1YB3A

Conserved hypothetical protein pfu-178653-001 from pyrococcus furiosus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
166
structure length
166
Chain Sequence
MLKEVHELLNRIWGDIFELREELKEELKGFTVEEVSEVFNAYLYIDGKWEEMKYPHPAFAVKPGGEVGATPQGFYFVFAFPKEELSKEFIEDVIRAFEKLFIYGAENFLEDFYNFEHPISGDEVWDRIVNSDEEMINFEVDLGFDKEEVKREIKRFIELARRYNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved hypothetical protein Pfu-178653-001 from Pyrococcus furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
total genus 47
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2004-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11447 DUF3201 Protein of unknown function (DUF3201)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1yb3A00
2ARSA 1USYC 4P74C 2RHQA 4TVYA 3HFZB 2C8MA 3HXZA 4YREA 5ELOA 1E24A 3RKYA 3IKLA 1X54A 2ZGWA 3VBBA 4BWAA 3NENA 1YFRA 3HXWA 1H4VB 4CH3A 4H2XB 1JJCB 2QHUA 2ZCEA 3BJUA 4XU1A 1PYSB 1X2HA 4Q6GA 1FYFA 1KMMA 1B76A 2CIMA 2ZNJA 3QO7A 2ZZEA 2DTHA 2XGTA 2DU5A 3ICAA 3MEYA 3RL6A 2EJGA 1ADYA 1WLEA 3MF1A 3TEHB 4YRCA 1QE0A 4EO4A 3VQXA 2QHVA 3RUXA 4YCUA 3P8VA 3PZCA 3NETA 2I4LA 2CJ9A 2EAYA 2I4MA 2I4NA 4YCWA 1NJ6A 3PCOA 3A31A 4P75C 4YDQA 4PHCA 2EL9A 3P8YA 4H2SA 4CH5A 3QO5A 4TVWA 4X5OA 3REXA 4ZTZB 2J3MA 3HRKA 3V7SA 3MF2A 2E10A 3A5YA 1B8AA 3HFZA 2G4CA 1USYA 3TEHA 4P71C 2DTOA 4HWRA 1NNHA 4YRIA 2ODRD 3V8LA 4KR2A 4PG3A 4G84A 3FJPA 5F5WA 2PMEA 1WYDA 4WJ3M 2RHSB 3OD1A 3QO8A 4XTUA 4XTXA 4XEOA 3HFVA 2Q7GA 4P73C 2J3LA 3RIRA 1WU7A 1X01A 2DKGA 2ZZFA 1RIQA 3UFGA 4AH6A 2C7IA 4DQ2A 1G5HA 1B7YA 3HTZA 4P74A 5KNNA 4YP0A 1WNLA 5C53B 4CS2A 3G1ZA 2ZT6A 4XTZA 4OP0A 4Q15A 2DXTA 4YRJA 3HXXA 4TQDA 2DQ3A 4YRRA 4TVAA 4YCVA 4YRTA 4P72A 4J15A 4HWPA 4XTWA 1YB3A 1EIYB 3L4GA 1W66A 2DTIA 2ODRC 3HY1A 1HTTA 4E51A 2E5AA 2RHQB 3A7AA 4H2XA 1J5WA 4RQEA 1EQRA 2DZ9A 3V7RA 4XTVA 1KMNA 4KQEA 5C52B 3UH0A 3QTCA 3DSQA 3UGQA 1EVKA 1H4SA 4P75A 4TVAB 3LSQA 2ARUA 1N9WA 5K1XA 1EFWA 2AKWA 4H02A 1H4QA 1BBUA 4P3NA 3CMQA 1BIBA 3NEMA 4P72C 4CS3A 2QHTA 2ZIMA 2ZTGA 4DPGA 1ASZA 4YRSA 2E1HA 4XU3A 3E9HA 5C51B 1JJCA 4NCXA 2P0LA 3RKXA 1NYQA 3KFUA 4G85A 2IY5A 1EVLA 3WQZA 4OLFA 1X56A 2IY5B 2DU7A 1G51A 1WQ7A 1Z7MA 1B70B 3IG2A 2Q7EA 2AMCA 3E9IA 2ARTA 4XTYA 1WQWA 2Q5IA 3PCOB 2ZZGA 2AMCB 3M4PA 3P8TA 2P5IA 4K86A 4YYEA 1WPYA 2ALYA 1HC7A 3RF1A 2I4OA 3VQWA 3W3SA 1NJ1A 4HWTA 1NJ5A 11ASA 4O2DA 1X2GA 4YRMA 4LNSA 1L0WA 3TEGA 3ERRA 4H2YA 1E22A 4YRGA 4WJ4A 2DVEA 3A7UA 4KR3A 4CH6A 3NELA 4YRQA 1QF6A 4UP7A 3VQVA 12ASA 2ZT8A 1B7YB 1YFSA 4YRFA 4HVCA 2E65A 4UPAA 1YGBA 3L1AA 3I7FA 1SRYA 3IALA 2ZNIA 1B70A 1G5IA 3HXYA 2FYKA 1VQZA 3QNEA 3UGTA 3IKMB 1SETA 3REUA 4HA8A 3V8JA 1PYSA 4BW9A 2E64A 1E1OA 3M4QA 4TQFA 5E3IA 3VQYA 4YRNA 2ZIOA 2E3CA 2CJAA 4HWOA 2EWNA 3L4GB 4UP8A 4CS4A 1EOVA 4RMFA 1HXDA 3A7RA 2ZR2A 1Z7NA 1H4TA 2EJ9A 2QHSA 2EJFA 3RGLA 4RDXA 4P73A 3R07A 1BIAA 1EIYA 3HXUA 1ATIA 2RHSA 3EFSA 5K1PA 4CH4A 2XTIA 4WI1A 4K87A 3RKWA 1ASYA 4YRKA 4TTVA 4WF2A 4XU2A 1NJ2A 4HWSA 3HXVA 2Q7HA 1ADJA 4YPFA 2DQ0A 1GGMA 2ALYB 2CJBA 1SESA 3LSSA 3A5ZA 1IL2A 1X55A 1BBWA 4P3PA 1NJ8A 2CGHA 3EFRA 1NYRA 4H2WA 3A74A 4P3OA 2DDZA 2PMFA 2DEQA 2ZINA 2AKWB 2DJZA 3V7CA 2DZCA 5ELNA 2ZT7A 2DXUA 2HNIA 4XU0A 3RACA 1LYLA 1YFTA 3V8KA 3HRIA 4L87A 3LC0A 4ZTUB 2E41A 5HGQA 4H2VA 1KOGA 4P71A 3TUPA 4UP9A 4XEMA 2ZXFA 4ZIBA 4RQFA 4K88A 4EX5A 1E1TA 3A32A 3L2ZA 4YRLA 4YRPA 4H2UA 1SERA 3HY0A 1C0AA 4TWAA 2ZR3A 2Q5HA 4YROA 3BFMA 4H2TA 2ZT5A
chains in the Genus database with same CATH superfamily
2ARSA 1USYC 4P74C 2RHQA 4TVYA 3HFZB 2C8MA 3HXZA 4YREA 5ELOA 1E24A 3RKYA 3IKLA 1X54A 2ZGWA 3VBBA 4BWAA 3NENA 1YFRA 3HXWA 1H4VB 4CH3A 4H2XB 1JJCB 2QHUA 2ZCEA 3BJUA 4XU1A 1PYSB 1X2HA 4Q6GA 1FYFA 1KMMA 1B76A 2CIMA 2ZNJA 3QO7A 2ZZEA 2DTHA 2XGTA 2DU5A 3ICAA 3MEYA 3RL6A 2EJGA 1ADYA 1WLEA 3MF1A 3TEHB 4YRCA 1QE0A 4EO4A 3VQXA 2QHVA 3RUXA 4YCUA 3P8VA 3PZCA 3NETA 2I4LA 2CJ9A 2EAYA 2I4MA 2I4NA 4YCWA 1NJ6A 3PCOA 3A31A 4P75C 4YDQA 4PHCA 2EL9A 3P8YA 4H2SA 4CH5A 3QO5A 4TVWA 4X5OA 3REXA 4ZTZB 2J3MA 3HRKA 3V7SA 3MF2A 2E10A 3A5YA 1B8AA 3HFZA 2G4CA 1USYA 4LVIA 3TEHA 4P71C 2DTOA 4HWRA 1NNHA 4YRIA 2ODRD 3MQZA 3V8LA 4KR2A 4PG3A 4G84A 3FJPA 5F5WA 2PMEA 1WYDA 4WJ3M 2RHSB 3OD1A 3QO8A 4XTUA 4XTXA 4XEOA 3HFVA 2Q7GA 4P73C 2J3LA 3RIRA 1WU7A 1X01A 2DKGA 2ZZFA 1RIQA 3UFGA 4AH6A 2C7IA 4DQ2A 1G5HA 1B7YA 3HTZA 4P74A 5KNNA 4YP0A 1WNLA 5C53B 4CS2A 3G1ZA 2ZT6A 4XTZA 4OP0A 4Q15A 2DXTA 4YRJA 3HXXA 4TQDA 2DQ3A 4YRRA 4TVAA 4YCVA 4YRTA 4P72A 4LVMA 4J15A 4HWPA 4XTWA 1YB3A 1EIYB 3L4GA 1W66A 2DTIA 2ODRC 3HY1A 1HTTA 4E51A 4LVLA 2E5AA 2RHQB 3A7AA 4H2XA 1J5WA 4RQEA 1EQRA 2DZ9A 3V7RA 4XTVA 1KMNA 4KQEA 5C52B 3UH0A 3QTCA 3DSQA 3UGQA 1EVKA 1H4SA 4P75A 4TVAB 3LSQA 2ARUA 1N9WA 5K1XA 1EFWA 2AKWA 4H02A 1H4QA 1BBUA 4P3NA 3CMQA 1BIBA 3NEMA 4P72C 4CS3A 2QHTA 2ZIMA 2ZTGA 4DPGA 1ASZA 4YRSA 2E1HA 4XU3A 3E9HA 5C51B 1JJCA 4NCXA 2P0LA 3RKXA 1NYQA 3KFUA 4G85A 2IY5A 1EVLA 3WQZA 4OLFA 1X56A 2IY5B 2DU7A 1G51A 1WQ7A 1Z7MA 1B70B 3IG2A 2Q7EA 2AMCA 3E9IA 2ARTA 4XTYA 1WQWA 2Q5IA 3PCOB 2ZZGA 2AMCB 3M4PA 3P8TA 2P5IA 4K86A 4YYEA 1WPYA 2ALYA 1HC7A 3RF1A 2I4OA 3VQWA 3W3SA 1NJ1A 4HWTA 1NJ5A 11ASA 4O2DA 1X2GA 4YRMA 4LNSA 1L0WA 3TEGA 3ERRA 4H2YA 1E22A 4YRGA 4WJ4A 2DVEA 3A7UA 4KR3A 4CH6A 3NELA 4YRQA 1QF6A 4UP7A 3VQVA 12ASA 2ZT8A 1B7YB 1YFSA 4YRFA 4HVCA 2E65A 4UPAA 1YGBA 3L1AA 3I7FA 1SRYA 3IALA 2ZNIA 1B70A 1G5IA 3HXYA 2FYKA 1VQZA 3QNEA 3UGTA 3IKMB 1SETA 3REUA 4HA8A 3V8JA 1PYSA 4BW9A 2E64A 1E1OA 3M4QA 4TQFA 5E3IA 3VQYA 4YRNA 2ZIOA 2E3CA 2CJAA 4HWOA 2EWNA 3L4GB 4UP8A 4CS4A 1EOVA 4RMFA 1HXDA 3A7RA 2ZR2A 1Z7NA 1H4TA 2EJ9A 2QHSA 2EJFA 3RGLA 4RDXA 4P73A 3R07A 1BIAA 1EIYA 3HXUA 1ATIA 2RHSA 3EFSA 5K1PA 4CH4A 2XTIA 4WI1A 4K87A 3RKWA 1ASYA 4YRKA 4TTVA 4WF2A 2A8EA 4XU2A 1NJ2A 4HWSA 3HXVA 2Q7HA 1ADJA 4YPFA 2DQ0A 1GGMA 2ALYB 2CJBA 1SESA 2NS6A 3LSSA 3A5ZA 1IL2A 1X55A 1BBWA 4P3PA 1NJ8A 2CGHA 3EFRA 1NYRA 4H2WA 4LVJA 3A74A 4P3OA 2DDZA 2PMFA 2DEQA 2ZINA 2AKWB 2DJZA 3V7CA 2DZCA 5ELNA 2ZT7A 2DXUA 2HNIA 4XU0A 3RACA 1LYLA 1YFTA 3V8KA 3HRIA 4L87A 3LC0A 4ZTUB 2E41A 5HGQA 4H2VA 1KOGA 4P71A 3TUPA 4UP9A 4XEMA 2ZXFA 4ZIBA 4RQFA 4K88A 4EX5A 1E1TA 3A32A 3L2ZA 4YRLA 4YRPA 4H2UA 1SERA 3HY0A 1C0AA 4TWAA 4LVKA 2ZR3A 4HT4A 2Q5HA 4YROA 3BFMA 4H2TA 2ZT5A
chains in the Genus database with same CATH topology
2ARSA 1USYC 4P74C 2RHQA 4TVYA 3HFZB 2C8MA 3HXZA 4YREA 5ELOA 1E24A 3RKYA 3IKLA 1X54A 2ZGWA 3VBBA 4BWAA 3NENA 1YFRA 3HXWA 1H4VB 4CH3A 4H2XB 1JJCB 2QHUA 2ZCEA 3BJUA 4XU1A 1PYSB 1X2HA 4Q6GA 1FYFA 1KMMA 1B76A 2CIMA 2ZNJA 3QO7A 2ZZEA 2DTHA 2XGTA 2DU5A 3ICAA 3MEYA 3RL6A 2EJGA 1ADYA 1WLEA 3MF1A 3TEHB 4YRCA 1QE0A 4EO4A 3VQXA 2QHVA 3RUXA 4YCUA 3P8VA 3PZCA 3NETA 2I4LA 2CJ9A 2EAYA 2I4MA 2I4NA 4YCWA 1NJ6A 3PCOA 3A31A 4P75C 4YDQA 4PHCA 2EL9A 3P8YA 4H2SA 4CH5A 3QO5A 4TVWA 4X5OA 3REXA 4ZTZB 2J3MA 3HRKA 3V7SA 3MF2A 2E10A 3A5YA 1B8AA 3HFZA 2G4CA 1USYA 4LVIA 3TEHA 4P71C 2DTOA 4HWRA 1NNHA 4YRIA 2ODRD 3MQZA 3V8LA 4KR2A 4PG3A 4G84A 3FJPA 5F5WA 2PMEA 1WYDA 4WJ3M 2RHSB 3OD1A 3QO8A 4XTUA 4XTXA 4XEOA 3HFVA 2Q7GA 4P73C 2J3LA 3RIRA 1WU7A 1X01A 2DKGA 2ZZFA 1RIQA 3UFGA 4AH6A 2C7IA 4DQ2A 1G5HA 1B7YA 3HTZA 4P74A 5KNNA 4YP0A 1WNLA 5C53B 4CS2A 3G1ZA 2ZT6A 4XTZA 4OP0A 4Q15A 2DXTA 4YRJA 3HXXA 4TQDA 2DQ3A 4YRRA 4TVAA 4YCVA 4YRTA 4P72A 4LVMA 4J15A 4HWPA 4XTWA 1YB3A 1EIYB 3L4GA 1W66A 2DTIA 2ODRC 3HY1A 1HTTA 4E51A 4LVLA 2E5AA 2RHQB 3A7AA 4H2XA 1J5WA 4RQEA 1EQRA 2DZ9A 3V7RA 4XTVA 1KMNA 4KQEA 5C52B 3UH0A 3QTCA 3DSQA 3UGQA 1EVKA 1H4SA 4P75A 4TVAB 3LSQA 2ARUA 1N9WA 5K1XA 1EFWA 2AKWA 4H02A 1H4QA 1BBUA 4P3NA 3CMQA 1BIBA 3NEMA 4P72C 4CS3A 2QHTA 2ZIMA 2ZTGA 4DPGA 1ASZA 4YRSA 2E1HA 4XU3A 3E9HA 5C51B 1JJCA 4NCXA 2P0LA 3RKXA 1NYQA 3KFUA 4G85A 2IY5A 1EVLA 3WQZA 4OLFA 1X56A 2IY5B 2DU7A 1G51A 1WQ7A 1Z7MA 1B70B 3IG2A 2Q7EA 2AMCA 3E9IA 2ARTA 4XTYA 1WQWA 2Q5IA 3PCOB 2ZZGA 2AMCB 3M4PA 3P8TA 2P5IA 4K86A 4YYEA 1WPYA 2ALYA 1HC7A 3RF1A 2I4OA 3VQWA 3W3SA 1NJ1A 4HWTA 1NJ5A 11ASA 4O2DA 1X2GA 4YRMA 4LNSA 1L0WA 3TEGA 3ERRA 4H2YA 1E22A 4YRGA 4WJ4A 2DVEA 3A7UA 4KR3A 4CH6A 3NELA 4YRQA 1QF6A 4UP7A 3VQVA 12ASA 2ZT8A 1B7YB 1YFSA 4YRFA 4HVCA 2E65A 4UPAA 1YGBA 3L1AA 3I7FA 1SRYA 3IALA 2ZNIA 1B70A 1G5IA 3HXYA 2FYKA 1VQZA 3QNEA 3UGTA 3IKMB 1SETA 3REUA 4HA8A 3V8JA 1PYSA 4BW9A 2E64A 1E1OA 3M4QA 4TQFA 5E3IA 3VQYA 4YRNA 2ZIOA 2E3CA 2CJAA 4HWOA 2EWNA 3L4GB 4UP8A 4CS4A 1EOVA 4RMFA 1HXDA 3A7RA 2ZR2A 1Z7NA 1H4TA 2EJ9A 2QHSA 2EJFA 3RGLA 4RDXA 4P73A 3R07A 1BIAA 1EIYA 3HXUA 1ATIA 2RHSA 3EFSA 5K1PA 4CH4A 2XTIA 4WI1A 4K87A 3RKWA 1ASYA 4YRKA 4TTVA 4WF2A 2A8EA 4XU2A 1NJ2A 4HWSA 3HXVA 2Q7HA 1ADJA 4YPFA 2DQ0A 1GGMA 2ALYB 2CJBA 1SESA 2NS6A 3LSSA 3A5ZA 1IL2A 1X55A 1BBWA 4P3PA 1NJ8A 2CGHA 3EFRA 1NYRA 4H2WA 4LVJA 3A74A 4P3OA 2DDZA 2PMFA 2DEQA 2ZINA 2AKWB 2DJZA 3V7CA 2DZCA 5ELNA 2ZT7A 2DXUA 2HNIA 4XU0A 3RACA 1LYLA 1YFTA 3V8KA 3HRIA 4L87A 3LC0A 4ZTUB 2E41A 5HGQA 4H2VA 1KOGA 4P71A 3TUPA 4UP9A 4XEMA 2ZXFA 4ZIBA 4RQFA 4K88A 4EX5A 1E1TA 3A32A 3L2ZA 4YRLA 4YRPA 4H2UA 1SERA 3HY0A 1C0AA 4TWAA 4LVKA 2ZR3A 4HT4A 2Q5HA 4YROA 3BFMA 4H2TA 2ZT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ARS A;  1USY C;  4P74 C;  2RHQ A;  4TVY A;  3HFZ B;  2C8M A;  3HXZ A;  4YRE A;  5ELO A;  1E24 A;  3RKY A;  3IKL A;  1X54 A;  2ZGW A;  3VBB A;  4BWA A;  3NEN A;  1YFR A;  3HXW A;  1H4V B;  4CH3 A;  4H2X B;  1JJC B;  2QHU A;  2ZCE A;  3BJU A;  4XU1 A;  1PYS B;  1X2H A;  4Q6G A;  1FYF A;  1KMM A;  1B76 A;  2CIM A;  2ZNJ A;  3QO7 A;  2ZZE A;  2DTH A;  2XGT A;  2DU5 A;  3ICA A;  3MEY A;  3RL6 A;  2EJG A;  1ADY A;  1WLE A;  3MF1 A;  3TEH B;  4YRC A;  1QE0 A;  4EO4 A;  3VQX A;  2QHV A;  3RUX A;  4YCU A;  3P8V A;  3PZC A;  3NET A;  2I4L A;  2CJ9 A;  2EAY A;  2I4M A;  2I4N A;  4YCW A;  1NJ6 A;  3PCO A;  3A31 A;  4P75 C;  4YDQ A;  4PHC A;  2EL9 A;  3P8Y A;  4H2S A;  4CH5 A;  3QO5 A;  4TVW A;  4X5O A;  3REX A;  4ZTZ B;  2J3M A;  3HRK A;  3V7S A;  3MF2 A;  2E10 A;  3A5Y A;  1B8A A;  3HFZ A;  2G4C A;  1USY A;  3TEH A;  4P71 C;  2DTO A;  4HWR A;  1NNH A;  4YRI A;  2ODR D;  3V8L A;  4KR2 A;  4PG3 A;  4G84 A;  3FJP A;  5F5W A;  2PME A;  1WYD A;  4WJ3 M;  2RHS B;  3OD1 A;  3QO8 A;  4XTU A;  4XTX A;  4XEO A;  3HFV A;  2Q7G A;  4P73 C;  2J3L A;  3RIR A;  1WU7 A;  1X01 A;  2DKG A;  2ZZF A;  1RIQ A;  3UFG A;  4AH6 A;  2C7I A;  4DQ2 A;  1G5H A;  1B7Y A;  3HTZ A;  4P74 A;  5KNN A;  4YP0 A;  1WNL A;  5C53 B;  4CS2 A;  3G1Z A;  2ZT6 A;  4XTZ A;  4OP0 A;  4Q15 A;  2DXT A;  4YRJ A;  3HXX A;  4TQD A;  2DQ3 A;  4YRR A;  4TVA A;  4YCV A;  4YRT A;  4P72 A;  4J15 A;  4HWP A;  4XTW A;  1YB3 A;  1EIY B;  3L4G A;  1W66 A;  2DTI A;  2ODR C;  3HY1 A;  1HTT A;  4E51 A;  2E5A A;  2RHQ B;  3A7A A;  4H2X A;  1J5W A;  4RQE A;  1EQR A;  2DZ9 A;  3V7R A;  4XTV A;  1KMN A;  4KQE A;  5C52 B;  3UH0 A;  3QTC A;  3DSQ A;  3UGQ A;  1EVK A;  1H4S A;  4P75 A;  4TVA B;  3LSQ A;  2ARU A;  1N9W A;  5K1X A;  1EFW A;  2AKW A;  4H02 A;  1H4Q A;  1BBU A;  4P3N A;  3CMQ A;  1BIB A;  3NEM A;  4P72 C;  4CS3 A;  2QHT A;  2ZIM A;  2ZTG A;  4DPG A;  1ASZ A;  4YRS A;  2E1H A;  4XU3 A;  3E9H A;  5C51 B;  1JJC A;  4NCX A;  2P0L A;  3RKX A;  1NYQ A;  3KFU A;  4G85 A;  2IY5 A;  1EVL A;  3WQZ A;  4OLF A;  1X56 A;  2IY5 B;  2DU7 A;  1G51 A;  1WQ7 A;  1Z7M A;  1B70 B;  3IG2 A;  2Q7E A;  2AMC A;  3E9I A;  2ART A;  4XTY A;  1WQW A;  2Q5I A;  3PCO B;  2ZZG A;  2AMC B;  3M4P A;  3P8T A;  2P5I A;  4K86 A;  4YYE A;  1WPY A;  2ALY A;  1HC7 A;  3RF1 A;  2I4O A;  3VQW A;  3W3S A;  1NJ1 A;  4HWT A;  1NJ5 A;  11AS A;  4O2D A;  1X2G A;  4YRM A;  4LNS A;  1L0W A;  3TEG A;  3ERR A;  4H2Y A;  1E22 A;  4YRG A;  4WJ4 A;  2DVE A;  3A7U A;  4KR3 A;  4CH6 A;  3NEL A;  4YRQ A;  1QF6 A;  4UP7 A;  3VQV A;  12AS A;  2ZT8 A;  1B7Y B;  1YFS A;  4YRF A;  4HVC A;  2E65 A;  4UPA A;  1YGB A;  3L1A A;  3I7F A;  1SRY A;  3IAL A;  2ZNI A;  1B70 A;  1G5I A;  3HXY A;  2FYK A;  1VQZ A;  3QNE A;  3UGT A;  3IKM B;  1SET A;  3REU A;  4HA8 A;  3V8J A;  1PYS A;  4BW9 A;  2E64 A;  1E1O A;  3M4Q A;  4TQF A;  5E3I A;  3VQY A;  4YRN A;  2ZIO A;  2E3C A;  2CJA A;  4HWO A;  2EWN A;  3L4G B;  4UP8 A;  4CS4 A;  1EOV A;  4RMF A;  1HXD A;  3A7R A;  2ZR2 A;  1Z7N A;  1H4T A;  2EJ9 A;  2QHS A;  2EJF A;  3RGL A;  4RDX A;  4P73 A;  3R07 A;  1BIA A;  1EIY A;  3HXU A;  1ATI A;  2RHS A;  3EFS A;  5K1P A;  4CH4 A;  2XTI A;  4WI1 A;  4K87 A;  3RKW A;  1ASY A;  4YRK A;  4TTV A;  4WF2 A;  4XU2 A;  1NJ2 A;  4HWS A;  3HXV A;  2Q7H A;  1ADJ A;  4YPF A;  2DQ0 A;  1GGM A;  2ALY B;  2CJB A;  1SES A;  3LSS A;  3A5Z A;  1IL2 A;  1X55 A;  1BBW A;  4P3P A;  1NJ8 A;  2CGH A;  3EFR A;  1NYR A;  4H2W A;  3A74 A;  4P3O A;  2DDZ A;  2PMF A;  2DEQ A;  2ZIN A;  2AKW B;  2DJZ A;  3V7C A;  2DZC A;  5ELN A;  2ZT7 A;  2DXU A;  2HNI A;  4XU0 A;  3RAC A;  1LYL A;  1YFT A;  3V8K A;  3HRI A;  4L87 A;  3LC0 A;  4ZTU B;  2E41 A;  5HGQ A;  4H2V A;  1KOG A;  4P71 A;  3TUP A;  4UP9 A;  4XEM A;  2ZXF A;  4ZIB A;  4RQF A;  4K88 A;  4EX5 A;  1E1T A;  3A32 A;  3L2Z A;  4YRL A;  4YRP A;  4H2U A;  1SER A;  3HY0 A;  1C0A A;  4TWA A;  2ZR3 A;  2Q5H A;  4YRO A;  3BFM A;  4H2T A;  2ZT5 A; 
#chains in the Genus database with same CATH topology
 2ARS A;  1USY C;  4P74 C;  2RHQ A;  4TVY A;  3HFZ B;  2C8M A;  3HXZ A;  4YRE A;  5ELO A;  1E24 A;  3RKY A;  3IKL A;  1X54 A;  2ZGW A;  3VBB A;  4BWA A;  3NEN A;  1YFR A;  3HXW A;  1H4V B;  4CH3 A;  4H2X B;  1JJC B;  2QHU A;  2ZCE A;  3BJU A;  4XU1 A;  1PYS B;  1X2H A;  4Q6G A;  1FYF A;  1KMM A;  1B76 A;  2CIM A;  2ZNJ A;  3QO7 A;  2ZZE A;  2DTH A;  2XGT A;  2DU5 A;  3ICA A;  3MEY A;  3RL6 A;  2EJG A;  1ADY A;  1WLE A;  3MF1 A;  3TEH B;  4YRC A;  1QE0 A;  4EO4 A;  3VQX A;  2QHV A;  3RUX A;  4YCU A;  3P8V A;  3PZC A;  3NET A;  2I4L A;  2CJ9 A;  2EAY A;  2I4M A;  2I4N A;  4YCW A;  1NJ6 A;  3PCO A;  3A31 A;  4P75 C;  4YDQ A;  4PHC A;  2EL9 A;  3P8Y A;  4H2S A;  4CH5 A;  3QO5 A;  4TVW A;  4X5O A;  3REX A;  4ZTZ B;  2J3M A;  3HRK A;  3V7S A;  3MF2 A;  2E10 A;  3A5Y A;  1B8A A;  3HFZ A;  2G4C A;  1USY A;  4LVI A;  3TEH A;  4P71 C;  2DTO A;  4HWR A;  1NNH A;  4YRI A;  2ODR D;  3MQZ A;  3V8L A;  4KR2 A;  4PG3 A;  4G84 A;  3FJP A;  5F5W A;  2PME A;  1WYD A;  4WJ3 M;  2RHS B;  3OD1 A;  3QO8 A;  4XTU A;  4XTX A;  4XEO A;  3HFV A;  2Q7G A;  4P73 C;  2J3L A;  3RIR A;  1WU7 A;  1X01 A;  2DKG A;  2ZZF A;  1RIQ A;  3UFG A;  4AH6 A;  2C7I A;  4DQ2 A;  1G5H A;  1B7Y A;  3HTZ A;  4P74 A;  5KNN A;  4YP0 A;  1WNL A;  5C53 B;  4CS2 A;  3G1Z A;  2ZT6 A;  4XTZ A;  4OP0 A;  4Q15 A;  2DXT A;  4YRJ A;  3HXX A;  4TQD A;  2DQ3 A;  4YRR A;  4TVA A;  4YCV A;  4YRT A;  4P72 A;  4LVM A;  4J15 A;  4HWP A;  4XTW A;  1YB3 A;  1EIY B;  3L4G A;  1W66 A;  2DTI A;  2ODR C;  3HY1 A;  1HTT A;  4E51 A;  4LVL A;  2E5A A;  2RHQ B;  3A7A A;  4H2X A;  1J5W A;  4RQE A;  1EQR A;  2DZ9 A;  3V7R A;  4XTV A;  1KMN A;  4KQE A;  5C52 B;  3UH0 A;  3QTC A;  3DSQ A;  3UGQ A;  1EVK A;  1H4S A;  4P75 A;  4TVA B;  3LSQ A;  2ARU A;  1N9W A;  5K1X A;  1EFW A;  2AKW A;  4H02 A;  1H4Q A;  1BBU A;  4P3N A;  3CMQ A;  1BIB A;  3NEM A;  4P72 C;  4CS3 A;  2QHT A;  2ZIM A;  2ZTG A;  4DPG A;  1ASZ A;  4YRS A;  2E1H A;  4XU3 A;  3E9H A;  5C51 B;  1JJC A;  4NCX A;  2P0L A;  3RKX A;  1NYQ A;  3KFU A;  4G85 A;  2IY5 A;  1EVL A;  3WQZ A;  4OLF A;  1X56 A;  2IY5 B;  2DU7 A;  1G51 A;  1WQ7 A;  1Z7M A;  1B70 B;  3IG2 A;  2Q7E A;  2AMC A;  3E9I A;  2ART A;  4XTY A;  1WQW A;  2Q5I A;  3PCO B;  2ZZG A;  2AMC B;  3M4P A;  3P8T A;  2P5I A;  4K86 A;  4YYE A;  1WPY A;  2ALY A;  1HC7 A;  3RF1 A;  2I4O A;  3VQW A;  3W3S A;  1NJ1 A;  4HWT A;  1NJ5 A;  11AS A;  4O2D A;  1X2G A;  4YRM A;  4LNS A;  1L0W A;  3TEG A;  3ERR A;  4H2Y A;  1E22 A;  4YRG A;  4WJ4 A;  2DVE A;  3A7U A;  4KR3 A;  4CH6 A;  3NEL A;  4YRQ A;  1QF6 A;  4UP7 A;  3VQV A;  12AS A;  2ZT8 A;  1B7Y B;  1YFS A;  4YRF A;  4HVC A;  2E65 A;  4UPA A;  1YGB A;  3L1A A;  3I7F A;  1SRY A;  3IAL A;  2ZNI A;  1B70 A;  1G5I A;  3HXY A;  2FYK A;  1VQZ A;  3QNE A;  3UGT A;  3IKM B;  1SET A;  3REU A;  4HA8 A;  3V8J A;  1PYS A;  4BW9 A;  2E64 A;  1E1O A;  3M4Q A;  4TQF A;  5E3I A;  3VQY A;  4YRN A;  2ZIO A;  2E3C A;  2CJA A;  4HWO A;  2EWN A;  3L4G B;  4UP8 A;  4CS4 A;  1EOV A;  4RMF A;  1HXD A;  3A7R A;  2ZR2 A;  1Z7N A;  1H4T A;  2EJ9 A;  2QHS A;  2EJF A;  3RGL A;  4RDX A;  4P73 A;  3R07 A;  1BIA A;  1EIY A;  3HXU A;  1ATI A;  2RHS A;  3EFS A;  5K1P A;  4CH4 A;  2XTI A;  4WI1 A;  4K87 A;  3RKW A;  1ASY A;  4YRK A;  4TTV A;  4WF2 A;  2A8E A;  4XU2 A;  1NJ2 A;  4HWS A;  3HXV A;  2Q7H A;  1ADJ A;  4YPF A;  2DQ0 A;  1GGM A;  2ALY B;  2CJB A;  1SES A;  2NS6 A;  3LSS A;  3A5Z A;  1IL2 A;  1X55 A;  1BBW A;  4P3P A;  1NJ8 A;  2CGH A;  3EFR A;  1NYR A;  4H2W A;  4LVJ A;  3A74 A;  4P3O A;  2DDZ A;  2PMF A;  2DEQ A;  2ZIN A;  2AKW B;  2DJZ A;  3V7C A;  2DZC A;  5ELN A;  2ZT7 A;  2DXU A;  2HNI A;  4XU0 A;  3RAC A;  1LYL A;  1YFT A;  3V8K A;  3HRI A;  4L87 A;  3LC0 A;  4ZTU B;  2E41 A;  5HGQ A;  4H2V A;  1KOG A;  4P71 A;  3TUP A;  4UP9 A;  4XEM A;  2ZXF A;  4ZIB A;  4RQF A;  4K88 A;  4EX5 A;  1E1T A;  3A32 A;  3L2Z A;  4YRL A;  4YRP A;  4H2U A;  1SER A;  3HY0 A;  1C0A A;  4TWA A;  4LVK A;  2ZR3 A;  4HT4 A;  2Q5H A;  4YRO A;  3BFM A;  4H2T A;  2ZT5 A; 
#chains in the Genus database with same CATH homology
 2ARS A;  1USY C;  4P74 C;  2RHQ A;  4TVY A;  3HFZ B;  2C8M A;  3HXZ A;  4YRE A;  5ELO A;  1E24 A;  3RKY A;  3IKL A;  1X54 A;  2ZGW A;  3VBB A;  4BWA A;  3NEN A;  1YFR A;  3HXW A;  1H4V B;  4CH3 A;  4H2X B;  1JJC B;  2QHU A;  2ZCE A;  3BJU A;  4XU1 A;  1PYS B;  1X2H A;  4Q6G A;  1FYF A;  1KMM A;  1B76 A;  2CIM A;  2ZNJ A;  3QO7 A;  2ZZE A;  2DTH A;  2XGT A;  2DU5 A;  3ICA A;  3MEY A;  3RL6 A;  2EJG A;  1ADY A;  1WLE A;  3MF1 A;  3TEH B;  4YRC A;  1QE0 A;  4EO4 A;  3VQX A;  2QHV A;  3RUX A;  4YCU A;  3P8V A;  3PZC A;  3NET A;  2I4L A;  2CJ9 A;  2EAY A;  2I4M A;  2I4N A;  4YCW A;  1NJ6 A;  3PCO A;  3A31 A;  4P75 C;  4YDQ A;  4PHC A;  2EL9 A;  3P8Y A;  4H2S A;  4CH5 A;  3QO5 A;  4TVW A;  4X5O A;  3REX A;  4ZTZ B;  2J3M A;  3HRK A;  3V7S A;  3MF2 A;  2E10 A;  3A5Y A;  1B8A A;  3HFZ A;  2G4C A;  1USY A;  4LVI A;  3TEH A;  4P71 C;  2DTO A;  4HWR A;  1NNH A;  4YRI A;  2ODR D;  3MQZ A;  3V8L A;  4KR2 A;  4PG3 A;  4G84 A;  3FJP A;  5F5W A;  2PME A;  1WYD A;  4WJ3 M;  2RHS B;  3OD1 A;  3QO8 A;  4XTU A;  4XTX A;  4XEO A;  3HFV A;  2Q7G A;  4P73 C;  2J3L A;  3RIR A;  1WU7 A;  1X01 A;  2DKG A;  2ZZF A;  1RIQ A;  3UFG A;  4AH6 A;  2C7I A;  4DQ2 A;  1G5H A;  1B7Y A;  3HTZ A;  4P74 A;  5KNN A;  4YP0 A;  1WNL A;  5C53 B;  4CS2 A;  3G1Z A;  2ZT6 A;  4XTZ A;  4OP0 A;  4Q15 A;  2DXT A;  4YRJ A;  3HXX A;  4TQD A;  2DQ3 A;  4YRR A;  4TVA A;  4YCV A;  4YRT A;  4P72 A;  4LVM A;  4J15 A;  4HWP A;  4XTW A;  1YB3 A;  1EIY B;  3L4G A;  1W66 A;  2DTI A;  2ODR C;  3HY1 A;  1HTT A;  4E51 A;  4LVL A;  2E5A A;  2RHQ B;  3A7A A;  4H2X A;  1J5W A;  4RQE A;  1EQR A;  2DZ9 A;  3V7R A;  4XTV A;  1KMN A;  4KQE A;  5C52 B;  3UH0 A;  3QTC A;  3DSQ A;  3UGQ A;  1EVK A;  1H4S A;  4P75 A;  4TVA B;  3LSQ A;  2ARU A;  1N9W A;  5K1X A;  1EFW A;  2AKW A;  4H02 A;  1H4Q A;  1BBU A;  4P3N A;  3CMQ A;  1BIB A;  3NEM A;  4P72 C;  4CS3 A;  2QHT A;  2ZIM A;  2ZTG A;  4DPG A;  1ASZ A;  4YRS A;  2E1H A;  4XU3 A;  3E9H A;  5C51 B;  1JJC A;  4NCX A;  2P0L A;  3RKX A;  1NYQ A;  3KFU A;  4G85 A;  2IY5 A;  1EVL A;  3WQZ A;  4OLF A;  1X56 A;  2IY5 B;  2DU7 A;  1G51 A;  1WQ7 A;  1Z7M A;  1B70 B;  3IG2 A;  2Q7E A;  2AMC A;  3E9I A;  2ART A;  4XTY A;  1WQW A;  2Q5I A;  3PCO B;  2ZZG A;  2AMC B;  3M4P A;  3P8T A;  2P5I A;  4K86 A;  4YYE A;  1WPY A;  2ALY A;  1HC7 A;  3RF1 A;  2I4O A;  3VQW A;  3W3S A;  1NJ1 A;  4HWT A;  1NJ5 A;  11AS A;  4O2D A;  1X2G A;  4YRM A;  4LNS A;  1L0W A;  3TEG A;  3ERR A;  4H2Y A;  1E22 A;  4YRG A;  4WJ4 A;  2DVE A;  3A7U A;  4KR3 A;  4CH6 A;  3NEL A;  4YRQ A;  1QF6 A;  4UP7 A;  3VQV A;  12AS A;  2ZT8 A;  1B7Y B;  1YFS A;  4YRF A;  4HVC A;  2E65 A;  4UPA A;  1YGB A;  3L1A A;  3I7F A;  1SRY A;  3IAL A;  2ZNI A;  1B70 A;  1G5I A;  3HXY A;  2FYK A;  1VQZ A;  3QNE A;  3UGT A;  3IKM B;  1SET A;  3REU A;  4HA8 A;  3V8J A;  1PYS A;  4BW9 A;  2E64 A;  1E1O A;  3M4Q A;  4TQF A;  5E3I A;  3VQY A;  4YRN A;  2ZIO A;  2E3C A;  2CJA A;  4HWO A;  2EWN A;  3L4G B;  4UP8 A;  4CS4 A;  1EOV A;  4RMF A;  1HXD A;  3A7R A;  2ZR2 A;  1Z7N A;  1H4T A;  2EJ9 A;  2QHS A;  2EJF A;  3RGL A;  4RDX A;  4P73 A;  3R07 A;  1BIA A;  1EIY A;  3HXU A;  1ATI A;  2RHS A;  3EFS A;  5K1P A;  4CH4 A;  2XTI A;  4WI1 A;  4K87 A;  3RKW A;  1ASY A;  4YRK A;  4TTV A;  4WF2 A;  2A8E A;  4XU2 A;  1NJ2 A;  4HWS A;  3HXV A;  2Q7H A;  1ADJ A;  4YPF A;  2DQ0 A;  1GGM A;  2ALY B;  2CJB A;  1SES A;  2NS6 A;  3LSS A;  3A5Z A;  1IL2 A;  1X55 A;  1BBW A;  4P3P A;  1NJ8 A;  2CGH A;  3EFR A;  1NYR A;  4H2W A;  4LVJ A;  3A74 A;  4P3O A;  2DDZ A;  2PMF A;  2DEQ A;  2ZIN A;  2AKW B;  2DJZ A;  3V7C A;  2DZC A;  5ELN A;  2ZT7 A;  2DXU A;  2HNI A;  4XU0 A;  3RAC A;  1LYL A;  1YFT A;  3V8K A;  3HRI A;  4L87 A;  3LC0 A;  4ZTU B;  2E41 A;  5HGQ A;  4H2V A;  1KOG A;  4P71 A;  3TUP A;  4UP9 A;  4XEM A;  2ZXF A;  4ZIB A;  4RQF A;  4K88 A;  4EX5 A;  1E1T A;  3A32 A;  3L2Z A;  4YRL A;  4YRP A;  4H2U A;  1SER A;  3HY0 A;  1C0A A;  4TWA A;  4LVK A;  2ZR3 A;  4HT4 A;  2Q5H A;  4YRO A;  3BFM A;  4H2T A;  2ZT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...