4JF5A 4I3IA 5DF9A 4O7DA 1OJ5A 3NHQA 1W63Q 4GLQA 3O3VA 5FEFA 2V0UA 3FPVA 1FSWA 2OWHA 4WMCA 2V0WA 3A0RA 1MXOA 1K25A 5EVLA 2PR5A 4BL3A 5GLDA 1OT6A 4WM9A 4Y0UA 3LR3A 2EX2A 5F82A 5K5BA 2ZC7A 4HBUA 2Y2LA 3N8SA 4JLFA 2EXAA 1JNUA 2V1BA 3L9KA 4EETB 3DBAA 1SDEA 3GTCA 5HAQA 3DTKA 4EUZA 4Q0JA 2GX5A 2VA0A 3H9WA 3LR4A 5CTNA 1GHMA 1YLPA 4MNRA 2HV1A 3BFGA 5IT5A 1YM1A 3C4OA 4P0MA 3MKFA 5FQQA 2UV0E 4OQGA 1T1AA 3MXQA 4P6ZS 3ZG0A 1VB6A 3LYXA 5G18A 1M40A 1TD5A 3IXBA 2H10A 4RX2A 2Y2NA 3NCKA 3EWKA 4CJNA 1MZUA 4JXSA 5HL6A 3PBTA 2O9CA 4YWZA 2XGNA 3UNWA 4K08A 3E4PA 1WYCA 5HX9A 3IWOA 1ES2A 2XRNA 1XX2A 2WK0A 2PU4A 4X55A 4QJGA 1YSPA 2XDMA 5L2FA 3IF6C 2ZOHA 3CPTB 4QU3A 1PI4A 5HAIA 4KZ4A 4PKYA 4UQIM 2PR6A 4LRYC 4S2NC 2D01A 3DW0A 4FH2A 2J3WA 1ZHHB 4WL9A 5EVIB 3D3OA 3F1PA 2ZC4B 1MPLA 4K0WA 3ZG8B 4R6LA 5JYOA 3S22A 1D7EA 3UB6A 5FAPA 4GS9A 3ZFZA 3NC8A 4EQ1A 1XPBA 2ZQDA 3PHYA 2J80A 5DTKA 5CHJA 3QP4A 1L0GA 3FKWA 3KSGA 1H0MA 4FSFA 1SDNA 2WKHA 2Q9NA 1NLZA 2ZD8A 4MLLA 2FFYA 1Y28A 1N9OA 3GDIA 2DCFA 2V8CA 1JWVA 2NUPC 2BLSA 4YFMA 4JXGA 3WS1A 2IWDA 3IS2B 3MF0A 3OPRA 3SH9A 2B18A 5AVEA 4ME4A 4R3BA 4ETZA 1W79A 5CRFA 3VV4A 4EXOA 4RVAA 4N9LA 3G4PA 2XSSA 4GDNA 1O7EA 2PDRA 2P9VA 3VP3A 2WKRA 5EVID 3GMWA 5CEDA 4JPMA 3G31A 1JWPA 3GSGA 3SOIA 1ONGA 3HJKA 2XFSA 4C75A 4WN5A 3D9YA 2ZQ8A 4OPZA 4IHQA 1RP5A 3GVBA 3S7OA 3A3JA 4XUXA 4HEFA 4EU0A 2ZQ7A 5GL9A 1F2KA 2IWBA 3B42A 5GHYA 3PBQA 2ZQ9A 4OQ0A 4EWFA 2O99A 1SKOB 4PM7A 4LPZA 4OOYA 1LL5A 1XA1A 1H5XA 3ISGA 5FDSA 1KOUA 4WEJA 3Q7ZA 4B9OA 4R1GA 4R4SA 2GDNA 1S67L 3G6OA 3UMEA 4Q0IA 1PFLA 3N6IA 4PHTA 1U60A 2IA2A 4S2MA 2LB9A 3VOLA 3LR5A 5AJGA 4IBXA 3QP6A 2J3TC 5IHVA 1GCEA 3WS2A 4EBPA 4HOIA 3V39A 3V3SA 2XD5A 3B3XA 1Y4OA 3UN7A 4I3AA 4MN5A 3T12B 2I72A 3HLEA 3PBOA 4Y5FA 1RGYA 5FAOA 2VEAA 3N4IA 3V3RA 1FSYA 3EEAA 4KZAA 1G68A 3P7NA 1NZOA 4PPRA 2PYPA 3VP1A 2XR0A 4GKUA 1SZVA 4MBHA 3B33A 3IHAA 4DRTA 5EE8A 3MR0A 3W4OA 3IX3A 3R7WA 4EBNA 4IEDA 4CLCE 5HDSA 3UE6A 4F3LB 3TE8A 3NOTC 1YKDA 3BLMA 2QKPA 2ZM8A 3F1NA 5DJTA 2ZQAA 2K31A 4Y0OA 1VEUB 3HJIA 4GD8A 2Y2JA 3M2KA 3E0YA 4OQIA 3OPLA 3EQVA 1C3BA 4S2KA 4FOFA 3C5AA 5HSQA 5TR7A 4EUVA 5C5KA 2R9WA 2VJWA 3ZVTA 4E04A 1S4RA 4KZBA 4WYYA 4L9GA 5HZHA 4L0LA 1JTDA 1PWGA 3KO6A 3UE1A 3E2KA 3MBZA 2VZWA 1YPRA 4MN7A 1TS8A 5EOEA 3LCEA 3UE3A 4BJPA 4I3JA 3DTMA 3AGDA 5E2EA 3NJAA 2FZ0A 1PNEA 2WYXA 4Y0TA 3R7WB 2OLUA 1T19A 1IEMA 1L0FA 4QY5A 4PM6A 4NK3A 4PM5A 3G30A 3EOIA 4N1HA 2QMIA 4R3JA 4NKPA 3MQQA 1IKGA 5CGXA 4S2PA 3LY3A 4ZJ3A 4PKYG 5AQ9A 4M3KA 4KG5A 1MWRA 3WS4A 3S4XA 2H0TA 3CUEA 2JBFA 1NYYA 4BBTA 1S1ZA 4P87A 2WKIA 3ZQ5A 4HP9A 4JF6A 4LV3A 2WGIA 2W3FA 2P08A 3IT9A 2WGVA 1YSQA 1FCOA 3PAGA 2XQZA 1IOUA 4KZ8A 1YLJA 2OLVA 4R4RA 1PWCA 4HNBA 4X25A 3Q7VA 3L7HA 5E43A 2JKFA 2RL3A 1XXMA 3UPOA 1K55C 5M1AA 3C2WA 2WGWA 3ULFA 4FCFA 4HHDA 3HVFA 3ZGAB 3GR2A 5HWTA 4EEPA 1HTZA 2ZBBA 3RXWA 4OLDA 1KVLA 3T1RA 4P6ZM 3BQAA 2GNXA 3TRCA 4CQHA 1LL8A 5KSCA 2VV8A 3ZG7B 4OP5A 2ZM0A 5EOOA 3FYZA 1YQSA 4RQ9A 2HPBA 3OCNA 3Q1FA 4I39A 3AGFA 2P04A 1BZAA 1ZG4A 3KSFA 4FUWA 4XXRA 1XGJA 2V8FA 2W0NA 4X56A 1KGGA 4OP8A 3HLBA 1PW8A 2QHKA 4RYEA 5EFWA 1ZG6A 3VFFA 1YMSA 3FPWA 3N8RA 4GN2A 1NY0A 2V20A 4KZ5A 3C7UA 3UO9A 3BFCA 3G2YA 2LB5A 4G3KA 4L9EA 4IUHA 5DKLA 2QYBA 1ALQA 5KIZA 1CEGA 2JKTI 1BLSA 5HARA 1OTEA 2W27A 5CHUA 3BFEA 1TEMA 3W8KA 4WF0A 1W5DA 2BTFP 1DRMA 5F69A 3T1XA 3NDEA 4X1MA 2AVXA 2HJEA 3A3EA 3CI6A 1G6AA 3G2ZA 3UDFA 3M6HA 4E3MA 4ARZA 3MZEA 2C6WB 4NXFA 1WE4A 2W3DA 3SH8A 3PTEA 3VSLA 1V9ZA 4LGWA 3OLOA 1IFQA 1ES3A 4BL2A 4L9FA 1P97A 3P01A 4KUKA 4AFIA 2XA7M 2Y4AA 2PAVP 1BULA 4HQAA 3E4OA 1IYPA 2Z2LB 1KGFA 1X0OA 3LUQA 3CG5A 5CTMA 3T1QB 4HJ3A 5M19A 3T4JA 5AQAA 1KDSA 4EERA 4XT2A 4OH0A 4ESPA 5FQJA 4G3WA 3BFDA 3UB9A 4GNUA 2YKFA 2X02A 3VP0A 4KG2A 2I9VA 3A0SA 1SKOA 1OJGA 2EFUA 4BLMA 3RFBA 3HUMA 3GV9A 3MZDA 4HBTA 1P0ZA 2HGVA 1JWZA 1QMFA 3VFHA 2QPNA 2G2WA 3MS6A 1PWDA 3BWLA 3CZDA 4G3VA 2Z6DA 2ACGA 1FQGA 4Y17A 5IU1A 1STZA 2K7SA 2J9PA 2PHYA 2OOLA 4WEKA 1ESIA 4EESA 4IUKA 1DJBA 1GA0A 1GHPA 5DJUA 4OPQA 5E2FA 3RXXA 4LCMA 4Y3IA 1YT4A 5FI7A 3FV7A 2JHEA 5FQKA 2HF6A 4EBLA 1S1YA 3BLSA 1CQAA 1XP4A 5FI6A 3BEBA 4O0PA 5J3WA 1K57C 4MDZA 4ZRRA 5AVFA 4LENA 4O01A 3SS4A 1N9BA 3MKEA 1VHMA 2JKTM 5D3OA 4M4XA 1EROA 3ZNTA 1KE3A 4N92A 5LBRA 4E3JA 4WBGA 1FR6A 5F83A 4OKPA 4KZ7A 3VP2A 3IBRA 3ZNYA 3VSKA 5HPFA 2Y2MA 3K3CA 4D2OA 3DTIA 4ZJ2A 1UWNX 4F3LA 5A90A 1NXYA 2Y79A 5A92A 2VGJA 1VETB 3LI8A 2VX8A 2BASA 3NIAA 1EWZA 1NJ4A 1LLBA 2PRFA 1OTAA 5FQMA 1D1JA 1ONHA 4CLCD 3RJUA 4E3NA 5FEGA 4E6XA 2XD1A 5BOHA 3MQOA 3NOUC 2ZQCA 4QY6A 4X1LA 3T4LA 1ODVA 1G5UA 1K55A 4MBKA 3IS2A 2A3UA 5FSRA 1LSXA 2Y59A 5CX7A 3C30A 5GHZA 1YLTA 3V5MA 3IXHA 4GJ4A 4JXVA 2OWJA 5IS1A 3OPHA 4JGOA 1K0KA 1K4FA 5GHXA 2P9VB 2PD8A 5CGWA 4UEYA 2EX8A 3DWKA 4FH4A 5A8BA 4KQDA 1FOFA 3LIEA 2Y2PA 1VQQA 2G2UA 2D02A 4FTXA 2BG1A 4GD6A 1WYBA 5L07A 3CUEC 3QP5A 5I94A 1XA7A 3ICYA 1IYQA 1EW0A 4DDSA 4JF4A 2ZLYA 5I5LA 3OPPA 2JKRM 4JGQA 3T4SA 5L10A 3T1SA 3A3FA 1MWUA 2DRWA 3N8LA 2HZ5A 5EECA 2J8YA 2W3GA 1MWTA 2JC7A 3VP4A 2L1MA 4IVKA 3BM6A 2JKRI 3T4TA 3MSHA 1LL9A 1ESUA 2R78A 3QHYA 3EGDC 3KYEA 4U0TA 1AWIA 1XFNA 4PM8A 4WELA 1VM1A 2V1AA 3HLDA 3LEQA 3LIAA 5GLCA 3OC2A 1DP9A 1HD8A 2EXBA 2W1TA 4UA6A 1KVMA 4LLOB 1GSVA 2ZC6B 4B88A 2L4RA 1A0KA 3TG9A 2M1CA 2W1RA 4NETA 1MC0A 4GHIB 2ZJ9A 3V50A 1XGIA 4N9KA 1SKFA 3B47A 3S7NA 3QP8A 1TF1A 1BUEA 1P9RA 1KDWA 5HWWA 3CPTA 3ZCZA 2KLIA 4Y7PA 1CJFA 3MFDA 2HDQA 1DJCA 2PU2A 3KYZA 3C7VA 4BD1A 2WAEA 1YAXA 2EWWA 3HUNA 3MXSA 4U3TA 3UDXA 3CAXA 1TDLA 2X01A 3Q7VB 3H82A 2H0YA 3WS5A 4QPRA 2RCXA 4X68A 1MKMA 3W2ZA 4JBFA 2HJ9C 1W8QA 2FFFB 2XLNA 1IELA 3LFVA 3UB5P 1GSXA 4Y13A 1UGUA 3HLFA 2OSUA 3VE3A 5DVAA 4D60A 3IBJA 3R4KA 3KSIA 4Z1WA 2M7UA 4R0QA 1DY6A 1G28A 3CMZA 3QP1A 1T1CA 3ZG5A 4JXWA 3IWQA 5FQ9A 2QWSA 4GB7A 4X69A 4BBUA 4DXBA 1FCNA 2Y2IA 4S2NA 4WZ4A 1NRFA 1EI5A 3LICA 2ZOIA 4ARZB 3PBSA 1K57A 3JPUA 4LCLA 3LGOA 1Z09A 4FD8A 1NWZA 4LV1A 5FL3A 3A0VA 5J4EA 4BENA 4EV4A 1Q2PA 2B95A 4DMZA 5CECA 1ZKJA 4LRZE 3IX8A 3PR6A 1SHVA 1YLZA 4E3KA
chains in the Genus database with same CATH topology
1NLZA 2PT7A 4ARZA 1Y28A 2PD7A 4NXFA 1N9OA 3GDIA 2W3DA 3HCYA 1S4SA 2NUPC 3F1OA 3LR0A 3MQ0A 1V9ZA 3K2NA 2KOIA 3OLOA 4R70A 1IFQA 1H8MA 4L9FA 1P97A 3P01A 3IS2B 1UWPX 2P7JA 4KUKA 3ZYTA 4AFIA 2XA7M 3E4QA 4EW7A 2O9BA 2VLGA 3MF0A 3BQ8A 4YOFA 4HQAA 3FG8A 1N9LA 1GSWA 3E4OA 2B18A 5AVEA 4ME4A 3LUQA 1X0OA 3UB7A 4ETZA 2L0WA 4H6JA 3MJQA 5HDDA 3VV4A 4HJ3A 2J3TD 4EXOA 3T4JA 4DN0A 3F1OB 2XSSA 4EERA 4XT2A 1S66L 5DFYA 2PDRA 3FC7A 4G3WA 3K3DA 5F6AA 3UB9A 2WKRA 4BMWA 2A2LA 3KYQA 3PBRA 5TBMB 4DJ3A 2YKFA 2H28A 5J7EA 1H3QA 4MMNA 2I9VA 3A0SA 3JVUA 1OJGA 4BBVA 4BWIA 3T4OA 4CLCC 4HP4A 3RFBA 3OCLA 4HH3A 1P0ZA 3HJKA 2HGVA 4WN5A 2Z6CA 1F9IA 1F98A 2MJ6A 4IHQA 3UB8A 1XJ4A 3BWLA 4GW9A 4G3VA 3S7OA 2Z6DA 4DJ2A 2GZAA 2A24A 4EU0A 5IU1A 1STZA 2K7SA 2PHYA 2OOLA 4HIAA 4WEKA 3H82B 4EESA 4IUKA 3OOVA 3B42A 4IJGA 5KSHA 3PBQA 1XJ2A 5DJUA 2O99A 3CLOA 4LPZA 3EQUA 4Y3IA 2WKQA 2M7VA 2JHEA 4EEUA 2HF6A 1S1YA 5G4YA 1KOUA 4XT2B 4WEJA 4O0PA 4B9OA 3BY8A 5J3WA 3LIBA 4MDZA 4ZRRA 3PXPA 1S67L 5AVFA 3C8CA 3G6OA 4O01A 3UMEA 1T18A 1OTDA 1VHMA 2JKTM 4Q0IA 1OT9A 2INWA 5G4ZA 4HY8A 1NLYA 5HD5A 4Y2FA 2WKPA 4PHTA 5TBMA 2IA2A 4M4XA 2LB9A 4OOMA 3VOLA 2B02A 3EGXC 4CLCA 3LR5A 5AJGA 3F1PB 5LBRA 2VV6A 2J3TC 5L8MA 1OTBA 1DP6A 2W1TB 1WA9A 3RH8B 2ZMVA 4NXBA 4HOIA 3IBRA 3LI9A 5HPFA 4I3AA 2VGLM 4HJ6A 1NRJA 4MN5A 3K3CA 2OAQ1 3BJNA 1TS0A 1UWNX 4F3LA 2A24B 3S7PA 2Y79A 3PBOA 4Y5FA 2PYRA 4PAUA 2VEAA 2GJ3A 3LI8A 2VX8A 2BASA 4MCWA 3JVVA 5HWVA 3EEAA 1N9NA 2JN7A 3P7NA 2KDKA 2PYPA 4H6JB 1OTAA 2QJ7A 1XFQA 3B33A 4WUJA 3E98A 4NXGA 4CLCD 3OBFA 1DP8A 3MR0A 2O9AA 5F68A 3UMDA 3R7WA 3MQOA 3NOUC 4CLCE 3CITA 5HDSA 3T4LA 1ODVA 4GCZA 3UE6A 4F3LB 4MN6A 3NOTC 1YKDA 2YKHA 3TE8A 1XJ3A 4KQOA 2QKPA 3IS2A 4NEED 1LSXA 3F1NA 5CX7A 3C30A 5DJTA 4Q0HA 4B93A 2K31A 3TJZC 3SW1A 3KSHA 4GJ4A 3HJIA 1LSWA 2OWJA 5IS1A 1G6OA 3CWFA 3E0YA 4JGOA 2NUTC 4ETXA 3EQVA 4JGPA 2W3HA 2KX6A 2PD8A 4UEYA 3VE4A 4FOFA 5HSQA 5A8BA 4KQDA 3LIEA 4EUVA 5C5KA 3PBNA 2W3EA 2VJWA 3RTYA 2D02A 4JGRA 4KUOA 4E04A 1S4RA 3CUEC 4L9GA 5HZHA 3NOPC 4L0LA 1V9YA 3ICYA 3GECA 4II7A 4HI4A 1EW0A 3KO6A 4LRXC 2VZWA 2CMNA 2OAP1 5I5LA 4MN7A 1ZTUA 1TS8A 3LIDA 3UE3A 3EEHA 4BJPA 3LIFA 4I3JA 2JKRM 1OTIA 4JGQA 4GHIA 3T4SA 4GS9B 1LSVA 4HJ4A 4OOLA 3T50A 3NJAA 2FZ0A 3R7WB 1T19A 1OPXA 3F1NB 3H7WA 2W3GA 4I3IA 5DF9A 4R38A 1OJ5A 3NHQA 3BY9A 2L1MA 1W63Q 4GLQA 3O5YA 2Y8HA 2JKRI 2V0UA 3FPVA 2OWHA 3EOIA 3T4QA 2V0WA 5F5YA 3A0RA 3T4TA 2VV7A 2G7UA 2XA7S 4NKPA 3MQQA 2R78A 3EGDC 1XFNA 4PKYG 2PR5A 4WLAA 4WELA 2ZMFA 4YNRA 1OT6A 1XJ6A 2V1AA 3LIAA 5TJJA 3LR3A 3CUEA 3OC2A 1DP9A 5K5BA 4BBTA 1S1ZA 2W1TA 3ZQ5A 4HP9A 4LLOB 1GSVA 1JNUA 2V1BA 4I5SA 2L4RA 2W3FA 3DBAA 2P08A 4EETB 2M1CA 5HPIA 3KX0X 2W1RA 1MC0A 1YSQA 3TW8A 4GHIB 4Q0JA 2GX5A 1IOUA 2VA0A 1BYWA 3B47A 2QJ5A 3S7NA 1TF1A 3H9WA 1P9RA 3LR4A 4HNBA 5HWWA 2HV1A 2V9AA 2KLIA 4HH2A 5IT5A 3C2WA 4I38A 2VGLS 1W63M 3ULFA 3MMHA 1T1AA 3KYZA 3MXQA 4P6ZS 4HHDA 1VB6A 3LYXA 2XROA 5HWTA 1YAXA 2EWWA 4EEPA 3D72A 3C38A 2ZBBA 4NXEA 3CAXA 1TD5A 4P6ZM 3BQAA 2GNXA 3TRCA 4CQHA 1LL8A 2FH5A 3H82A 2VV8A 2K2NA 1LT0A 3PYPA 4QPRA 3EWKA 5HDCA 1MKMA 1MZUA 4RQ9A 5HL6A 3W2ZA 3PBTA 3OCNA 2O9CA 4I39A 4YWZA 5DKKA 2HJ9C 2P04A 4K08A 3E4PA 1TS7A 2XRNA 3MFXA 3LFVA 3KSFA 1GSXA 1UGUA 2W0NA 3VE3A 1P9WA 1YSPA 4O8GA 3IBJA 2O0YA 4UQIS 3R4KA 2ZOHA 2QHKA 3KSIA 5EFWA 4Z1WA 2M7UA 3U2AA 3FPWA 1G28A 1T1CA 2QWSA 4PKYA 3H7WB 2PR6A 4LRYC 4UQIM 4BBUA 2D01A 1TS6A 3V67A 2J3WA 1ZHHB 2LB5A 4WL9A 4G3KA 2DMWA 3S7QA 4L9EA 4IUHA 5DKLA 2QYBA 3LICA 2ZOIA 2EWVA 3D3OA 3F1PA 3PBSA 4ARZB 5KIZA 4R3AA 2JKTI 5HD3A 4R6LA 2EA9A 3BW6A 1OTEA 1T1BA 2W27A 1D7EA 4WF0A 3UB6A 5MC7A 1NWZA 4GS9A 5FL3A 3A0VA 2VKSA 5J4EA 1DRMA 4EQ1A 3PHYA 4CLCB 2J80A 5DFXA 5F69A 3T4KA 4DMZA 1D06A 2HJEA 4LRZE 3CI6A 1F5MA 3PR6A 3KSGA 4FSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BQA A;  3BQ8 A;  4UEY A;  1YAX A; 
#chains in the Genus database with same CATH topology
 2PT7 A;  1CK3 A;  2PD7 A;  2WUQ A;  3HLW A;  2ZC3 B;  2Z2M B;  4DF6 A;  3F1O A;  2H5S A;  4UAA A;  2KOI A;  4R70 A;  1H8M A;  1PI5 A;  5A93 A;  3WS0 A;  5FI2 A;  1UWP X;  1SCW A;  2P7J A;  2JCH A;  3E4Q A;  2O9B A;  2VLG A;  1ES5 A;  3IH8 A;  3IQA A;  2V1Z A;  3JYI A;  1PZO A;  4E3O A;  3MJQ A;  3MZF A;  3ZHH A;  3IF5 A;  4DN0 A;  5FAT A;  3A3I A;  1MKI A;  2B5R A;  1S66 L;  5DFY A;  4OLG A;  3FC7 A;  5E2G A;  5EM1 A;  4KG6 A;  4DE0 A;  5F6A A;  1BLP A;  2A2L A;  3KYQ A;  1S6R A;  2XEP A;  3PBR A;  5TBM B;  5J7E A;  1H3Q A;  4MMN A;  1N4O A;  3HLG A;  4BBV A;  3QNC A;  4BD0 A;  1DJA A;  1XKZ A;  4HP4 A;  5HFO A;  4HH3 A;  5CER A;  2Z6C A;  4DE3 A;  1F9I A;  2MJ6 A;  3UB8 A;  3HLC A;  3TOI A;  4QB8 A;  1E25 A;  2C5W B;  4DJ2 A;  2XK1 A;  3NBL A;  1CF0 A;  4HIA A;  1JVJ A;  1K56 A;  1XJ2 A;  5EV0 A;  1E3U A;  3CLO A;  5F1G A;  3EQU A;  4Y15 A;  5G4Y A;  3CHW P;  3IXD A;  1BSG A;  3PXP A;  4UA9 A;  2VK3 A;  1OTD A;  2XFT A;  1PYY A;  2INW A;  4HY8 A;  1MWS A;  2E8J A;  5HD5 A;  3SH7 A;  1PRQ A;  2ZM2 A;  2WKP A;  1IKI A;  5TBM A;  3Q81 A;  2Q9M A;  5DF8 A;  2B02 A;  3EGX C;  3G35 A;  4BQM A;  2WAF A;  3M2J A;  3TSG A;  2P74 A;  2VV6 A;  2ZL1 B;  1OTB A;  2XH9 A;  3O87 A;  3VOY A;  3GQZ A;  1DP6 A;  2PBY A;  2Y2G A;  2W1T B;  1WA9 A;  3IF6 A;  3G32 A;  1YLW A;  3LI9 A;  1VEU A;  4LV2 A;  2VGL M;  4HJ6 A;  3HL9 A;  2OAQ 1;  3BJN A;  5CEB A;  2Y2H A;  4IBR A;  2PYR A;  5F1F A;  1S0W A;  4QWO A;  4MCW A;  3JVV A;  3LO7 A;  4ZBE A;  3DWZ A;  1N9N A;  2JN7 A;  2KDK A;  3O88 A;  1BTL A;  1GA9 A;  4YIN A;  3SS5 A;  4NG2 A;  1KE4 A;  3BYD A;  4WUJ A;  2HP9 A;  2QJ7 A;  5JYP A;  1DP8 A;  3UMD A;  2O9A A;  3CJM A;  1IYO A;  1L0E A;  1K54 C;  5CGS A;  3OZH A;  3CIT A;  1BT5 A;  4GCZ A;  1FIL A;  4MN6 A;  1QME A;  2HDS A;  4Q0H A;  4B93 A;  3TJZ C;  3WRT A;  3SW1 A;  3KSH A;  3Q07 A;  3ZG9 B;  3HRE A;  1G6O A;  1CI9 A;  1K56 D;  4ETX A;  4A5R A;  4N1X A;  2KX6 A;  3VE4 A;  4QHC A;  5DTS A;  2Y2Q A;  4OQH A;  3HBR A;  3PBN A;  3LY4 A;  1ACF A;  3IH9 A;  3RTY A;  4JGR A;  4KUO A;  4F94 A;  2PBD P;  1JTG A;  3NOP C;  1V9Y A;  4II7 A;  3GEC A;  1W8Y A;  3IWI A;  3FZC A;  1W7F A;  2XF3 A;  3LID A;  4EQI A;  3LIF A;  1OTI A;  5GLB A;  4WMC D;  4GS9 B;  4XUZ A;  1LSV A;  4OOL A;  4OPR A;  3T50 A;  1E4D A;  1OPX A;  4C3Q A;  3N7W A;  3F1N B;  3H7W A;  4R38 A;  1KGE A;  3BY9 A;  3E2L A;  3O5Y A;  2Y8H A;  5TGF A;  2ZL1 A;  1FIK A;  4X53 A;  3T4Q A;  5EUA A;  5F5Y A;  1LI0 A;  3UDI A;  2VV7 A;  2G7U A;  2XA7 S;  1Q2Q A;  4DE2 A;  1O07 A;  4WLA A;  2ZMF A;  2DNS A;  4YNR A;  4B4X A;  1XJ6 A;  1CI8 A;  1NZU A;  5TJJ A;  3QNB A;  2HDR A;  3W4P A;  4CPK A;  2HP5 A;  1PIO A;  2E8I A;  3VOZ A;  1L0D A;  4I5S A;  5HPI A;  3KX0 X;  4ZTK A;  3TW8 A;  4IVI A;  4GDB A;  5AQ7 A;  1J3W A;  1BYW A;  3VMA A;  2QJ5 A;  3S1Y A;  3DTE A;  2V9A A;  3NUL A;  4HH2 A;  1GHI A;  4I38 A;  2VGL S;  1W63 M;  4KZ9 A;  1MY8 A;  3SS3 A;  3MMH A;  2WZZ A;  2JKG A;  2XRO A;  2VGK A;  3D72 A;  4GZB A;  3C38 A;  1E3U D;  4NXE A;  3QP2 A;  2FH5 A;  5J8X A;  4K0X A;  2ZMA A;  4H8R A;  2K2N A;  1LT0 A;  3PYP A;  4QD4 A;  1ERQ A;  5HDC A;  5CHM A;  1L3L A;  1H8Y A;  2JE5 A;  5DKK A;  1I5Q A;  3GRJ A;  1TS7 A;  3MFX A;  4ID4 A;  1IYS A;  4E3L A;  5CXW A;  1P9W A;  2Y55 A;  4O8G A;  2Y2K A;  3MXR A;  1K6S A;  2O0Y A;  4UQI S;  4KZ3 A;  4OPY A;  3U2A A;  3NDG A;  3H7W B;  1TS6 A;  3V67 A;  5KMW A;  3BFF A;  3FWL A;  4OVD A;  2DMW A;  3S7Q A;  3G34 A;  5FAQ A;  2EWV A;  4UHU A;  4R3A A;  5HL1 A;  2R9X A;  4X6T A;  3BRM A;  5HD3 A;  2EA9 A;  3BW6 A;  4S2I A;  1T1B A;  5MC7 A;  5HW3 A;  4WZ5 A;  2UWX A;  2EFX A;  3ZDJ A;  3D4F A;  2VKS A;  3A3D A;  1RGZ A;  1I2W A;  3U4L P;  3NEC A;  4CLC B;  2J9O A;  2QZ6 A;  5DFX A;  3T4K A;  5EPH A;  1LI9 A;  2J7V A;  1D06 A;  1F5M A;  3I7J A;  1KE0 A;  4UA7 A;  1PW1 A;  4RX3 A;  4PM9 A;  1ERM A;  3HCY A;  1S4S A;  4OON A;  3O86 A;  3LR0 A;  5EVE A;  3MQ0 A;  1BLC A;  3K2N A;  4GOG A;  4KEN B;  2Y2O A;  3ITB A;  3ZYT A;  4EW7 A;  3BQ8 A;  5EM0 A;  4YOF A;  3FG8 A;  1N9L A;  1GSW A;  5M18 A;  1MBL A;  3NI9 A;  3UB7 A;  2L0W A;  4H6J A;  5HDD A;  5FDH A;  2J3T D;  1HLU P;  4E6W A;  2IWC A;  3P98 A;  2X71 A;  3F1O B;  4P85 A;  3K3D A;  1FCM A;  2EX6 A;  4BMW A;  4DE1 A;  4DJ3 A;  2H28 A;  3W4Q A;  3HUO A;  1HVB A;  1Z6F A;  3JVU A;  3AGE A;  4BWI A;  3IXG A;  3T4O A;  4CLC C;  4LFU A;  3OCL A;  3IX4 A;  3WRZ A;  2CC1 A;  1F98 A;  1XJ4 A;  4GW9 A;  4S2J A;  4S2L A;  2GZA A;  2A24 A;  3H82 B;  4HES A;  3LEZ A;  3P09 A;  3OOV A;  4IJG A;  5KSH A;  2WAD A;  3ZVW A;  4MBF A;  3ITA A;  5AQB A;  4R23 A;  3UE0 A;  4PMA A;  1VET A;  1L2S A;  2WKQ A;  2M7V A;  4EEU A;  4K91 A;  3NY4 A;  4WZ5 C;  4XT2 B;  2OV5 A;  3BY8 A;  3BEC A;  3LIB A;  4C6Y A;  4ZAM A;  3C8C A;  3PAE A;  1K4E A;  3FKV A;  4Q8I A;  1PZP A;  1T18 A;  1OT9 A;  5G4Z A;  5EVI C;  1NLY A;  1K38 A;  4Y2F A;  1YMX A;  5U47 A;  4OOM A;  1LHY A;  4CLC A;  3UY6 A;  3F1P B;  5EVI A;  5FAS A;  5L8M A;  2HDU A;  3RH8 B;  3IHB A;  2ZMV A;  4NXB A;  1FR1 A;  1Y54 A;  4Z9Q A;  1NRJ A;  5DTT A;  1TS0 A;  4RA7 A;  2WZX A;  2A24 B;  3S7P A;  2V2F F;  4ZJ1 A;  5HAP A;  2WKE A;  4PAU A;  2GJ3 A;  2WGW B;  1YLY A;  5HWV A;  4ZDX A;  3IF6 B;  2EX9 A;  5E2H A;  4H6J B;  4LV0 A;  1XFQ A;  3E98 A;  4NXG A;  1K54 A;  3OBF A;  2Q0O A;  1TDG A;  4U0X A;  1H8Z A;  5F68 A;  5FA7 A;  5L09 A;  2YKH A;  1AXB A;  1XJ3 A;  1M6K A;  4KQO A;  3C4P A;  3Q82 A;  5TFQ A;  4NEE D;  2A49 A;  1ZC2 A;  4KZ6 A;  2ZC5 B;  2Y91 A;  1I2S A;  1LSW A;  3CWF A;  5FQI A;  2NUT C;  4DDY A;  3UPP A;  3WWX A;  5A91 A;  4B4Z A;  3UPN A;  1BLH A;  4JGP A;  2W3H A;  1ES4 A;  4KQQ A;  1HZO A;  2HP6 A;  4E3I A;  4KQR A;  4MEZ A;  1J9M A;  2W3E A;  4DXC A;  3M6B A;  5DF7 A;  1K6R A;  4HI4 A;  1TVF A;  1CEF A;  4LRX C;  1OME A;  2CMN A;  2OAP 1;  3DAV A;  1ZTU A;  1NYM A;  3EEH A;  5GLA A;  4GHI A;  4JKT A;  4HJ4 A;  1RCJ A;  4DKI A;  4P6B A;  4S2O A;  3SZT A;  5KZH A;  4JF5 A;  4I3I A;  5DF9 A;  4O7D A;  1OJ5 A;  3NHQ A;  1W63 Q;  4GLQ A;  3O3V A;  5FEF A;  2V0U A;  3FPV A;  1FSW A;  2OWH A;  4WMC A;  2V0W A;  3A0R A;  1MXO A;  1K25 A;  5EVL A;  2PR5 A;  4BL3 A;  5GLD A;  1OT6 A;  4WM9 A;  4Y0U A;  3LR3 A;  2EX2 A;  5F82 A;  5K5B A;  2ZC7 A;  4HBU A;  2Y2L A;  3N8S A;  4JLF A;  2EXA A;  1JNU A;  2V1B A;  3L9K A;  4EET B;  3DBA A;  1SDE A;  3GTC A;  5HAQ A;  3DTK A;  4EUZ A;  4Q0J A;  2GX5 A;  2VA0 A;  3H9W A;  3LR4 A;  5CTN A;  1GHM A;  1YLP A;  4MNR A;  2HV1 A;  3BFG A;  5IT5 A;  1YM1 A;  3C4O A;  4P0M A;  3MKF A;  5FQQ A;  2UV0 E;  4OQG A;  1T1A A;  3MXQ A;  4P6Z S;  3ZG0 A;  1VB6 A;  3LYX A;  5G18 A;  1M40 A;  1TD5 A;  3IXB A;  2H10 A;  4RX2 A;  2Y2N A;  3NCK A;  3EWK A;  4CJN A;  1MZU A;  4JXS A;  5HL6 A;  3PBT A;  2O9C A;  4YWZ A;  2XGN A;  3UNW A;  4K08 A;  3E4P A;  1WYC A;  5HX9 A;  3IWO A;  1ES2 A;  2XRN A;  1XX2 A;  2WK0 A;  2PU4 A;  4X55 A;  4QJG A;  1YSP A;  2XDM A;  5L2F A;  3IF6 C;  2ZOH A;  3CPT B;  4QU3 A;  1PI4 A;  5HAI A;  4KZ4 A;  4PKY A;  4UQI M;  2PR6 A;  4LRY C;  4S2N C;  2D01 A;  3DW0 A;  4FH2 A;  2J3W A;  1ZHH B;  4WL9 A;  5EVI B;  3D3O A;  3F1P A;  2ZC4 B;  1MPL A;  4K0W A;  3ZG8 B;  4R6L A;  5JYO A;  3S22 A;  1D7E A;  3UB6 A;  5FAP A;  4GS9 A;  3ZFZ A;  3NC8 A;  4EQ1 A;  1XPB A;  2ZQD A;  3PHY A;  2J80 A;  5DTK A;  5CHJ A;  3QP4 A;  1L0G A;  3FKW A;  3KSG A;  1H0M A;  4FSF A;  1SDN A;  2WKH A;  2Q9N A;  1NLZ A;  2ZD8 A;  4MLL A;  2FFY A;  1Y28 A;  1N9O A;  3GDI A;  2DCF A;  2V8C A;  1JWV A;  2NUP C;  2BLS A;  4YFM A;  4JXG A;  3WS1 A;  2IWD A;  3IS2 B;  3MF0 A;  3OPR A;  3SH9 A;  2B18 A;  5AVE A;  4ME4 A;  4R3B A;  4ETZ A;  1W79 A;  5CRF A;  3VV4 A;  4EXO A;  4RVA A;  4N9L A;  3G4P A;  2XSS A;  4GDN A;  1O7E A;  2PDR A;  2P9V A;  3VP3 A;  2WKR A;  5EVI D;  3GMW A;  5CED A;  4JPM A;  3G31 A;  1JWP A;  3GSG A;  3SOI A;  1ONG A;  3HJK A;  2XFS A;  4C75 A;  4WN5 A;  3D9Y A;  2ZQ8 A;  4OPZ A;  4IHQ A;  1RP5 A;  3GVB A;  3S7O A;  3A3J A;  4XUX A;  4HEF A;  4EU0 A;  2ZQ7 A;  5GL9 A;  1F2K A;  2IWB A;  3B42 A;  5GHY A;  3PBQ A;  2ZQ9 A;  4OQ0 A;  4EWF A;  2O99 A;  1SKO B;  4PM7 A;  4LPZ A;  4OOY A;  1LL5 A;  1XA1 A;  1H5X A;  3ISG A;  5FDS A;  1KOU A;  4WEJ A;  3Q7Z A;  4B9O A;  4R1G A;  4R4S A;  2GDN A;  1S67 L;  3G6O A;  3UME A;  4Q0I A;  1PFL A;  3N6I A;  4PHT A;  1U60 A;  2IA2 A;  4S2M A;  2LB9 A;  3VOL A;  3LR5 A;  5AJG A;  4IBX A;  3QP6 A;  2J3T C;  5IHV A;  1GCE A;  3WS2 A;  4EBP A;  4HOI A;  3V39 A;  3V3S A;  2XD5 A;  3B3X A;  1Y4O A;  3UN7 A;  4I3A A;  4MN5 A;  3T12 B;  2I72 A;  3HLE A;  3PBO A;  4Y5F A;  1RGY A;  5FAO A;  2VEA A;  3N4I A;  3V3R A;  1FSY A;  3EEA A;  4KZA A;  1G68 A;  3P7N A;  1NZO A;  4PPR A;  2PYP A;  3VP1 A;  2XR0 A;  4GKU A;  1SZV A;  4MBH A;  3B33 A;  3IHA A;  4DRT A;  5EE8 A;  3MR0 A;  3W4O A;  3IX3 A;  3R7W A;  4EBN A;  4IED A;  4CLC E;  5HDS A;  3UE6 A;  4F3L B;  3TE8 A;  3NOT C;  1YKD A;  3BLM A;  2QKP A;  2ZM8 A;  3F1N A;  5DJT A;  2ZQA A;  2K31 A;  4Y0O A;  1VEU B;  3HJI A;  4GD8 A;  2Y2J A;  3M2K A;  3E0Y A;  4OQI A;  3OPL A;  3EQV A;  1C3B A;  4S2K A;  4FOF A;  3C5A A;  5HSQ A;  5TR7 A;  4EUV A;  5C5K A;  2R9W A;  2VJW A;  3ZVT A;  4E04 A;  1S4R A;  4KZB A;  4WYY A;  4L9G A;  5HZH A;  4L0L A;  1JTD A;  1PWG A;  3KO6 A;  3UE1 A;  3E2K A;  3MBZ A;  2VZW A;  1YPR A;  4MN7 A;  1TS8 A;  5EOE A;  3LCE A;  3UE3 A;  4BJP A;  4I3J A;  3DTM A;  3AGD A;  5E2E A;  3NJA A;  2FZ0 A;  1PNE A;  2WYX A;  4Y0T A;  3R7W B;  2OLU A;  1T19 A;  1IEM A;  1L0F A;  4QY5 A;  4PM6 A;  4NK3 A;  4PM5 A;  3G30 A;  3EOI A;  4N1H A;  2QMI A;  4R3J A;  4NKP A;  3MQQ A;  1IKG A;  5CGX A;  4S2P A;  3LY3 A;  4ZJ3 A;  4PKY G;  5AQ9 A;  4M3K A;  4KG5 A;  1MWR A;  3WS4 A;  3S4X A;  2H0T A;  3CUE A;  2JBF A;  1NYY A;  4BBT A;  1S1Z A;  4P87 A;  2WKI A;  3ZQ5 A;  4HP9 A;  4JF6 A;  4LV3 A;  2WGI A;  2W3F A;  2P08 A;  3IT9 A;  2WGV A;  1YSQ A;  1FCO A;  3PAG A;  2XQZ A;  1IOU A;  4KZ8 A;  1YLJ A;  2OLV A;  4R4R A;  1PWC A;  4HNB A;  4X25 A;  3Q7V A;  3L7H A;  5E43 A;  2JKF A;  2RL3 A;  1XXM A;  3UPO A;  1K55 C;  5M1A A;  3C2W A;  2WGW A;  3ULF A;  4FCF A;  4HHD A;  3HVF A;  3ZGA B;  3GR2 A;  5HWT A;  4EEP A;  1HTZ A;  2ZBB A;  3RXW A;  4OLD A;  1KVL A;  3T1R A;  4P6Z M;  3BQA A;  2GNX A;  3TRC A;  4CQH A;  1LL8 A;  5KSC A;  2VV8 A;  3ZG7 B;  4OP5 A;  2ZM0 A;  5EOO A;  3FYZ A;  1YQS A;  4RQ9 A;  2HPB A;  3OCN A;  3Q1F A;  4I39 A;  3AGF A;  2P04 A;  1BZA A;  1ZG4 A;  3KSF A;  4FUW A;  4XXR A;  1XGJ A;  2V8F A;  2W0N A;  4X56 A;  1KGG A;  4OP8 A;  3HLB A;  1PW8 A;  2QHK A;  4RYE A;  5EFW A;  1ZG6 A;  3VFF A;  1YMS A;  3FPW A;  3N8R A;  4GN2 A;  1NY0 A;  2V20 A;  4KZ5 A;  3C7U A;  3UO9 A;  3BFC A;  3G2Y A;  2LB5 A;  4G3K A;  4L9E A;  4IUH A;  5DKL A;  2QYB A;  1ALQ A;  5KIZ A;  1CEG A;  2JKT I;  1BLS A;  5HAR A;  1OTE A;  2W27 A;  5CHU A;  3BFE A;  1TEM A;  3W8K A;  4WF0 A;  1W5D A;  2BTF P;  1DRM A;  5F69 A;  3T1X A;  3NDE A;  4X1M A;  2AVX A;  2HJE A;  3A3E A;  3CI6 A;  1G6A A;  3G2Z A;  3UDF A;  3M6H A;  4E3M A;  4ARZ A;  3MZE A;  2C6W B;  4NXF A;  1WE4 A;  2W3D A;  3SH8 A;  3PTE A;  3VSL A;  1V9Z A;  4LGW A;  3OLO A;  1IFQ A;  1ES3 A;  4BL2 A;  4L9F A;  1P97 A;  3P01 A;  4KUK A;  4AFI A;  2XA7 M;  2Y4A A;  2PAV P;  1BUL A;  4HQA A;  3E4O A;  1IYP A;  2Z2L B;  1KGF A;  1X0O A;  3LUQ A;  3CG5 A;  5CTM A;  3T1Q B;  4HJ3 A;  5M19 A;  3T4J A;  5AQA A;  1KDS A;  4EER A;  4XT2 A;  4OH0 A;  4ESP A;  5FQJ A;  4G3W A;  3BFD A;  3UB9 A;  4GNU A;  2YKF A;  2X02 A;  3VP0 A;  4KG2 A;  2I9V A;  3A0S A;  1SKO A;  1OJG A;  2EFU A;  4BLM A;  3RFB A;  3HUM A;  3GV9 A;  3MZD A;  4HBT A;  1P0Z A;  2HGV A;  1JWZ A;  1QMF A;  3VFH A;  2QPN A;  2G2W A;  3MS6 A;  1PWD A;  3BWL A;  3CZD A;  4G3V A;  2Z6D A;  2ACG A;  1FQG A;  4Y17 A;  5IU1 A;  1STZ A;  2K7S A;  2J9P A;  2PHY A;  2OOL A;  4WEK A;  1ESI A;  4EES A;  4IUK A;  1DJB A;  1GA0 A;  1GHP A;  5DJU A;  4OPQ A;  5E2F A;  3RXX A;  4LCM A;  4Y3I A;  1YT4 A;  5FI7 A;  3FV7 A;  2JHE A;  5FQK A;  2HF6 A;  4EBL A;  1S1Y A;  3BLS A;  1CQA A;  1XP4 A;  5FI6 A;  3BEB A;  4O0P A;  5J3W A;  1K57 C;  4MDZ A;  4ZRR A;  5AVF A;  4LEN A;  4O01 A;  3SS4 A;  1N9B A;  3MKE A;  1VHM A;  2JKT M;  5D3O A;  4M4X A;  1ERO A;  3ZNT A;  1KE3 A;  4N92 A;  5LBR A;  4E3J A;  4WBG A;  1FR6 A;  5F83 A;  4OKP A;  4KZ7 A;  3VP2 A;  3IBR A;  3ZNY A;  3VSK A;  5HPF A;  2Y2M A;  3K3C A;  4D2O A;  3DTI A;  4ZJ2 A;  1UWN X;  4F3L A;  5A90 A;  1NXY A;  2Y79 A;  5A92 A;  2VGJ A;  1VET B;  3LI8 A;  2VX8 A;  2BAS A;  3NIA A;  1EWZ A;  1NJ4 A;  1LLB A;  2PRF A;  1OTA A;  5FQM A;  1D1J A;  1ONH A;  4CLC D;  3RJU A;  4E3N A;  5FEG A;  4E6X A;  2XD1 A;  5BOH A;  3MQO A;  3NOU C;  2ZQC A;  4QY6 A;  4X1L A;  3T4L A;  1ODV A;  1G5U A;  1K55 A;  4MBK A;  3IS2 A;  2A3U A;  5FSR A;  1LSX A;  2Y59 A;  5CX7 A;  3C30 A;  5GHZ A;  1YLT A;  3V5M A;  3IXH A;  4GJ4 A;  4JXV A;  2OWJ A;  5IS1 A;  3OPH A;  4JGO A;  1K0K A;  1K4F A;  5GHX A;  2P9V B;  2PD8 A;  5CGW A;  4UEY A;  2EX8 A;  3DWK A;  4FH4 A;  5A8B A;  4KQD A;  1FOF A;  3LIE A;  2Y2P A;  1VQQ A;  2G2U A;  2D02 A;  4FTX A;  2BG1 A;  4GD6 A;  1WYB A;  5L07 A;  3CUE C;  3QP5 A;  5I94 A;  1XA7 A;  3ICY A;  1IYQ A;  1EW0 A;  4DDS A;  4JF4 A;  2ZLY A;  5I5L A;  3OPP A;  2JKR M;  4JGQ A;  3T4S A;  5L10 A;  3T1S A;  3A3F A;  1MWU A;  2DRW A;  3N8L A;  2HZ5 A;  5EEC A;  2J8Y A;  2W3G A;  1MWT A;  2JC7 A;  3VP4 A;  2L1M A;  4IVK A;  3BM6 A;  2JKR I;  3T4T A;  3MSH A;  1LL9 A;  1ESU A;  2R78 A;  3QHY A;  3EGD C;  3KYE A;  4U0T A;  1AWI A;  1XFN A;  4PM8 A;  4WEL A;  1VM1 A;  2V1A A;  3HLD A;  3LEQ A;  3LIA A;  5GLC A;  3OC2 A;  1DP9 A;  1HD8 A;  2EXB A;  2W1T A;  4UA6 A;  1KVM A;  4LLO B;  1GSV A;  2ZC6 B;  4B88 A;  2L4R A;  1A0K A;  3TG9 A;  2M1C A;  2W1R A;  4NET A;  1MC0 A;  4GHI B;  2ZJ9 A;  3V50 A;  1XGI A;  4N9K A;  1SKF A;  3B47 A;  3S7N A;  3QP8 A;  1TF1 A;  1BUE A;  1P9R A;  1KDW A;  5HWW A;  3CPT A;  3ZCZ A;  2KLI A;  4Y7P A;  1CJF A;  3MFD A;  2HDQ A;  1DJC A;  2PU2 A;  3KYZ A;  3C7V A;  4BD1 A;  2WAE A;  1YAX A;  2EWW A;  3HUN A;  3MXS A;  4U3T A;  3UDX A;  3CAX A;  1TDL A;  2X01 A;  3Q7V B;  3H82 A;  2H0Y A;  3WS5 A;  4QPR A;  2RCX A;  4X68 A;  1MKM A;  3W2Z A;  4JBF A;  2HJ9 C;  1W8Q A;  2FFF B;  2XLN A;  1IEL A;  3LFV A;  3UB5 P;  1GSX A;  4Y13 A;  1UGU A;  3HLF A;  2OSU A;  3VE3 A;  5DVA A;  4D60 A;  3IBJ A;  3R4K A;  3KSI A;  4Z1W A;  2M7U A;  4R0Q A;  1DY6 A;  1G28 A;  3CMZ A;  3QP1 A;  1T1C A;  3ZG5 A;  4JXW A;  3IWQ A;  5FQ9 A;  2QWS A;  4GB7 A;  4X69 A;  4BBU A;  4DXB A;  1FCN A;  2Y2I A;  4S2N A;  4WZ4 A;  1NRF A;  1EI5 A;  3LIC A;  2ZOI A;  4ARZ B;  3PBS A;  1K57 A;  3JPU A;  4LCL A;  3LGO A;  1Z09 A;  4FD8 A;  1NWZ A;  4LV1 A;  5FL3 A;  3A0V A;  5J4E A;  4BEN A;  4EV4 A;  1Q2P A;  2B95 A;  4DMZ A;  5CEC A;  1ZKJ A;  4LRZ E;  3IX8 A;  3PR6 A;  1SHV A;  1YLZ A;  4E3K A; 
#chains in the Genus database with same CATH homology
 1NLZ A;  2PT7 A;  4ARZ A;  1Y28 A;  2PD7 A;  4NXF A;  1N9O A;  3GDI A;  2W3D A;  3HCY A;  1S4S A;  2NUP C;  3F1O A;  3LR0 A;  3MQ0 A;  1V9Z A;  3K2N A;  2KOI A;  3OLO A;  4R70 A;  1IFQ A;  1H8M A;  4L9F A;  1P97 A;  3P01 A;  3IS2 B;  1UWP X;  2P7J A;  4KUK A;  3ZYT A;  4AFI A;  2XA7 M;  3E4Q A;  4EW7 A;  2O9B A;  2VLG A;  3MF0 A;  3BQ8 A;  4YOF A;  4HQA A;  3FG8 A;  1N9L A;  1GSW A;  3E4O A;  2B18 A;  5AVE A;  4ME4 A;  3LUQ A;  1X0O A;  3UB7 A;  4ETZ A;  2L0W A;  4H6J A;  3MJQ A;  5HDD A;  3VV4 A;  4HJ3 A;  2J3T D;  4EXO A;  3T4J A;  4DN0 A;  3F1O B;  2XSS A;  4EER A;  4XT2 A;  1S66 L;  5DFY A;  2PDR A;  3FC7 A;  4G3W A;  3K3D A;  5F6A A;  3UB9 A;  2WKR A;  4BMW A;  2A2L A;  3KYQ A;  3PBR A;  5TBM B;  4DJ3 A;  2YKF A;  2H28 A;  5J7E A;  1H3Q A;  4MMN A;  2I9V A;  3A0S A;  3JVU A;  1OJG A;  4BBV A;  4BWI A;  3T4O A;  4CLC C;  4HP4 A;  3RFB A;  3OCL A;  4HH3 A;  1P0Z A;  3HJK A;  2HGV A;  4WN5 A;  2Z6C A;  1F9I A;  1F98 A;  2MJ6 A;  4IHQ A;  3UB8 A;  1XJ4 A;  3BWL A;  4GW9 A;  4G3V A;  3S7O A;  2Z6D A;  4DJ2 A;  2GZA A;  2A24 A;  4EU0 A;  5IU1 A;  1STZ A;  2K7S A;  2PHY A;  2OOL A;  4HIA A;  4WEK A;  3H82 B;  4EES A;  4IUK A;  3OOV A;  3B42 A;  4IJG A;  5KSH A;  3PBQ A;  1XJ2 A;  5DJU A;  2O99 A;  3CLO A;  4LPZ A;  3EQU A;  4Y3I A;  2WKQ A;  2M7V A;  2JHE A;  4EEU A;  2HF6 A;  1S1Y A;  5G4Y A;  1KOU A;  4XT2 B;  4WEJ A;  4O0P A;  4B9O A;  3BY8 A;  5J3W A;  3LIB A;  4MDZ A;  4ZRR A;  3PXP A;  1S67 L;  5AVF A;  3C8C A;  3G6O A;  4O01 A;  3UME A;  1T18 A;  1OTD A;  1VHM A;  2JKT M;  4Q0I A;  1OT9 A;  2INW A;  5G4Z A;  4HY8 A;  1NLY A;  5HD5 A;  4Y2F A;  2WKP A;  4PHT A;  5TBM A;  2IA2 A;  4M4X A;  2LB9 A;  4OOM A;  3VOL A;  2B02 A;  3EGX C;  4CLC A;  3LR5 A;  5AJG A;  3F1P B;  5LBR A;  2VV6 A;  2J3T C;  5L8M A;  1OTB A;  1DP6 A;  2W1T B;  1WA9 A;  3RH8 B;  2ZMV A;  4NXB A;  4HOI A;  3IBR A;  3LI9 A;  5HPF A;  4I3A A;  2VGL M;  4HJ6 A;  1NRJ A;  4MN5 A;  3K3C A;  2OAQ 1;  3BJN A;  1TS0 A;  1UWN X;  4F3L A;  2A24 B;  3S7P A;  2Y79 A;  3PBO A;  4Y5F A;  2PYR A;  4PAU A;  2VEA A;  2GJ3 A;  3LI8 A;  2VX8 A;  2BAS A;  4MCW A;  3JVV A;  5HWV A;  3EEA A;  1N9N A;  2JN7 A;  3P7N A;  2KDK A;  2PYP A;  4H6J B;  1OTA A;  2QJ7 A;  1XFQ A;  3B33 A;  4WUJ A;  3E98 A;  4NXG A;  4CLC D;  3OBF A;  1DP8 A;  3MR0 A;  2O9A A;  5F68 A;  3UMD A;  3R7W A;  3MQO A;  3NOU C;  4CLC E;  3CIT A;  5HDS A;  3T4L A;  1ODV A;  4GCZ A;  3UE6 A;  4F3L B;  4MN6 A;  3NOT C;  1YKD A;  2YKH A;  3TE8 A;  1XJ3 A;  4KQO A;  2QKP A;  3IS2 A;  4NEE D;  1LSX A;  3F1N A;  5CX7 A;  3C30 A;  5DJT A;  4Q0H A;  4B93 A;  2K31 A;  3TJZ C;  3SW1 A;  3KSH A;  4GJ4 A;  3HJI A;  1LSW A;  2OWJ A;  5IS1 A;  1G6O A;  3CWF A;  3E0Y A;  4JGO A;  2NUT C;  4ETX A;  3EQV A;  4JGP A;  2W3H A;  2KX6 A;  2PD8 A;  4UEY A;  3VE4 A;  4FOF A;  5HSQ A;  5A8B A;  4KQD A;  3LIE A;  4EUV A;  5C5K A;  3PBN A;  2W3E A;  2VJW A;  3RTY A;  2D02 A;  4JGR A;  4KUO A;  4E04 A;  1S4R A;  3CUE C;  4L9G A;  5HZH A;  3NOP C;  4L0L A;  1V9Y A;  3ICY A;  3GEC A;  4II7 A;  4HI4 A;  1EW0 A;  3KO6 A;  4LRX C;  2VZW A;  2CMN A;  2OAP 1;  5I5L A;  4MN7 A;  1ZTU A;  1TS8 A;  3LID A;  3UE3 A;  3EEH A;  4BJP A;  3LIF A;  4I3J A;  2JKR M;  1OTI A;  4JGQ A;  4GHI A;  3T4S A;  4GS9 B;  1LSV A;  4HJ4 A;  4OOL A;  3T50 A;  3NJA A;  2FZ0 A;  3R7W B;  1T19 A;  1OPX A;  3F1N B;  3H7W A;  2W3G A;  4I3I A;  5DF9 A;  4R38 A;  1OJ5 A;  3NHQ A;  3BY9 A;  2L1M A;  1W63 Q;  4GLQ A;  3O5Y A;  2Y8H A;  2JKR I;  2V0U A;  3FPV A;  2OWH A;  3EOI A;  3T4Q A;  2V0W A;  5F5Y A;  3A0R A;  3T4T A;  2VV7 A;  2G7U A;  2XA7 S;  4NKP A;  3MQQ A;  2R78 A;  3EGD C;  1XFN A;  4PKY G;  2PR5 A;  4WLA A;  4WEL A;  2ZMF A;  4YNR A;  1OT6 A;  1XJ6 A;  2V1A A;  3LIA A;  5TJJ A;  3LR3 A;  3CUE A;  3OC2 A;  1DP9 A;  5K5B A;  4BBT A;  1S1Z A;  2W1T A;  3ZQ5 A;  4HP9 A;  4LLO B;  1GSV A;  1JNU A;  2V1B A;  4I5S A;  2L4R A;  2W3F A;  3DBA A;  2P08 A;  4EET B;  2M1C A;  5HPI A;  3KX0 X;  2W1R A;  1MC0 A;  1YSQ A;  3TW8 A;  4GHI B;  4Q0J A;  2GX5 A;  1IOU A;  2VA0 A;  1BYW A;  3B47 A;  2QJ5 A;  3S7N A;  1TF1 A;  3H9W A;  1P9R A;  3LR4 A;  4HNB A;  5HWW A;  2HV1 A;  2V9A A;  2KLI A;  4HH2 A;  5IT5 A;  3C2W A;  4I38 A;  2VGL S;  1W63 M;  3ULF A;  3MMH A;  1T1A A;  3KYZ A;  3MXQ A;  4P6Z S;  4HHD A;  1VB6 A;  3LYX A;  2XRO A;  5HWT A;  1YAX A;  2EWW A;  4EEP A;  3D72 A;  3C38 A;  2ZBB A;  4NXE A;  3CAX A;  1TD5 A;  4P6Z M;  3BQA A;  2GNX A;  3TRC A;  4CQH A;  1LL8 A;  2FH5 A;  3H82 A;  2VV8 A;  2K2N A;  1LT0 A;  3PYP A;  4QPR A;  3EWK A;  5HDC A;  1MKM A;  1MZU A;  4RQ9 A;  5HL6 A;  3W2Z A;  3PBT A;  3OCN A;  2O9C A;  4I39 A;  4YWZ A;  5DKK A;  2HJ9 C;  2P04 A;  4K08 A;  3E4P A;  1TS7 A;  2XRN A;  3MFX A;  3LFV A;  3KSF A;  1GSX A;  1UGU A;  2W0N A;  3VE3 A;  1P9W A;  1YSP A;  4O8G A;  3IBJ A;  2O0Y A;  4UQI S;  3R4K A;  2ZOH A;  2QHK A;  3KSI A;  5EFW A;  4Z1W A;  2M7U A;  3U2A A;  3FPW A;  1G28 A;  1T1C A;  2QWS A;  4PKY A;  3H7W B;  2PR6 A;  4LRY C;  4UQI M;  4BBU A;  2D01 A;  1TS6 A;  3V67 A;  2J3W A;  1ZHH B;  2LB5 A;  4WL9 A;  4G3K A;  2DMW A;  3S7Q A;  4L9E A;  4IUH A;  5DKL A;  2QYB A;  3LIC A;  2ZOI A;  2EWV A;  3D3O A;  3F1P A;  3PBS A;  4ARZ B;  5KIZ A;  4R3A A;  2JKT I;  5HD3 A;  4R6L A;  2EA9 A;  3BW6 A;  1OTE A;  1T1B A;  2W27 A;  1D7E A;  4WF0 A;  3UB6 A;  5MC7 A;  1NWZ A;  4GS9 A;  5FL3 A;  3A0V A;  2VKS A;  5J4E A;  1DRM A;  4EQ1 A;  3PHY A;  4CLC B;  2J80 A;  5DFX A;  5F69 A;  3T4K A;  4DMZ A;  1D06 A;  2HJE A;  4LRZ E;  3CI6 A;  1F5M A;  3PR6 A;  3KSG A;  4FSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...