1YB6A

Hydroxynitrile lyase from hevea brasiliensis in complex with mandelonitrile
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants of the enantioselectivity of the hydroxynitrile lyase from Hevea brasiliensis
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lyase
molecule keywords (S)-acetone-cyanohydrin lyase
total genus 104
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2004-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yb6A00
5DJ5A 1ODTC 4Y2XA 4Y7DA 4FNMA 3G0BA 3I2GA 1MAAA 5CW2A 4MWTA 2PSFA 2XUKA 1M33A 4BAZA 5ALQA 3WQHA 1Y7IA 4MJ3A 1AMNA 4BRZA 4K6KA 3DEAA 5DTIA 4O08A 4GHWA 4A5SA 5FRDA 4Q3LA 2XMSA 3DD5A 3F8SA 2CUTA 3YASA 5AM5A 1UOOA 3IUQA 5ALDA 2WTMA 2HA4A 4X91A 4XIIA 1MTZA 3G9ZA 3IA2A 2QKYA 3WL8A 4X7BA 5JZBA 4UHHA 1HQDA 3QH4A 4QDTA 5C8XA 3H19A 4AMZA 4CG2A 1QE3A 1VKHA 2QMQA 2G4LA 2E3JA 3C5VA 5EFZA 2HADA 2XB6A 2Z8ZA 1MPXA 2WM2A 5A71A 2PU7A 2H7CA 4DMHA 3W2TA 4FWBA 4PQEA 2XMBA 1ODCA 5A6VA 2ZYRA 1LZLA 3FOBA 4DSZA 4K6HA 3G0DA 4G8CA 3STWA 5AKZA 4GDMA 1N5RA 1VE7A 4YK7A 1CUGA 1CR6A 2WUDA 4C6HA 5BOVA 2ZYIA 3BF7A 5K3FB 3WKDA 1BS9A 1JJBA 3B3QA 2PVSA 3WYDA 5ALVA 4PSUA 3STVA 1AGYA 1T2NA 5DNUA 1R1DA 5I7UA 2PU5A 5AKIA 3WYNA 5AH0A 5EHQA 1DT3A 2RHTA 3EBLA 2WQZA 5CTAA 1EH5A 2XUGA 4A23A 2GZSA 3ZPXA 1FFAA 5F4ZA 1Q84A 3OC0A 5AOCA 2OCIA 4Q82A 5C81A 2Q0XA 4RNCA 5I9IA 5HF9A 1B6GA 4F60A 3GUUA 5HCUA 3VVLA 5IH7A 4ZGBA 3WZLA 2R8BA 1TCCA 4OUKX 3C6BA 1LPSA 4MWSA 1DQZA 3VISA 1CUYA 5DYWA 4BTVA 4NZZA 1MO2A 1XKTA 3U0VA 3FYUC 3K6KA 3IULA 1CQWA 1QIDA 3O9VA 1FSSA 5C7YA 3LLCA 3LIPA 4BVKA 5HF6A 4PNZA 1CUSA 2PKYX 4GW3A 1EVQA 5AP9A 2BGRA 5AIAA 1K4YA 2Y2VA 3BF8A 2WU4A 1ZOIA 3I6MA 1U2EA 3DQZA 4DYHA 1ACJA 2VTVA 5JASA 2XUIA 2B61A 2JGKA 4DMFA 3A70A 1J07A 1PV1A 5AM2A 2QM0A 3G02A 3BDVA 4QEKA 4F21A 4FBLA 1ZD5A 2GBCA 1EHYA 3DOHA 1XFDA 2WIDA 4FFWA 4G4JA 1C7IA 2FUKA 1WHSA 4HXGA 1ETHA 2WHQA 1ODSA 3FYUA 4FBMA 3WKCA 5ALGA 2Z3WA 1S8OA 1EDEA 4WY5A 4OYLA 3V1NA 4ZXFA 1DWOA 1VA4A 2OAEA 4KACA 1CQZA 1UK9A 4WY8A 1QFMA 2WG1A 5AK3A 3IB3A 1B41A 1ZIYA 2QVBA 3LP5A 3NOXA 4ZI5A 4DNQA 1UKAA 4IO0A 2WFLA 3G8YA 5ALSA 4M0EA 3R0VA 2Y1KA 2D0DA 1QIKA 5AM3A 1R9NA 4K2AA 4KE6A 1X2EA 3F97A 5C8VA 2WJ6A 1R4ZA 1CPYA 1Y37A 5EGNA 5CBKA 5CXUA 3WA6A 4B0PA 4DSAA 1ZIXA 3OPMA 2WSLA 1XZAA 3TEJA 1XZDA 4W1QA 3VJKA 3H1AA 5IVDA 1Z68A 3FLAA 1GQSA 1LGYA 2BUBA 2ZJ7A 5EHNA 2BFNA 1IZ7A 1LNSA 5AIBA 2JF0A 3T52A 2OQIA 3E4DA 5HQ3A 1YAJA 2HRQA 3WK7A 1XRMA 2WUEA 4CIBA 2GYWA 3KWJA 4GWLA 3GA7A 4H18A 3JYHA 4UBMA 2XMCA 3Q0TA 1UT6A 3WK4A 4BTLA 4ARBA 2WUFA 3PDCA 5EIEA 2HL6A 2HDWA 1XZKA 2WLSA 3A2MA 1EDBA 3CN7A 2PSDA 3DYVA 5E4TA 2O7RA 2XQIA 3BIXA 4FLFA 3H04A 4AZ0A 4YASA 1QIIA 5CURA 5HF8A 4B7ZA 1CRLA 3RARA 5AK6A 1XZJA 2ZJFA 4Y2RA 2HHAA 4PF1A 2DQYA 2GYUA 3QPDA 1XRNA 1O6FA 2WG2A 1XZIA 4BE4A 4F5ZA 3WWCA 1YR2A 2EDAA 4E15A 3D2CA 5HZGA 1CUHA 1AUOA 2OPHA 5K3FA 4NMWA 3LIIA 3S8YA 4TVKA 1EXWA 4BCCA 1D07A 1C4XA 1XZFA 4S0XA 4J0JA 4QDZA 1H2YA 4AN1A 3DYIA 3D4LA 4C4XA 4DGQA 2WKWA 5AJHA 4ARAA 4B6GA 4KRYA 3QZUA 4OPMA 2HIHA 4JH0A 1XRRA 4WDQA 2JEYA 3B12A 1Y7HA 5AOAA 2VJDA 3O9MA 2PL5A 1MNQA 1QJ4A 2B4KA 2OLEA 2WHPA 2AJ8A 5K3EA 2QZPA 4W1RA 1F8UA 5AK4A 4H7DA 2JEZA 5AOBA 4U2BA 3AIOA 5LZ8A 3L1HA 1ZD4A 5IVKA 4J0KA 5ALUA 5KREA 4DLNA 4KE8A 1K63A 2XQKA 2XMQA 2WTNA 2WHPB 4Y2SA 2RHWA 2VA9A 5ALLA 4AO8A 4OB6A 1GXSA 4BP9A 1QTIA 2XI4A 1P0MA 1W76A 2HA0A 4H7FA 1DQYA 3H1BA 1P0IA 4B9AA 4OD0A 1GQRA 4B81A 5FDFA 1XRLA 5JATA 4FHZA 3CXUA 3D59A 1XZEA 4DNOA 3HACA 1WPXA 3HLKA 2IIVA 4PO3X 2W22A 1BU8A 4W1SA 2JGIA 2JGEA 1R9MA 4LYDA 5JAUA 3O4GA 3SK0A 2HA5A 3PICA 3H2IA 3WA7A 1ZICA 2PBLA 4X6YA 5HK8A 1CUJA 5AI4A 1Q83A 3IIIA 3ESDA 1MAHA 4INZA 1ZGBA 3R40A 3IVMA 1I6WA 4H7JA 3CCBA 3UUFA 5LP1A 4D9JA 2PUHA 3DLTA 3K2IA 3E1GA 5HQ3B 5AKEA 2DR0A 2JGLA 3IBTA 4B9EA 3F96A 4B0OA 3WWEA 1BEZA 4GLBA 5K3CA 1BCRA 3IUMA 1VZ3A 3R41A 1ZI8A 2WFLB 3DL4A 5D3ZA 3SC2A 5A7FA 2ZYHA 3WJ1A 3WJ2A 1J1IA 4WCVA 1BEEA 5DNWA 1YSCA 4BCDA 1H22A 5AI8A 1R3DA 3C5WP 5HF5A 4QDOA 5ALYA 4YX9A 4EUSA 2BUAA 4J0GA 4B80A 4LIPD 1BN7A 4AMYA 4X3CA 5IKXA 3BXPA 4BDTA 4MEAA 2C0PA 3OOSA 3WLAA 2Z3ZA 3M81A 1IVYA 2XUJA 3ED1A 7YASA 5LZ2A 1ZI6A 5CT4A 1JMYA 1QLWA 4Y9SA 4JEIA 1DU4A 3F67A 1SC9A 2WIKA 3G0GA 1YB7A 2VQ6A 4JNCA 4RE5A 2WIFA 2WUGA 4QNNA 3H18A 4GECA 5SYMA 2AJDA 4AB1A 1IMJA 1USWA 1SOMA 4J0IA 5FOQA 2HU5A 1A8UA 1CUCA 3A2NA 4IH9A 5DLPA 5DYTA 1C7JA 2J3DA 2EEPA 3V48A 3O0DA 4IHAA 1SCIA 3WKBA 3WL5A 3S2ZA 3DNMA 4X95A 5HKAA 1G66A 3GBSA 3V1MA 5LLSA 3HI4A 4DMCA 3AZPA 4HZGA 2WFZA 1XZBA 4EY7A 1R50A 2V96A 3WWOA 5T4EA 5FXMA 2WJ3A 1YCDA 2VF2A 2C4HA 4N8EA 3FAKA 3IDAA 2H9YA 1GPLA 4MQLA 5CRIA 4KR0A 5HFAA 1J2EA 3AINA 1CUIA 1VA5A 5HKBA 4TGLA 2O7VA 1VXRA 2DHEA 4N5IX 1TQHA 5CT5A 1GKLA 1CEXA 4OU4A 1F0PA 4ZV7A 1NU6A 4CFSA 1EK1A 1TK3A 3KXPA 3GZJA 1UXOA 3R3VA 4G8BA 1N5MA 4JYMA 3LCRA 2YXPX 1W6RA 3H17A 1CUVA 1XZHA 3C45A 2RONA 1L7QA 5LYYA 2JGFA 4Z49A 1DT5A 1SCKA 4WFKA 4E14A 2XMRA 3QMWA 4Y2TA 1ZD2P 3V9AA 3EQ8A 2WFMA 5EIHA 2H7XA 3GELA 3GROA 4G4GA 1ACLA 2HU7A 3H2JA 4HVTA 4MEBA 2HA3A 3NUZA 1QO9A 2BGNA 3TRDA 2OXEA 1K5PA 4KAJA 1WCYA 4UFPA 4BAGA 1YS1X 3DCNA 3STXA 4BP8A 4X92A 1GPNA 2FJPA 1G42A 1F0NA 2PUJA 3ESAA 5AI6A 2C7BA 4EBBA 1JKMA 2XUPA 3DL7A 1G5FA 3F9CA 1ORVA 3ANTA 4DMKA 2XLBA 1W52X 4UBJA 4BZZA 1U4NA 2DFPA 1QIEA 4BE9A 4HS9A 2OAGA 2JIDA 4FLMA 1H2ZA 1LBSA 1OILA 4ZV9A 2PSJA 2XE4A 2QUAA 2Z8XA 1U8EA 3A2LA 4J3JA 3A6ZA 3PFBA 5FKJA 4GXNA 5T4FA 1XZCA 4Q1VA 2HA7A 3STTA 4H77A 5JALA 2J4FA 2XMDA 4XWGA 1HBJA 1E8NA 2B9VA 4KAFA 4FFVA 2ES4A 1QO7A 1AURA 5AM4A 3M82A 2O2HA 4QE3A 2CKMA 1PJAA 1AQLA 4J0HA 3G9UA 2VEOA 1VOTA 3IURA 4G9EA 2VT7A 4B84A 1XLWA 3JW8A 2GBGA 4PSDA 3KOOA 4H7EA 3FVTA 5D6OA 3DS8A 2PM8A 4OCZA 1R88A 3L1JA 4X97A 2C0QA 3O95A 3WK8A 2HM7A 5AK5A 3M83A 3F98A 1ZD3A 5A7GA 4N5HX 4L0CA 3O4IA 3VJLA 2YASA 4J0CA 1JU4A 3D2AA 5AKHA 1EINA 4PW0A 1XQVA 1UZAA 3LS2A 4UBOA 3W04A 2HFJA 4UUQA 4BB0A 5JD5A 4H0CA 1QIFA 1XZGA 5DWDA 2GBFA 5KWJA 1JT2A 3V1KA 4CIAA 1QOZA 4HAIA 5ESRA 4AQDA 4J7AA 1E89A 1XZLA 4B83A 4AX4A 4CG3A 2XUOA 4M0MA 1IUOA 1N1MA 4L9AA 4BVLA 4Q05A 3G0IA 2XMGA 5ALPA 4K6GA 4UBNA 5DTJA 1H2WA 4FMPA 3P2MA 3R3UA 5DNVA 4HRYA 1EA5A 1EDDA 1BROA 5H3HA 2XQGA 2VAXA 5HFNA 1RWQA 3UMJA 3QVMA 1CUDA 1VZ2A 1XQYA 5LKAA 1AX9A 4TPKA 5EHZA 3CN9A 3WL7A 3HXKA 4UHDA 5JADA 1BE0A 3AFIA 3U1TA 3DKKA 4JYPA 5LZ7A 2I78A 1MJ5A 4KRXA 4BYMA 4BCBA 4HXEB 5ALFA 3W06A 5ISMA 2XT0A 5EIAA 5IVIA 3AZQA 4ZRDA 1IZ8A 4LXHA 3C6YA 3C87A 3ESBA 2QT9A 5ALTA 2OCLA 4AO6A 3D7RA 1BRTA 3KSRA 4AXBA 2ZYSA 2X8BA 4X94A 5FV4A 3HZOA 5ALWA 1ZJ5A 5JAPA 4JUIA 2WILA 1GPKA 2VATA 5ALHA 1EVEA 2FX5A 1Q0RA 4ZWNA 5AO9A 5K3AA 5CH8A 1WB4A 4A16A 4QDUA 1LPAB 3CCCA 3H2HA 5K3DA 2CMFA 5AI5A 3ANSA 1THGA 2CEKA 2I03A 1HKHA 1UK7A 4FOLA 4J03A 4QDXA 1E8DA 1LPNA 2OG1A 3AIMA 3K9BA 2OQVA 4FLEA 2XUDA 1WHTA 5AKLA 4Y2YA 4KYVA 1EB9A 3VJMA 4DTCA 1QGED 1SFRA 4P08A 4GEGA 1VE6A 4E46A 5JAHA 1YS2X 5SYNA 4BZWA 3R3ZA 4I3FA 5JZSA 3ZLVA 4MYDA 5FUMA 1CUWA 2YYSA 3C43A 1FFCA 2CJPA 1MU0A 4P93A 2ACKA 5CT8A 3ESCA 4H7HA 4CI9A 2BJHA 5ALRA 4Y2UA 1UK8A 2VJCA 4C4ZA 5JIBA 3FYUB 3HABA 2C5GA 3RK4A 2XUQA 3STUA 1UK6A 5EHXA 5JAOA 1LPOA 6YASA 4BC0A 3R3XA 4BC1A 2AXEA 3AUKA 3I2FA 1H23A 1E66A 3WMRA 3RLIA 2Z5GA 1GZ7A 4WDRA 4LXGA 3QITA 1PFQA 1UOPA 3FWHA 4U2FA 4QA9A 1FFBA 3AZOA 2HA6A 1L7AA 5AI9A 1LPMA 3PF9A 2I3DA 1Q0ZA 5FP0A 2ZJ6A 1NX9A 3OTQA 3N2ZB 3ZLUA 4Y2QA 3OURA 3OM8A 2I3ZA 4KE9A 3VVMA 2IITA 1XQWA 5JZ9A 2Y6VA 1E3QA 4X6UA 4UPDA 4OSEA 1LLFA 5FLKA 2AJBA 1XLVA 3AIKA 1QIGA 1GKKA 2WIJA 3BJRA 4CCYB 4UFOA 4PV7A 4B82A 2QR5A 2OCGA 4IH4A 4ZREA 4RPCA 5CXXA 3SWWA 3WKEA 4N8DA 1XRPA 1CUZA 3FLEA 4BDSA 4BVJA 4C89A 5E4JA 1N8SA 2XLCA 2P8SA 1VXOA 2QUBA 4X93A 5E4YA 3W05A 1UKBA 3C6XA 3STYA 2GZRA 5ALIA 1ZJ4A 4QZVA 1XLUA 3VXKA 1OCEA 1CVLA 2BCEA 2GYVA 2FJ0A 4BATA 1X70A 3H2KA 1JU3A 3C8HA 2XUHA 2XQFA 1QIHA 5CMLA 1JMKC 2PPLA 4G8DA 4C4YA 1YB6A 4Y2JA 3HSSA 3EQ7A 2VJAA 3I2KA 4EHBA 1E8MA 5KWIA 2ZSIA 3EF3A 3M3DA 1WPRA 1CIJA 1YASA 3QMVA 5J3JA 3PE6A 3AILA 5JD4A 3X3HA 5BV7A 2O2IA 4OB8A 3QM1A 1JI3A 2QXUA 2C58A 1ORWA 2JGMA 4KEAA 1WM1A 1X2BA 1BCSA 2BKLA 3DOIA 1QONA 4G5XA 5JYCA 3FVRA 1G4HA 2JGJA 2DCMA 4FTWA 1UKCA 5D7BA 3I2JA 5CH5A 4OB7A 5AI0A 4ROTA 3WK6A 4BRSA 1A8SA 1MX1A 2JBWA 1AZWA 1K6EA 1TCBA 4G1FA 1BN6A 1CUUA 4X85A 2PX6A 3BE8A 4Q3OA 5LIPA 4RGYA 5CT9A 4XVCA 5ALZA 3DKRA 1UOQA 3H2GA 1EX9A 1XZMA 4U2EA 1FFDA 1U65A 3WKAA 5A2GA 3EQ9A 2J4CA 5JANA 1P0PA 3FYTA 2BAGA 5LKRA 4U2DA 4AN0A 4PSCA 3MGAA 3E0XA 2OGSA 2CB9A 4DIUA 4L72A 4UFNA 1YA4A 4K5QA 4H7IA 1QIMA 3D3NA 2H7YA 2XUAA 5E2IA 3I1YA 3HC7A 2WU3A 2OCKA 5ALMA 3WK9A 1XROA 4CCYA 1IUNA 2K2QB 1W75A 1P0QA 4UBLA 5LZ9A 2G5TA 5CT6A 4EY6A 4WFJA 1CUFA 1CUBA 4EY4A 5K5EA 2VT6A 3FLBA 2OGTA 1JFRA 5ALNA 1HDEA 5BWBA 4NS4A 2RI6A 3AJAA 4U2CA 3TJMA 5BWCA 4V2IA 5FPPA 3WZMA 4XJVA 3ILSA 3KDAA 5ALXA 5AICA 3WL6A 2ZSHA 3HRHA 4XX1A 2WIGA 4NVRA 1IUPA 4C87A 4H35A 3FSGA 3WIBA 3R3WA 5YASA 4W1PA 2ONCA 3QMMA 2V98A 3TGLA 4W63A 2BUCA 4KE7A 5T4BA 4Y2PA 1CUXA 4I4CA 5AKYA 2DSNA 4BBZA 4LYEA 2DHDA 2RGUA 1EB8A 1JJFA 1T4MA 5AHXA 4CG1A 3BWXA 1A8QA 3W9UA 4LXIA 2EDCA 3E3AA 2RIPA 1FFEA 3I1IA 3H0CA 1W4LA 2WHRA 1MNAA 4RE6A 4H7KA 2Y6UA 3NGMA 4U2GA 3QPAA 4DNPA 4G4IA 1DINA 1DWQA 2D5LA 3FCYA 1L7RA 2QS9A 1YAHA 1ZGCA 2UZ0A 1LZKA 2ROQA 3HYSA 4E11A 1YA8A 3D2BA 5I8PA 2XQJA 2ZVDA 4UHEA 2X5XA 4GI1A 3WWPA 4KAAA 1AC5A 1DX6A 1TIBA 5AKXA 4UHFA 4GBGA 3W9BA 2VSQA 1LPPA 5AKKA 4HTAA 2W6CX 2AJCA 4FKBA 3VDXA 4DNFA 3T4UA 3O4HA 3O4JA 4EB0A 5JD6A 2HA2A 3BDIA 5AM1A 3WK5A 4DM7A 2QRUA 4CCWA 4FDMA 1SCQA 3I6YA 1XRQA 1JJIA 4WFIA 3OG9A 2HRRA 2IX9A 2C5FA 1EI9A 5A7HA 3D5EA 2QJWA 1DTEA 3QBJA 4EY8A 3ZWQA 3MVEA 4UHCA 5K3BA 4QWWA 3WWDA 3C6ZA 3PUIA 1CUEA 2WJ4A 2PSHA 2DQZA 3WIOA 4FNGA 4OU5A 2VJBA 3I2HA 1UFOA 1MN6A 1VLQA 3FBWA 5KBYA 4MYSA 3IUJA 1ISPA 3MUNA 3G9XA 4I19A 5HK9A 2Y2UA 5ALEA 1RYYA 2YH2A 3R3YA 2ECFA 1THTA 2OGZA 1ZI9A 3V1LA 3G7NA 3HEAA 4ITVA 1W1IA 1CLEA 4P9NA 5IVHA 1TCAA 2HFKA 3ICWA 3I2IA 1WOMA 4L3WA 1CFJA 1UWCA 3C8DA 4J0DA 3EIOA 3G0CA 3GFFA 4QLAA 3PI6A 3PFCA 1KU6A 1DX4A 3IUNA 3PF8A 1TAHA 4LKOA 4B85A 3UUEA 2J3QA 4P92A 3N0TA 4OYYA 5AKGA 1MX9A 4KJXA 1VJ5A 1J06A 2DHCA 2CZQA 5C8ZA 1O6GA 3BJMA 4X71A 5T4HA 4YPVA 3D0KA 5JARA 4ETWA 1FJ2A 3SX4A 5CH3A 3QPCA 4AZ3A 2PSEA 1HLGA 2CBGA 5ALOA 4G9GA 2X76A 2ACEA 4BAUA 1KEZA 3B5EA 4IH1A 1RP1A 2ORYA 2V97A 1LBTA 2O2GA 1MX5A 4LHEA 3BL8A 1XQXA 2LIPA 1TKRA 4C01A 1KU0A 2H1IA 4X00A 4AO7A 3KD2A 4Q34A 3JWEA 3FSGD 1OXMA 1K8QA 5EI5A 3BIWA 4X6XA 3FNBA 1H2XA 1WB6A 3NWOA 4IQ4A 5ALKA 5LZ4A 1XKLA 2R11A 3KWFA 4UBKA 1QTRA 2XMZA 5A62A 1WB5A 2QOEA 3C70A 3VKFA 2QXTA 3FCXA 2HU8A 4F0JA 4Y2VA 1F6WA 5AM0A 2B20A 3ZV7A 4EY5A 3ZI7A 2V9ZA 3RKSA 1A7UA 1DWPA 4MXDA 2VAVA 1TRHA 3PUHA 1QZ3A 2XUFA 1LPBB 4EZIA 5D3KA 1QIJA 3WI7A 2XDWA 3QYJA 1E5TA 2G5PA 1EK2A 2QJRA 4N8SA 3DDUA 3RM3A 1HPLA 4EA6A 3DJYA 1A88A 3G9TA 4UBIA 3HJUA 3L1IA 1HL7A 2AJLI 2GBIA 4MQMA 2NW6A 5DYYA 1CV2A 4M0FA 1CUAA 4QLOA 2QTBA 4C88A 3I28A 2G63A 4Q3KA 4QWMA 1GGVA 3I6ZA 4HXFB 3ZLTA 4UHBA 5FPQA 4X90A 1NU8A 1MT3A 2RAUA 1GT6A 2WG0A 4W9RA 3MUOA 5AKJA 1AKNA 3ICVA 5LZ5A 5ALJA 1QFSA 4HRXA 3Q8WA 4WJLA
chains in the Genus database with same CATH superfamily
4H2DA 1R5JA 1A5SB 2QW0X 5DJ5A 5LOVA 1IPFA 4Y2XA 2IYVA 2BMDA 3KOMA 2I4LA 5EXDA 4RAQA 2P0EA 1NPYA 4FNMA 1KZ7B 3I2GA 5FD8A 5AW1A 4RXTA 1MAAA 2D0IA 1I13A 4MVYA 1COZA 4A2CA 3PT9A 4D5GA 2IQIA 1XXHE 3UN1A 4JT2A 1K8YB 3GARA 2W2VA 4O2AF 2AYZA 1EBUA 5L4NA 2BZ0A 1ESZA 4J4TA 3GMTA 4K6KA 5DTIA 1NQ5A 1WO8A 5A4KA 5GJVC 3C74A 3RC8A 4MUXA 2P2DA 3NEJA 3SI7A 3U6KA 3ETGA 3TRKA 3UPDA 3V1TC 4IM7A 1DKPA 1I7QB 1UBLS 2VOJA 4QEZA 1MPTA 4REQB 2XODA 2R8YA 4MDHA 5AVQA 3VH3A 1PYOA 4RMHA 3TZQA 2IUEA 3JTMA 1QK5A 3YASA 3B38A 3MRTA 4KLRA 4RVFA 2NU7A 3MWGA 1PZEA 1HETA 3AR9A 1JLMA 2ZANA 1K75A 2WTMA 2EJTA 1RKBA 3OJCA 4QXOA 4MS3B 1IY8A 1U4OA 3LDHA 1DKOA 4NXNB 3E58A 3C3WA 2OSVA 5CD1A 3A28A 3AUTA 3UKJA 1P7ZA 2RK6A 5AJWA 1S7CA 3WL8A 5JZBA 1YVEI 4RLSA 1N4AA 5FR1A 1C9KA 2JFYA 2P9JA 3D6HA 1E1NA 5FOXA 3W1VA 1JGTA 4DCCA 2BZGA 2XTMA 2R0QC 4MGHA 1GNQA 3UAVA 3I4LA 3P0FA 4PGHA 1W1WA 1NW4A 5KNDH 1QE3A 5BN3A 1RABA 4BASA 3K1YA 1SZCA 2I2XB 1ZH4A 3HU1A 1NIPA 2E3JA 2PR7A 3WHIA 3AL3A 4BU0A 4WZAE 5DOZA 3TH5A 1TW2A 3SXUB 5CX1B 2PKXA 4ISCA 4YAFA 2P2GA 2XDQB 5DHRA 3K8YA 4TN5A 4QHYA 4V0MA 5CJPA 5BXQC 3TBHA 4RVDA 1C8BA 4YT5A 5AXBA 5HKLA 3R24A 4YDSA 2BWJA 4YRJA 3OUTA 4PQEA 3K8OE 4EPXA 1VYVA 1CZKA 2XMBA 2DP4E 3EVDA 4TQ9A 3GLGA 2PKRA 4XQEA 2IPNA 4WRRA 4JZKA 4PPGA 3PHGA 1M75A 1XAIA 2GN9A 2WDZA 1JVNA 3FOBA 1CJMA 4I6GA 3T7RA 4AP5A 1DNPA 3NAQA 1XEXA 1QG6A 2DY1A 1HSZA 3BUSA 1BGWA 3NEAA 2PIDA 2GDJA 1JH8A 3JV7A 2G9UA 4GH5A 3STWA 1EFAA 3X43A 1DC3A 1LWNA 2FFJA 4GP7A 3JATB 1SA0B 2OV3A 4LSZA 1C8VB 4Q93A 2HF7A 5KNBA 5JJKA 1N5RA 3GF4A 4G5QA 2VDWB 4MQBA 5G40A 2AEMA 3E3LA 4G97A 4QQ8A 3GVHA 4EG7A 4ZHQA 3MGGA 1BGXT 3PNYA 2VLIA 4C07A 5SV2A 5J4HA 1MHTA 3PR2B 2IA5A 3ZXSA 2PWBA 1UIMA 2XZDA 1OREA 4V0OA 3WKDA 4E51A 1BS9A 3JYQA 4V1CI 1C7RA 5A5VA 4GPAA 4YV0A 2FPUA 2P65A 2V3WA 4PSUA 3LSTA 4O33A 2FZ4A 4NDZA 2YN0A 1E4EB 1TF7A 2A1IA 2IGBA 2R5WA 1SU8A 2MMGA 3BFKA 5AW4A 3B1XA 3K8ZA 3U7HB 1R6UA 3MWKA 4G4SP 1BYUA 5BY2A 3EXG1 2NXJA 4TKVB 5K8VA 1ABBA 1SVMA 2UVPB 2WTBA 1AK2A 3K94A 3MAJA 3EZFA 3WYNA 2HLHA 4PYLA 4RLQA 2IGTA 1WEHA 3RSLA 2HRDA 4DDHA 5JTTA 2WQZA 3ZXYA 3BFXA 4CQMA 2QRMA 2Y27A 4CE6A 4IFTA 2ZBRA 2XUGA 4KFUA 1ZK3A 4RDHA 2BMVA 4X1OA 1UC8A 3F2IA 1Z13A 4IQ0A 4MNTA 4HQOA 2NUAB 1RYBA 3ITKA 3VBCA 1FOEB 3VU3A 4H1HA 1ZHOA 4H6XA 1HG0A 2X8JB 2DYKA 4KIWA 2QYHA 2R6R1 3DHVA 1ZYUA 4Q6WA 4WKBA 5F4ZA 1SXPA 5K45A 2E48A 4IDOA 1T15A 5AOCA 4H4DA 5F51A 2Q0XA 4ID9A 2P9EA 4K8RB 4RNCA 4Z1MA 1LCIA 1KI6A 2HBQA 4TM7A 4AY5A 1XG5A 1Z4KA 3B52X 3KKNA 3LX5A 2ZPAA 1EGMB 4O2AB 2QD5A 4W5TA 2O8BB 2WD7A 3O6VA 4ZAFA 3A1CA 4FCWA 3WZLA 4HNVA 1TCCA 3VTAA 3PEUA 2GCNA 2JJMA 2P2YA 3BHMA 1OPRA 2BTOA 3SSMA 3VISA 1BMFA 1I8TA 1OHHD 3HWRA 3I30X 5K6TA 3U61B 3KKLA 1XP8A 1BCSB 2V9PA 4OXRA 4G67A 4MYRA 1CQWA 3KQVA 3CIFA 4EFNA 2IEYA 4ARIA 5K51A 5C7YA 4YJ3B 1K8XB 1DJNA 1B8OA 1QE5A 2G9QA 3QEJA 2DHQA 4FYWA 2W37A 2ZYWX 5ARDA 4D9HA 1K88A 3B1JA 1P1FA 1KDVA 4DIEA 1JR4A 1GTL1 3B1FA 3HCAA 4MKHA 3E05A 2JLSA 1G9XA 3PQFA 4MRVA 4QSMA 1PR9A 3DT8A 3LCMA 3N2GA 5DB4A 3THRA 1IPHA 1MKYA 4RLFA 3WB9A 1O95A 2C5SA 4WTOA 2QRHA 5TQJA 4R51A 4AMBA 2AKYA 4QPPA 4ETMA 5JFOA 2PKYX 1AVTA 4PVDA 4R4JA 2WUWE 4JBNA 3NDJA 1A95A 4TXJA 2W2KA 2N9UA 3NVKI 4LFCB 2GSDA 2ZIAA 1P5ZB 3FNRA 1IBSA 2M32A 1PE0A 5AP9A 4YJ2A 4A0QA 3IB6A 3SEFA 5CA0F 3UO8B 5LNK1 2FGKA 2F9MA 4GGOA 5J2TB 4LJ6A 4QTTB 2Y2VA 5D01A 4ZEOA 3HUTA 3WP0A 4G5FA 2WU4A 2CJFA 2J7KA 2Z43A 2AZ4A 4CEHB 1EESA 4NBRA 3GLHA 2VQDA 4R2LA 4RV5A 3EXIA 3RYHA 1U7ZA 3I6MA 3VTZA 2V6FA 4Q4HB 1NXWA 1U2EA 2G80A 4DGSA 2C77A 3KVNA 3DQZA 4PIMA 2DG2A 1W581 5K0GA 2X42A 3E9ZA 4TUYA 1JHZA 2B61A 2JGKA 3T99A 3A70A 4EI7A 2N3ZA 4J9VA 1YTLA 2K5UA 4E70A 1XJQA 2V7PA 1WDMA 4DXAA 1TKBA 1YC5A 5FCDA 2J0UA 3BWDD 3G02A 4KK4A 5TS2A 2W6IA 4MWGA 3P8ZA 5LA6B 1KETA 3L0BA 4GZ6A 3B8EA 4P6VF 4F21A 1JFFA 3H2SA 3MMNA 1TXGA 2C5LA 4FFMA 3P19A 4LK3A 3K0KA 3DOHA 3KVOA 2ZVQX 2IS2A 4ODIA 1K68A 1N4DA 3DAFA 5CYPA 4FFWA 1FIUA 5F4BA 3GWZA 3BIOA 1VPVA 2J3EA 4DCGA 4FWTA 2AF4C 4JI6B 3AM1A 1Z83A 3C0KA 2X7HA 4D44A 1JHOA 5ALGA 3SJBA 4PNPA 3ZU3A 3B1VA 4HCJA 4OATA 4G09A 1Z75A 3VJRA 3PPVA 1L7MA 2PTGA 3I04A 2OXTA 4XTCS 3I3OA 1IBRA 3V1NA 4B31A 1VA4A 1DDIA 4MQFA 3UW1A 1YQXA 2H1SA 2OAEA 2WP8J 5BN3B 4TMTA 1RKQA 2ST1A 3NX4A 3QVWA 2BSAA 5ER6A 3TX2A 1U02A 2WG1A 1HRKA 1UWKA 4BOYA 1DG9A 1I7LA 2ID8A 2ZQZA 3P4YA 5AK3A 5TIIA 1EG2A 1VBKA 3IB3A 5C53B 5FTKA 1YCHA 1HTTA 1KVRA 1GZ4A 3RU2A 3JQ9C 1R74A 4DV6B 4TS4A 2BGUA 3EFEA 3Q12A 3HADA 5DBOA 3VPAA 4L6IA 1I3LA 1JDVA 1TGYA 3NOXA 4TRNA 3GDFA 4ZI5A 4DNQA 3QW2A 4DCOA 5CHEA 4YVFA 5KIAA 3HXQA 1M5UA 2JAQA 1LB1B 3WGNA 2ZWIA 3T5DA 5DLEA 1KH3A 4NJOA 4DR3B 3BZWA 1X8KA 4QTZA 1DJPA 2SECE 3R0VA 4B3BA 2QN9A 2O6HA 4DA8A 2Q4EA 1T9KA 4CJXA 4L15A 4DR4B 4EITA 3TCXB 4R05A 3R2JA 5FJJA 1CY8A 3L7JA 1DEXA 3OCCA 4L5CA 4KE6A 2PX5A 2WJ6A 1VGVA 3K9LA 4F0JA 1LW6E 4UEOA 1CPYA 3U1VA 2IS4A 4YAWA 1H8HA 4NJMA 4MO9A 4ZPJA 1VG1A 4QTXA 1UDWA 1TYAE 3WYEA 1P4RA 4EG0A 2W8BB 3DVAB 5T6MA 4IICA 2H85A 2L17A 3I83A 2AHRA 3PFFA 3UHOA 4B0PA 3TRIA 1JQLB 1ZIXA 2FQYA 4KXVA 2GZ3A 3OE5A 1XEWX 5K6AC 2RD2A 2Z58A 1TJYA 4JWTA 1US8B 1XCBA 1IEWA 1QQ6A 1RW4A 2XDQA 3VJKA 3H1AA 2FZLA 2TMGA 1OXKB 1O2DA 5FULA 3G2LA 3PFGA 3KP1A 2ZJ7A 1I6LA 3QQPA 3RGGA 4O0LA 2OM2A 4AZTA 4JP2A 4PX2A 1YRAA 4P7JA 3VKWA 2RGGA 4A2PA 2RIRA 4XPZA 5ADVA 2JF0A 2QK4A 3RT1A 2XBMA 1NJ2A 2AK3A 2WU8A 3Q7IA 4CTNA 1R5NA 3FOFC 4EZBA 1YAJA 2WB2A 3A27A 2WUEA 3VUFA 3G2NA 5DM70 1ENPA 4F1JA 2Q7OE 3MM4A 3KWJA 4YYEA 4M6WA 3I8XA 1TDJA 3DULA 5EA2A 1MGOA 4E7OA 1U6IA 2DQKA 1DWUA 4M60A 2VF5X 4UBMA 2XMCA 3ZDYB 4CDGA 3OUZA 4X63A 1SCJA 3KETA 3K6SA 2IHYA 2OV4A 4IYJA 3SJZA 3Q0TA 4GYJA 1EJBA 2P1RA 2WPDA 4MVWA 2P9TA 4AJ4A 4QM6A 4YS6A 3OJWA 4WACA 2PNJA 5F2KA 1KI7A 1XPUA 3W2FA 4TSFA 4J49A 5DXAA 2BMFA 4ARBA 2IXBA 3MMXA 4BFLA 4IHQA 1JLKA 1FRZA 1OXBB 5D6NA 3A2KA 1IJFA 1PLJA 4JJ4A 1GA4A 4R2WA 5IP5A 5K2MA 4ZZIA 3KYCA 3UGJA 3MMSA 5DASA 1DRVA 2VPZA 3DYVA 4Z9AA 2KBEA 1Z7GA 4B33A 5IF9A 5JSHA 3VNUA 2XE7A 5BVGA 1YNSA 3I72A 3D64A 2FZ5A 3KTAB 1DARA 2YXLA 4AZ0A 1QIIA 5HF8A 1TA4A 4Z2AA 1O7JA 2GZ2A 2YC4C 1P72A 2I3BA 1P61B 3DDSA 3RARA 4EO4A 4JITA 5AK6A 2QI9F 1CQPA 1XZJA 3MD9A 3ZK9A 3QVKA 3EPHA 2YJ3A 2DQYA 2V7WA 4C03A 3T38A 1XRNA 1O6FA 1TW3A 4IVNA 4X7RA 3LW8A 5BPFA 5JNWA 5K01A 5LXTB 1EK5A 5BR1A 1MAWA 4UAVA 1WXQA 4UTRA 4WXMA 1FS4A 3ZJTA 3PC8A 1XEXB 1KVTA 2FGJA 2C99A 3GA0A 2OMEA 2VIIA 4DCPA 4IUBS 1JE1A 4MYCA 4BP3A 4F2WA 4BE4A 1SOWA 1KS9A 1MJGM 1D4AA 3KBBA 3SOPA 1TTTA 3BMXA 2OV1A 2P3OA 4DIOA 2O8EA 1UF9A 1E9RA 3FDFA 2FEPA 2X0JA 1TT5A 1YULA 4XGNA 4GGPA 2LP4Y 3C7KA 3IQGX 3FKSA 3LIIA 1YVRA 2H1CA 1XTKA 2QN6A 1K0FA 3AOGA 3TRHA 2JEOA 3E3MA 4ZCQA 4GOMD 1UBOS 1VIMA 3EVZA 3PYXA 3D9QX 1UFKA 3JQEA 3L7LA 1O9HA 2E4WA 5JBQA 1ZXLA 2FCAA 2AMLA 2HXYA 2NTVA 4S0XA 1PJLA 1UP4A 1DTWB 1W0JA 2W4QA 3LVQE 3NW9A 1JFLA 4OFWA 4MVJG 3DH0A 4RETA 5EGSA 5BORA 5LD2C 2DZDA 3ACBA 3DYIA 3DOEA 3SF8B 9ABPA 2Q5CA 4UEJA 2CMGA 4DLRA 4PG6A 1X39A 1H1LA 1S2DA 3HCWA 4B7CA 5KNLA 1P74A 3PHLA 1T1SA 1PJ4A 3VO8A 4KRYA 1PZMA 4EFDA 1FRFS 1G3QA 2PXAA 4DMUB 2VQEB 1Q0LA 2LRHA 5GTDA 1KSFX 4OK6A 1Q44A 1NP3A 1LFDB 3BIFA 4G1UC 3VSBA 5HS4A 3HP7A 5EE3A 2QTVA 4BQIA 2QP4A 4NU8X 5G0UA 1ID8A 1G2OA 4EYKA 3LL7A 5DGXA 1Q7RA 4XI9A 1C4KA 1YB2A 2FMKA 2W6MA 3LUBA 2GK4A 2C42A 3AM5A 1GPWB 4MH0R 2B4KA 4NEHB 4XUDA 2AJ8A 3WYGA 3LF1A 3LQ1A 2DBYA 5CR9A 3S81A 1HA3A 3CJRA 1HOXA 4UTZA 1F8UA 4X1IA 2GYYA 1U94A 5AK4A 2VHEA 4PCUA 4RA9B 3PVZA 4K28A 4ATNA 2DFVA 3SKXA 3WRWA 2OBLA 3CFYA 3KBOA 2G0NA 3L1HA 4BU1A 3NHPA 1JQKA 2C9MA 2DM6A 3PNPA 1BDHA 1SVOA 2B1IA 1ZEMA 1IYZA 3FOWA 4GOXA 3RBXA 5EJGA 2CXRA 2IWHA 2O8CB 3UKDA 4KE8A 2HJGA 1K63A 4HQNA 5DSXA 2XQKA 4AMGA 2XMQA 3C4JA 4U7GA 4JU9A 4WJZA 3V2HA 3BEDA 4BO4A 2WHPB 2ZAMA 2PD4A 3FVQA 2W43A 1U1FA 1LBHA 2GFIA 2G9RA 2X9LA 2IU4A 4TUYB 4FGLA 1ITZA 3BWYA 1CJCA 3NCHA 4JQYA 4KR9A 4LE2A 3VQTA 6PFKA 5KDOA 1SKMA 1GXSA 3BD6A 3KHUA 4JLJA 2R66A 4RMNA 5DZSA 3T3PB 3ECCA 3W2IA 2V4MA 4N6NA 1W34A 1QTIA 1E9FA 1X13A 3GEDA 1O94A 3DM9B 4JJ8A 1U2DC 5KB3A 4PC3A 3V9PA 3KQHA 3D7MA 1JDTA 4AZWA 3H1BA 4OQZA 2ONJA 2CFCA 5I6DA 4NE9A 2H0RA 4XOIA 1C80A 1J0DA 2LDXA 2WRZA 5IDQA 1OVMA 3ANMA 4I1YA 1P2UA 1GQRA 3KYDA 4LNUA 3DCJA 4B40A 4I5EA 3BK7A 5CXQA 2Y1WA 1S0UA 3FM9A 2VH2A 1NP7A 2KQUA 3NPMA 4Z86A 4YJHA 1I4OA 3CVVA 1K4KA 1Y8RA 4NJEB 4Z4EA 3FXAA 1X15A 2FPRA 3HLKA 3TINA 3ROPA 3VU0A 1UMDA 1WUYA 5AESA 1R0XA 2QMYA 4KUHA 2CHEA 4N76A 2O9JA 4N49A 2W22A 1G8HA 3LCCA 1GUYA 2UXBB 1EE9A 2IYQA 2PFKA 3PRYA 2A0YA 2BKAA 4KWHA 1Y3IA 4EL0A 5I9BA 3LLSA 3JZMA 3EVNA 3TZLA 3D31A 4WZBB 5EIBC 2XZLA 3M1YA 1YK0A 5JY6A 4M49A 1KOJA 2XVZA 4LQ4A 4ZCPA 4ALNA 1A69A 5F9HA 4DRXA 3BSSA 3HV2A 2R79A 3ABIA 1ZICA 3AIIA 3NDIA 1C29B 2HPAA 2FF5A 1DC8A 4PNHA 4QODA 4YJFB 3TKYA 4W6ZA 3ZVLA 3T61A 3SJ7A 2I6UA 3QKWA 4MKZA 3S99A 3UT0A 4OG2A 3PDWA 5K03A 2EKDA 4A8PA 4GKBA 4UVDA 4MAAA 3FZNA 3ROFA 4MUFA 3IIIA 1WDLA 2XYGA 3ESDA 3L8MA 2QLNA 4D26A 5FTNA 1PR6A 1JLHA 2LKDA 2AXNA 4INZA 3MZ0A 1H5QA 3R40A 4AIRA 5IC4A 4PCAA 3DVAA 1PG0A 2JI8A 4H3HB 4C5CA 2V7EA 5G02A 5TB5A 3CCBA 1DBVO 3UUFA 4D9JA 1COWD 1E1DA 4R1NA 3DLTA 1JDNA 4JJAA 3I5MA 2JAWA 3LY5A 4D42A 2HW8A 5AKEA 2DR0A 4IOLA 2H5EA 3R7DA 3WBFA 2L82A 1L4EA 3DLBA 3BMNA 5TMEA 1DKNA 4M1EA 1YFZA 4FPXA 5JWRA 3F96A 4B0OA 2DPYA 3USCS 2P62A 4O2RA 1QP0A 4EHJA 4J9UE 2YV1A 3T7EA 4NPCA 5EJ5A 1NMQA 3CUUA 4NENA 3L8DA 8ADHA 3TR5A 1BEZA 4GLBA 3WBKA 3D3EA 2VPIA 2VRWA 2XITA 5JEEA 4CODB 1GDHA 1U1EA 2P68A 4GOND 4MWOA 4RVNA 2C3YA 3QQ5A 2B2CA 1JLLA 3BE6A 1QJCA 4CETA 1B7GO 4UKDA 3M7IA 3DL4A 3MJCA 5D3ZA 2GCPA 3QE4A 5CLQA 4NCJA 3C4QA 5A7FA 4TTQA 2QV7A 5EEHA 1MQ8B 1I4DD 5KO2A 2O3JA 3WJ2A 4NLLA 4WCVA 3TZEA 1ULAA 5BQ3A 1R16A 2ZITA 5FEMA 4EKIA 1N0IA 3FUWA 2Y1CA 4HYEA 1YSCA 4BCDA 3UM9A 1OKKA 3HM2A 4K9MA 4D46A 1V4BA 3FBTA 1BVHA 1G41A 2DTEA 3H5VA 1ISGA 4YX9A 1PG2A 1QB7A 4RD0A 4UD2A 4U63A 4U6NA 3A0RB 4YCBA 3NNSA 4YUVA 4P4SA 5A04A 5K1ZA 2GD2A 2PRKA 4XW2A 5IKXA 1OX4B 2Q6OA 4Z5XA 3DMDA 1CRPA 4MEAA 4EB6A 3P9XA 1AUQA 1FEZA 1GA6A 1Y82A 2N75A 2TMKA 3DFMA 3OOSA 4GZLA 4N40A 4KRFA 1ZLYA 2Z3ZA 2JLWA 3M81A 1VC2A 3R6TA 3O75A 1IVYA 1OTHA 2VSFA 5ES4B 2XUJA 1TVEA 1VLMA 1PKXA 2NZJA 3ED1A 4C5BA 5A6SB 1RKXA 3B2NA 5CT4A 2FF7A 1ZESA 3LXXA 3NATA 4HZUB 4NYJQ 1X3LA 2JB9A 2IEAA 4PCLA 4PZYA 2QMOA 3A11A 1GUDA 4R1MA 4DQKA 1B42A 5TGTA 2VUSA 1RFGE 1B74A 3K09A 3ELUA 4CDMA 2EF1A 3HYCA 3N8HA 3PPIA 4HQKA 2B5OA 4JLOA 4LXQA 4CR7A 2GM9A 4RZ3A 1HTWA 4NAHA 5EWMA 4E22A 3BAZA 4JBHA 3VZPA 5HOQA 1AS3A 3VPCA 5SYMA 2EW1A 2AJDA 3NP9A 5JQGF 2P6UA 1IMJA 1USWA 2YVKA 5FI1B 5CCBA 2WSSA 3EX7C 1A5ZA 1BGVA 2Y4OA 3CZRA 3LKDA 4K3UA 5CIQA 4B7AA 3EXIB 4ZRNA 4H0FA 4MUIA 1A50B 2NUTB 1N2HA 3DOOA 4GL4A 1ZH2A 4IFBA 4N7RA 3SJCA 4KYUA 1JVBA 3ILYA 4JQCA 3TLZA 2P3LA 3BA6A 3FYCA 1R4NB 4FYIA 4IO1A 3RADC 2RFLA 4XM2A 1NF3A 2DC1A 3MRXA 2G1AA 4DAEA 4RTLA 2OVBA 3SQXA 2JPDA 1KZHA 1Y63A 2YXDA 3DB1A 3WKBA 4Z7QB 4RJTA 3WL5A 4E12A 2HMAA 3EEQA 1N5JA 2ZBUA 3S2ZA 1R37A 2VUHB 3DNMA 2O2DA 2NO5A 4Y98A 2DJIA 1NG9A 3ADOA 1H93A 5HKAA 4ONEA 1BQ4A 1K7FB 4HWTA 2NSHA 1WEKA 4ENWA 2CJXA 1RQ7A 1RXVA 3HBJA 1NFFA 3A7DA 4DJ5X 1GCIA 4AJNA 1NQVA 4HZGA 2WFZA 4EY7A 3GVIA 1G5RA 2FCRA 4DQXA 3ZUPA 3HCEA 4C7OB 1I36A 3DMTA 4BVBA 3B89A 1HDIA 4QXQA 3A36A 3L7CA 1YMUA 4MPPA 1UJCA 2YIDA 1Y9ZA 1RBMA 4N8EA 4RX1A 2FU5C 3L82B 3TSCA 2XE8A 3L4SO 2BKUA 1L1EA 1DJLA 5CXSA 4IVPA 4R1TA 3TDKA 1AS2A 1GPLA 3RVKA 3VOAA 3FHTA 1E3DA 4OJTA 3FHCB 2H4JA 4PNEA 3FFAA 2HD4A 2VVTA 2Z6VA 4ZDKA 3WNCA 4OAQA 1E60A 5LQCA 3CMMA 3SS8A 3L92A 2D0OB 3EGDA 1FVOA 3HBLA 5DWQA 1JHQA 4HH1A 4MPRA 3RV3A 4HGYA 1R8JA 2H59A 2WABA 3LBIA 4RKYA 1G8GA 1P2FA 1PR1A 5U1PA 1EFPA 3C85A 1C1YA 2XNHA 3JCZA 4H08A 4Q9NA 4LRWA 3BTOA 1CWUA 3K09C 3KT3A 1QR2A 4RK6A 5CT5A 4EJFA 3MLEA 4IS2A 5I9SA 4F96A 1Z0JA 3ONWA 4G2TA 3GP8A 1F0PA 2PWYA 4QATA 2NX2A 4ZV7A 3X2SA 1SMKA 2P3SA 1CEYA 2Z6AA 2DERA 1OLSA 5KTPA 4G41A 3UAXA 3F6CA 3I0MA 3LZCA 5KPJA 5A0TA 4FJ0A 3OLZA 1ZM3A 1Y81A 5F98A 2ZP1A 1EK1A 1CS4C 4JKIA 5LCXA 2XXBA 3ZD8A 3ZD9A 3A9UA 4ZTUB 2SKEA 2OCPA 2OP1A 2GPWA 2IU6A 2P5UA 3EDMA 3TYXA 4CGYA 3QF7A 1OT3A 2ERXA 2IXTA 2OQ2A 3ZBPA 1R0ZA 3KXPA 1TZCA 1Z4OA 4Z4GA 1EJ2A 1KI2A 2VZ9A 3RIXA 2HMTA 1UXOA 1SELA 2X15A 4UMDA 2PKEA 2Q4DA 4MCIA 3ZHTA 2Z4SA 2O8DA 5D00A 1JLSA 2UZIR 3GEIA 1ULZA 1BJTA 2A59A 1SKYE 3K70D 1NDQA 3TZHA 4KQJA 3LX6A 1AKWA 3EPPA 4OI2A 1YOVB 1ND6A 1NI4A 4MVJD 3H17A 2PNFA 3WO1A 2DBRA 4NFLA 1XZHA 2WTEA 4RVGA 3C45A 3N28A 3RVDA 2VYVA 1CJTC 1P0CA 1L7QA 1XX6A 2RONA 3UMMA 2I66A 1N2CE 4B8YA 4YP0A 4Z49A 4BO9A 1E4OA 1LBQA 3FI0A 3HRIA 4R1LA 4EKEA 4JQZA 5THQA 1W44A 2MIIA 4PHCA 1DXYA 4R0NA 4GPEA 2RB5A 4WFKA 2ERYA 5EZYB 2XCRB 3GJ7A 3PYLA 3UMVA 4EKGA 3ZV3A 3DTVB 1V7PC 2HQSA 2CYCA 1DZIA 1JHPA 2PBRA 1V39A 3K1AB 4WZBA 1NXSA 5BYBA 4CL8A 4F92B 1Z8FA 1P3JA 5L6MB 1VB3A 2ZVPX 3EQ8A 2X9QA 3ZEAA 1WXIA 4RMGA 3UJ9A 5CVCA 3VGPA 3ZOKA 4BMYA 5IK2D 1TAUA 4K6OA 3U7QA 3HFSA 1GY8A 3I23A 3INTA 1WBDA 2DQSA 1Y8AA 3QNMA 4E5DA 3QLTA 1Z37A 5DXJA 1YZLA 2HYIC 2KMLA 3QP9A 1M7HA 4CLEA 2P6OA 2FW0A 1Q7GA 3MRVA 3TD2A 3CZCA 4L4UA 2BP7B 2BGNA 1UM8A 2PJDA 1XJ0A 2YY7A 2OXEA 3IV9A 3OBIA 4OIFA 5JBIA 4KXFB 5JRZA 5JY1A 2QQFA 1A9OA 4KAJA 5U9CA 1TAGA 3TN7A 1O5TA 1JKIA 2Z30A 4UFPA 3P0RA 3DLIA 5BT8A 2PHZA 1TZKA 3KEFA 4YMWA 4X92A 4HLQB 2O5EA 3PU6A 2C7OA 1SQ6A 1WUJS 1G42A 5F2OA 3DCYA 5LU8A 3EIEA 3BD8A 2IH5A 1KO7A 4PM4A 2PZFA 2X19A 5AI6A 3I1JA 3BH6A 1VCNA 2R8PA 4E88A 1A7JA 1IBCA 3OQVA 4CT4B 3EQZA 3H3JA 3ZDDA 1U7WA 1O9BA 1RZ3A 1F48A 3P2KA 2X9GA 3O03A 4CW7A 3EEYA 3DL7A 5KHOC 1G5FA 4HC4A 1ZXBA 1E2PA 3DLPX 3MEQA 3VO2A 4AECA 4FOOA 3CO5A 1W52X 4B6OA 2JK1A 1U4NA 4DUPA 3FE2A 4GYKA 2EHDA 2DFPA 2ZULA 1ZMBA 3G85A 2F43B 2RC5A 4RY9A 1ECJA 1QIEA 4X1KA 5A5GA 3CVXA 4HS9A 1LNZA 1R0CA 4PO1A 4WBNB 4XCQA 3MQ2A 2CSUA 5AXDA 4QBTA 5JSQA 1Z4PX 1B2RA 3EUAA 3G2QA 1OILA 1PX2A 4IFEA 3E03A 4HZIA 4B76A 2PSJA 5HFJA 3ABZA 1JW9B 1VKNA 5G41A 3ZCQA 2ZUDA 3IP3A 1RCTE 4O8CA 3KNZA 3OFVA 2VZ8A 2B9EA 1JKJA 1MB2A 2QMZA 1J0AA 4J3JA 4XCVA 1UBRS 3BTSA 2ATVA 2Y05A 3D4IA 4YT2A 4FEYA 3IOYA 4OX9Y 3H97A 3DNFA 3GJ0A 4WL0A 4E5NA 1BIFA 1YCGA 4KVGA 2HA7A 3STTA 1UJ4A 3P2IA 5JDIA 3BT7A 3L0IB 1D5WA 5KVAA 4X1IB 3R0ZA 4ER7A 4EYSA 3LUHA 2XMDA 1MIHA 3IERA 1RLOA 4C4RA 3EDYA 4EBFA 5ITZB 3EXHA 3M6IA 3MA0A 2FW8A 2FR8A 5BWLA 1QYVA 2WV7A 2ZBQA 5AJZA 1WD7A 3X1YA 3VAYA 4K86A 3KEQA 5AM4A 2EZ8A 2QPLA 4IDPA 4Q3DA 4OKNA 3QVLA 3TW4A 4OTZA 3FUCA 1PJAA 2CXXA 1D4FA 2ZTSA 4UDOA 4D0SA 4Q9HA 4LWOA 2AV6A 1GPDG 2R00A 4OGWA 4OJYA 4UASA 3G9UA 2VEOA 4WNYA 1WLSA 4Y6OA 2V0NA 3RSQA 4Z51A 1EX7A 3H1FA 3IURA 2JCVA 4G9EA 4NH0A 4Q16A 2CD7A 1Y5LA 1G8MA 2VHUA 4B84A 3UJ3X 3L7AA 5A5DA 2QL5A 5LB4A 5CDFE 4OLBA 4LNHA 3IAS1 2B25A 1KOLA 4R8KA 3WGHA 3FOEC 3RQSA 1U3CA 4RKEA 3DEIA 4TMXA 3ZV5A 1FBTA 1L7BA 1VM6A 3ET5A 1V25A 3HBMA 5C5DA 2Y4NA 1KHTA 5D6OA 4B75A 4BQSA 3DS8A 1R6VA 4BJ1A 3ZHXA 3ZN2A 3BCSA 5I8ZA 5EL0A 3ML1A 2D2IA 2PUBA 4Z1MD 4OCZA 3L1JA 4ZVRA 2C0QA 2Q6VA 4GMXA 5CM9C 3O95A 1KZ9A 4ZVTA 3ISTA 2O5CA 1PWHA 3M83A 4EEKA 3LCVB 1G3RA 1ZD3A 1IY9A 1X94A 2ZJ4A 3AV3A 3L46A 4MI9A 5A7GA 5F1YA 1DZ3A 4G65A 1BH2A 3BCRA 2DMRA 4L0CA 2A35A 3IE2A 1D6JA 1NNUA 3AHHA 3KYBA 2QVCA 2YASA 2E37A 1JU4A 1UFVA 3G9QA 4NBSA 3ZWDA 4BB6A 3F6YA 3WLKX 5DLQC 4RIFA 3KQSA 2BEUA 4OUDB 1N6KA 2ZRHA 1OLSB 3D54D 3IKJA 5JH7A 2XRFA 4IOKA 1DADA 1XQVA 5F33A 3GG9A 1TZBA 4K9KA 4NL4H 2W70A 5A03A 2FZVA 3PDJA 4MW4A 3HXTA 4QUIA 3PGMA 1T4GA 4PX9A 2O3QA 5J5CA 3BKWA 3IESA 3HB5X 4M55A 3G2HA 1W6UA 1XCGB 4GNKA 4RQUA 2JD2A 4TWBA 4UUQA 2NWQA 3EGCA 1DHRA 1W5EA 4R2XA 2JLBA 3M4NA 3CZ9A 3MLAA 3QKUA 4YRFA 5THXA 5C31A 4O1MA 1RAAA 1CCWA 1HORA 1QIFA 3P9PA 5JJLA 4MRAA 3U6BA 1U2ZA 1YOVA 2GBFA 3CJTA 5KWJA 4OA5A 3GAAA 3H05A 3V1KA 1K7SN 2A0UA 1KPHA 1FL9A 5KWSA 3PCRB 1BQ3A 4CM4B 3HJNA 3A0UA 2VTDA 3QGMA 3RSGA 3V3KA 1PWEA 2F48A 1JG1A 4IRXA 1RHQA 2WEKA 4B83A 3B7WA 3OU2A 3P0HA 3KEGA 1IB0A 1CU1A 2XUOA 4ND8B 2AN3A 4P7FA 2REBA 3UJBA 2E21A 3VPDA 5BV2P 5JCPA 5BXYA 3Q3HA 1WCWA 3OZUA 4X90A 2I22A 3N2LA 1TFRA 3V32A 1G2PA 5DM1A 3E9MA 4BVLA 4BE7B 4I4NA 4Q7LA 4QELA 3G0IA 2XMGA 1SOVA 4K6GA 1CK4A 4FNAA 4JIMA 3GEPA 3K5IA 4K6CA 3KFLA 2WTXA 4FMPA 4LYFA 4AU1A 4BMOB 3L8EA 4CUKA 2ZUFA 1WXHA 2PQMA 4KPFC 3Q8KA 3RU3A 1A4UA 1Z74A 1JEEA 2Z98A 2WYVA 4N39A 3L93A 2YIVX 3GLFA 1A8HA 2F90A 2RHBA 4ZO9A 3SE0A 3V4SA 5JO9A 2ZRLA 3KQOA 5H3HA 4XUGB 4AG3A 5HFNA 1DBIA 4RWEA 1V0JA 2OHVA 1C1XB 2XE6A 4WCFB 3OM1A 5DTQA 1LC3A 1V11B 5D3MB 4W8GA 1CNFA 1ZC4A 2Y1XA 3II6X 3OOHA 3WL7A 1B0ZA 2JIZD 1BE0A 3D4PA 5E95A 2PGAA 3K0FB 4KPYA 1KQ3A 5CA1F 1FTQA 1J90A 3DKKA 3PXCX 4DB2A 2ZS9A 4LHWA 2C7QA 2WNIA 3W5CA 4RD6A 1X86B 1TUEA 1LTKA 3DWFA 4YAEA 1A77A 1EUQA 1JTVA 4OHMA 4PHGA 3IKTA 4S2EA 1BKYA 2AQIA 1AKQA 1KMNA 3GJ5A 1E63A 1TD1A 2P9CA 1FNSA 2PV7A 4LRQA 5JS7A 5KX5F 2C5AA 4KR3A 1JH9A 1G5TA 3QA9A 3AZQA 3NAGA 4LOJA 4IIYA 2VTBB 1H05A 3MTDA 3UJ6A 2YJ6A 1L2TA 1MVNA 1KOGA 1LSUA 5E2BA 4BXOA 1ZHFA 3FYDA 4D9NA 1G291 2EJUA 5DHFA 2H63A 4KOEC 1OAOC 2W2KB 3UVEA 4E4YA 1ZVJA 1JQDA 2J5XA 2JIMA 3OX3A 2G5CA 2JA1A 4Y1RB 1RZUA 2F2TA 4P1ZA 1CY6A 2RC6A 2X8BA 1R2QA 1YUMA 4X94A 1HQCA 4Y6SA 1CQJA 1L3CA 3IJPA 4ZICA 2YYZA 5H82A 4PZZA 5I7SA 2PKWA 3THWB 2LTAA 5ALWA 4C2BA 2IEBA 3ANLA 1UMCB 2D1TA 1RR6A 4O2AA 1ZJ5A 4M0LA 5KJCA 1NI4B 4BP1A 5AW8A 5JAPA 4JUIA 2WILA 4A5OA 3G13A 2D5BA 1QANA 2Z2KA 3IVGA 4FS3A 1GPKA 1UJMA 3D2LA 4QBFA 3V6MA 2J0VA 5CD9A 3ZXXA 1WMSA 5K0LA 7REQB 2G40A 2I6SA 2NTEA 2V6MA 4DJFC 3GOHA 1A2OA 2GSWA 4ZYYA 4GL2A 1VPEA 3OZDA 5KQGA 1E7MA 2GM3A 4DV7B 2CHFA 5HJ2A 3ZV4A 4EJ6A 4U7DA 1NPDA 3RODA 1JI0A 3EBOA 2XF8A 1WB4A 2P9HA 3ESRA 2EFGA 1TQ2A 4NQRA 2VJKA 1U6KA 2QJFA 1YK1A 3JQ7B 4TL8A 4IYRA 3CUSA 3K9QO 4MGEA 1B16A 3AFGA 1TCVA 4MVJA 4QDUA 3IQFA 2FPGA 3CCCA 4IWXA 3S0JA 4A92A 4JN6B 2Z4RA 5I7RA 3CMCO 2GPNA 2NZ8A 2CMFA 2VQSA 1Z4JA 3JPWA 2G17A 3TKAA 1J5EB 1L4GA 3VZCA 1Z06A 2XSZA 3IHLA 2CNOA 3OTWA 3O7WA 4MUYA 5DMHA 2ISQA 5B4VA 2CEKA 3HDJA 2HJ9A 2ZJ3A 1J09A 3EGWA 1GNPA 1TT7A 3DBHB 4QDXA 5HKKA 3KQMA 1E8DA 5CK4A 1E79D 1NIJA 2G09A 3GN1A 4PONA 4TKMA 4D3XA 4E2FA 2NVUA 1UKZA 5M7EA 3TZ6A 4E5MA 4KNWA 2XAAA 5AKLA 3K53A 4R83A 4Y2YA 1N5KA 1RPNA 3RTBA 3ZDQA 2ZI5A 1XTZA 3H4TA 3LQ4A 1YQDA 2OBXA 4DTCA 1E94E 5DX8A 2BISA 5KNDA 3KL2A 2YXEA 1TJNA 4P08A 3ZE9A 5IABA 2ZB3A 3E7FA 5JBNA 4GEGA 1S6YA 1DSSG 5I7OA 1MT0A 2CGEA 2IHVA 4E46A 1WV0A 2YVUA 2ZUSA 5T3YA 4GQBA 2OXFA 4R9UC 3TLCA 1GSIA 5JAHA 4OQXA 1RWBA 2I2CA 1IAVA 4XRGA 1OLXA 1IVSA 4Q01A 1QYIA 1I3OA 2FX3A 2VWHA 2HSEA 2ZOSA 1YS2X 3AFMA 3GGPA 4I3FA 4EI8A 5IKOA 2D2FA 3DD1A 5EWJA 1WXDA 2G04A 2VUTA 2VP9A 5EXPA 1BH6A 2G7ZA 3M1IA 3ZLVA 1DBQA 1J2RA 3PHCA 1ISSA 1DTWA 1T5TA 5ES3A 1CUWA 2Y1EA 3NFRA 3HXLA 2LV8A 3OIYA 4MMZB 3S1AA 3UB2A 1YV9A 4C7JA 3DDWA 4A03A 1NVBA 2FMUA 3A1NA 3HJRA 6AT1A 2H18A 4EX6A 4X1YB 4ZVSA 3W5VA 5ECDA 1LF5A 2AGVA 4PIVA 5CEJA 3C7AA 3GP3A 1DC7A 3RS8A 4CI9A 4OAOA 5ALRA 2BGKA 3BHJA 4F11A 1A4IA 1RZRA 3PJRA 3B60A 1T2EA 2JGDB 1BMQA 1RJEA 4R84A 4C4ZA 4JROA 1J8YF 3UQYS 3TECE 2UU9B 2AWOA 2I33A 4FE4A 1YQUA 3TQIA 5HRCA 2BHRA 2J0EA 3GXBA 3PLAE 5KX5A 4ID3A 3U7EB 1IM8A 2C94A 4FHEA 3RK4A 1CETA 4BKMA 2FN7A 4BFVA 3PQEA 4B1FA 5EHXA 1U0EA 1NE7A 1PG5A 3I73A 2PFSA 1NR1A 4FI3C 1H0RA 4QOIA 3UUWA 3S8EA 4ZAVA 3R3XA 4FEGA 3DP7A 3HUFA 1SD1A 4RORA 5HQTA 1JDBC 1JNXX 1GFSA 3UA3A 3QVSA 3AUKA 3W4KA 4HVLA 4HG2A 1H23A 1I94B 1N92A 4QFBA 3WMRA 1T9BA 2VYQA 2XBUA 3ODGA 4CKBA 3ZYCA 3NYWA 2GM4A 1M83A 1WQ3A 4WDRA 4G0UA 4O5OA 4R1OA 1QK3A 5TR9A 5GPBA 3ZWBA 1FFBA 1P39A 3AZOA 1IN1A 2WZQA 4EPVA 1GFWA 1DC4A 1LPMA 1D0VA 2R00C 2A94A 2FOLA 3CT4A 3N58A 4TVSA 1ZVMA 2XADA 2I3DA 3PF9A 1W7AA 1HDOA 4EO9A 3NYRA 3PQCA 4LY6A 2ZJ6A 1AGPA 4B47A 1Q6ZA 1MJHA 1DPGA 4M38A 1KJZA 1W88B 4QYWA 3OURA 4JI0B 3OM8A 3K70B 1D4ZA 1GGEA 4JDPA 1E7RA 2OCXA 3LT1A 1Y8QB 2I54A 1YR9A 4WOPA 4ZZ0A 3BXFA 4DCNA 3LA6A 2LW7A 1N6PA 5JZ9A 2Y6VA 3IP1A 4NH4A 4ES6A 4C0JA 3EY9A 1F4VA 1GG5A 1I9CA 1US8A 5LDGA 3SZGA 3U49A 1TTQB 1PP4A 2AJBA 1XLVA 4C6TB 1QIGA 5AUOB 1GKKA 2VSNA 2WIJA 4BTEA 1VJCA 4UCWA 2D8MA 3QEAZ 2IIBA 1S7GA 4I55B 1OE0A 4PV7A 5G4KB 2B3DA 3HRKA 3E3OA 3OVMA 4C4TA 1BKSB 2HDHA 5EP1A 2QR5A 4RD1A 4P0PB 4PAMA 1M2VB 5DCUA 3OCWA 3H6GA 1U28C 2H1OA 1U7UA 4J4HA 3X1MA 1XL0A 1MZVA 1KEEB 1QMPA 2QYTA 4UNIA 4KG7A 3RHTA 1NJSA 2ZJYA 3U44A 5D3QA 3LQKA 3N0WA 1M2JA 2J07A 2BSXA 1RAHA 1S1CA 2QU8A 1TYBE 3I4CA 5EMKA 3WKEA 2FWBA 2Q2OA 3A1SA 4D5EA 4B3JA 1L5HA 3DHWC 3ESYA 1L5NA 3ESXA 1CUZA 1WP9A 3UJPA 4C89A 2B2NA 2ZDQA 2JFFA 1FLDA 2BDEA 3DNPA 5EXXA 3RAFC 3QPVA 3CLSC 2BR5A 3HJHA 1VXOA 3W1EA 1M8JA 2SNIE 3HJBA 4XM0A 2J9RA 1OXTA 3U17A 4X64B 3H2YA 4U7TB 3IQWA 2J6BA 4P34A 2QTFA 1UKBA 5ANRB 3THXB 4MKFA 1J22A 4W82A 3GT7A 1ULUA 5DSTA 4E94A 4M3NA 4PAWA 3BS4A 1Q0HA 1Y5RA 4QZVA 4PINA 1Y34E 3LLMA 5E7IA 1XLUA 3U56A 1ZL0A 2AIRA 2WKPA 4M1SA 1XWIA 5IAGA 3L1KA 2HH9A 1OCEA 3VXKA 5EKDA 4LRTB 1U8ZA 3V3TA 5C37A 4MSUA 2ZE8A 5K8TA 5B57C 1KQNA 3IIJA 1O95D 1X87A 1OA0A 1X70A 3H87A 3NC0C 4NP6A 4QYXA 3EEFA 5JLJA 1N78A 3DE5X 3IPYA 4HFMA 4ZXPA 5CU7A 3GLFB 1UWLA 2XUHA 5FEUA 2H4FA 4FXOA 5CPFA 1UQTA 1X7DA 2G6BA 5JNSA 1GITA 5H7XA 2XQFA 4F04A 1X80A 4C0WA 3WMFA 4E03A 1EZ4A 1P4SA 1G8PA 1KRHA 1J23A 2CNKA 2D2EA 2IYAA 2JJ8A 3PE3A 3L6EA 3PQ2A 2D3TA 4G8DA 4WCFA 1YB6A 5F7JA 5IHXA 2YHSA 3THWA 1EZ1A 4PPFA 4Y2JA 2ZK7A 5KVSA 3I32A 4RTPA 1GPH1 2IY8A 4B3SB 3WO0A 4I2NA 3KD3A 1ABEA 3B2EA 3EGEA 3IUPA 3Q1LA 4KIJA 4P80A 4ALLA 4EHBA 4HOYA 2ZSIA 4F12A 4UTNA 5IKPA 3KZCA 4OQNA 3I5AA 1WPRA 4MGKR 3ZH9B 1GKUB 2HCBA 2X7JA 3KT0A 5CLLA 4AF8A 1PD0A 4ZC1A 1OFUA 2J7PA 3P2OA 2XCIA 3PE6A 4EQ6B 1XA3A 4GFDA 3I53A 3URMA 5JD4A 4C2UA 1M2WA 4AJ9A 4EYQA 1MAVA 1XNHA 1WE2A 2XKAA 5ILOA 4GI5A 5KOJB 2OHXA 3CH4B 3I9NA 3QM1A 3BMQB 1UC9A 3NHSA 1H1LB 4XYEA 4LV6A 2C58A 1ORWA 1Q6YA 3NBMA 4GX5A 5CVDA 5H3LA 1IBLB 1WM1A 1X2BA 2ZYGA 4JP1A 3GRZA 4MB6A 3TLEA 3VPBA 1LEHA 1HE2A 3AWIA 4TM8A 4W5HA 3SR3A 4P3KA 1ZRMA 1NDUA 4BGUA 2QX4A 2HT6A 2DU8A 3F6BX 3COPA 4MYUA 1UKCA 4XD7D 3TCNA 3WNVA 4YMGA 3I2JA 2PJUA 4OB7A 5KQPA 4HPXB 2HXGA 3EIQA 4U2KA 5EQDA 1E92A 3L8CA 3WK6A 1IVNA 4P4NA 1LFAA 1PEKE 1A8SA 1X14A 1Z73A 3HNOA 1MX1A 2R6CA 3NRBA 4EABA 5B2EA 1AZWA 1S96A 2O2YA 3LK7A 3ZHRA 3N2IA 3CUEF 3UJDA 3KYDB 4NX2A 1QG0A 1TCBA 1V37A 4QRIA 1TT5B 5CVEA 4JD5A 1CUUA 1JSZA 1KEPA 5FA8A 2RAPA 2IDKA 4L4YA 3V97A 2CT8A 5LQUA 1QRTA 1RE1A 2ZCJA 5DNEA 4L76A 4RGYA 1CIVA 1DHTA 3W2GA 4YHBA 5LP6F 1J33A 2ZYUX 3FZGA 2IXEA 5DN9A 2Y0PA 1H2AS 4X6LA 4BNYA 4RY8A 1NE2A 1C7ZA 3I39X 3HKDB 4I8DA 4JOSA 2P79A 4UREA 3QIVA 2O05A 1NVVQ 5GONB 5JNUA 3BMCA 2IUUA 2CLEB 4COKA 5C5IA 2MYTA 2YJNA 5A3SA 5FWYA 2Q6TA 5DF1A 2XGSA 4PAQA 5FTWA 3ZU6A 3G23A 1H42A 1U1GA 1FFDA 4GVLA 3WKAA 3JQBA 4TKVA 3EVBA 4RQAA 3EQ9A 3L4BA 1NUSA 1ZN8A 2PZMA 2PGDA 2ARKA 4FB5A 5LKRA 3OICA 1P4AA 4Q9DA 1EUDA 3FF1A 4ABYA 2AVNA 4FINA 1YI8A 2BDUA 3UK7A 4MUJA 4GBED 2VDMB 2ZW9A 5KYYA 4HPWA 1AMOA 4FN5A 1KAHA 4MV7A 4LSGA 4MDFA 2HSZA 3LFUA 3L01A 3A4LA 4RFVA 2Z1MA 4CWAA 1P6XA 4DIUA 1BXZA 2HNKA 2VXOA 4JSRA 4ZO7A 2VDQB 3K4PA 4RH0A 5JJBA 1GQQA 1DUIA 1NHWA 3I9LA 4RU1A 3TG8A 2H2GA 1MA0A 1W5BA 2VDJA 2YBEA 4AJ1A 1FNBA 4AY6A 4L8VA 1RCUA 1KTIA 4YMUA 5FWAA 3QBTA 1Z2AA 4QU5A 3HA5A 5I7HA 3WLOA 2OESA 1Q2XA 2XUAA 1E9EA 2GK7A 4LYJA 3N3BC 4UUOA 4IJVA 4X62B 1GNVA 4ETIA 1W5FA 4FQ8A 4YWHA 4U6QA 4ZT7A 1CRZA 2YVAA 3A10A 3BE4A 2Z2IA 4KMSA 3WLPA 1W4AA 1W75A 1RYMA 3A1TA 2AQKA 3CH7A 4R0VA 4UBLA 2REQB 1KHHA 2OV2A 3RG8A 3ZCXA 4D96A 5G0VA 4QYSA 4RSRA 3VSDA 2G5TA 3OE7A 2KPOA 1EUCA 1V5IA 2XTJA 2XB8A 5CT6A 2UYHA 5KNDD 4YJFA 3ZD7A 3FZQA 3PUWA 5DK6A 2IHUA 2QVXX 3MXTA 3WYFA 4EMBA 4P86A 3RUAA 2MYNA 2ATEA 3TRJA 3ZNNA 5K5EA 4XTRA 3FLBA 3JAWB 1GWNA 2BBSA 1A7KA 1RWXA 5CA0A 1R0SA 3AI3A 3MNFA 3HTXA 1I2BA 1I9GA 2Q6IA 2LKCA 1PZGA 2WOOA 3ELBA 3JX9A 4R7ZA 1N8TA 1WZUA 1XPJA 5L3SB 4NS4A 3PQ6A 4X5OA 1AUXA 1T3LA 5HKOA 4PBRA 5K0JA 2C7GA 2NACA 3CZ4A 1II8B 3OPYB 5ESDA 3T4EA 3TJMA 1RXEA 2PO7A 2ZJBA 5KMGB 2XCLA 1OU4A 3QOYA 1ISHA 4HWOA 4XJVA 3R5FA 4YWJA 1OAAA 1A96A 3TFOA 1YQ9A 2ZT7A 1J70A 3KDAA 4LN1A 5ALXA 3O26A 4LHYA 2Q1UA 1WSBA 1DP4A 4FMBB 4RCZA 2DBQA 1PRYA 4ND6A 4YPOA 4RYDA 4MX8A 5P21A 3MJRA 3DEHA 4WEQA 4XX1A 5FIUA 3AEKB 3NYQA 4F91B 1UPUA 1KJYA 4NVRA 1T4DA 4D4HA 4C87A 4F7DA 4HX2A 4XB2A 5DHPA 2O5VA 3A9TA 5GM1A 3AETB 2ZR9A 3RFUA 4XAQA 1J0BA 3R3WA 3TVTA 3L8YA 2A5GA 2JD0A 4BUJA 2V98A 1XD9A 4W63A 4HBGA 4ZU6X 1IZZA 3TFWA 1CUXA 2HLNA 3KTOA 4I4CA 4MS3A 1I5OA 3PWZA 4BNXA 2H4HA 3GH1A 3LLUA 4OH7A 4HUJA 1NKSA 5F5NA 3DC7A 1I33A 4YRMA 4AS3A 3REOA 5HILA 1GTMA 3JYLA 1XU9A 2CHQA 2XCTB 1VHDA 3EQ2A 5ELLA 4E5UA 2EJVA 2X2PA 3JWHA 2DHDA 2RGUA 3AC0A 4JJIA 4O02B 4RIIA 4INJA 3SVLA 4RTRA 1UANA 4M9CA 3CGGA 5JDCA 5IWCA 4M9UA 2YYYA 4BFWA 4JI2B 2FQWA 2YV2A 3A06A 3UPUA 2VXBA 2WVHA 3RRMA 1QRRA 3FMPB 4X44A 5FUYA 5INTA 4DR7B 4X7MA 5EKTA 1QCCA 4XIFA 1XE3A 1YXMA 2Z3VA 3I9KA 3T6KA 2EDCA 2ZI9A 3QOXA 1ZC3A 3ZHVA 4PS0A 1Z7BA 1JAXA 2CNWD 3ZIDA 5FL7D 2H1HA 4IG9A 4GMKA 2Z2XA 1Y1LA 1W4ZA 3H0CA 3IBFA 2L18A 2WHRA 1MNAA 4JR1A 5JQGA 3I01A 1Z7EA 3E8XA 2A5LA 1IU9A 3LK6A 3ZQUA 3IQDB 4G26A 1WETA 2H08A 4AWAA 4DZZA 2ZBVA 4HYTA 2D5LA 2EL7A 3OZRA 4UUPA 4CU2A 2ZE5A 4AKHA 2UZ0A 2E4VA 1I7NA 3AR2A 3QF4B 1SB8A 3NG1A 4XDYA 1XTTA 2B4RO 1V43A 1FZQA 1V3VA 2QLBA 2ROQA 4DC9A 3F90A 4E7PA 3GT3A 1KMHB 2R4UA 4YCMA 1K3TA 1TEVA 2QZ9A 2HB6A 2VKTA 5JYEA 5A9SB 5C52B 3A05A 4BNWA 5IWAB 3K4QA 2I7TA 3ZWCA 1U2GC 3OLXA 1OOEA 4N3BA 4DA9A 4EJMA 2JHFA 2G72A 2X5XA 4O1IA 5KYUB 4DEVA 3HGTA 3LV8A 4KAAA 1R0KA 2WYUA 5C35A 1AC5A 1DX6A 1TIBA 1TC2A 1W8DA 3DGEC 3NVAA 4AWXA 5JHHB 2OUKA 1JEAA 3UCXA 3NVMB 1KA9H 2CLSA 3H6HA 3OQ6A 4AJKA 2QN1A 3TIXB 3W9BA 3KELA 4US1R 1WABA 1LPPA 3BILA 2CMHA 1PNOA 1E7WA 1DOZA 4Q03A 1TVMA 1KC3A 4C4OA 3O9ZA 1IHPA 1P44A 4I5FA 1MO3A 1SKAA 1D2AA 3OZFA 3BD7A 3RC1A 3HV0A 3GLHE 4DNFA 1L8LA 4HYYA 4NMLA 3T4UA 1FS5A 1Q91A 1YR6A 3O4HA 2TMYA 3EAGA 3O4JA 3FUVA 1Q0TA 3O4FA 2B0CA 2FMHA 2HA2A 1G8YA 1BYIA 3DFIA 2KBFA 1GSAA 2X6RA 3FPSA 1O6CA 4G5OA 4WLOA 5CA1A 1GARA 4R3UC 1PFUA 3E2PA 3SHOA 4CCWA 3NHAA 4NULA 1HRDA 5F1PA 3N6RA 4RKFA 1DFHA 4MW6A 1ZONA 3VAZA 2PUTA 4MVJH 1N8NA 2VCYA 3Q2OA 3Q87B 2BMEA 3PX2A 2L0XA 1RHRA 4FD3A 2HWWA 3AB7A 3RFFA 1OI4A 3D5EA 4OGKA 1ZGHA 2HMUA 1GG9A 1ZMRA 3OP1A 5AVUA 4CTKA 3HI6A 2O50A 3ZWQA 1WUHS 2BBTA 1A27A 3Q41A 4J8PA 4QBKA 4UUBA 1V9LA 3WB0A 2X22A 1EYZA 3T5CA 1RM0A 1FXSA 1Z5UA 2I2DA 1EPUA 3C6ZA 4MUGA 3MT0A 1X7XA 3AEXA 3OETA 3PUIA 5DH9A 2YFQA 4PQRA 5BNTA 4TS9A 4YJ2B 1ZPDA 2VJBA 4REMA 5JCJA 1NV8A 3VO9A 4A3SA 4CMAA 3CE9A 3D8SA 1V1RB 4KIFA 3ETJA 1T5DX 1A9XA 3I2HA 2NUPA 2CBXA 1IZ0A 3JRXA 5E9JA 3SLKA 1OX6A 1W87A 3GT4A 1EP2B 1MN6A 2BH9A 3I37X 4NMMA 4R81A 3TG2A 4TWAA 1VDZA 4RF4A 3JQBC 5E8RA 5EJEA 5KBYA 2B5WA 1S2NA 1UXHA 1Q1GA 4WX2B 1ISPA 4HX5A 4J1TC 4TT3A 3AVTA 3IR7A 1Y4DE 2HQRA 1SXJA 5FBLB 1JG3A 1HZZA 3EB9A 1X7YA 3IC5A 1E98A 5KKAA 3UAZA 1SCUA 3DUFB 1ZL2A 2CXUA 1WDKA 3FDZB 2I7DA 2MCFA 4E3ZA 4I1VA 1JQ3A 2FHSA 4QIHA 4TLDA 4XEHA 3S4YA 4JUFA 1T5SA 2W2MA 3EZNA 1G7RA 4E0BA 2R3SA 1MB9A 2B82A 2VBFA 3AU8A 2GAFA 1JDJA 1T5IA 2PWZA 2HEGA 5EHIA 1LD3A 4JXZA 3OO0A 1QV9A 1NM5A 3IDOA 1I4EB 3PC4A 3V1LA 1EUDB 1HZJA 2JFQA 3G7NA 3SBEA 3TBKA 1PL8A 3CONA 1W1IA 3P7MA 4O5AA 2Y0EA 4EHNA 5BSHA 3RAEC 2NNWB 1K7CA 3PD7A 5IVHA 1TCAA 4IIXA 3SS9X 2H54A 2A3RA 1F3LA 3A6FA 2IY7A 3E7WA 1FFSA 3D5QA 2ZU0C 1GQFA 4G6ZA 4AMVA 3VHXA 1UPTA 1HMPA 3G3EA 3DPIA 3HO8A 1CFJA 2VYFA 4RCVA 2YRFA 4DR1B 1PFWA 1GTSA 1W49A 2ZRIA 1EFPB 3C8DA 4FFOA 2I2WA 5G2OA 2WYOA 3KOWA 4UUNA 3BPSA 3ZHZA 4MA0A 3R3HA 1YT5A 1WCIB 3EMDA 1DAOA 1TYZA 1VG9B 3PI6A 4HWRA 1U90A 1DX4A 4R9NA 1THMA 1BFUA 1TAHA 1YL6A 2FDXA 4LKOA 4DPKA 3I04M 1L7PA 3OO1A 5M34A 1YKGA 3DV9A 5HIIA 1W0KA 1C9NA 3N2KB 1OLUA 3AJ9A 3LNTA 4QAJA 2H1LA 1URPA 2Q3DA 4KR6A 4N7MA 3T5AA 4PZLA 1XTVA 3BD9A 2A6PA 1U7TA 3NP7A 4P92A 4E1VA 4CI0B 5LIRA 1SPXA 2HWUA 4KQMA 3NPAA 5AKGA 3JVUA 1MX9A 4LJ4A 4OGGA 1VJ5A 2IS1A 1RTTA 1WMAA 4N6OA 2JLYA 3AUFA 2A86A 1QCDA 2VP2A 3HYRA 3I52A 3PXEA 3HM9A 1FTSA 1XD2A 2CZQA 3AOEA 4BNDA 4EL5A 5IANA 3ADCA 1J6UA 2X9VA 2FRDA 1SC1A 3HGQA 1HT2E 4F1KA 4PQFA 1GGNA 4Y0AA 1P7PA 1KI4A 4L74A 1C1XA 1AQUA 1GCGA 2BFPA 4X71A 1K89A 3I9FA 3M6LA 5DV9A 3GPLA 1LDNA 5CTJA 5HMMA 1EVJA 2Q6LA 3EXHB 2KS6A 4JLDA 4Q4AB 3AVWA 1KQOA 3SX4A 2BEJA 2J9FA 5CH3A 1VRCA 2X1VA 2AUTA 5IXYA 3JAMA 4JNKA 5TXGA 1TAQA 2JVKA 2Q1YA 4WH0A 2NSDA 4D80A 3L9XA 3WAGA 2WJAA 3LPDA 5JXIA 1AU9A 3L5OA 4KV9A 5FT9A 4ZCRA 2WOJA 5BP7A 3GEBA 4LOKA 1U9CA 1N1DA 1KY2A 2OG2A 3IJ5A 4AD8A 1KL7A 4GSKA 4EA9A 3QEMB 4KNVA 4DR5B 4Q4JA 4EVRA 2ACEA 3FA2A 4Q3CA 2QIPA 5JFTA 3GJYA 2H4WA 5KNCA 4I5IA 1UBGA 1W9HA 2IP4A 2RE8A 3S2IA 5IJZA 1Z6XA 2O2GA 5BN5B 5BR4A 5KYVA 4LHEA 1E3WA 4IV0A 3OQPA 4Q7EA 1D1SA 5MDHA 4C01A 1KU0A 3DG9A 5DLDA 2EZ9A 3FSGD 1OXMA 4ZQHA 1NQUA 1UBNA 3PUYA 3DOJA 3V4PB 2EFDB 2FSGA 4RABA 1AHPA 1ZIPA 2PMEA 4C0SA 2V3CC 3PXAA 5EXTA 3IQHX 3K0FA 2OORC 1E1CA 1H2XA 3T7JA 3NWOA 1FMTA 3KCNA 3BULA 1UBTS 3O2QB 4UBKA 4C30A 4LY3A 4DFDA 4YCLA 3L02A 1NXPA 4DSNA 5HBGA 1QTRA 3ASZA 3KB2A 1OYYA 3HB4X 3Q3IA 4HDCA 4D8XA 1Y6FA 3DZFA 3JD3A 3C70A 4HDRA 3WLIA 4CNQA 3ZGXA 3B6KA 3DKIA 2QUJA 1GLGA 1RT9A 4L75A 1RQ2A 5D51S 3U7QB 3BRQA 3NIFB 5JNLA 1CEEA 4L0DA 1FP1D 1XELA 2R1VA 2J0QA 1RWWA 1UJNA 2XDYA 3LUGA 1J9GA 2F43A 2X8AA 4ZVOA 5I9MA 4IDEA 3RVJA 1A4RA 1VG0B 3U7FB 1EGAA 2FZKA 4QRHA 2B20A 2ZBEA 3GRVA 5KQMA 4EY5A 3ZZMA 2EX0A 3KO8A 3P5BA 2V9ZA 1Q16A 2XWPA 5ILGA 1TC1A 1TU3A 2XVYA 3AHJA 4QXRA 3S2GA 3KKOA 5L3ZA 3ADBA 1V3QE 1EJ0A 2V54A 3MOIA 2DWCA 3IDQA 1TZJA 2CV0A 1LSSA 4YREA 4COOA 5CEFA 7MDHA 1LPBB 1WOYA 1PZFA 3ACCA 2VHTA 3AP3A 2Q3MA 3R9WA 4DUYB 1E64A 3JQ9A 2AE1A 3TTWA 1C9DB 4DLXA 3PQ7A 2I7CA 4XPIB 1XYVA 4L5BA 4MJ7A 4MR8B 1UC5B 5KCMA 2IYEA 2NP6A 2EARA 4G0MA 2G28A 3CB4A 5IK2A 3S1SA 1Z38A 3E35A 3ESQA 4F46A 3BWEA 4HAOA 3UK2A 1PTJC 3L1UA 3LD9A 5I5EA 4B45A 1XEFA 3LFHA 5JWHA 4YUAA 3KAJA 3FRHA 3FTFA 1T8RA 4QYTA 5C5EA 3P9IA 2JZOA 4FDVA 1V8OA 3QG1A 4J07A 4AZ0B 3SF8A 1JQ5A 1TJ4A 2PSSA 3HKEB 3DJYA 1CJBA 3AT1A 1CB7A 5GWXA 4P54A 4D9EA 1T8PA 4QXPA 2IYWA 1I3CA 1HLDA 4HB4A 9MHTA 2R7MA