1YB3A

Conserved hypothetical protein pfu-178653-001 from pyrococcus furiosus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
166
structure length
166
Chain Sequence
MLKEVHELLNRIWGDIFELREELKEELKGFTVEEVSEVFNAYLYIDGKWEEMKYPHPAFAVKPGGEVGATPQGFYFVFAFPKEELSKEFIEDVIRAFEKLFIYGAENFLEDFYNFEHPISGDEVWDRIVNSDEEMINFEVDLGFDKEEVKREIKRFIELARRYNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Conserved hypothetical protein Pfu-178653-001 from Pyrococcus furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
total genus 47
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2004-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11447 DUF3201 Protein of unknown function (DUF3201)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1yb3A00
3V7SA 3NELA 5KNNA 4CS3A 2DU7A 4TVAB 4H2YA 1WQWA 1GGMA 1EVKA 4WJ3M 2RHSB 2QHSA 4XTYA 1HTTA 4H2XA 1H4VB 4BWAA 3L4GA 4HA8A 4EO4A 2E41A 3BJUA 1HXDA 4XTUA 1SERA 2XTIA 3A5YA 1YGBA 3IKMB 3E9IA 4YRLA 2Q5IA 4YRIA 4XTWA 12ASA 4G84A 4YRNA 2CIMA 1YFRA 1B7YB 1QF6A 1KMNA 3RF1A 1IL2A 5E3IA 4DQ2A 1W66A 4YCWA 4YDQA 4XTXA 4TQDA 1EQRA 3RKWA 2RHSA 1NJ6A 4CS2A 1WPYA 4H2TA 3A31A 2ZNJA 2ZCEA 2AMCB 4HWTA 2ZTGA 3HXXA 4TQFA 2ODRD 2E64A 5C53B 2ARUA 1X01A 3QO8A 1J5WA 2DU5A 2ARTA 2C7IA 2RHQB 3QO5A 3V7RA 1SRYA 3HFVA 3TEHB 3UFGA 4O2DA 1ASZA 3DSQA 1HC7A 4NCXA 2E65A 4P3NA 1BIBA 1E1OA 3HFZB 4WF2A 4XEMA 2XGTA 3NETA 4OLFA 3WQZA 2ZR3A 2QHVA 3VQYA 1B70A 2DTHA 2HNIA 3MEYA 4RDXA 2DQ0A 2DXTA 1NJ5A 2DVEA 4K86A 3TUPA 2PMEA 2Q5HA 4WI1A 4J15A 1H4SA 4DPGA 11ASA 3TEHA 2AKWB 2EJ9A 4CH5A 4YYEA 1KOGA 4XU0A 1FYFA 3HTZA 4P74C 4XU1A 3HFZA 1NJ1A 1WU7A 3REXA 4HWPA 1ATIA 2CGHA 1SETA 4RMFA 4ZIBA 1PYSB 3HXWA 2EL9A 4E51A 4UP8A 4H2VA 4P3PA 4TVYA 3HXVA 4HVCA 3PCOB 2ZT6A 2E3CA 2ALYB 1X2HA 1WNLA 3RKXA 2AKWA 3RGLA 4P73A 4YRKA 3HY0A 1E22A 1EFWA 3LSQA 1JJCB 3ICAA 3QNEA 1WYDA 2ZIMA 1PYSA 2QHUA 4P71A 3KFUA 4H2SA 4XU2A 3PCOA 4KQEA 3LSSA 4K87A 4XU3A 4TTVA 2ALYA 5HGQA 3HRKA 2DJZA 1G51A 5F5WA 2DXUA 4LNSA 4P72A 1NJ2A 1C0AA 3I7FA 4YRQA 4Q6GA 1E1TA 3IG2A 3NENA 5K1PA 1JJCA 4H2UA 1KMMA 1E24A 4CH6A 3R07A 1B70B 1NYQA 5C51B 3NEMA 4XEOA 3CMQA 4P75A 3MF2A 4YP0A 4UPAA 2DKGA 3A7RA 3P8YA 4YRCA 4P3OA 5K1XA 3A5ZA 3HXZA 2ZXFA 3IALA 4YRJA 3TEGA 1EIYB 1BIAA 4BW9A 4HWOA 1H4QA 3MF1A 2ZIOA 2IY5B 3RUXA 3FJPA 4YRMA 3L1AA 1USYA 4YCUA 2P5IA 1X56A 3EFRA 3UH0A 1YFSA 3G1ZA 3PZCA 2CJBA 2DEQA 2Q7EA 4H2WA 3P8VA 4YRFA 3A74A 2DQ3A 4XTVA 3OD1A 2Q7GA 1SESA 4OP0A 1EIYA 3VQXA 1VQZA 2ZR2A 2DTOA 2IY5A 1X55A 4YRTA 3HRIA 3QO7A 3IKLA 1YB3A 4RQEA 4L87A 2DZCA 3V7CA 1G5HA 2DDZA 3EFSA 2J3LA 3E9HA 1BBWA 2ZZGA 2ZZEA 4HWRA 4XTZA 1Z7MA 2Q7HA 2ZNIA 5ELOA 3L2ZA 2DZ9A 3VQWA 3UGQA 1NNHA 4AH6A 2EAYA 1G5IA 2FYKA 1H4TA 2CJ9A 2EJGA 4CH4A 3RKYA 4WJ4A 4UP7A 1B76A 1N9WA 2EWNA 2ZT8A 3QTCA 3A32A 1QE0A 4K88A 4YPFA 2ZZFA 2ZT7A 1WLEA 3M4PA 3M4QA 4G85A 2I4NA 2PMFA 4RQFA 4TVAA 1RIQA 3RL6A 3P8TA 3BFMA 2ARSA 2C8MA 2E1HA 4P73C 4PG3A 1EOVA 1ADYA 4YRGA 4YRPA 2P0LA 2ZGWA 4TWAA 3V8KA 1LYLA 4P74A 4X5OA 5ELNA 2ZT5A 3VBBA 1L0WA 4ZTUB 1BBUA 4P71C 3UGTA 1Z7NA 4KR2A 3RIRA 3VQVA 2QHTA 3A7AA 4YRSA 1B7YA 2I4OA 3ERRA 4YREA 2ZINA 3W3SA 4P72C 2J3MA 1EVLA 1ADJA 1B8AA 2AMCA 3LC0A 1X54A 3A7UA 4UP9A 4KR3A 2G4CA 4H02A 3V8JA 5C52B 1X2GA 3RACA 4PHCA 4CS4A 4P75C 2E5AA 2DTIA 2RHQA 4YROA 1NYRA 1WQ7A 3HXUA 1NJ8A 3HXYA 2E10A 2CJAA 2I4MA 2ODRC 2EJFA 3REUA 1ASYA 4HWSA 4H2XB 4Q15A 3L4GB 4TVWA 3V8LA 4YRRA 3HY1A 4EX5A 4CH3A 2I4LA 1YFTA 4YCVA 4ZTZB 1USYC
chains in the Genus database with same CATH superfamily
3V7SA 3NELA 5KNNA 4CS3A 2DU7A 4TVAB 4H2YA 1WQWA 1GGMA 1EVKA 4WJ3M 2RHSB 2QHSA 4XTYA 1HTTA 4H2XA 1H4VB 4BWAA 3L4GA 4HA8A 4EO4A 2E41A 3BJUA 1HXDA 4XTUA 1SERA 2XTIA 3A5YA 1YGBA 3IKMB 3E9IA 4YRLA 2Q5IA 4YRIA 4XTWA 12ASA 4G84A 4YRNA 2CIMA 1YFRA 1B7YB 1QF6A 1KMNA 3RF1A 1IL2A 5E3IA 4DQ2A 1W66A 4YCWA 4YDQA 4XTXA 4TQDA 1EQRA 3RKWA 2RHSA 1NJ6A 4CS2A 1WPYA 4H2TA 3A31A 2ZNJA 2ZCEA 2AMCB 4HWTA 2ZTGA 3HXXA 4TQFA 2ODRD 2E64A 4LVIA 5C53B 2ARUA 1X01A 3QO8A 1J5WA 2DU5A 2ARTA 2C7IA 2RHQB 3QO5A 3V7RA 1SRYA 3HFVA 3TEHB 3UFGA 4O2DA 1ASZA 3DSQA 1HC7A 4NCXA 2E65A 4P3NA 1BIBA 1E1OA 3HFZB 4WF2A 4XEMA 2XGTA 3NETA 4OLFA 3WQZA 2NS6A 2ZR3A 2QHVA 3VQYA 1B70A 2DTHA 2HNIA 3MEYA 4RDXA 2DQ0A 2DXTA 1NJ5A 2DVEA 4K86A 4LVJA 3TUPA 2PMEA 2Q5HA 4WI1A 4J15A 1H4SA 4DPGA 11ASA 3TEHA 2AKWB 2EJ9A 4CH5A 4YYEA 1KOGA 4XU0A 1FYFA 3HTZA 4P74C 4XU1A 3HFZA 1NJ1A 1WU7A 3REXA 4HWPA 1ATIA 2CGHA 1SETA 4RMFA 4ZIBA 1PYSB 3HXWA 2EL9A 4E51A 4UP8A 4H2VA 4P3PA 4TVYA 3HXVA 4HVCA 3PCOB 2ZT6A 2E3CA 2ALYB 1X2HA 4LVLA 1WNLA 3RKXA 2AKWA 3RGLA 4P73A 4YRKA 3HY0A 1E22A 1EFWA 3LSQA 1JJCB 3ICAA 3QNEA 1WYDA 2ZIMA 1PYSA 2QHUA 4P71A 3KFUA 4H2SA 4XU2A 3PCOA 4KQEA 3LSSA 4K87A 4XU3A 4TTVA 2ALYA 5HGQA 3HRKA 2DJZA 1G51A 5F5WA 2DXUA 4LNSA 4P72A 1NJ2A 1C0AA 3I7FA 4YRQA 4Q6GA 1E1TA 3IG2A 3NENA 4LVKA 5K1PA 1JJCA 4H2UA 1KMMA 1E24A 4CH6A 3R07A 1B70B 1NYQA 5C51B 3NEMA 4XEOA 3CMQA 4P75A 3MF2A 4YP0A 4UPAA 2DKGA 3A7RA 3P8YA 4YRCA 4P3OA 5K1XA 3A5ZA 3HXZA 2ZXFA 3IALA 4YRJA 3TEGA 1EIYB 1BIAA 4BW9A 4HWOA 1H4QA 3MF1A 2ZIOA 2IY5B 3RUXA 3FJPA 4YRMA 3L1AA 1USYA 4YCUA 2P5IA 1X56A 3EFRA 3UH0A 1YFSA 3G1ZA 3PZCA 2CJBA 2DEQA 2Q7EA 4H2WA 3P8VA 4YRFA 3A74A 2DQ3A 4XTVA 3OD1A 2Q7GA 1SESA 4OP0A 1EIYA 3VQXA 1VQZA 2ZR2A 2DTOA 2IY5A 1X55A 2A8EA 4YRTA 3HRIA 3QO7A 3IKLA 1YB3A 4RQEA 4L87A 2DZCA 3V7CA 1G5HA 2DDZA 3EFSA 2J3LA 3E9HA 1BBWA 2ZZGA 2ZZEA 4HWRA 4XTZA 1Z7MA 2Q7HA 2ZNIA 5ELOA 3L2ZA 2DZ9A 3VQWA 4HT4A 3UGQA 1NNHA 4AH6A 2EAYA 1G5IA 2FYKA 1H4TA 2CJ9A 2EJGA 4CH4A 3RKYA 4WJ4A 4UP7A 1B76A 1N9WA 2EWNA 2ZT8A 3QTCA 3A32A 1QE0A 4K88A 4YPFA 2ZZFA 2ZT7A 1WLEA 3M4PA 3M4QA 4G85A 2I4NA 2PMFA 4RQFA 4TVAA 1RIQA 3RL6A 3P8TA 3BFMA 2ARSA 2C8MA 2E1HA 4P73C 4PG3A 1EOVA 1ADYA 4YRGA 4YRPA 2P0LA 2ZGWA 4TWAA 3V8KA 1LYLA 4P74A 4X5OA 5ELNA 2ZT5A 3VBBA 1L0WA 4ZTUB 1BBUA 4P71C 3UGTA 1Z7NA 4KR2A 3RIRA 3VQVA 2QHTA 3A7AA 4YRSA 1B7YA 2I4OA 3ERRA 4YREA 2ZINA 3W3SA 4P72C 2J3MA 1EVLA 1ADJA 1B8AA 2AMCA 3LC0A 1X54A 3A7UA 4UP9A 4KR3A 2G4CA 4H02A 3V8JA 5C52B 1X2GA 3RACA 4PHCA 4CS4A 4P75C 2E5AA 2DTIA 2RHQA 4YROA 1NYRA 1WQ7A 3HXUA 1NJ8A 3HXYA 2E10A 2CJAA 2I4MA 2ODRC 2EJFA 3REUA 4LVMA 1ASYA 4HWSA 4H2XB 4Q15A 3L4GB 4TVWA 3MQZA 3V8LA 4YRRA 3HY1A 4EX5A 4CH3A 2I4LA 1YFTA 4YCVA 4ZTZB 1USYC
chains in the Genus database with same CATH topology
3V7SA 3NELA 5KNNA 4CS3A 2DU7A 4TVAB 4H2YA 1WQWA 1GGMA 1EVKA 4WJ3M 2RHSB 2QHSA 4XTYA 1HTTA 4H2XA 1H4VB 4BWAA 3L4GA 4HA8A 4EO4A 2E41A 3BJUA 1HXDA 4XTUA 1SERA 2XTIA 3A5YA 1YGBA 3IKMB 3E9IA 4YRLA 2Q5IA 4YRIA 4XTWA 12ASA 4G84A 4YRNA 2CIMA 1YFRA 1B7YB 1QF6A 1KMNA 3RF1A 1IL2A 5E3IA 4DQ2A 1W66A 4YCWA 4YDQA 4XTXA 4TQDA 1EQRA 3RKWA 2RHSA 1NJ6A 4CS2A 1WPYA 4H2TA 3A31A 2ZNJA 2ZCEA 2AMCB 4HWTA 2ZTGA 3HXXA 4TQFA 2ODRD 2E64A 4LVIA 5C53B 2ARUA 1X01A 3QO8A 1J5WA 2DU5A 2ARTA 2C7IA 2RHQB 3QO5A 3V7RA 1SRYA 3HFVA 3TEHB 3UFGA 4O2DA 1ASZA 3DSQA 1HC7A 4NCXA 2E65A 4P3NA 1BIBA 1E1OA 3HFZB 4WF2A 4XEMA 2XGTA 3NETA 4OLFA 3WQZA 2NS6A 2ZR3A 2QHVA 3VQYA 1B70A 2DTHA 2HNIA 3MEYA 4RDXA 2DQ0A 2DXTA 1NJ5A 2DVEA 4K86A 4LVJA 3TUPA 2PMEA 2Q5HA 4WI1A 4J15A 1H4SA 4DPGA 11ASA 3TEHA 2AKWB 2EJ9A 4CH5A 4YYEA 1KOGA 4XU0A 1FYFA 3HTZA 4P74C 4XU1A 3HFZA 1NJ1A 1WU7A 3REXA 4HWPA 1ATIA 2CGHA 1SETA 4RMFA 4ZIBA 1PYSB 3HXWA 2EL9A 4E51A 4UP8A 4H2VA 4P3PA 4TVYA 3HXVA 4HVCA 3PCOB 2ZT6A 2E3CA 2ALYB 1X2HA 4LVLA 1WNLA 3RKXA 2AKWA 3RGLA 4P73A 4YRKA 3HY0A 1E22A 1EFWA 3LSQA 1JJCB 3ICAA 3QNEA 1WYDA 2ZIMA 1PYSA 2QHUA 4P71A 3KFUA 4H2SA 4XU2A 3PCOA 4KQEA 3LSSA 4K87A 4XU3A 4TTVA 2ALYA 5HGQA 3HRKA 2DJZA 1G51A 5F5WA 2DXUA 4LNSA 4P72A 1NJ2A 1C0AA 3I7FA 4YRQA 4Q6GA 1E1TA 3IG2A 3NENA 4LVKA 5K1PA 1JJCA 4H2UA 1KMMA 1E24A 4CH6A 3R07A 1B70B 1NYQA 5C51B 3NEMA 4XEOA 3CMQA 4P75A 3MF2A 4YP0A 4UPAA 2DKGA 3A7RA 3P8YA 4YRCA 4P3OA 5K1XA 3A5ZA 3HXZA 2ZXFA 3IALA 4YRJA 3TEGA 1EIYB 1BIAA 4BW9A 4HWOA 1H4QA 3MF1A 2ZIOA 2IY5B 3RUXA 3FJPA 4YRMA 3L1AA 1USYA 4YCUA 2P5IA 1X56A 3EFRA 3UH0A 1YFSA 3G1ZA 3PZCA 2CJBA 2DEQA 2Q7EA 4H2WA 3P8VA 4YRFA 3A74A 2DQ3A 4XTVA 3OD1A 2Q7GA 1SESA 4OP0A 1EIYA 3VQXA 1VQZA 2ZR2A 2DTOA 2IY5A 1X55A 2A8EA 4YRTA 3HRIA 3QO7A 3IKLA 1YB3A 4RQEA 4L87A 2DZCA 3V7CA 1G5HA 2DDZA 3EFSA 2J3LA 3E9HA 1BBWA 2ZZGA 2ZZEA 4HWRA 4XTZA 1Z7MA 2Q7HA 2ZNIA 5ELOA 3L2ZA 2DZ9A 3VQWA 4HT4A 3UGQA 1NNHA 4AH6A 2EAYA 1G5IA 2FYKA 1H4TA 2CJ9A 2EJGA 4CH4A 3RKYA 4WJ4A 4UP7A 1B76A 1N9WA 2EWNA 2ZT8A 3QTCA 3A32A 1QE0A 4K88A 4YPFA 2ZZFA 2ZT7A 1WLEA 3M4PA 3M4QA 4G85A 2I4NA 2PMFA 4RQFA 4TVAA 1RIQA 3RL6A 3P8TA 3BFMA 2ARSA 2C8MA 2E1HA 4P73C 4PG3A 1EOVA 1ADYA 4YRGA 4YRPA 2P0LA 2ZGWA 4TWAA 3V8KA 1LYLA 4P74A 4X5OA 5ELNA 2ZT5A 3VBBA 1L0WA 4ZTUB 1BBUA 4P71C 3UGTA 1Z7NA 4KR2A 3RIRA 3VQVA 2QHTA 3A7AA 4YRSA 1B7YA 2I4OA 3ERRA 4YREA 2ZINA 3W3SA 4P72C 2J3MA 1EVLA 1ADJA 1B8AA 2AMCA 3LC0A 1X54A 3A7UA 4UP9A 4KR3A 2G4CA 4H02A 3V8JA 5C52B 1X2GA 3RACA 4PHCA 4CS4A 4P75C 2E5AA 2DTIA 2RHQA 4YROA 1NYRA 1WQ7A 3HXUA 1NJ8A 3HXYA 2E10A 2CJAA 2I4MA 2ODRC 2EJFA 3REUA 4LVMA 1ASYA 4HWSA 4H2XB 4Q15A 3L4GB 4TVWA 3MQZA 3V8LA 4YRRA 3HY1A 4EX5A 4CH3A 2I4LA 1YFTA 4YCVA 4ZTZB 1USYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7S A;  3NEL A;  5KNN A;  4CS3 A;  2DU7 A;  4TVA B;  4H2Y A;  1WQW A;  1GGM A;  1EVK A;  4WJ3 M;  2RHS B;  2QHS A;  4XTY A;  1HTT A;  4H2X A;  1H4V B;  4BWA A;  3L4G A;  4HA8 A;  4EO4 A;  2E41 A;  3BJU A;  1HXD A;  4XTU A;  1SER A;  2XTI A;  3A5Y A;  1YGB A;  3IKM B;  3E9I A;  4YRL A;  2Q5I A;  4YRI A;  4XTW A;  12AS A;  4G84 A;  4YRN A;  2CIM A;  1YFR A;  1B7Y B;  1QF6 A;  1KMN A;  3RF1 A;  1IL2 A;  5E3I A;  4DQ2 A;  1W66 A;  4YCW A;  4YDQ A;  4XTX A;  4TQD A;  1EQR A;  3RKW A;  2RHS A;  1NJ6 A;  4CS2 A;  1WPY A;  4H2T A;  3A31 A;  2ZNJ A;  2ZCE A;  2AMC B;  4HWT A;  2ZTG A;  3HXX A;  4TQF A;  2ODR D;  2E64 A;  5C53 B;  2ARU A;  1X01 A;  3QO8 A;  1J5W A;  2DU5 A;  2ART A;  2C7I A;  2RHQ B;  3QO5 A;  3V7R A;  1SRY A;  3HFV A;  3TEH B;  3UFG A;  4O2D A;  1ASZ A;  3DSQ A;  1HC7 A;  4NCX A;  2E65 A;  4P3N A;  1BIB A;  1E1O A;  3HFZ B;  4WF2 A;  4XEM A;  2XGT A;  3NET A;  4OLF A;  3WQZ A;  2ZR3 A;  2QHV A;  3VQY A;  1B70 A;  2DTH A;  2HNI A;  3MEY A;  4RDX A;  2DQ0 A;  2DXT A;  1NJ5 A;  2DVE A;  4K86 A;  3TUP A;  2PME A;  2Q5H A;  4WI1 A;  4J15 A;  1H4S A;  4DPG A;  11AS A;  3TEH A;  2AKW B;  2EJ9 A;  4CH5 A;  4YYE A;  1KOG A;  4XU0 A;  1FYF A;  3HTZ A;  4P74 C;  4XU1 A;  3HFZ A;  1NJ1 A;  1WU7 A;  3REX A;  4HWP A;  1ATI A;  2CGH A;  1SET A;  4RMF A;  4ZIB A;  1PYS B;  3HXW A;  2EL9 A;  4E51 A;  4UP8 A;  4H2V A;  4P3P A;  4TVY A;  3HXV A;  4HVC A;  3PCO B;  2ZT6 A;  2E3C A;  2ALY B;  1X2H A;  1WNL A;  3RKX A;  2AKW A;  3RGL A;  4P73 A;  4YRK A;  3HY0 A;  1E22 A;  1EFW A;  3LSQ A;  1JJC B;  3ICA A;  3QNE A;  1WYD A;  2ZIM A;  1PYS A;  2QHU A;  4P71 A;  3KFU A;  4H2S A;  4XU2 A;  3PCO A;  4KQE A;  3LSS A;  4K87 A;  4XU3 A;  4TTV A;  2ALY A;  5HGQ A;  3HRK A;  2DJZ A;  1G51 A;  5F5W A;  2DXU A;  4LNS A;  4P72 A;  1NJ2 A;  1C0A A;  3I7F A;  4YRQ A;  4Q6G A;  1E1T A;  3IG2 A;  3NEN A;  5K1P A;  1JJC A;  4H2U A;  1KMM A;  1E24 A;  4CH6 A;  3R07 A;  1B70 B;  1NYQ A;  5C51 B;  3NEM A;  4XEO A;  3CMQ A;  4P75 A;  3MF2 A;  4YP0 A;  4UPA A;  2DKG A;  3A7R A;  3P8Y A;  4YRC A;  4P3O A;  5K1X A;  3A5Z A;  3HXZ A;  2ZXF A;  3IAL A;  4YRJ A;  3TEG A;  1EIY B;  1BIA A;  4BW9 A;  4HWO A;  1H4Q A;  3MF1 A;  2ZIO A;  2IY5 B;  3RUX A;  3FJP A;  4YRM A;  3L1A A;  1USY A;  4YCU A;  2P5I A;  1X56 A;  3EFR A;  3UH0 A;  1YFS A;  3G1Z A;  3PZC A;  2CJB A;  2DEQ A;  2Q7E A;  4H2W A;  3P8V A;  4YRF A;  3A74 A;  2DQ3 A;  4XTV A;  3OD1 A;  2Q7G A;  1SES A;  4OP0 A;  1EIY A;  3VQX A;  1VQZ A;  2ZR2 A;  2DTO A;  2IY5 A;  1X55 A;  4YRT A;  3HRI A;  3QO7 A;  3IKL A;  1YB3 A;  4RQE A;  4L87 A;  2DZC A;  3V7C A;  1G5H A;  2DDZ A;  3EFS A;  2J3L A;  3E9H A;  1BBW A;  2ZZG A;  2ZZE A;  4HWR A;  4XTZ A;  1Z7M A;  2Q7H A;  2ZNI A;  5ELO A;  3L2Z A;  2DZ9 A;  3VQW A;  3UGQ A;  1NNH A;  4AH6 A;  2EAY A;  1G5I A;  2FYK A;  1H4T A;  2CJ9 A;  2EJG A;  4CH4 A;  3RKY A;  4WJ4 A;  4UP7 A;  1B76 A;  1N9W A;  2EWN A;  2ZT8 A;  3QTC A;  3A32 A;  1QE0 A;  4K88 A;  4YPF A;  2ZZF A;  2ZT7 A;  1WLE A;  3M4P A;  3M4Q A;  4G85 A;  2I4N A;  2PMF A;  4RQF A;  4TVA A;  1RIQ A;  3RL6 A;  3P8T A;  3BFM A;  2ARS A;  2C8M A;  2E1H A;  4P73 C;  4PG3 A;  1EOV A;  1ADY A;  4YRG A;  4YRP A;  2P0L A;  2ZGW A;  4TWA A;  3V8K A;  1LYL A;  4P74 A;  4X5O A;  5ELN A;  2ZT5 A;  3VBB A;  1L0W A;  4ZTU B;  1BBU A;  4P71 C;  3UGT A;  1Z7N A;  4KR2 A;  3RIR A;  3VQV A;  2QHT A;  3A7A A;  4YRS A;  1B7Y A;  2I4O A;  3ERR A;  4YRE A;  2ZIN A;  3W3S A;  4P72 C;  2J3M A;  1EVL A;  1ADJ A;  1B8A A;  2AMC A;  3LC0 A;  1X54 A;  3A7U A;  4UP9 A;  4KR3 A;  2G4C A;  4H02 A;  3V8J A;  5C52 B;  1X2G A;  3RAC A;  4PHC A;  4CS4 A;  4P75 C;  2E5A A;  2DTI A;  2RHQ A;  4YRO A;  1NYR A;  1WQ7 A;  3HXU A;  1NJ8 A;  3HXY A;  2E10 A;  2CJA A;  2I4M A;  2ODR C;  2EJF A;  3REU A;  1ASY A;  4HWS A;  4H2X B;  4Q15 A;  3L4G B;  4TVW A;  3V8L A;  4YRR A;  3HY1 A;  4EX5 A;  4CH3 A;  2I4L A;  1YFT A;  4YCV A;  4ZTZ B;  1USY C; 
#chains in the Genus database with same CATH topology
 3V7S A;  3NEL A;  5KNN A;  4CS3 A;  2DU7 A;  4TVA B;  4H2Y A;  1WQW A;  1GGM A;  1EVK A;  4WJ3 M;  2RHS B;  2QHS A;  4XTY A;  1HTT A;  4H2X A;  1H4V B;  4BWA A;  3L4G A;  4HA8 A;  4EO4 A;  2E41 A;  3BJU A;  1HXD A;  4XTU A;  1SER A;  2XTI A;  3A5Y A;  1YGB A;  3IKM B;  3E9I A;  4YRL A;  2Q5I A;  4YRI A;  4XTW A;  12AS A;  4G84 A;  4YRN A;  2CIM A;  1YFR A;  1B7Y B;  1QF6 A;  1KMN A;  3RF1 A;  1IL2 A;  5E3I A;  4DQ2 A;  1W66 A;  4YCW A;  4YDQ A;  4XTX A;  4TQD A;  1EQR A;  3RKW A;  2RHS A;  1NJ6 A;  4CS2 A;  1WPY A;  4H2T A;  3A31 A;  2ZNJ A;  2ZCE A;  2AMC B;  4HWT A;  2ZTG A;  3HXX A;  4TQF A;  2ODR D;  2E64 A;  4LVI A;  5C53 B;  2ARU A;  1X01 A;  3QO8 A;  1J5W A;  2DU5 A;  2ART A;  2C7I A;  2RHQ B;  3QO5 A;  3V7R A;  1SRY A;  3HFV A;  3TEH B;  3UFG A;  4O2D A;  1ASZ A;  3DSQ A;  1HC7 A;  4NCX A;  2E65 A;  4P3N A;  1BIB A;  1E1O A;  3HFZ B;  4WF2 A;  4XEM A;  2XGT A;  3NET A;  4OLF A;  3WQZ A;  2NS6 A;  2ZR3 A;  2QHV A;  3VQY A;  1B70 A;  2DTH A;  2HNI A;  3MEY A;  4RDX A;  2DQ0 A;  2DXT A;  1NJ5 A;  2DVE A;  4K86 A;  4LVJ A;  3TUP A;  2PME A;  2Q5H A;  4WI1 A;  4J15 A;  1H4S A;  4DPG A;  11AS A;  3TEH A;  2AKW B;  2EJ9 A;  4CH5 A;  4YYE A;  1KOG A;  4XU0 A;  1FYF A;  3HTZ A;  4P74 C;  4XU1 A;  3HFZ A;  1NJ1 A;  1WU7 A;  3REX A;  4HWP A;  1ATI A;  2CGH A;  1SET A;  4RMF A;  4ZIB A;  1PYS B;  3HXW A;  2EL9 A;  4E51 A;  4UP8 A;  4H2V A;  4P3P A;  4TVY A;  3HXV A;  4HVC A;  3PCO B;  2ZT6 A;  2E3C A;  2ALY B;  1X2H A;  4LVL A;  1WNL A;  3RKX A;  2AKW A;  3RGL A;  4P73 A;  4YRK A;  3HY0 A;  1E22 A;  1EFW A;  3LSQ A;  1JJC B;  3ICA A;  3QNE A;  1WYD A;  2ZIM A;  1PYS A;  2QHU A;  4P71 A;  3KFU A;  4H2S A;  4XU2 A;  3PCO A;  4KQE A;  3LSS A;  4K87 A;  4XU3 A;  4TTV A;  2ALY A;  5HGQ A;  3HRK A;  2DJZ A;  1G51 A;  5F5W A;  2DXU A;  4LNS A;  4P72 A;  1NJ2 A;  1C0A A;  3I7F A;  4YRQ A;  4Q6G A;  1E1T A;  3IG2 A;  3NEN A;  4LVK A;  5K1P A;  1JJC A;  4H2U A;  1KMM A;  1E24 A;  4CH6 A;  3R07 A;  1B70 B;  1NYQ A;  5C51 B;  3NEM A;  4XEO A;  3CMQ A;  4P75 A;  3MF2 A;  4YP0 A;  4UPA A;  2DKG A;  3A7R A;  3P8Y A;  4YRC A;  4P3O A;  5K1X A;  3A5Z A;  3HXZ A;  2ZXF A;  3IAL A;  4YRJ A;  3TEG A;  1EIY B;  1BIA A;  4BW9 A;  4HWO A;  1H4Q A;  3MF1 A;  2ZIO A;  2IY5 B;  3RUX A;  3FJP A;  4YRM A;  3L1A A;  1USY A;  4YCU A;  2P5I A;  1X56 A;  3EFR A;  3UH0 A;  1YFS A;  3G1Z A;  3PZC A;  2CJB A;  2DEQ A;  2Q7E A;  4H2W A;  3P8V A;  4YRF A;  3A74 A;  2DQ3 A;  4XTV A;  3OD1 A;  2Q7G A;  1SES A;  4OP0 A;  1EIY A;  3VQX A;  1VQZ A;  2ZR2 A;  2DTO A;  2IY5 A;  1X55 A;  2A8E A;  4YRT A;  3HRI A;  3QO7 A;  3IKL A;  1YB3 A;  4RQE A;  4L87 A;  2DZC A;  3V7C A;  1G5H A;  2DDZ A;  3EFS A;  2J3L A;  3E9H A;  1BBW A;  2ZZG A;  2ZZE A;  4HWR A;  4XTZ A;  1Z7M A;  2Q7H A;  2ZNI A;  5ELO A;  3L2Z A;  2DZ9 A;  3VQW A;  4HT4 A;  3UGQ A;  1NNH A;  4AH6 A;  2EAY A;  1G5I A;  2FYK A;  1H4T A;  2CJ9 A;  2EJG A;  4CH4 A;  3RKY A;  4WJ4 A;  4UP7 A;  1B76 A;  1N9W A;  2EWN A;  2ZT8 A;  3QTC A;  3A32 A;  1QE0 A;  4K88 A;  4YPF A;  2ZZF A;  2ZT7 A;  1WLE A;  3M4P A;  3M4Q A;  4G85 A;  2I4N A;  2PMF A;  4RQF A;  4TVA A;  1RIQ A;  3RL6 A;  3P8T A;  3BFM A;  2ARS A;  2C8M A;  2E1H A;  4P73 C;  4PG3 A;  1EOV A;  1ADY A;  4YRG A;  4YRP A;  2P0L A;  2ZGW A;  4TWA A;  3V8K A;  1LYL A;  4P74 A;  4X5O A;  5ELN A;  2ZT5 A;  3VBB A;  1L0W A;  4ZTU B;  1BBU A;  4P71 C;  3UGT A;  1Z7N A;  4KR2 A;  3RIR A;  3VQV A;  2QHT A;  3A7A A;  4YRS A;  1B7Y A;  2I4O A;  3ERR A;  4YRE A;  2ZIN A;  3W3S A;  4P72 C;  2J3M A;  1EVL A;  1ADJ A;  1B8A A;  2AMC A;  3LC0 A;  1X54 A;  3A7U A;  4UP9 A;  4KR3 A;  2G4C A;  4H02 A;  3V8J A;  5C52 B;  1X2G A;  3RAC A;  4PHC A;  4CS4 A;  4P75 C;  2E5A A;  2DTI A;  2RHQ A;  4YRO A;  1NYR A;  1WQ7 A;  3HXU A;  1NJ8 A;  3HXY A;  2E10 A;  2CJA A;  2I4M A;  2ODR C;  2EJF A;  3REU A;  4LVM A;  1ASY A;  4HWS A;  4H2X B;  4Q15 A;  3L4G B;  4TVW A;  3MQZ A;  3V8L A;  4YRR A;  3HY1 A;  4EX5 A;  4CH3 A;  2I4L A;  1YFT A;  4YCV A;  4ZTZ B;  1USY C; 
#chains in the Genus database with same CATH homology
 3V7S A;  3NEL A;  5KNN A;  4CS3 A;  2DU7 A;  4TVA B;  4H2Y A;  1WQW A;  1GGM A;  1EVK A;  4WJ3 M;  2RHS B;  2QHS A;  4XTY A;  1HTT A;  4H2X A;  1H4V B;  4BWA A;  3L4G A;  4HA8 A;  4EO4 A;  2E41 A;  3BJU A;  1HXD A;  4XTU A;  1SER A;  2XTI A;  3A5Y A;  1YGB A;  3IKM B;  3E9I A;  4YRL A;  2Q5I A;  4YRI A;  4XTW A;  12AS A;  4G84 A;  4YRN A;  2CIM A;  1YFR A;  1B7Y B;  1QF6 A;  1KMN A;  3RF1 A;  1IL2 A;  5E3I A;  4DQ2 A;  1W66 A;  4YCW A;  4YDQ A;  4XTX A;  4TQD A;  1EQR A;  3RKW A;  2RHS A;  1NJ6 A;  4CS2 A;  1WPY A;  4H2T A;  3A31 A;  2ZNJ A;  2ZCE A;  2AMC B;  4HWT A;  2ZTG A;  3HXX A;  4TQF A;  2ODR D;  2E64 A;  4LVI A;  5C53 B;  2ARU A;  1X01 A;  3QO8 A;  1J5W A;  2DU5 A;  2ART A;  2C7I A;  2RHQ B;  3QO5 A;  3V7R A;  1SRY A;  3HFV A;  3TEH B;  3UFG A;  4O2D A;  1ASZ A;  3DSQ A;  1HC7 A;  4NCX A;  2E65 A;  4P3N A;  1BIB A;  1E1O A;  3HFZ B;  4WF2 A;  4XEM A;  2XGT A;  3NET A;  4OLF A;  3WQZ A;  2NS6 A;  2ZR3 A;  2QHV A;  3VQY A;  1B70 A;  2DTH A;  2HNI A;  3MEY A;  4RDX A;  2DQ0 A;  2DXT A;  1NJ5 A;  2DVE A;  4K86 A;  4LVJ A;  3TUP A;  2PME A;  2Q5H A;  4WI1 A;  4J15 A;  1H4S A;  4DPG A;  11AS A;  3TEH A;  2AKW B;  2EJ9 A;  4CH5 A;  4YYE A;  1KOG A;  4XU0 A;  1FYF A;  3HTZ A;  4P74 C;  4XU1 A;  3HFZ A;  1NJ1 A;  1WU7 A;  3REX A;  4HWP A;  1ATI A;  2CGH A;  1SET A;  4RMF A;  4ZIB A;  1PYS B;  3HXW A;  2EL9 A;  4E51 A;  4UP8 A;  4H2V A;  4P3P A;  4TVY A;  3HXV A;  4HVC A;  3PCO B;  2ZT6 A;  2E3C A;  2ALY B;  1X2H A;  4LVL A;  1WNL A;  3RKX A;  2AKW A;  3RGL A;  4P73 A;  4YRK A;  3HY0 A;  1E22 A;  1EFW A;  3LSQ A;  1JJC B;  3ICA A;  3QNE A;  1WYD A;  2ZIM A;  1PYS A;  2QHU A;  4P71 A;  3KFU A;  4H2S A;  4XU2 A;  3PCO A;  4KQE A;  3LSS A;  4K87 A;  4XU3 A;  4TTV A;  2ALY A;  5HGQ A;  3HRK A;  2DJZ A;  1G51 A;  5F5W A;  2DXU A;  4LNS A;  4P72 A;  1NJ2 A;  1C0A A;  3I7F A;  4YRQ A;  4Q6G A;  1E1T A;  3IG2 A;  3NEN A;  4LVK A;  5K1P A;  1JJC A;  4H2U A;  1KMM A;  1E24 A;  4CH6 A;  3R07 A;  1B70 B;  1NYQ A;  5C51 B;  3NEM A;  4XEO A;  3CMQ A;  4P75 A;  3MF2 A;  4YP0 A;  4UPA A;  2DKG A;  3A7R A;  3P8Y A;  4YRC A;  4P3O A;  5K1X A;  3A5Z A;  3HXZ A;  2ZXF A;  3IAL A;  4YRJ A;  3TEG A;  1EIY B;  1BIA A;  4BW9 A;  4HWO A;  1H4Q A;  3MF1 A;  2ZIO A;  2IY5 B;  3RUX A;  3FJP A;  4YRM A;  3L1A A;  1USY A;  4YCU A;  2P5I A;  1X56 A;  3EFR A;  3UH0 A;  1YFS A;  3G1Z A;  3PZC A;  2CJB A;  2DEQ A;  2Q7E A;  4H2W A;  3P8V A;  4YRF A;  3A74 A;  2DQ3 A;  4XTV A;  3OD1 A;  2Q7G A;  1SES A;  4OP0 A;  1EIY A;  3VQX A;  1VQZ A;  2ZR2 A;  2DTO A;  2IY5 A;  1X55 A;  2A8E A;  4YRT A;  3HRI A;  3QO7 A;  3IKL A;  1YB3 A;  4RQE A;  4L87 A;  2DZC A;  3V7C A;  1G5H A;  2DDZ A;  3EFS A;  2J3L A;  3E9H A;  1BBW A;  2ZZG A;  2ZZE A;  4HWR A;  4XTZ A;  1Z7M A;  2Q7H A;  2ZNI A;  5ELO A;  3L2Z A;  2DZ9 A;  3VQW A;  4HT4 A;  3UGQ A;  1NNH A;  4AH6 A;  2EAY A;  1G5I A;  2FYK A;  1H4T A;  2CJ9 A;  2EJG A;  4CH4 A;  3RKY A;  4WJ4 A;  4UP7 A;  1B76 A;  1N9W A;  2EWN A;  2ZT8 A;  3QTC A;  3A32 A;  1QE0 A;  4K88 A;  4YPF A;  2ZZF A;  2ZT7 A;  1WLE A;  3M4P A;  3M4Q A;  4G85 A;  2I4N A;  2PMF A;  4RQF A;  4TVA A;  1RIQ A;  3RL6 A;  3P8T A;  3BFM A;  2ARS A;  2C8M A;  2E1H A;  4P73 C;  4PG3 A;  1EOV A;  1ADY A;  4YRG A;  4YRP A;  2P0L A;  2ZGW A;  4TWA A;  3V8K A;  1LYL A;  4P74 A;  4X5O A;  5ELN A;  2ZT5 A;  3VBB A;  1L0W A;  4ZTU B;  1BBU A;  4P71 C;  3UGT A;  1Z7N A;  4KR2 A;  3RIR A;  3VQV A;  2QHT A;  3A7A A;  4YRS A;  1B7Y A;  2I4O A;  3ERR A;  4YRE A;  2ZIN A;  3W3S A;  4P72 C;  2J3M A;  1EVL A;  1ADJ A;  1B8A A;  2AMC A;  3LC0 A;  1X54 A;  3A7U A;  4UP9 A;  4KR3 A;  2G4C A;  4H02 A;  3V8J A;  5C52 B;  1X2G A;  3RAC A;  4PHC A;  4CS4 A;  4P75 C;  2E5A A;  2DTI A;  2RHQ A;  4YRO A;  1NYR A;  1WQ7 A;  3HXU A;  1NJ8 A;  3HXY A;  2E10 A;  2CJA A;  2I4M A;  2ODR C;  2EJF A;  3REU A;  4LVM A;  1ASY A;  4HWS A;  4H2X B;  4Q15 A;  3L4G B;  4TVW A;  3MQZ A;  3V8L A;  4YRR A;  3HY1 A;  4EX5 A;  4CH3 A;  2I4L A;  1YFT A;  4YCV A;  4ZTZ B;  1USY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...