1YB3A

Conserved hypothetical protein pfu-178653-001 from pyrococcus furiosus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
166
structure length
166
Chain Sequence
MLKEVHELLNRIWGDIFELREELKEELKGFTVEEVSEVFNAYLYIDGKWEEMKYPHPAFAVKPGGEVGATPQGFYFVFAFPKEELSKEFIEDVIRAFEKLFIYGAENFLEDFYNFEHPISGDEVWDRIVNSDEEMINFEVDLGFDKEEVKREIKRFIELARRYNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved hypothetical protein Pfu-178653-001 from Pyrococcus furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
total genus 47
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2004-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11447 DUF3201 Protein of unknown function (DUF3201)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1yb3A00
11ASA 4AH6A 1B76A 1KOGA 3M4QA 3A32A 4P75A 1J5WA 3NENA 4NCXA 3TEGA 1E24A 2XGTA 4YRQA 4YPFA 2I4OA 4YRPA 1PYSB 4H2XA 2Q7HA 4P72C 3HTZA 3RGLA 3TUPA 1SESA 3IG2A 2ZXFA 1IL2A 4XEMA 3L4GB 4ZTZB 1LYLA 4P3PA 4TVWA 2ZTGA 1WPYA 2XTIA 1BIBA 2IY5B 4UP9A 4CH5A 3HRIA 2DXTA 1WU7A 3RKWA 1X54A 4YRTA 4WF2A 3VQWA 4HWSA 4TVAB 4EX5A 4PHCA 2ZNJA 4L87A 4P72A 1G51A 4YRGA 1YFSA 2ZT5A 4H2YA 1ASZA 3QO7A 4E51A 4ZIBA 5K1XA 1B8AA 1WQWA 1EQRA 4XTZA 4P74C 3HXZA 5K1PA 4HWPA 2ODRC 2ZGWA 2CJ9A 4K86A 1FYFA 2DTHA 1EIYB 4OLFA 4RQEA 1H4VB 1X56A 4TTVA 4YRIA 2DU7A 3LSQA 1EVKA 4J15A 4XU3A 3RIRA 3HFZA 3LSSA 4DQ2A 1YFRA 4P71C 4YRCA 4P74A 2AKWA 3A31A 1WLEA 2CIMA 2P5IA 1B70A 2ZR2A 4CS3A 2ZNIA 1VQZA 1QF6A 4YYEA 3RKXA 4XU2A 2ZT8A 4TQDA 4CS4A 3TEHA 3IKMB 4YRMA 2QHTA 4P73A 1YFTA 4YREA 2DU5A 2ZT6A 1N9WA 2ARUA 1NNHA 1SRYA 1EVLA 2RHSB 4RDXA 4KR3A 2E64A 1PYSA 2I4MA 3P8YA 2DZ9A 4O2DA 4P3OA 2ZZFA 1C0AA 3MF2A 4YRRA 4H2VA 4H2WA 4K88A 3RACA 3V7CA 4DPGA 2ZT7A 2C7IA 1H4SA 3REXA 1BBUA 1YGBA 2Q5IA 2E41A 3PCOB 1NYQA 4CH6A 1NJ8A 3DSQA 4H2SA 4UPAA 4H2XB 4YCVA 4H2TA 3V8JA 4WJ4A 3E9IA 3PZCA 3VQYA 2ODRD 2EAYA 3FJPA 4WJ3M 2DKGA 3G1ZA 2DXUA 3UGTA 2E1HA 4UP8A 4RMFA 1H4QA 4YCUA 1NJ5A 4YDQA 2E10A 2I4LA 1B7YA 2ARSA 1X2HA 1SETA 3VBBA 2EL9A 4YRJA 3L4GA 2DQ0A 1BIAA 3RL6A 3A5YA 5C53B 4YRFA 4CH3A 2QHVA 2ZIOA 1WNLA 1ADJA 5F5WA 2ZZGA 1X01A 2EWNA 4XEOA 3P8TA 4KQEA 4PG3A 2RHQA 1G5IA 2E5AA 4OP0A 2ZINA 1KMNA 3EFSA 1NYRA 4TQFA 1HXDA 2DEQA 4HWTA 4HWRA 2AMCB 3A7RA 4TVYA 1B7YB 2ZR3A 2C8MA 1ATIA 3R07A 4XTWA 4X5OA 5ELNA 4XTVA 3VQXA 3HXUA 4P75C 2AKWB 2RHSA 4G85A 3IKLA 4RQFA 4H02A 3NELA 2DQ3A 3OD1A 1USYA 3V7RA 1YB3A 3UH0A 1E1TA 2Q7EA 2QHSA 3UGQA 3MEYA 4YROA 1SERA 2IY5A 3P8VA 4Q15A 4CH4A 3HXXA 4P71A 3L2ZA 2Q7GA 3A7UA 1E1OA 4YRNA 3A74A 3V8LA 2CJBA 3KFUA 3ICAA 1L0WA 3QO5A 4BWAA 3LC0A 2DTOA 3QNEA 2J3MA 2PMFA 4HVCA 2DDZA 1G5HA 1WQ7A 2CJAA 3IALA 4LNSA 1EOVA 1H4TA 4XTYA 5C52B 4XU0A 3CMQA 1QE0A 3VQVA 1NJ1A 3M4PA 1W66A 4ZTUB 2G4CA 2DZCA 4UP7A 2RHQB 4P3NA 3UFGA 1RIQA 4EO4A 2CGHA 1HTTA 3V8KA 2ZCEA 4G84A 4WI1A 4XTXA 3HFVA 2QHUA 3HFZB 1NJ6A 4BW9A 1JJCB 1KMMA 3TEHB 3NETA 4K87A 1USYC 4HA8A 3HXVA 3BFMA 3V7SA 3L1AA 3HXWA 3NEMA 3MF1A 2AMCA 4YRLA 3W3SA 5E3IA 2ALYA 3HRKA 4YRSA 1X2GA 3BJUA 3A5ZA 4HWOA 2E65A 2HNIA 2ZIMA 4TWAA 4P73C 3RUXA 4YRKA 2DTIA 2PMEA 3E9HA 1E22A 1B70B 3A7AA 3EFRA 1WYDA 4Q6GA 2FYKA 4YCWA 2ARTA 4TVAA 1BBWA 2DVEA 1Z7NA 2Q5HA 1EIYA 4KR2A 3HY1A 3I7FA 2I4NA 3HY0A 3QO8A 4CS2A 12ASA 1X55A 3ERRA 4H2UA 1ADYA 4XU1A 1HC7A 1ASYA 3PCOA 2EJGA 5ELOA 3WQZA 3HXYA 1Z7MA 2P0LA 5C51B 2EJ9A 3RF1A 3REUA 1NJ2A 4XTUA 2DJZA 3RKYA 1GGMA 2ZZEA 1EFWA 2EJFA 5KNNA 2E3CA 1JJCA 2J3LA 3QTCA 4YP0A 2ALYB 5HGQA
chains in the Genus database with same CATH superfamily
11ASA 4AH6A 1B76A 1KOGA 3M4QA 3A32A 4P75A 1J5WA 3NENA 4NCXA 3TEGA 4HT4A 1E24A 2XGTA 4YRQA 4YPFA 2I4OA 4YRPA 1PYSB 4H2XA 2Q7HA 4P72C 3HTZA 3RGLA 3TUPA 1SESA 3IG2A 2ZXFA 1IL2A 4XEMA 3L4GB 4ZTZB 1LYLA 4P3PA 4TVWA 2ZTGA 1WPYA 2XTIA 1BIBA 2IY5B 4UP9A 4CH5A 3HRIA 2DXTA 1WU7A 3RKWA 1X54A 4YRTA 4WF2A 3VQWA 4HWSA 4TVAB 4EX5A 2NS6A 4PHCA 2ZNJA 4L87A 4P72A 1G51A 4YRGA 1YFSA 2ZT5A 4H2YA 1ASZA 3QO7A 4E51A 4ZIBA 5K1XA 1B8AA 1WQWA 1EQRA 4XTZA 4LVKA 4P74C 3HXZA 5K1PA 4HWPA 2ODRC 2ZGWA 2CJ9A 4K86A 1FYFA 2DTHA 1EIYB 4OLFA 4RQEA 1H4VB 1X56A 4TTVA 4YRIA 2DU7A 3LSQA 1EVKA 4J15A 4XU3A 3RIRA 3HFZA 3LSSA 4DQ2A 1YFRA 4P71C 4YRCA 4P74A 2AKWA 3A31A 1WLEA 2CIMA 2P5IA 1B70A 2ZR2A 4CS3A 2ZNIA 1VQZA 1QF6A 4YYEA 3RKXA 4XU2A 2ZT8A 4TQDA 4CS4A 3TEHA 3IKMB 4YRMA 2QHTA 4P73A 1YFTA 4YREA 4LVMA 2DU5A 2ZT6A 1N9WA 2ARUA 1NNHA 1SRYA 1EVLA 2RHSB 4RDXA 4KR3A 2E64A 1PYSA 2I4MA 3P8YA 2DZ9A 4O2DA 4P3OA 2ZZFA 1C0AA 3MF2A 4YRRA 4H2VA 4H2WA 4K88A 3RACA 3V7CA 4DPGA 2ZT7A 2C7IA 1H4SA 3REXA 1BBUA 1YGBA 2Q5IA 2E41A 3PCOB 1NYQA 4CH6A 1NJ8A 3DSQA 4H2SA 4UPAA 4H2XB 4YCVA 4H2TA 3V8JA 4WJ4A 3E9IA 3PZCA 3VQYA 2ODRD 2EAYA 3FJPA 4WJ3M 2DKGA 3G1ZA 2DXUA 3UGTA 2E1HA 4UP8A 4RMFA 1H4QA 4YCUA 1NJ5A 4YDQA 2E10A 2I4LA 1B7YA 2ARSA 1X2HA 1SETA 3VBBA 2EL9A 4YRJA 3L4GA 2DQ0A 1BIAA 3RL6A 3A5YA 5C53B 4YRFA 4CH3A 2QHVA 2ZIOA 1WNLA 1ADJA 5F5WA 2ZZGA 4LVIA 1X01A 2EWNA 4XEOA 3P8TA 4KQEA 4PG3A 2RHQA 1G5IA 2E5AA 4OP0A 2ZINA 1KMNA 3EFSA 1NYRA 4TQFA 1HXDA 2DEQA 4HWTA 4HWRA 2AMCB 2A8EA 3A7RA 4TVYA 1B7YB 2ZR3A 2C8MA 1ATIA 3R07A 4XTWA 4X5OA 5ELNA 4XTVA 3VQXA 3HXUA 4P75C 2AKWB 2RHSA 4G85A 3IKLA 4RQFA 4H02A 3NELA 2DQ3A 3OD1A 1USYA 3MQZA 3V7RA 1YB3A 3UH0A 1E1TA 2Q7EA 2QHSA 3UGQA 3MEYA 4YROA 1SERA 2IY5A 3P8VA 4Q15A 4CH4A 3HXXA 4P71A 3L2ZA 2Q7GA 3A7UA 1E1OA 4YRNA 3A74A 3V8LA 2CJBA 3KFUA 3ICAA 1L0WA 3QO5A 4BWAA 3LC0A 2DTOA 3QNEA 2J3MA 2PMFA 4HVCA 2DDZA 1G5HA 1WQ7A 2CJAA 3IALA 4LNSA 1EOVA 1H4TA 4XTYA 5C52B 4XU0A 3CMQA 1QE0A 3VQVA 1NJ1A 3M4PA 1W66A 4ZTUB 2G4CA 2DZCA 4UP7A 2RHQB 4P3NA 3UFGA 1RIQA 4EO4A 2CGHA 1HTTA 3V8KA 2ZCEA 4G84A 4WI1A 4XTXA 3HFVA 2QHUA 3HFZB 1NJ6A 4BW9A 1JJCB 1KMMA 3TEHB 3NETA 4K87A 4LVLA 1USYC 4HA8A 3HXVA 3BFMA 3V7SA 3L1AA 3HXWA 3NEMA 3MF1A 2AMCA 4YRLA 3W3SA 5E3IA 2ALYA 3HRKA 4YRSA 1X2GA 3BJUA 4LVJA 3A5ZA 4HWOA 2E65A 2HNIA 2ZIMA 4TWAA 4P73C 3RUXA 4YRKA 2DTIA 2PMEA 3E9HA 1E22A 1B70B 3A7AA 3EFRA 1WYDA 4Q6GA 2FYKA 4YCWA 2ARTA 4TVAA 1BBWA 2DVEA 1Z7NA 2Q5HA 1EIYA 4KR2A 3HY1A 3I7FA 2I4NA 3HY0A 3QO8A 4CS2A 12ASA 1X55A 3ERRA 4H2UA 1ADYA 4XU1A 1HC7A 1ASYA 3PCOA 2EJGA 5ELOA 3WQZA 3HXYA 1Z7MA 2P0LA 5C51B 2EJ9A 3RF1A 3REUA 1NJ2A 4XTUA 2DJZA 3RKYA 1GGMA 2ZZEA 1EFWA 2EJFA 5KNNA 2E3CA 1JJCA 2J3LA 3QTCA 4YP0A 2ALYB 5HGQA
chains in the Genus database with same CATH topology
11ASA 4AH6A 1B76A 1KOGA 3M4QA 3A32A 4P75A 1J5WA 3NENA 4NCXA 3TEGA 4HT4A 1E24A 2XGTA 4YRQA 4YPFA 2I4OA 4YRPA 1PYSB 4H2XA 2Q7HA 4P72C 3HTZA 3RGLA 3TUPA 1SESA 3IG2A 2ZXFA 1IL2A 4XEMA 3L4GB 4ZTZB 1LYLA 4P3PA 4TVWA 2ZTGA 1WPYA 2XTIA 1BIBA 2IY5B 4UP9A 4CH5A 3HRIA 2DXTA 1WU7A 3RKWA 1X54A 4YRTA 4WF2A 3VQWA 4HWSA 4TVAB 4EX5A 2NS6A 4PHCA 2ZNJA 4L87A 4P72A 1G51A 4YRGA 1YFSA 2ZT5A 4H2YA 1ASZA 3QO7A 4E51A 4ZIBA 5K1XA 1B8AA 1WQWA 1EQRA 4XTZA 4LVKA 4P74C 3HXZA 5K1PA 4HWPA 2ODRC 2ZGWA 2CJ9A 4K86A 1FYFA 2DTHA 1EIYB 4OLFA 4RQEA 1H4VB 1X56A 4TTVA 4YRIA 2DU7A 3LSQA 1EVKA 4J15A 4XU3A 3RIRA 3HFZA 3LSSA 4DQ2A 1YFRA 4P71C 4YRCA 4P74A 2AKWA 3A31A 1WLEA 2CIMA 2P5IA 1B70A 2ZR2A 4CS3A 2ZNIA 1VQZA 1QF6A 4YYEA 3RKXA 4XU2A 2ZT8A 4TQDA 4CS4A 3TEHA 3IKMB 4YRMA 2QHTA 4P73A 1YFTA 4YREA 4LVMA 2DU5A 2ZT6A 1N9WA 2ARUA 1NNHA 1SRYA 1EVLA 2RHSB 4RDXA 4KR3A 2E64A 1PYSA 2I4MA 3P8YA 2DZ9A 4O2DA 4P3OA 2ZZFA 1C0AA 3MF2A 4YRRA 4H2VA 4H2WA 4K88A 3RACA 3V7CA 4DPGA 2ZT7A 2C7IA 1H4SA 3REXA 1BBUA 1YGBA 2Q5IA 2E41A 3PCOB 1NYQA 4CH6A 1NJ8A 3DSQA 4H2SA 4UPAA 4H2XB 4YCVA 4H2TA 3V8JA 4WJ4A 3E9IA 3PZCA 3VQYA 2ODRD 2EAYA 3FJPA 4WJ3M 2DKGA 3G1ZA 2DXUA 3UGTA 2E1HA 4UP8A 4RMFA 1H4QA 4YCUA 1NJ5A 4YDQA 2E10A 2I4LA 1B7YA 2ARSA 1X2HA 1SETA 3VBBA 2EL9A 4YRJA 3L4GA 2DQ0A 1BIAA 3RL6A 3A5YA 5C53B 4YRFA 4CH3A 2QHVA 2ZIOA 1WNLA 1ADJA 5F5WA 2ZZGA 4LVIA 1X01A 2EWNA 4XEOA 3P8TA 4KQEA 4PG3A 2RHQA 1G5IA 2E5AA 4OP0A 2ZINA 1KMNA 3EFSA 1NYRA 4TQFA 1HXDA 2DEQA 4HWTA 4HWRA 2AMCB 2A8EA 3A7RA 4TVYA 1B7YB 2ZR3A 2C8MA 1ATIA 3R07A 4XTWA 4X5OA 5ELNA 4XTVA 3VQXA 3HXUA 4P75C 2AKWB 2RHSA 4G85A 3IKLA 4RQFA 4H02A 3NELA 2DQ3A 3OD1A 1USYA 3MQZA 3V7RA 1YB3A 3UH0A 1E1TA 2Q7EA 2QHSA 3UGQA 3MEYA 4YROA 1SERA 2IY5A 3P8VA 4Q15A 4CH4A 3HXXA 4P71A 3L2ZA 2Q7GA 3A7UA 1E1OA 4YRNA 3A74A 3V8LA 2CJBA 3KFUA 3ICAA 1L0WA 3QO5A 4BWAA 3LC0A 2DTOA 3QNEA 2J3MA 2PMFA 4HVCA 2DDZA 1G5HA 1WQ7A 2CJAA 3IALA 4LNSA 1EOVA 1H4TA 4XTYA 5C52B 4XU0A 3CMQA 1QE0A 3VQVA 1NJ1A 3M4PA 1W66A 4ZTUB 2G4CA 2DZCA 4UP7A 2RHQB 4P3NA 3UFGA 1RIQA 4EO4A 2CGHA 1HTTA 3V8KA 2ZCEA 4G84A 4WI1A 4XTXA 3HFVA 2QHUA 3HFZB 1NJ6A 4BW9A 1JJCB 1KMMA 3TEHB 3NETA 4K87A 4LVLA 1USYC 4HA8A 3HXVA 3BFMA 3V7SA 3L1AA 3HXWA 3NEMA 3MF1A 2AMCA 4YRLA 3W3SA 5E3IA 2ALYA 3HRKA 4YRSA 1X2GA 3BJUA 4LVJA 3A5ZA 4HWOA 2E65A 2HNIA 2ZIMA 4TWAA 4P73C 3RUXA 4YRKA 2DTIA 2PMEA 3E9HA 1E22A 1B70B 3A7AA 3EFRA 1WYDA 4Q6GA 2FYKA 4YCWA 2ARTA 4TVAA 1BBWA 2DVEA 1Z7NA 2Q5HA 1EIYA 4KR2A 3HY1A 3I7FA 2I4NA 3HY0A 3QO8A 4CS2A 12ASA 1X55A 3ERRA 4H2UA 1ADYA 4XU1A 1HC7A 1ASYA 3PCOA 2EJGA 5ELOA 3WQZA 3HXYA 1Z7MA 2P0LA 5C51B 2EJ9A 3RF1A 3REUA 1NJ2A 4XTUA 2DJZA 3RKYA 1GGMA 2ZZEA 1EFWA 2EJFA 5KNNA 2E3CA 1JJCA 2J3LA 3QTCA 4YP0A 2ALYB 5HGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 11AS A;  4AH6 A;  1B76 A;  1KOG A;  3M4Q A;  3A32 A;  4P75 A;  1J5W A;  3NEN A;  4NCX A;  3TEG A;  1E24 A;  2XGT A;  4YRQ A;  4YPF A;  2I4O A;  4YRP A;  1PYS B;  4H2X A;  2Q7H A;  4P72 C;  3HTZ A;  3RGL A;  3TUP A;  1SES A;  3IG2 A;  2ZXF A;  1IL2 A;  4XEM A;  3L4G B;  4ZTZ B;  1LYL A;  4P3P A;  4TVW A;  2ZTG A;  1WPY A;  2XTI A;  1BIB A;  2IY5 B;  4UP9 A;  4CH5 A;  3HRI A;  2DXT A;  1WU7 A;  3RKW A;  1X54 A;  4YRT A;  4WF2 A;  3VQW A;  4HWS A;  4TVA B;  4EX5 A;  4PHC A;  2ZNJ A;  4L87 A;  4P72 A;  1G51 A;  4YRG A;  1YFS A;  2ZT5 A;  4H2Y A;  1ASZ A;  3QO7 A;  4E51 A;  4ZIB A;  5K1X A;  1B8A A;  1WQW A;  1EQR A;  4XTZ A;  4P74 C;  3HXZ A;  5K1P A;  4HWP A;  2ODR C;  2ZGW A;  2CJ9 A;  4K86 A;  1FYF A;  2DTH A;  1EIY B;  4OLF A;  4RQE A;  1H4V B;  1X56 A;  4TTV A;  4YRI A;  2DU7 A;  3LSQ A;  1EVK A;  4J15 A;  4XU3 A;  3RIR A;  3HFZ A;  3LSS A;  4DQ2 A;  1YFR A;  4P71 C;  4YRC A;  4P74 A;  2AKW A;  3A31 A;  1WLE A;  2CIM A;  2P5I A;  1B70 A;  2ZR2 A;  4CS3 A;  2ZNI A;  1VQZ A;  1QF6 A;  4YYE A;  3RKX A;  4XU2 A;  2ZT8 A;  4TQD A;  4CS4 A;  3TEH A;  3IKM B;  4YRM A;  2QHT A;  4P73 A;  1YFT A;  4YRE A;  2DU5 A;  2ZT6 A;  1N9W A;  2ARU A;  1NNH A;  1SRY A;  1EVL A;  2RHS B;  4RDX A;  4KR3 A;  2E64 A;  1PYS A;  2I4M A;  3P8Y A;  2DZ9 A;  4O2D A;  4P3O A;  2ZZF A;  1C0A A;  3MF2 A;  4YRR A;  4H2V A;  4H2W A;  4K88 A;  3RAC A;  3V7C A;  4DPG A;  2ZT7 A;  2C7I A;  1H4S A;  3REX A;  1BBU A;  1YGB A;  2Q5I A;  2E41 A;  3PCO B;  1NYQ A;  4CH6 A;  1NJ8 A;  3DSQ A;  4H2S A;  4UPA A;  4H2X B;  4YCV A;  4H2T A;  3V8J A;  4WJ4 A;  3E9I A;  3PZC A;  3VQY A;  2ODR D;  2EAY A;  3FJP A;  4WJ3 M;  2DKG A;  3G1Z A;  2DXU A;  3UGT A;  2E1H A;  4UP8 A;  4RMF A;  1H4Q A;  4YCU A;  1NJ5 A;  4YDQ A;  2E10 A;  2I4L A;  1B7Y A;  2ARS A;  1X2H A;  1SET A;  3VBB A;  2EL9 A;  4YRJ A;  3L4G A;  2DQ0 A;  1BIA A;  3RL6 A;  3A5Y A;  5C53 B;  4YRF A;  4CH3 A;  2QHV A;  2ZIO A;  1WNL A;  1ADJ A;  5F5W A;  2ZZG A;  1X01 A;  2EWN A;  4XEO A;  3P8T A;  4KQE A;  4PG3 A;  2RHQ A;  1G5I A;  2E5A A;  4OP0 A;  2ZIN A;  1KMN A;  3EFS A;  1NYR A;  4TQF A;  1HXD A;  2DEQ A;  4HWT A;  4HWR A;  2AMC B;  3A7R A;  4TVY A;  1B7Y B;  2ZR3 A;  2C8M A;  1ATI A;  3R07 A;  4XTW A;  4X5O A;  5ELN A;  4XTV A;  3VQX A;  3HXU A;  4P75 C;  2AKW B;  2RHS A;  4G85 A;  3IKL A;  4RQF A;  4H02 A;  3NEL A;  2DQ3 A;  3OD1 A;  1USY A;  3V7R A;  1YB3 A;  3UH0 A;  1E1T A;  2Q7E A;  2QHS A;  3UGQ A;  3MEY A;  4YRO A;  1SER A;  2IY5 A;  3P8V A;  4Q15 A;  4CH4 A;  3HXX A;  4P71 A;  3L2Z A;  2Q7G A;  3A7U A;  1E1O A;  4YRN A;  3A74 A;  3V8L A;  2CJB A;  3KFU A;  3ICA A;  1L0W A;  3QO5 A;  4BWA A;  3LC0 A;  2DTO A;  3QNE A;  2J3M A;  2PMF A;  4HVC A;  2DDZ A;  1G5H A;  1WQ7 A;  2CJA A;  3IAL A;  4LNS A;  1EOV A;  1H4T A;  4XTY A;  5C52 B;  4XU0 A;  3CMQ A;  1QE0 A;  3VQV A;  1NJ1 A;  3M4P A;  1W66 A;  4ZTU B;  2G4C A;  2DZC A;  4UP7 A;  2RHQ B;  4P3N A;  3UFG A;  1RIQ A;  4EO4 A;  2CGH A;  1HTT A;  3V8K A;  2ZCE A;  4G84 A;  4WI1 A;  4XTX A;  3HFV A;  2QHU A;  3HFZ B;  1NJ6 A;  4BW9 A;  1JJC B;  1KMM A;  3TEH B;  3NET A;  4K87 A;  1USY C;  4HA8 A;  3HXV A;  3BFM A;  3V7S A;  3L1A A;  3HXW A;  3NEM A;  3MF1 A;  2AMC A;  4YRL A;  3W3S A;  5E3I A;  2ALY A;  3HRK A;  4YRS A;  1X2G A;  3BJU A;  3A5Z A;  4HWO A;  2E65 A;  2HNI A;  2ZIM A;  4TWA A;  4P73 C;  3RUX A;  4YRK A;  2DTI A;  2PME A;  3E9H A;  1E22 A;  1B70 B;  3A7A A;  3EFR A;  1WYD A;  4Q6G A;  2FYK A;  4YCW A;  2ART A;  4TVA A;  1BBW A;  2DVE A;  1Z7N A;  2Q5H A;  1EIY A;  4KR2 A;  3HY1 A;  3I7F A;  2I4N A;  3HY0 A;  3QO8 A;  4CS2 A;  12AS A;  1X55 A;  3ERR A;  4H2U A;  1ADY A;  4XU1 A;  1HC7 A;  1ASY A;  3PCO A;  2EJG A;  5ELO A;  3WQZ A;  3HXY A;  1Z7M A;  2P0L A;  5C51 B;  2EJ9 A;  3RF1 A;  3REU A;  1NJ2 A;  4XTU A;  2DJZ A;  3RKY A;  1GGM A;  2ZZE A;  1EFW A;  2EJF A;  5KNN A;  2E3C A;  1JJC A;  2J3L A;  3QTC A;  4YP0 A;  2ALY B;  5HGQ A; 
#chains in the Genus database with same CATH topology
 11AS A;  4AH6 A;  1B76 A;  1KOG A;  3M4Q A;  3A32 A;  4P75 A;  1J5W A;  3NEN A;  4NCX A;  3TEG A;  4HT4 A;  1E24 A;  2XGT A;  4YRQ A;  4YPF A;  2I4O A;  4YRP A;  1PYS B;  4H2X A;  2Q7H A;  4P72 C;  3HTZ A;  3RGL A;  3TUP A;  1SES A;  3IG2 A;  2ZXF A;  1IL2 A;  4XEM A;  3L4G B;  4ZTZ B;  1LYL A;  4P3P A;  4TVW A;  2ZTG A;  1WPY A;  2XTI A;  1BIB A;  2IY5 B;  4UP9 A;  4CH5 A;  3HRI A;  2DXT A;  1WU7 A;  3RKW A;  1X54 A;  4YRT A;  4WF2 A;  3VQW A;  4HWS A;  4TVA B;  4EX5 A;  2NS6 A;  4PHC A;  2ZNJ A;  4L87 A;  4P72 A;  1G51 A;  4YRG A;  1YFS A;  2ZT5 A;  4H2Y A;  1ASZ A;  3QO7 A;  4E51 A;  4ZIB A;  5K1X A;  1B8A A;  1WQW A;  1EQR A;  4XTZ A;  4LVK A;  4P74 C;  3HXZ A;  5K1P A;  4HWP A;  2ODR C;  2ZGW A;  2CJ9 A;  4K86 A;  1FYF A;  2DTH A;  1EIY B;  4OLF A;  4RQE A;  1H4V B;  1X56 A;  4TTV A;  4YRI A;  2DU7 A;  3LSQ A;  1EVK A;  4J15 A;  4XU3 A;  3RIR A;  3HFZ A;  3LSS A;  4DQ2 A;  1YFR A;  4P71 C;  4YRC A;  4P74 A;  2AKW A;  3A31 A;  1WLE A;  2CIM A;  2P5I A;  1B70 A;  2ZR2 A;  4CS3 A;  2ZNI A;  1VQZ A;  1QF6 A;  4YYE A;  3RKX A;  4XU2 A;  2ZT8 A;  4TQD A;  4CS4 A;  3TEH A;  3IKM B;  4YRM A;  2QHT A;  4P73 A;  1YFT A;  4YRE A;  4LVM A;  2DU5 A;  2ZT6 A;  1N9W A;  2ARU A;  1NNH A;  1SRY A;  1EVL A;  2RHS B;  4RDX A;  4KR3 A;  2E64 A;  1PYS A;  2I4M A;  3P8Y A;  2DZ9 A;  4O2D A;  4P3O A;  2ZZF A;  1C0A A;  3MF2 A;  4YRR A;  4H2V A;  4H2W A;  4K88 A;  3RAC A;  3V7C A;  4DPG A;  2ZT7 A;  2C7I A;  1H4S A;  3REX A;  1BBU A;  1YGB A;  2Q5I A;  2E41 A;  3PCO B;  1NYQ A;  4CH6 A;  1NJ8 A;  3DSQ A;  4H2S A;  4UPA A;  4H2X B;  4YCV A;  4H2T A;  3V8J A;  4WJ4 A;  3E9I A;  3PZC A;  3VQY A;  2ODR D;  2EAY A;  3FJP A;  4WJ3 M;  2DKG A;  3G1Z A;  2DXU A;  3UGT A;  2E1H A;  4UP8 A;  4RMF A;  1H4Q A;  4YCU A;  1NJ5 A;  4YDQ A;  2E10 A;  2I4L A;  1B7Y A;  2ARS A;  1X2H A;  1SET A;  3VBB A;  2EL9 A;  4YRJ A;  3L4G A;  2DQ0 A;  1BIA A;  3RL6 A;  3A5Y A;  5C53 B;  4YRF A;  4CH3 A;  2QHV A;  2ZIO A;  1WNL A;  1ADJ A;  5F5W A;  2ZZG A;  4LVI A;  1X01 A;  2EWN A;  4XEO A;  3P8T A;  4KQE A;  4PG3 A;  2RHQ A;  1G5I A;  2E5A A;  4OP0 A;  2ZIN A;  1KMN A;  3EFS A;  1NYR A;  4TQF A;  1HXD A;  2DEQ A;  4HWT A;  4HWR A;  2AMC B;  2A8E A;  3A7R A;  4TVY A;  1B7Y B;  2ZR3 A;  2C8M A;  1ATI A;  3R07 A;  4XTW A;  4X5O A;  5ELN A;  4XTV A;  3VQX A;  3HXU A;  4P75 C;  2AKW B;  2RHS A;  4G85 A;  3IKL A;  4RQF A;  4H02 A;  3NEL A;  2DQ3 A;  3OD1 A;  1USY A;  3MQZ A;  3V7R A;  1YB3 A;  3UH0 A;  1E1T A;  2Q7E A;  2QHS A;  3UGQ A;  3MEY A;  4YRO A;  1SER A;  2IY5 A;  3P8V A;  4Q15 A;  4CH4 A;  3HXX A;  4P71 A;  3L2Z A;  2Q7G A;  3A7U A;  1E1O A;  4YRN A;  3A74 A;  3V8L A;  2CJB A;  3KFU A;  3ICA A;  1L0W A;  3QO5 A;  4BWA A;  3LC0 A;  2DTO A;  3QNE A;  2J3M A;  2PMF A;  4HVC A;  2DDZ A;  1G5H A;  1WQ7 A;  2CJA A;  3IAL A;  4LNS A;  1EOV A;  1H4T A;  4XTY A;  5C52 B;  4XU0 A;  3CMQ A;  1QE0 A;  3VQV A;  1NJ1 A;  3M4P A;  1W66 A;  4ZTU B;  2G4C A;  2DZC A;  4UP7 A;  2RHQ B;  4P3N A;  3UFG A;  1RIQ A;  4EO4 A;  2CGH A;  1HTT A;  3V8K A;  2ZCE A;  4G84 A;  4WI1 A;  4XTX A;  3HFV A;  2QHU A;  3HFZ B;  1NJ6 A;  4BW9 A;  1JJC B;  1KMM A;  3TEH B;  3NET A;  4K87 A;  4LVL A;  1USY C;  4HA8 A;  3HXV A;  3BFM A;  3V7S A;  3L1A A;  3HXW A;  3NEM A;  3MF1 A;  2AMC A;  4YRL A;  3W3S A;  5E3I A;  2ALY A;  3HRK A;  4YRS A;  1X2G A;  3BJU A;  4LVJ A;  3A5Z A;  4HWO A;  2E65 A;  2HNI A;  2ZIM A;  4TWA A;  4P73 C;  3RUX A;  4YRK A;  2DTI A;  2PME A;  3E9H A;  1E22 A;  1B70 B;  3A7A A;  3EFR A;  1WYD A;  4Q6G A;  2FYK A;  4YCW A;  2ART A;  4TVA A;  1BBW A;  2DVE A;  1Z7N A;  2Q5H A;  1EIY A;  4KR2 A;  3HY1 A;  3I7F A;  2I4N A;  3HY0 A;  3QO8 A;  4CS2 A;  12AS A;  1X55 A;  3ERR A;  4H2U A;  1ADY A;  4XU1 A;  1HC7 A;  1ASY A;  3PCO A;  2EJG A;  5ELO A;  3WQZ A;  3HXY A;  1Z7M A;  2P0L A;  5C51 B;  2EJ9 A;  3RF1 A;  3REU A;  1NJ2 A;  4XTU A;  2DJZ A;  3RKY A;  1GGM A;  2ZZE A;  1EFW A;  2EJF A;  5KNN A;  2E3C A;  1JJC A;  2J3L A;  3QTC A;  4YP0 A;  2ALY B;  5HGQ A; 
#chains in the Genus database with same CATH homology
 11AS A;  4AH6 A;  1B76 A;  1KOG A;  3M4Q A;  3A32 A;  4P75 A;  1J5W A;  3NEN A;  4NCX A;  3TEG A;  4HT4 A;  1E24 A;  2XGT A;  4YRQ A;  4YPF A;  2I4O A;  4YRP A;  1PYS B;  4H2X A;  2Q7H A;  4P72 C;  3HTZ A;  3RGL A;  3TUP A;  1SES A;  3IG2 A;  2ZXF A;  1IL2 A;  4XEM A;  3L4G B;  4ZTZ B;  1LYL A;  4P3P A;  4TVW A;  2ZTG A;  1WPY A;  2XTI A;  1BIB A;  2IY5 B;  4UP9 A;  4CH5 A;  3HRI A;  2DXT A;  1WU7 A;  3RKW A;  1X54 A;  4YRT A;  4WF2 A;  3VQW A;  4HWS A;  4TVA B;  4EX5 A;  2NS6 A;  4PHC A;  2ZNJ A;  4L87 A;  4P72 A;  1G51 A;  4YRG A;  1YFS A;  2ZT5 A;  4H2Y A;  1ASZ A;  3QO7 A;  4E51 A;  4ZIB A;  5K1X A;  1B8A A;  1WQW A;  1EQR A;  4XTZ A;  4LVK A;  4P74 C;  3HXZ A;  5K1P A;  4HWP A;  2ODR C;  2ZGW A;  2CJ9 A;  4K86 A;  1FYF A;  2DTH A;  1EIY B;  4OLF A;  4RQE A;  1H4V B;  1X56 A;  4TTV A;  4YRI A;  2DU7 A;  3LSQ A;  1EVK A;  4J15 A;  4XU3 A;  3RIR A;  3HFZ A;  3LSS A;  4DQ2 A;  1YFR A;  4P71 C;  4YRC A;  4P74 A;  2AKW A;  3A31 A;  1WLE A;  2CIM A;  2P5I A;  1B70 A;  2ZR2 A;  4CS3 A;  2ZNI A;  1VQZ A;  1QF6 A;  4YYE A;  3RKX A;  4XU2 A;  2ZT8 A;  4TQD A;  4CS4 A;  3TEH A;  3IKM B;  4YRM A;  2QHT A;  4P73 A;  1YFT A;  4YRE A;  4LVM A;  2DU5 A;  2ZT6 A;  1N9W A;  2ARU A;  1NNH A;  1SRY A;  1EVL A;  2RHS B;  4RDX A;  4KR3 A;  2E64 A;  1PYS A;  2I4M A;  3P8Y A;  2DZ9 A;  4O2D A;  4P3O A;  2ZZF A;  1C0A A;  3MF2 A;  4YRR A;  4H2V A;  4H2W A;  4K88 A;  3RAC A;  3V7C A;  4DPG A;  2ZT7 A;  2C7I A;  1H4S A;  3REX A;  1BBU A;  1YGB A;  2Q5I A;  2E41 A;  3PCO B;  1NYQ A;  4CH6 A;  1NJ8 A;  3DSQ A;  4H2S A;  4UPA A;  4H2X B;  4YCV A;  4H2T A;  3V8J A;  4WJ4 A;  3E9I A;  3PZC A;  3VQY A;  2ODR D;  2EAY A;  3FJP A;  4WJ3 M;  2DKG A;  3G1Z A;  2DXU A;  3UGT A;  2E1H A;  4UP8 A;  4RMF A;  1H4Q A;  4YCU A;  1NJ5 A;  4YDQ A;  2E10 A;  2I4L A;  1B7Y A;  2ARS A;  1X2H A;  1SET A;  3VBB A;  2EL9 A;  4YRJ A;  3L4G A;  2DQ0 A;  1BIA A;  3RL6 A;  3A5Y A;  5C53 B;  4YRF A;  4CH3 A;  2QHV A;  2ZIO A;  1WNL A;  1ADJ A;  5F5W A;  2ZZG A;  4LVI A;  1X01 A;  2EWN A;  4XEO A;  3P8T A;  4KQE A;  4PG3 A;  2RHQ A;  1G5I A;  2E5A A;  4OP0 A;  2ZIN A;  1KMN A;  3EFS A;  1NYR A;  4TQF A;  1HXD A;  2DEQ A;  4HWT A;  4HWR A;  2AMC B;  2A8E A;  3A7R A;  4TVY A;  1B7Y B;  2ZR3 A;  2C8M A;  1ATI A;  3R07 A;  4XTW A;  4X5O A;  5ELN A;  4XTV A;  3VQX A;  3HXU A;  4P75 C;  2AKW B;  2RHS A;  4G85 A;  3IKL A;  4RQF A;  4H02 A;  3NEL A;  2DQ3 A;  3OD1 A;  1USY A;  3MQZ A;  3V7R A;  1YB3 A;  3UH0 A;  1E1T A;  2Q7E A;  2QHS A;  3UGQ A;  3MEY A;  4YRO A;  1SER A;  2IY5 A;  3P8V A;  4Q15 A;  4CH4 A;  3HXX A;  4P71 A;  3L2Z A;  2Q7G A;  3A7U A;  1E1O A;  4YRN A;  3A74 A;  3V8L A;  2CJB A;  3KFU A;  3ICA A;  1L0W A;  3QO5 A;  4BWA A;  3LC0 A;  2DTO A;  3QNE A;  2J3M A;  2PMF A;  4HVC A;  2DDZ A;  1G5H A;  1WQ7 A;  2CJA A;  3IAL A;  4LNS A;  1EOV A;  1H4T A;  4XTY A;  5C52 B;  4XU0 A;  3CMQ A;  1QE0 A;  3VQV A;  1NJ1 A;  3M4P A;  1W66 A;  4ZTU B;  2G4C A;  2DZC A;  4UP7 A;  2RHQ B;  4P3N A;  3UFG A;  1RIQ A;  4EO4 A;  2CGH A;  1HTT A;  3V8K A;  2ZCE A;  4G84 A;  4WI1 A;  4XTX A;  3HFV A;  2QHU A;  3HFZ B;  1NJ6 A;  4BW9 A;  1JJC B;  1KMM A;  3TEH B;  3NET A;  4K87 A;  4LVL A;  1USY C;  4HA8 A;  3HXV A;  3BFM A;  3V7S A;  3L1A A;  3HXW A;  3NEM A;  3MF1 A;  2AMC A;  4YRL A;  3W3S A;  5E3I A;  2ALY A;  3HRK A;  4YRS A;  1X2G A;  3BJU A;  4LVJ A;  3A5Z A;  4HWO A;  2E65 A;  2HNI A;  2ZIM A;  4TWA A;  4P73 C;  3RUX A;  4YRK A;  2DTI A;  2PME A;  3E9H A;  1E22 A;  1B70 B;  3A7A A;  3EFR A;  1WYD A;  4Q6G A;  2FYK A;  4YCW A;  2ART A;  4TVA A;  1BBW A;  2DVE A;  1Z7N A;  2Q5H A;  1EIY A;  4KR2 A;  3HY1 A;  3I7F A;  2I4N A;  3HY0 A;  3QO8 A;  4CS2 A;  12AS A;  1X55 A;  3ERR A;  4H2U A;  1ADY A;  4XU1 A;  1HC7 A;  1ASY A;  3PCO A;  2EJG A;  5ELO A;  3WQZ A;  3HXY A;  1Z7M A;  2P0L A;  5C51 B;  2EJ9 A;  3RF1 A;  3REU A;  1NJ2 A;  4XTU A;  2DJZ A;  3RKY A;  1GGM A;  2ZZE A;  1EFW A;  2EJF A;  5KNN A;  2E3C A;  1JJC A;  2J3L A;  3QTC A;  4YP0 A;  2ALY B;  5HGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...