1YB3A

Conserved hypothetical protein pfu-178653-001 from pyrococcus furiosus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
166
structure length
166
Chain Sequence
MLKEVHELLNRIWGDIFELREELKEELKGFTVEEVSEVFNAYLYIDGKWEEMKYPHPAFAVKPGGEVGATPQGFYFVFAFPKEELSKEFIEDVIRAFEKLFIYGAENFLEDFYNFEHPISGDEVWDRIVNSDEEMINFEVDLGFDKEEVKREIKRFIELARRYNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved hypothetical protein Pfu-178653-001 from Pyrococcus furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
total genus 47
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2004-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11447 DUF3201 Protein of unknown function (DUF3201)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1yb3A00
4TVYA 3RGLA 1EQRA 3LSQA 1X54A 4H2XA 2QHSA 4PHCA 3TEHB 4UP8A 1HC7A 3V7CA 3IALA 2E5AA 1X55A 4YCWA 4HA8A 1W66A 1YGBA 3EFSA 1USYA 3L4GB 1Z7NA 3HRIA 3A5YA 3FJPA 4X5OA 1PYSA 1NJ1A 3HFVA 2RHSA 3IG2A 2ZTGA 4TVAB 3TUPA 4XTUA 3HXXA 2ZT6A 3QO7A 1G5IA 4CS4A 1SERA 4YCUA 3P8YA 4HWPA 3NEMA 4KR2A 3V7SA 4YP0A 2DKGA 1JJCB 1WQWA 3TEHA 1NNHA 1B70A 2Q7HA 4YPFA 2ARTA 11ASA 2E65A 3RIRA 2Q5HA 2ARSA 4YRRA 3EFRA 1EFWA 1WLEA 1X2GA 1B70B 3A5ZA 3NENA 2CJAA 3R07A 1B8AA 2RHSB 2ZT8A 4TQFA 2ODRD 4P73C 2C7IA 3ERRA 2J3MA 1WPYA 3UGTA 3VBBA 1E24A 2DU7A 2ZGWA 4NCXA 1BBUA 1ASZA 3HTZA 5C51B 4H2UA 1NJ5A 1SRYA 3HXVA 3L4GA 1YFSA 2ZT7A 3UFGA 4XTVA 1EIYB 5HGQA 2DEQA 2DVEA 4YRJA 1EIYA 4XTWA 3VQVA 4HVCA 1YFTA 3REXA 3G1ZA 3A31A 1Z7MA 1ASYA 2P5IA 4LNSA 4YDQA 1X56A 5F5WA 3OD1A 3V8JA 2QHUA 4YRQA 4O2DA 4P3NA 3QO8A 1KMNA 4XU2A 1BIAA 1IL2A 1USYC 4CS3A 3I7FA 4XTXA 2ZT5A 4J15A 4WJ4A 3L2ZA 3L1AA 1J5WA 3A74A 1WQ7A 5KNNA 2DXUA 5ELOA 2HNIA 2QHTA 3V7RA 2DU5A 4YYEA 1ADJA 4HWOA 4H02A 3A7UA 3HXZA 1QF6A 4CS2A 2CJBA 3VQYA 4P74C 1H4QA 2DZCA 4RDXA 4KQEA 2ZR3A 4RQFA 4K86A 2AMCA 3RKYA 2DQ3A 4YRTA 2DTHA 2PMEA 2C8MA 1QE0A 3QTCA 2EAYA 1NJ6A 2Q7GA 1B7YA 4BWAA 4YRPA 2Q7EA 2ZXFA 3BJUA 5K1XA 3RKWA 3MF2A 1PYSB 3QO5A 4YRGA 3ICAA 3PCOA 2DTOA 4WJ3M 2RHQA 4BW9A 2ARUA 2I4MA 1NYQA 2P0LA 4L87A 4YREA 4YRMA 3RACA 4XU0A 4DQ2A 1H4VB 1BIBA 2ZZGA 3A7RA 1E1TA 1H4SA 4AH6A 4WI1A 4K87A 4RMFA 1FYFA 4YROA 3IKMB 3BFMA 4EX5A 3HFZA 4UPAA 4Q6GA 4P74A 4XEOA 2ZNJA 4P72A 2ZR2A 4UP9A 2ZINA 2E41A 1B76A 4YRSA 4TQDA 1X2HA 4Q15A 3HXYA 1LYLA 4HWRA 3E9HA 4CH6A 4TVWA 4E51A 2DJZA 2E64A 3RKXA 2ZCEA 4HWTA 4YRKA 1KOGA 2ZZEA 1H4TA 1C0AA 1ATIA 4P3OA 2AKWA 2ZNIA 2ODRC 3PCOB 3TEGA 3PZCA 2I4LA 2EWNA 4G85A 4YRNA 2ZIOA 1HTTA 1E1OA 2XGTA 2AKWB 3A7AA 3QNEA 3NETA 1SESA 3HFZB 4XU1A 2EJGA 2E3CA 1HXDA 1NYRA 2ALYB 5C53B 2EJ9A 1VQZA 3P8TA 2Q5IA 4UP7A 4H2YA 3RF1A 4G84A 3VQXA 2J3LA 4CH5A 3V8LA 4TTVA 1EOVA 3M4PA 4HWSA 3LSSA 3DSQA 12ASA 4ZIBA 3MF1A 4XTZA 1GGMA 3CMQA 1NJ2A 4P3PA 1B7YB 3MEYA 4RQEA 1G51A 3HY1A 1EVKA 4CH3A 4YRFA 4H2SA 2EJFA 2DDZA 1WNLA 2ZIMA 3P8VA 4YRIA 3LC0A 5K1PA 1EVLA 2DZ9A 4OP0A 4YRLA 1N9WA 4PG3A 3HXUA 3RL6A 1ADYA 4H2WA 1JJCA 1KMMA 1YB3A 3UH0A 2G4CA 2DTIA 4TVAA 3WQZA 2XTIA 1X01A 2FYKA 2IY5A 1NJ8A 1G5HA 4XTYA 3HY0A 2IY5B 3KFUA 5ELNA 3NELA 4KR3A 2DXTA 1RIQA 4P73A 4P75A 4P71A 1BBWA 1L0WA 2PMFA 3REUA 3IKLA 2DQ0A 3M4QA 3E9IA 1YFRA 2E1HA 2ZZFA 4OLFA 4WF2A 4ZTUB 4CH4A 2CGHA 4K88A 4H2XB 3RUXA 4H2VA 2AMCB 3VQWA 2E10A 5E3IA 2I4OA 4YCVA 3V8KA 2CIMA 3A32A 4TWAA 4EO4A 4P71C 1WU7A 4YRCA 1E22A 1WYDA 4P75C 2EL9A 2CJ9A 2QHVA 2I4NA 3UGQA 4XEMA 4ZTZB 4DPGA 2RHQB 4P72C 1SETA 3HXWA 5C52B 3HRKA 4H2TA 3W3SA 2ALYA 4XU3A
chains in the Genus database with same CATH superfamily
4TVYA 3RGLA 1EQRA 3LSQA 1X54A 4H2XA 2QHSA 4PHCA 3TEHB 4UP8A 1HC7A 3V7CA 3IALA 2E5AA 1X55A 4YCWA 4HA8A 1W66A 1YGBA 3EFSA 1USYA 3L4GB 1Z7NA 3HRIA 3A5YA 3FJPA 4X5OA 1PYSA 1NJ1A 3HFVA 3MQZA 2RHSA 3IG2A 2ZTGA 4TVAB 3TUPA 4XTUA 3HXXA 2ZT6A 3QO7A 1G5IA 4CS4A 1SERA 4YCUA 3P8YA 4HWPA 4HT4A 3NEMA 4KR2A 3V7SA 4YP0A 2DKGA 1JJCB 1WQWA 3TEHA 1NNHA 1B70A 2Q7HA 4YPFA 2ARTA 11ASA 2E65A 3RIRA 2Q5HA 2ARSA 4YRRA 3EFRA 1EFWA 1WLEA 1X2GA 1B70B 3A5ZA 3NENA 2CJAA 3R07A 1B8AA 2RHSB 2ZT8A 4TQFA 2ODRD 4P73C 2C7IA 3ERRA 2J3MA 1WPYA 3UGTA 3VBBA 1E24A 2DU7A 2ZGWA 4NCXA 1BBUA 1ASZA 3HTZA 5C51B 4H2UA 1NJ5A 1SRYA 3HXVA 3L4GA 1YFSA 2ZT7A 3UFGA 4XTVA 1EIYB 5HGQA 2DEQA 2DVEA 4YRJA 1EIYA 4XTWA 3VQVA 4HVCA 1YFTA 3REXA 3G1ZA 3A31A 1Z7MA 1ASYA 2P5IA 4LNSA 4YDQA 1X56A 5F5WA 3OD1A 3V8JA 2QHUA 4YRQA 4O2DA 4P3NA 3QO8A 4LVLA 1KMNA 4XU2A 1BIAA 1IL2A 1USYC 4CS3A 3I7FA 4XTXA 2ZT5A 4J15A 4WJ4A 3L2ZA 3L1AA 1J5WA 3A74A 1WQ7A 5KNNA 2DXUA 5ELOA 2HNIA 2QHTA 3V7RA 2DU5A 4YYEA 1ADJA 4HWOA 4H02A 3A7UA 3HXZA 1QF6A 4CS2A 2CJBA 3VQYA 4P74C 1H4QA 2DZCA 4RDXA 4KQEA 2ZR3A 4RQFA 4K86A 2AMCA 3RKYA 2DQ3A 4YRTA 2DTHA 2PMEA 2C8MA 1QE0A 3QTCA 2EAYA 1NJ6A 2Q7GA 1B7YA 4BWAA 4YRPA 2Q7EA 2ZXFA 3BJUA 5K1XA 3RKWA 3MF2A 1PYSB 3QO5A 4YRGA 3ICAA 3PCOA 2DTOA 4WJ3M 4LVJA 2RHQA 4BW9A 2ARUA 2I4MA 1NYQA 2P0LA 4L87A 4YREA 4YRMA 3RACA 4XU0A 4DQ2A 1H4VB 1BIBA 2ZZGA 3A7RA 1E1TA 1H4SA 4AH6A 4WI1A 4K87A 4RMFA 1FYFA 4YROA 3IKMB 3BFMA 4EX5A 3HFZA 4UPAA 4Q6GA 4P74A 4XEOA 2ZNJA 4P72A 2ZR2A 2A8EA 4UP9A 2ZINA 2E41A 1B76A 4YRSA 4TQDA 1X2HA 4Q15A 3HXYA 1LYLA 4HWRA 3E9HA 4CH6A 4TVWA 4E51A 2DJZA 2E64A 3RKXA 2NS6A 2ZCEA 4HWTA 4YRKA 1KOGA 2ZZEA 1H4TA 1C0AA 1ATIA 4P3OA 2AKWA 2ZNIA 2ODRC 3PCOB 3TEGA 3PZCA 2I4LA 2EWNA 4G85A 4YRNA 2ZIOA 1HTTA 1E1OA 2XGTA 2AKWB 3A7AA 3QNEA 3NETA 1SESA 3HFZB 4XU1A 4LVMA 2EJGA 2E3CA 1HXDA 1NYRA 2ALYB 5C53B 2EJ9A 1VQZA 3P8TA 2Q5IA 4UP7A 4H2YA 3RF1A 4G84A 3VQXA 2J3LA 4CH5A 3V8LA 4TTVA 4LVKA 1EOVA 3M4PA 4HWSA 3LSSA 3DSQA 12ASA 4ZIBA 3MF1A 4XTZA 1GGMA 3CMQA 1NJ2A 4P3PA 1B7YB 3MEYA 4RQEA 1G51A 3HY1A 1EVKA 4CH3A 4YRFA 4H2SA 2EJFA 2DDZA 1WNLA 2ZIMA 3P8VA 4YRIA 3LC0A 5K1PA 1EVLA 2DZ9A 4OP0A 4YRLA 1N9WA 4PG3A 3HXUA 3RL6A 1ADYA 4H2WA 1JJCA 1KMMA 1YB3A 3UH0A 2G4CA 2DTIA 4TVAA 3WQZA 2XTIA 1X01A 2FYKA 2IY5A 1NJ8A 1G5HA 4XTYA 3HY0A 4LVIA 2IY5B 3KFUA 5ELNA 3NELA 4KR3A 2DXTA 1RIQA 4P73A 4P75A 4P71A 1BBWA 1L0WA 2PMFA 3REUA 3IKLA 2DQ0A 3M4QA 3E9IA 1YFRA 2E1HA 2ZZFA 4OLFA 4WF2A 4ZTUB 4CH4A 2CGHA 4K88A 4H2XB 3RUXA 4H2VA 2AMCB 3VQWA 2E10A 5E3IA 2I4OA 4YCVA 3V8KA 2CIMA 3A32A 4TWAA 4EO4A 4P71C 1WU7A 4YRCA 1E22A 1WYDA 4P75C 2EL9A 2CJ9A 2QHVA 2I4NA 3UGQA 4XEMA 4ZTZB 4DPGA 2RHQB 4P72C 1SETA 3HXWA 5C52B 3HRKA 4H2TA 3W3SA 2ALYA 4XU3A
chains in the Genus database with same CATH topology
4TVYA 3RGLA 1EQRA 3LSQA 1X54A 4H2XA 2QHSA 4PHCA 3TEHB 4UP8A 1HC7A 3V7CA 3IALA 2E5AA 1X55A 4YCWA 4HA8A 1W66A 1YGBA 3EFSA 1USYA 3L4GB 1Z7NA 3HRIA 3A5YA 3FJPA 4X5OA 1PYSA 1NJ1A 3HFVA 3MQZA 2RHSA 3IG2A 2ZTGA 4TVAB 3TUPA 4XTUA 3HXXA 2ZT6A 3QO7A 1G5IA 4CS4A 1SERA 4YCUA 3P8YA 4HWPA 4HT4A 3NEMA 4KR2A 3V7SA 4YP0A 2DKGA 1JJCB 1WQWA 3TEHA 1NNHA 1B70A 2Q7HA 4YPFA 2ARTA 11ASA 2E65A 3RIRA 2Q5HA 2ARSA 4YRRA 3EFRA 1EFWA 1WLEA 1X2GA 1B70B 3A5ZA 3NENA 2CJAA 3R07A 1B8AA 2RHSB 2ZT8A 4TQFA 2ODRD 4P73C 2C7IA 3ERRA 2J3MA 1WPYA 3UGTA 3VBBA 1E24A 2DU7A 2ZGWA 4NCXA 1BBUA 1ASZA 3HTZA 5C51B 4H2UA 1NJ5A 1SRYA 3HXVA 3L4GA 1YFSA 2ZT7A 3UFGA 4XTVA 1EIYB 5HGQA 2DEQA 2DVEA 4YRJA 1EIYA 4XTWA 3VQVA 4HVCA 1YFTA 3REXA 3G1ZA 3A31A 1Z7MA 1ASYA 2P5IA 4LNSA 4YDQA 1X56A 5F5WA 3OD1A 3V8JA 2QHUA 4YRQA 4O2DA 4P3NA 3QO8A 4LVLA 1KMNA 4XU2A 1BIAA 1IL2A 1USYC 4CS3A 3I7FA 4XTXA 2ZT5A 4J15A 4WJ4A 3L2ZA 3L1AA 1J5WA 3A74A 1WQ7A 5KNNA 2DXUA 5ELOA 2HNIA 2QHTA 3V7RA 2DU5A 4YYEA 1ADJA 4HWOA 4H02A 3A7UA 3HXZA 1QF6A 4CS2A 2CJBA 3VQYA 4P74C 1H4QA 2DZCA 4RDXA 4KQEA 2ZR3A 4RQFA 4K86A 2AMCA 3RKYA 2DQ3A 4YRTA 2DTHA 2PMEA 2C8MA 1QE0A 3QTCA 2EAYA 1NJ6A 2Q7GA 1B7YA 4BWAA 4YRPA 2Q7EA 2ZXFA 3BJUA 5K1XA 3RKWA 3MF2A 1PYSB 3QO5A 4YRGA 3ICAA 3PCOA 2DTOA 4WJ3M 4LVJA 2RHQA 4BW9A 2ARUA 2I4MA 1NYQA 2P0LA 4L87A 4YREA 4YRMA 3RACA 4XU0A 4DQ2A 1H4VB 1BIBA 2ZZGA 3A7RA 1E1TA 1H4SA 4AH6A 4WI1A 4K87A 4RMFA 1FYFA 4YROA 3IKMB 3BFMA 4EX5A 3HFZA 4UPAA 4Q6GA 4P74A 4XEOA 2ZNJA 4P72A 2ZR2A 2A8EA 4UP9A 2ZINA 2E41A 1B76A 4YRSA 4TQDA 1X2HA 4Q15A 3HXYA 1LYLA 4HWRA 3E9HA 4CH6A 4TVWA 4E51A 2DJZA 2E64A 3RKXA 2NS6A 2ZCEA 4HWTA 4YRKA 1KOGA 2ZZEA 1H4TA 1C0AA 1ATIA 4P3OA 2AKWA 2ZNIA 2ODRC 3PCOB 3TEGA 3PZCA 2I4LA 2EWNA 4G85A 4YRNA 2ZIOA 1HTTA 1E1OA 2XGTA 2AKWB 3A7AA 3QNEA 3NETA 1SESA 3HFZB 4XU1A 4LVMA 2EJGA 2E3CA 1HXDA 1NYRA 2ALYB 5C53B 2EJ9A 1VQZA 3P8TA 2Q5IA 4UP7A 4H2YA 3RF1A 4G84A 3VQXA 2J3LA 4CH5A 3V8LA 4TTVA 4LVKA 1EOVA 3M4PA 4HWSA 3LSSA 3DSQA 12ASA 4ZIBA 3MF1A 4XTZA 1GGMA 3CMQA 1NJ2A 4P3PA 1B7YB 3MEYA 4RQEA 1G51A 3HY1A 1EVKA 4CH3A 4YRFA 4H2SA 2EJFA 2DDZA 1WNLA 2ZIMA 3P8VA 4YRIA 3LC0A 5K1PA 1EVLA 2DZ9A 4OP0A 4YRLA 1N9WA 4PG3A 3HXUA 3RL6A 1ADYA 4H2WA 1JJCA 1KMMA 1YB3A 3UH0A 2G4CA 2DTIA 4TVAA 3WQZA 2XTIA 1X01A 2FYKA 2IY5A 1NJ8A 1G5HA 4XTYA 3HY0A 4LVIA 2IY5B 3KFUA 5ELNA 3NELA 4KR3A 2DXTA 1RIQA 4P73A 4P75A 4P71A 1BBWA 1L0WA 2PMFA 3REUA 3IKLA 2DQ0A 3M4QA 3E9IA 1YFRA 2E1HA 2ZZFA 4OLFA 4WF2A 4ZTUB 4CH4A 2CGHA 4K88A 4H2XB 3RUXA 4H2VA 2AMCB 3VQWA 2E10A 5E3IA 2I4OA 4YCVA 3V8KA 2CIMA 3A32A 4TWAA 4EO4A 4P71C 1WU7A 4YRCA 1E22A 1WYDA 4P75C 2EL9A 2CJ9A 2QHVA 2I4NA 3UGQA 4XEMA 4ZTZB 4DPGA 2RHQB 4P72C 1SETA 3HXWA 5C52B 3HRKA 4H2TA 3W3SA 2ALYA 4XU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TVY A;  3RGL A;  1EQR A;  3LSQ A;  1X54 A;  4H2X A;  2QHS A;  4PHC A;  3TEH B;  4UP8 A;  1HC7 A;  3V7C A;  3IAL A;  2E5A A;  1X55 A;  4YCW A;  4HA8 A;  1W66 A;  1YGB A;  3EFS A;  1USY A;  3L4G B;  1Z7N A;  3HRI A;  3A5Y A;  3FJP A;  4X5O A;  1PYS A;  1NJ1 A;  3HFV A;  2RHS A;  3IG2 A;  2ZTG A;  4TVA B;  3TUP A;  4XTU A;  3HXX A;  2ZT6 A;  3QO7 A;  1G5I A;  4CS4 A;  1SER A;  4YCU A;  3P8Y A;  4HWP A;  3NEM A;  4KR2 A;  3V7S A;  4YP0 A;  2DKG A;  1JJC B;  1WQW A;  3TEH A;  1NNH A;  1B70 A;  2Q7H A;  4YPF A;  2ART A;  11AS A;  2E65 A;  3RIR A;  2Q5H A;  2ARS A;  4YRR A;  3EFR A;  1EFW A;  1WLE A;  1X2G A;  1B70 B;  3A5Z A;  3NEN A;  2CJA A;  3R07 A;  1B8A A;  2RHS B;  2ZT8 A;  4TQF A;  2ODR D;  4P73 C;  2C7I A;  3ERR A;  2J3M A;  1WPY A;  3UGT A;  3VBB A;  1E24 A;  2DU7 A;  2ZGW A;  4NCX A;  1BBU A;  1ASZ A;  3HTZ A;  5C51 B;  4H2U A;  1NJ5 A;  1SRY A;  3HXV A;  3L4G A;  1YFS A;  2ZT7 A;  3UFG A;  4XTV A;  1EIY B;  5HGQ A;  2DEQ A;  2DVE A;  4YRJ A;  1EIY A;  4XTW A;  3VQV A;  4HVC A;  1YFT A;  3REX A;  3G1Z A;  3A31 A;  1Z7M A;  1ASY A;  2P5I A;  4LNS A;  4YDQ A;  1X56 A;  5F5W A;  3OD1 A;  3V8J A;  2QHU A;  4YRQ A;  4O2D A;  4P3N A;  3QO8 A;  1KMN A;  4XU2 A;  1BIA A;  1IL2 A;  1USY C;  4CS3 A;  3I7F A;  4XTX A;  2ZT5 A;  4J15 A;  4WJ4 A;  3L2Z A;  3L1A A;  1J5W A;  3A74 A;  1WQ7 A;  5KNN A;  2DXU A;  5ELO A;  2HNI A;  2QHT A;  3V7R A;  2DU5 A;  4YYE A;  1ADJ A;  4HWO A;  4H02 A;  3A7U A;  3HXZ A;  1QF6 A;  4CS2 A;  2CJB A;  3VQY A;  4P74 C;  1H4Q A;  2DZC A;  4RDX A;  4KQE A;  2ZR3 A;  4RQF A;  4K86 A;  2AMC A;  3RKY A;  2DQ3 A;  4YRT A;  2DTH A;  2PME A;  2C8M A;  1QE0 A;  3QTC A;  2EAY A;  1NJ6 A;  2Q7G A;  1B7Y A;  4BWA A;  4YRP A;  2Q7E A;  2ZXF A;  3BJU A;  5K1X A;  3RKW A;  3MF2 A;  1PYS B;  3QO5 A;  4YRG A;  3ICA A;  3PCO A;  2DTO A;  4WJ3 M;  2RHQ A;  4BW9 A;  2ARU A;  2I4M A;  1NYQ A;  2P0L A;  4L87 A;  4YRE A;  4YRM A;  3RAC A;  4XU0 A;  4DQ2 A;  1H4V B;  1BIB A;  2ZZG A;  3A7R A;  1E1T A;  1H4S A;  4AH6 A;  4WI1 A;  4K87 A;  4RMF A;  1FYF A;  4YRO A;  3IKM B;  3BFM A;  4EX5 A;  3HFZ A;  4UPA A;  4Q6G A;  4P74 A;  4XEO A;  2ZNJ A;  4P72 A;  2ZR2 A;  4UP9 A;  2ZIN A;  2E41 A;  1B76 A;  4YRS A;  4TQD A;  1X2H A;  4Q15 A;  3HXY A;  1LYL A;  4HWR A;  3E9H A;  4CH6 A;  4TVW A;  4E51 A;  2DJZ A;  2E64 A;  3RKX A;  2ZCE A;  4HWT A;  4YRK A;  1KOG A;  2ZZE A;  1H4T A;  1C0A A;  1ATI A;  4P3O A;  2AKW A;  2ZNI A;  2ODR C;  3PCO B;  3TEG A;  3PZC A;  2I4L A;  2EWN A;  4G85 A;  4YRN A;  2ZIO A;  1HTT A;  1E1O A;  2XGT A;  2AKW B;  3A7A A;  3QNE A;  3NET A;  1SES A;  3HFZ B;  4XU1 A;  2EJG A;  2E3C A;  1HXD A;  1NYR A;  2ALY B;  5C53 B;  2EJ9 A;  1VQZ A;  3P8T A;  2Q5I A;  4UP7 A;  4H2Y A;  3RF1 A;  4G84 A;  3VQX A;  2J3L A;  4CH5 A;  3V8L A;  4TTV A;  1EOV A;  3M4P A;  4HWS A;  3LSS A;  3DSQ A;  12AS A;  4ZIB A;  3MF1 A;  4XTZ A;  1GGM A;  3CMQ A;  1NJ2 A;  4P3P A;  1B7Y B;  3MEY A;  4RQE A;  1G51 A;  3HY1 A;  1EVK A;  4CH3 A;  4YRF A;  4H2S A;  2EJF A;  2DDZ A;  1WNL A;  2ZIM A;  3P8V A;  4YRI A;  3LC0 A;  5K1P A;  1EVL A;  2DZ9 A;  4OP0 A;  4YRL A;  1N9W A;  4PG3 A;  3HXU A;  3RL6 A;  1ADY A;  4H2W A;  1JJC A;  1KMM A;  1YB3 A;  3UH0 A;  2G4C A;  2DTI A;  4TVA A;  3WQZ A;  2XTI A;  1X01 A;  2FYK A;  2IY5 A;  1NJ8 A;  1G5H A;  4XTY A;  3HY0 A;  2IY5 B;  3KFU A;  5ELN A;  3NEL A;  4KR3 A;  2DXT A;  1RIQ A;  4P73 A;  4P75 A;  4P71 A;  1BBW A;  1L0W A;  2PMF A;  3REU A;  3IKL A;  2DQ0 A;  3M4Q A;  3E9I A;  1YFR A;  2E1H A;  2ZZF A;  4OLF A;  4WF2 A;  4ZTU B;  4CH4 A;  2CGH A;  4K88 A;  4H2X B;  3RUX A;  4H2V A;  2AMC B;  3VQW A;  2E10 A;  5E3I A;  2I4O A;  4YCV A;  3V8K A;  2CIM A;  3A32 A;  4TWA A;  4EO4 A;  4P71 C;  1WU7 A;  4YRC A;  1E22 A;  1WYD A;  4P75 C;  2EL9 A;  2CJ9 A;  2QHV A;  2I4N A;  3UGQ A;  4XEM A;  4ZTZ B;  4DPG A;  2RHQ B;  4P72 C;  1SET A;  3HXW A;  5C52 B;  3HRK A;  4H2T A;  3W3S A;  2ALY A;  4XU3 A; 
#chains in the Genus database with same CATH topology
 4TVY A;  3RGL A;  1EQR A;  3LSQ A;  1X54 A;  4H2X A;  2QHS A;  4PHC A;  3TEH B;  4UP8 A;  1HC7 A;  3V7C A;  3IAL A;  2E5A A;  1X55 A;  4YCW A;  4HA8 A;  1W66 A;  1YGB A;  3EFS A;  1USY A;  3L4G B;  1Z7N A;  3HRI A;  3A5Y A;  3FJP A;  4X5O A;  1PYS A;  1NJ1 A;  3HFV A;  3MQZ A;  2RHS A;  3IG2 A;  2ZTG A;  4TVA B;  3TUP A;  4XTU A;  3HXX A;  2ZT6 A;  3QO7 A;  1G5I A;  4CS4 A;  1SER A;  4YCU A;  3P8Y A;  4HWP A;  4HT4 A;  3NEM A;  4KR2 A;  3V7S A;  4YP0 A;  2DKG A;  1JJC B;  1WQW A;  3TEH A;  1NNH A;  1B70 A;  2Q7H A;  4YPF A;  2ART A;  11AS A;  2E65 A;  3RIR A;  2Q5H A;  2ARS A;  4YRR A;  3EFR A;  1EFW A;  1WLE A;  1X2G A;  1B70 B;  3A5Z A;  3NEN A;  2CJA A;  3R07 A;  1B8A A;  2RHS B;  2ZT8 A;  4TQF A;  2ODR D;  4P73 C;  2C7I A;  3ERR A;  2J3M A;  1WPY A;  3UGT A;  3VBB A;  1E24 A;  2DU7 A;  2ZGW A;  4NCX A;  1BBU A;  1ASZ A;  3HTZ A;  5C51 B;  4H2U A;  1NJ5 A;  1SRY A;  3HXV A;  3L4G A;  1YFS A;  2ZT7 A;  3UFG A;  4XTV A;  1EIY B;  5HGQ A;  2DEQ A;  2DVE A;  4YRJ A;  1EIY A;  4XTW A;  3VQV A;  4HVC A;  1YFT A;  3REX A;  3G1Z A;  3A31 A;  1Z7M A;  1ASY A;  2P5I A;  4LNS A;  4YDQ A;  1X56 A;  5F5W A;  3OD1 A;  3V8J A;  2QHU A;  4YRQ A;  4O2D A;  4P3N A;  3QO8 A;  4LVL A;  1KMN A;  4XU2 A;  1BIA A;  1IL2 A;  1USY C;  4CS3 A;  3I7F A;  4XTX A;  2ZT5 A;  4J15 A;  4WJ4 A;  3L2Z A;  3L1A A;  1J5W A;  3A74 A;  1WQ7 A;  5KNN A;  2DXU A;  5ELO A;  2HNI A;  2QHT A;  3V7R A;  2DU5 A;  4YYE A;  1ADJ A;  4HWO A;  4H02 A;  3A7U A;  3HXZ A;  1QF6 A;  4CS2 A;  2CJB A;  3VQY A;  4P74 C;  1H4Q A;  2DZC A;  4RDX A;  4KQE A;  2ZR3 A;  4RQF A;  4K86 A;  2AMC A;  3RKY A;  2DQ3 A;  4YRT A;  2DTH A;  2PME A;  2C8M A;  1QE0 A;  3QTC A;  2EAY A;  1NJ6 A;  2Q7G A;  1B7Y A;  4BWA A;  4YRP A;  2Q7E A;  2ZXF A;  3BJU A;  5K1X A;  3RKW A;  3MF2 A;  1PYS B;  3QO5 A;  4YRG A;  3ICA A;  3PCO A;  2DTO A;  4WJ3 M;  4LVJ A;  2RHQ A;  4BW9 A;  2ARU A;  2I4M A;  1NYQ A;  2P0L A;  4L87 A;  4YRE A;  4YRM A;  3RAC A;  4XU0 A;  4DQ2 A;  1H4V B;  1BIB A;  2ZZG A;  3A7R A;  1E1T A;  1H4S A;  4AH6 A;  4WI1 A;  4K87 A;  4RMF A;  1FYF A;  4YRO A;  3IKM B;  3BFM A;  4EX5 A;  3HFZ A;  4UPA A;  4Q6G A;  4P74 A;  4XEO A;  2ZNJ A;  4P72 A;  2ZR2 A;  2A8E A;  4UP9 A;  2ZIN A;  2E41 A;  1B76 A;  4YRS A;  4TQD A;  1X2H A;  4Q15 A;  3HXY A;  1LYL A;  4HWR A;  3E9H A;  4CH6 A;  4TVW A;  4E51 A;  2DJZ A;  2E64 A;  3RKX A;  2NS6 A;  2ZCE A;  4HWT A;  4YRK A;  1KOG A;  2ZZE A;  1H4T A;  1C0A A;  1ATI A;  4P3O A;  2AKW A;  2ZNI A;  2ODR C;  3PCO B;  3TEG A;  3PZC A;  2I4L A;  2EWN A;  4G85 A;  4YRN A;  2ZIO A;  1HTT A;  1E1O A;  2XGT A;  2AKW B;  3A7A A;  3QNE A;  3NET A;  1SES A;  3HFZ B;  4XU1 A;  4LVM A;  2EJG A;  2E3C A;  1HXD A;  1NYR A;  2ALY B;  5C53 B;  2EJ9 A;  1VQZ A;  3P8T A;  2Q5I A;  4UP7 A;  4H2Y A;  3RF1 A;  4G84 A;  3VQX A;  2J3L A;  4CH5 A;  3V8L A;  4TTV A;  4LVK A;  1EOV A;  3M4P A;  4HWS A;  3LSS A;  3DSQ A;  12AS A;  4ZIB A;  3MF1 A;  4XTZ A;  1GGM A;  3CMQ A;  1NJ2 A;  4P3P A;  1B7Y B;  3MEY A;  4RQE A;  1G51 A;  3HY1 A;  1EVK A;  4CH3 A;  4YRF A;  4H2S A;  2EJF A;  2DDZ A;  1WNL A;  2ZIM A;  3P8V A;  4YRI A;  3LC0 A;  5K1P A;  1EVL A;  2DZ9 A;  4OP0 A;  4YRL A;  1N9W A;  4PG3 A;  3HXU A;  3RL6 A;  1ADY A;  4H2W A;  1JJC A;  1KMM A;  1YB3 A;  3UH0 A;  2G4C A;  2DTI A;  4TVA A;  3WQZ A;  2XTI A;  1X01 A;  2FYK A;  2IY5 A;  1NJ8 A;  1G5H A;  4XTY A;  3HY0 A;  4LVI A;  2IY5 B;  3KFU A;  5ELN A;  3NEL A;  4KR3 A;  2DXT A;  1RIQ A;  4P73 A;  4P75 A;  4P71 A;  1BBW A;  1L0W A;  2PMF A;  3REU A;  3IKL A;  2DQ0 A;  3M4Q A;  3E9I A;  1YFR A;  2E1H A;  2ZZF A;  4OLF A;  4WF2 A;  4ZTU B;  4CH4 A;  2CGH A;  4K88 A;  4H2X B;  3RUX A;  4H2V A;  2AMC B;  3VQW A;  2E10 A;  5E3I A;  2I4O A;  4YCV A;  3V8K A;  2CIM A;  3A32 A;  4TWA A;  4EO4 A;  4P71 C;  1WU7 A;  4YRC A;  1E22 A;  1WYD A;  4P75 C;  2EL9 A;  2CJ9 A;  2QHV A;  2I4N A;  3UGQ A;  4XEM A;  4ZTZ B;  4DPG A;  2RHQ B;  4P72 C;  1SET A;  3HXW A;  5C52 B;  3HRK A;  4H2T A;  3W3S A;  2ALY A;  4XU3 A; 
#chains in the Genus database with same CATH homology
 4TVY A;  3RGL A;  1EQR A;  3LSQ A;  1X54 A;  4H2X A;  2QHS A;  4PHC A;  3TEH B;  4UP8 A;  1HC7 A;  3V7C A;  3IAL A;  2E5A A;  1X55 A;  4YCW A;  4HA8 A;  1W66 A;  1YGB A;  3EFS A;  1USY A;  3L4G B;  1Z7N A;  3HRI A;  3A5Y A;  3FJP A;  4X5O A;  1PYS A;  1NJ1 A;  3HFV A;  3MQZ A;  2RHS A;  3IG2 A;  2ZTG A;  4TVA B;  3TUP A;  4XTU A;  3HXX A;  2ZT6 A;  3QO7 A;  1G5I A;  4CS4 A;  1SER A;  4YCU A;  3P8Y A;  4HWP A;  4HT4 A;  3NEM A;  4KR2 A;  3V7S A;  4YP0 A;  2DKG A;  1JJC B;  1WQW A;  3TEH A;  1NNH A;  1B70 A;  2Q7H A;  4YPF A;  2ART A;  11AS A;  2E65 A;  3RIR A;  2Q5H A;  2ARS A;  4YRR A;  3EFR A;  1EFW A;  1WLE A;  1X2G A;  1B70 B;  3A5Z A;  3NEN A;  2CJA A;  3R07 A;  1B8A A;  2RHS B;  2ZT8 A;  4TQF A;  2ODR D;  4P73 C;  2C7I A;  3ERR A;  2J3M A;  1WPY A;  3UGT A;  3VBB A;  1E24 A;  2DU7 A;  2ZGW A;  4NCX A;  1BBU A;  1ASZ A;  3HTZ A;  5C51 B;  4H2U A;  1NJ5 A;  1SRY A;  3HXV A;  3L4G A;  1YFS A;  2ZT7 A;  3UFG A;  4XTV A;  1EIY B;  5HGQ A;  2DEQ A;  2DVE A;  4YRJ A;  1EIY A;  4XTW A;  3VQV A;  4HVC A;  1YFT A;  3REX A;  3G1Z A;  3A31 A;  1Z7M A;  1ASY A;  2P5I A;  4LNS A;  4YDQ A;  1X56 A;  5F5W A;  3OD1 A;  3V8J A;  2QHU A;  4YRQ A;  4O2D A;  4P3N A;  3QO8 A;  4LVL A;  1KMN A;  4XU2 A;  1BIA A;  1IL2 A;  1USY C;  4CS3 A;  3I7F A;  4XTX A;  2ZT5 A;  4J15 A;  4WJ4 A;  3L2Z A;  3L1A A;  1J5W A;  3A74 A;  1WQ7 A;  5KNN A;  2DXU A;  5ELO A;  2HNI A;  2QHT A;  3V7R A;  2DU5 A;  4YYE A;  1ADJ A;  4HWO A;  4H02 A;  3A7U A;  3HXZ A;  1QF6 A;  4CS2 A;  2CJB A;  3VQY A;  4P74 C;  1H4Q A;  2DZC A;  4RDX A;  4KQE A;  2ZR3 A;  4RQF A;  4K86 A;  2AMC A;  3RKY A;  2DQ3 A;  4YRT A;  2DTH A;  2PME A;  2C8M A;  1QE0 A;  3QTC A;  2EAY A;  1NJ6 A;  2Q7G A;  1B7Y A;  4BWA A;  4YRP A;  2Q7E A;  2ZXF A;  3BJU A;  5K1X A;  3RKW A;  3MF2 A;  1PYS B;  3QO5 A;  4YRG A;  3ICA A;  3PCO A;  2DTO A;  4WJ3 M;  4LVJ A;  2RHQ A;  4BW9 A;  2ARU A;  2I4M A;  1NYQ A;  2P0L A;  4L87 A;  4YRE A;  4YRM A;  3RAC A;  4XU0 A;  4DQ2 A;  1H4V B;  1BIB A;  2ZZG A;  3A7R A;  1E1T A;  1H4S A;  4AH6 A;  4WI1 A;  4K87 A;  4RMF A;  1FYF A;  4YRO A;  3IKM B;  3BFM A;  4EX5 A;  3HFZ A;  4UPA A;  4Q6G A;  4P74 A;  4XEO A;  2ZNJ A;  4P72 A;  2ZR2 A;  2A8E A;  4UP9 A;  2ZIN A;  2E41 A;  1B76 A;  4YRS A;  4TQD A;  1X2H A;  4Q15 A;  3HXY A;  1LYL A;  4HWR A;  3E9H A;  4CH6 A;  4TVW A;  4E51 A;  2DJZ A;  2E64 A;  3RKX A;  2NS6 A;  2ZCE A;  4HWT A;  4YRK A;  1KOG A;  2ZZE A;  1H4T A;  1C0A A;  1ATI A;  4P3O A;  2AKW A;  2ZNI A;  2ODR C;  3PCO B;  3TEG A;  3PZC A;  2I4L A;  2EWN A;  4G85 A;  4YRN A;  2ZIO A;  1HTT A;  1E1O A;  2XGT A;  2AKW B;  3A7A A;  3QNE A;  3NET A;  1SES A;  3HFZ B;  4XU1 A;  4LVM A;  2EJG A;  2E3C A;  1HXD A;  1NYR A;  2ALY B;  5C53 B;  2EJ9 A;  1VQZ A;  3P8T A;  2Q5I A;  4UP7 A;  4H2Y A;  3RF1 A;  4G84 A;  3VQX A;  2J3L A;  4CH5 A;  3V8L A;  4TTV A;  4LVK A;  1EOV A;  3M4P A;  4HWS A;  3LSS A;  3DSQ A;  12AS A;  4ZIB A;  3MF1 A;  4XTZ A;  1GGM A;  3CMQ A;  1NJ2 A;  4P3P A;  1B7Y B;  3MEY A;  4RQE A;  1G51 A;  3HY1 A;  1EVK A;  4CH3 A;  4YRF A;  4H2S A;  2EJF A;  2DDZ A;  1WNL A;  2ZIM A;  3P8V A;  4YRI A;  3LC0 A;  5K1P A;  1EVL A;  2DZ9 A;  4OP0 A;  4YRL A;  1N9W A;  4PG3 A;  3HXU A;  3RL6 A;  1ADY A;  4H2W A;  1JJC A;  1KMM A;  1YB3 A;  3UH0 A;  2G4C A;  2DTI A;  4TVA A;  3WQZ A;  2XTI A;  1X01 A;  2FYK A;  2IY5 A;  1NJ8 A;  1G5H A;  4XTY A;  3HY0 A;  4LVI A;  2IY5 B;  3KFU A;  5ELN A;  3NEL A;  4KR3 A;  2DXT A;  1RIQ A;  4P73 A;  4P75 A;  4P71 A;  1BBW A;  1L0W A;  2PMF A;  3REU A;  3IKL A;  2DQ0 A;  3M4Q A;  3E9I A;  1YFR A;  2E1H A;  2ZZF A;  4OLF A;  4WF2 A;  4ZTU B;  4CH4 A;  2CGH A;  4K88 A;  4H2X B;  3RUX A;  4H2V A;  2AMC B;  3VQW A;  2E10 A;  5E3I A;  2I4O A;  4YCV A;  3V8K A;  2CIM A;  3A32 A;  4TWA A;  4EO4 A;  4P71 C;  1WU7 A;  4YRC A;  1E22 A;  1WYD A;  4P75 C;  2EL9 A;  2CJ9 A;  2QHV A;  2I4N A;  3UGQ A;  4XEM A;  4ZTZ B;  4DPG A;  2RHQ B;  4P72 C;  1SET A;  3HXW A;  5C52 B;  3HRK A;  4H2T A;  3W3S A;  2ALY A;  4XU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...