1YB6A

Hydroxynitrile lyase from hevea brasiliensis in complex with mandelonitrile
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants of the enantioselectivity of the hydroxynitrile lyase from Hevea brasiliensis
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lyase
molecule keywords (S)-acetone-cyanohydrin lyase
total genus 104
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2004-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yb6A00
1UK8A 4QA9A 4QDOA 4DTCA 1Z68A 1QIKA 2O2IA 2GZSA 4G5XA 4BZWA 4ZI5A 3A2MA 2QXTA 4QDTA 1HPLA 1WB5A 1VA5A 4WFIA 4DNOA 3E1GA 4FOLA 1XQWA 1QIHA 5LP1A 2O2HA 4B0PA 4Q3LA 3D4LA 5HF6A 2XQKA 4Q05A 4J3JA 4X3CA 1EI9A 4IO0A 1ZI8A 1VOTA 1NX9A 5K3EA 4B85A 3O4IA 5SYNA 1CUBA 5E4JA 5HKBA 3TGLA 5BWCA 1IZ8A 3F8SA 4UBLA 5BWBA 4YK7A 4X7BA 3AFIA 5CMLA 3BIWA 1CRLA 5AM5A 1VJ5A 4KE8A 4KEAA 1G42A 4X95A 1QGED 2C5FA 3O0DA 1FJ2A 4W63A 2CUTA 4E46A 2XQGA 4BRZA 5JANA 1JT2A 3DKKA 1QIGA 2WG1A 4NVRA 1HL7A 4G4JA 1TCAA 5AOBA 2G4LA 5ALHA 1FFBA 1XZMA 3M3DA 2HFKA 1YA4A 3SWWA 4G4IA 1AUOA 1XZIA 1MTZA 1DU4A 5I8PA 1KEZA 2XUGA 5IVKA 1XQVA 2OXEA 1HBJA 4EB0A 3G0CA 4LYEA 3QMWA 4AB1A 2ECFA 1P0MA 4H0CA 3BDIA 3PE6A 2HL6A 3H1AA 3SK0A 3LCRA 2Q0XA 2XMZA 4UBJA 1E5TA 4KAFA 1QIFA 1Q83A 4Y9SA 1WCYA 1ZD3A 3VXKA 5FLKA 1ZIYA 1WPXA 2J3QA 2AXEA 3STVA 2AJ8A 2WUGA 2PSFA 5ESRA 4HS9A 2GYUA 2PU5A 5CT6A 3DNMA 3JYHA 3RKSA 3IDAA 3D2AA 3WL5A 4BATA 1PV1A 1MT3A 1R4ZA 1SOMA 2HIHA 2GBCA 4BAUA 5AKXA 4C6HA 2RIPA 1W75A 5KBYA 1EA5A 1LLFA 1UWCA 5JZSA 2B4KA 3FBWA 5JZBA 5FPPA 1KU6A 1NU6A 5HFAA 3Q8WA 4X93A 2WIKA 3MVEA 4UBKA 4FKBA 4DGQA 3HEAA 1M33A 1DWPA 5ALJA 3I2HA 5E4TA 2EDAA 4X85A 1TKRA 1O6FA 3STXA 2DSNA 1MN6A 4IH1A 4AO7A 1FFDA 1ZD5A 4ZV7A 4FNGA 2XUKA 3FWHA 2IX9A 4UFPA 2HM7A 3G7NA 1CUDA 1R9NA 1XLUA 3FSGA 2FJPA 2JGIA 2R11A 5HKAA 4MXDA 5HF5A 4ZV9A 2K2QB 3C6BA 3CCCA 2GYVA 4UFOA 5CXXA 1SCIA 4WJLA 2QS9A 5ALNA 1AGYA 3FOBA 2ZSHA 4FLEA 3VDXA 2Z3WA 1YB7A 2WU3A 4J0JA 3OM8A 3G0IA 1CUSA 4OU4A 1AMNA 1R88A 3O4HA 4G8CA 1MX9A 3N0TA 4OSEA 3T52A 3X3HA 4JYPA 2HA0A 1ACLA 3EQ8A 5ALDA 3D2CA 3H1BA 4EY8A 2PL5A 4BE4A 1A7UA 3I2JA 3HC7A 4QZVA 2XQIA 5DNVA 4ARAA 1EB8A 1XROA 1XZEA 2ES4A 2VT6A 3D3NA 2XUHA 1B6GA 3W06A 4FDMA 2JGEA 4G1FA 1W52X 2J4FA 2CBGA 4GDMA 4BYMA 4ETWA 4ROTA 2OG1A 2G5TA 5LKRA 1QFMA 3WL8A 3WA7A 3WWDA 1UXOA 1QIMA 4ZREA 2Z3ZA 5AI8A 4XJVA 5ALWA 1J07A 4K6KA 2Y2VA 1XZHA 3B5EA 1YS1X 1J2EA 1EVQA 4LXIA 3A6ZA 5K3AA 1Q0RA 1ODCA 5EHQA 4Y7DA 2FUKA 2DCMA 1E8MA 3HACA 4N8DA 1VXRA 4J0HA 2XMBA 2OAEA 1E8DA 1GPLA 4RPCA 5ALRA 2X76A 5AK6A 3HSSA 2ZVDA 5AI5A 4B6GA 5LIPA 1U8EA 1CUHA 2GBIA 5A71A 4LKOA 4M0FA 4XIIA 4H7DA 3ZWQA 2WHPA 5KWJA 3HABA 2XQJA 2WHRA 5CH8A 3H19A 2H7XA 1QIEA 3BL8A 4KR0A 2PUJA 3R0VA 3F98A 2JGFA 5ALIA 1H22A 2RHTA 4KAAA 5AIBA 1PJAA 1H2XA 2ROQA 2YH2A 2XQFA 1T4MA 2LIPA 1YR2A 3VVLA 3I2IA 3I6MA 2OQIA 1R3DA 3W2TA 4I3FA 3WQHA 2I78A 4X00A 1XRQA 5A6VA 3BDVA 4HXEB 3DKRA 1XZGA 2YASA 1BEZA 1ZI9A 1VXOA 3H2IA 2BAGA 5ALMA 4YASA 1Q0ZA 2HRQA 1UKBA 3W9UA 1X2EA 3AIOA 1S8OA 5LZ8A 2XB6A 4MWTA 5AKKA 4IH4A 5IVDA 3QM1A 3U0VA 4JEIA 3RM3A 4F5ZA 1MJ5A 2XUDA 1WPRA 1CR6A 1LNSA 4GBGA 4UHFA 1EDDA 1ETHA 2WQZA 3IULA 3ESBA 4ZWNA 2PM8A 4PSDA 1C4XA 5JIBA 2VF2A 4QDUA 4DMHA 2OCIA 3AINA 1XRLA 1GT6A 4W1PA 3AUKA 5ALFA 3G9ZA 1ZD2P 1E89A 1WB4A 1D07A 2DFPA 4YPVA 3PF9A 3E3AA 1OCEA 3C6ZA 3D2BA 5I9IA 3QMVA 3KWJA 4QWWA 3LS2A 5DYYA 4KRXA 3C5WP 5EIHA 1QIIA 3LIIA 4LHEA 5H3HA 2GBFA 1O6GA 5K3DA 3WYNA 3TJMA 1CUGA 5K3CA 1N8SA 4K6GA 2WUFA 4OPMA 3R3XA 2VJCA 4F60A 4C4YA 5AKGA 4NMWA 5E4YA 1CQWA 1G5FA 5DWDA 5LZ2A 4Q82A 1T2NA 4WFJA 3QPAA 3R41A 4KRYA 4AMZA 3CCBA 4DNFA 4EUSA 5IH7A 2OCLA 1LPNA 5D3ZA 2O7VA 2C4HA 2GBGA 3FYTA 2HHAA 1X70A 1JJFA 4DIUA 5F4ZA 4LXGA 1H23A 4KE6A 3PDCA 5ALXA 3F96A 5AO9A 5DNUA 3G0DA 4QWMA 3C5VA 4H7FA 1LBTA 2QKYA 4C89A 3H17A 4DNQA 1MO2A 2VEOA 3IVMA 2Y1KA 2RAUA 3OG9A 3S2ZA 4DLNA 2HRRA 2P8SA 2RHWA 4LXHA 1EH5A 4RGYA 2QXUA 2BKLA 4U2EA 1ZI6A 4TVKA 4N5IX 5A62A 4GECA 1IUPA 1UK7A 1U2EA 2XLBA 2IITA 4H35A 4DMKA 3O9VA 2OPHA 1RP1A 3ESAA 4BTLA 1BE0A 3DOHA 2WG2A 2W22A 1N5MA 2Y6UA 3OPMA 1HQDA 2QUBA 4CG2A 4F0JA 1DWQA 4BP9A 5KREA 2PPLA 4K2AA 2WILA 4JUIA 3G9TA 1JI3A 2QR5A 1TAHA 5E2IA 2ZYRA 5T4BA 1F0NA 4GWLA 2V97A 1ORVA 4FNMA 1JMKC 1XKLA 3HJUA 3G9UA 1TCCA 4GW3A 1RYYA 4EY5A 1TK3A 3IURA 4X6UA 4G9GA 2VAVA 5KWIA 4EHBA 3W04A 1XZJA 4W1RA 4Q3OA 2C5GA 1AC5A 4UUQA 4E11A 2FJ0A 2DHEA 2DQYA 5K3FA 3I1IA 4X92A 1TQHA 2CB9A 3H0CA 2O7RA 2HU8A 4EY6A 3UMJA 2XMRA 2V98A 1TIBA 4Y2JA 1DWOA 3D0KA 4CIAA 1LPOA 3TRDA 4OU5A 4HAIA 1XLWA 2XUOA 2WUDA 3B12A 5ALUA 3BF7A 3E4DA 5ALEA 3RLIA 3FSGD 1JU4A 3R3ZA 3VJLA 3STTA 5BV7A 1C7JA 2C58A 1BCSA 3GROA 3H2JA 2X5XA 4J0CA 1E66A 3ILSA 2B20A 3R3YA 4HZGA 4AO6A 5JYCA 3STUA 2QOEA 5T4HA 5AKLA 5AM2A 4KE7A 4C01A 2D0DA 2OQVA 3LIPA 3DYVA 3ESDA 4M0MA 3G8YA 3PFBA 5DNWA 2QJWA 1EHYA 4HXGA 3AZQA 4WDQA 5JAOA 1AKNA 4DMFA 2XLCA 5AP9A 1CUIA 4PQEA 1DQZA 5C7YA 1QO9A 5LYYA 2G5PA 2RONA 4KYVA 3FVTA 3WLAA 4BC1A 4AZ0A 4BDTA 1K4YA 5EIEA 2I3DA 3R40A 3E0XA 2VTVA 1TRHA 3G0GA 2HA7A 1FFCA 1GQSA 1CIJA 5EHZA 1YB6A 2PSEA 1J06A 2WTNA 3GZJA 3C8DA 1CUUA 5SYMA 5DLPA 4BP8A 3NUZA 2H7CA 3FYUA 1MAAA 3C8HA 3K6KA 4RE6A 3KDAA 5FPQA 2HDWA 4M0EA 1VLQA 3ANSA 1XZFA 3H2GA 1AURA 4H7EA 4BE9A 3IBTA 5CT4A 3C45A 4GHWA 4KE9A 5JASA 1E3QA 3EIOA 4AN0A 2IIVA 4AZ3A 4DYHA 1ODSA 2OLEA 3C43A 3WWPA 4BAGA 1CUXA 1QTRA 4CCWA 4ZRDA 5HQ3A 1EINA 1W4LA 3BXPA 4U2CA 7YASA 5A7FA 1WOMA 1SCQA 4BAZA 4P93A 2WHPB 1QOZA 5DJ5A 2G63A 1BCRA 4Y2XA 2O2GA 5AKIA 5JD6A 1R9MA 3CXUA 5FRDA 1P0PA 2HFJA 4MEAA 1Y7HA 4V2IA 2PVSA 4AQDA 4G4GA 1ODTC 1UOOA 1CUEA 3W05A 2R8BA 5AK5A 1DT3A 6YASA 1XKTA 1QONA 5HZGA 3WK5A 3KOOA 4WCVA 4Q1VA 1XZCA 5IVHA 3WZMA 4BDSA 3HZOA 1CUVA 1CPYA 3EF3A 1QLWA 4B82A 1CUFA 2BCEA 4C87A 5CXUA 1HDEA 3D7RA 3AIMA 5AM1A 4HTAA 4ZXFA 3STYA 1CUZA 5HF8A 5CH3A 1THTA 1PFQA 3K9BA 5FUMA 1VZ2A 4MYDA 4Z49A 1QE3A 5JAPA 3WK7A 2JF0A 2WKWA 4P92A 2XUIA 3ZV7A 1XQYA 4W1QA 5CURA 2I3ZA 1UK6A 3IUQA 2CMFA 4QLAA 1XZBA 4OD0A 2HA4A 3WMRA 2VT7A 2ACKA 3H2HA 2XMDA 3ZLTA 4H7IA 4H7HA 5JALA 3VISA 5DTJA 4EZIA 1LGYA 3ZI7A 2JGMA 2VATA 4DNPA 1P0IA 3DL4A 3AZOA 4LIPD 2PSJA 5JADA 1XZLA 3PICA 4OB6A 4E14A 3V1KA 2QUAA 3WKAA 2XUQA 4CFSA 5JD5A 4G8BA 3OOSA 5LZ9A 3WI7A 2QM0A 3BF8A 3V1MA 3QPCA 1UT6A 4Y2SA 5ALGA 2H9YA 1DT5A 1F0PA 4UBMA 1LPAB 1IUOA 3QMMA 2OGSA 4Y2PA 1JJBA 3OTQA 2PSDA 1FFEA 4KACA 2VSQA 4ZGBA 3GA7A 1QZ3A 4I19A 1YSCA 4J0DA 3WKCA 2CKMA 4B84A 3FAKA 1XZDA 1YCDA 2WHQA 1VE7A 2WIDA 3AZPA 5LZ5A 3ZLUA 1CUCA 4A23A 2OCGA 3FCYA 5AKHA 2HA6A 4CG3A 4OYYA 2WSLA 4CI9A 2Y2UA 1A8UA 3FLEA 4IQ4A 4K6HA 1ZJ5A 5ALQA 3NGMA 4QDXA 1MNQA 4H7KA 1L7AA 4X6XA 1QIJA 2ZJ6A 4GEGA 2BGRA 2WUEA 2BFNA 4W9RA 3FCXA 1RWQA 3WL6A 5ISMA 3O95A 2WU4A 2W6CX 3LLCA 1WHTA 2WJ4A 4OCZA 1YS2X 1AZWA 2XUPA 4BCBA 3H18A 1IUNA 1Y7IA 1XRPA 5ALSA 4FWBA 1FSSA 1ZICA 3W9BA 3JWEA 1H2ZA 1W6RA 5AKYA 2YXPX 4J03A 2CEKA 4PSUA 2WTMA 3LP5A 1FFAA 1CEXA 4BVLA 2EDCA 2EEPA 4FFWA 3MUNA 5A7HA 4XX1A 4J0KA 3ZPXA 1CUWA 5AICA 3QYJA 5AK4A 1GKLA 3DD5A 4U2GA 5K5EA 4MWSA 1UFOA 5AK3A 4RNCA 2XMQA 1CQZA 4N8SA 5HCUA 2DQZA 3S8YA 4B80A 2CJPA 3R3WA 2WJ3A 3WKBA 4UBOA 3D59A 1XRNA 4UHDA 3FYUC 5CT5A 4C4XA 4BTVA 3SC2A 1DINA 4FMPA 3KWFA 2HU5A 1LPPA 3I6ZA 3D5EA 2WJ6A 1CUAA 1MX5A 1BRTA 3G0BA 4AO8A 1L7RA 5CT9A 3I2FA 1LPMA 5LZ7A 2PKYX 2HA2A 4Y2QA 4OB8A 2XUFA 1YAJA 3P2MA 4PV7A 2CZQA 4WY8A 4A16A 3RK4A 3WWEA 2QTBA 3SX4A 3IUNA 5AI9A 3BWXA 1BN6A 3I2GA 5AKZA 2WLSA 2X8BA 1SCKA 2B9VA 2OCKA 4J0GA 1G66A 1XFDA 1MAHA 1GZ7A 5EHNA 2QZPA 4U2DA 5CW2A 2HU7A 2BGNA 5A2GA 2ZYSA 1XLVA 4X71A 5EHXA 4UBNA 1HLGA 4J7AA 4WFKA 5DYTA 5JARA 1B41A 4KJXA 4I4CA 3PUIA 3G9XA 4GI1A 1ZOIA 1DTEA 2WM2A 4C4ZA 2YYSA 1OXMA 3WK4A 3WZLA 3WK8A 1NU8A 3DS8A 4Q34A 3FNBA 5LLSA 4ARBA 2BJHA 2V96A 4L9AA 5ALPA 5FDFA 1UK9A 3M82A 3WIOA 2I03A 3BJMA 3L1HA 4BCDA 5AI6A 1R1DA 1E8NA 4D9JA 2ZSIA 1JJIA 3O9MA 4INZA 4BVJA 4MQMA 4PNZA 2NW6A 3PI6A 5JAHA 2VJAA 1GGVA 3K2IA 1EK2A 1N5RA 3DYIA 3EQ9A 5ALZA 2PSHA 4DSZA 2E3JA 5AOCA 4PW0A 5C81A 2OAGA 3V48A 4G9EA 5AKEA 4Y2VA 1VZ3A 3ESCA 1CUYA 2OGTA 4F21A 5AKJA 1ISPA 1QJ4A 1BU8A 3IIIA 4C88A 1USWA 1XQXA 5JZ9A 3AJAA 4UHHA 4HRYA 3WWCA 1GPKA 2H1IA 3YASA 1UOQA 3C6YA 4MJ3A 4W1SA 4CCYB 1ACJA 5J3JA 4X91A 1EDBA 4XVCA 4A5SA 4OUKX 4UHEA 2AJBA 2ACEA 3JW8A 1H2WA 4UPDA 3GFFA 3G02A 5ALOA 1BROA 5JD4A 4EY4A 2AJCA 3CN7A 4BCCA 5T4FA 5D6OA 4X90A 3CN9A 2C7BA 3MUOA 3NOXA 5AI0A 1EB9A 3C87A 1K8QA 4B0OA 3UUFA 2C0PA 4X6YA 3QITA 1ZIXA 4P9NA 4ITVA 1SC9A 4B9EA 1QIDA 5IVIA 2FX5A 3IUMA 1R50A 1ZGCA 3QH4A 1CUJA 2PX6A 3DL7A 1GKKA 3I28A 1A8QA 4WY5A 5HFNA 1EXWA 3F67A 2JIDA 4NS4A 2XMCA 2QVBA 1GQRA 1DX4A 1BN7A 5HK8A 3FVRA 2RGUA 2QRUA 4KAJA 3IA2A 4WDRA 3ED1A 2JEZA 3AIKA 1QTIA 2XUAA 3QVMA 2QJRA 3FLBA 4P08A 5FXMA 1F8UA 3GBSA 5AOAA 4BBZA 5CBKA 4J0IA 4Y2TA 4H77A 4OYLA 4YX9A 4LYDA 3RARA 1JMYA 3WKEA 5DYWA 1YAHA 3C70A 3WIBA 4TGLA 3HLKA 1CLEA 3R3UA 2BUAA 1ZGBA 4L72A 1BEEA 1U4NA 2QT9A 4UBIA 2WIJA 4HRXA 3DOIA 3L1JA 5FV4A 5JAUA 4GLBA 3F97A 3GELA 5C8XA 3WYDA 4JNCA 4MQLA 5DTIA 2H7YA 4DM7A 1WM1A 3I2KA 5BOVA 5HQ3B 4AMYA 3B3QA 5JATA 2XT0A 3BIXA 5D3KA 2ZJ7A 3V1LA 3ICVA 3HXKA 1BS9A 4RE5A 2WFMA 1F6WA 1LPBB 2HADA 2WG0A 1VKHA 2ZYHA 5CT8A 1DX6A 4L3WA 3M83A 2Z8ZA 1IZ7A 1CV2A 4AX4A 1XZAA 1JKMA 2GYWA 4PF1A 2HA3A 2WFLA 2PU7A 2JGJA 3HYSA 2J3DA 4FFVA 2VAXA 4BC0A 2AJLI 2DHDA 2VQ6A 2ZYIA 1YA8A 2WIFA 1L7QA 1LBSA 4BB0A 5AJHA 2D5LA 3F9CA 3KXPA 5AM4A 5T4EA 2J4CA 5CH5A 2WFLB 2B61A 1VA4A 4X97A 2DHCA 4UHBA 3V1NA 3UUEA 2PUHA 3IUJA 4U2BA 4Q3KA 3DQZA 1ZD4A 4FLFA 3PUHA 4MYSA 4EBBA 1AQLA 3NWOA 3ANTA 3HRHA 5LZ4A 1UZAA 3DEAA 2UZ0A 2Z5GA 3A2NA 5ALYA 1LZLA 1CFJA 4HXFB 4CIBA 5A7GA 3A70A 1ZJ4A 4XWGA 1JFRA 2ONCA 3MGAA 4IHAA 1XRRA 1LZKA 3I6YA 1DQYA 5K3FB 1Q84A 2DR0A 1G4HA 1LPSA 2RI6A 3DLTA 5AHXA 4MEBA 4B7ZA 5EFZA 5HK9A 4JH0A 1W1IA 2XDWA 3HI4A 4BRSA 4EA6A 4Y2RA 2JGKA 1U65A 3VVMA 4B81A 3I1YA 5ALTA 2PBLA 4FBLA 3ZLVA 4FHZA 2JEYA 1K63A 3O4GA 4GXNA 4NZZA 1UKAA 4N5HX 5AI4A 2VJBA 1Y37A 5HF9A 4AN1A 4BVKA 4EY7A 4Y2UA 5CRIA 4DSAA 5AM3A 3M81A 4BZZA 5YASA 4UHCA 1IMJA 2WIGA 4X94A 2VA9A 4OB7A 5AIAA 3N2ZB 4PO3X 2XI4A 3DJYA 3WJ2A 3WL7A 5AM0A 3A2LA 3BE8A 3QBJA 2WFZA 1VE6A 1IVYA 1GPNA 2Y6VA 4K5QA 3V9AA 4HVTA 5LKAA 3STWA 3H04A 2GZRA 1OILA 1A88A 1MPXA 3EBLA 5ALKA 1THGA 4O08A 3C6XA 3ICWA 2XE4A 2C0QA 4FBMA 4FTWA 1EX9A 3O4JA 1J1IA 1EDEA 3GUUA 1YASA 2Z8XA 3R3VA 3DDUA 4G8DA 3T4UA 3DCNA 2JBWA 1EVEA 3TEJA 1N1MA 4S0XA 1C7IA 1XZKA 3U1TA 1QO7A 4QNNA 1HKHA 3OURA 4U2FA 3WA6A 5C8ZA 4QE3A 1I6WA 1QFSA 3VJKA 2OGZA 3WK6A 5ALLA 3QZUA 1MX1A 2AJDA 1H2YA 5FP0A 1MNAA 4N8EA 2VJDA 3AILA 2JGLA 3IB3A 4QEKA 3EQ7A 5CTAA 1TCBA 1K5PA 1JU3A 4QLOA 2XUJA 4FLMA 3BJRA 3KSRA 3H2KA 5FOQA 5K3BA 4E15A 3VJMA 5EI5A 2QMQA 3WKDA 3OC0A 3PFCA 1UOPA 5D7BA 4AXBA 3WK9A 4JYMA 2BUCA 3FLAA 1W76A 4UFNA 5AH0A 3KD2A 4L0CA 1WHSA 1SFRA 4B83A 5ALVA 3VKFA 4IH9A 3QPDA 5I7UA 4H7JA 1K6EA 3L1IA 5FKJA 1WB6A 1CVLA 1P0QA 2ORYA 3Q0TA 1X2BA 3WWOA 1XRMA 4B9AA 2HA5A 1AX9A 5C8VA 4Y2YA 2BUBA 5EGNA 4TPKA 1MU0A 1ORWA 4H18A 3WJ1A 4PSCA 4CCYA 4CG1A 2V9ZA 5EIAA 2ZJFA 1GXSA 2XMGA 3PF8A 2XMSA 1UKCA 1KU0A 1A8SA 4QDZA 1EK1A 3FYUB 5IKXA 4DMCA
chains in the Genus database with same CATH superfamily
2VNAA 3DTVD 3HBJA 4CIDA 2C3OA 2HQBA 3E61A 2AMFA 4TS3A 2WYUA 1P3JA 4RL4A 4ECEA 4R83A 2RJNA 4ZU1X 3WYAA 1WHSB 2O2IA 2GZSA 4OHOA 3FWNA 2YWCA 2FPIA 2QXTA 4M7OA 4DZTA 5B57C 2QMZA 3HJAA 1VKRA 1G6HA 4GGPA 4C06A 4D9MA 2XDQA 3KV3O 1ZZEA 3DT8A 3ICOA 4GZ6A 1NP3A 2D2IA 1FXSA 3HE3A 4CM9D 1WB5A 2RH9B 4JLPA 5DK4A 4BLSA 2JAPA 4ZDIA 3NFYA 4RO0A 3U0BA 3ENNA 3NU1A 3VYSB 1BVHA 1W0KD 2R4UA 1JA0A 1T25A 2PRKA 2XKBA 3H2BA 4HMPA 3TL6A 5H9WA 4CKWA 2NP7A 2YX1A 1OLOA 3P97A 1P74A 2CHVA 5K1ZA 3NC0C 4XDZA 5KPJA 2QRJA 4LYHA 3SE7A 1SVSA 4NYMQ 3ZY5A 1YE3A 3GIDA 4YIHA 2I7VA 1PNRA 4K6CA 2I9PA 3CZ9A 5HF6A 4Q05A 5C2JB 1X9HA 3BCUA 3KVYA 3PWKA 4I4TA 4J7XA 4AFNA 5A04A 3GLFB 1IQ0A 1SJ9A 2MOKA 3BYZA 2W2PA 1OHHD 4ACBA 5EP2A 4CKEB 5BXYA 3BXEA 3N7AA 2G72A 2SKCA 3ZC3A 3T61A 4B85A 4ZEMA 3OQPA 2E49A 1ENOA 4RENA 1FP4A 3AERA 5C4GB 1UL1X 3ZI0A 4BO8A 1HTTA 1ZGGA 1E3SA 1C3XA 4F86A 3OUUA 4HZIA 4FHDA 3K92A 5BWBA 1EK0A 4YK7A 3T0IA 3AFIA 1MR3F 4JBGA 1GZUA 5DP2A 4OP3A 2VTBB 2EFCB 4PC6A 2NYRA 2W6JA 1KHTA 1KKLA 3KDPA 4XR4A 5AM5A 4KEAA 3PIRA 1Q3TA 5I4CA 4R2HA 2MYNA 4GAEA 3HJHA 5AVZA 3O0DA 5BW4A 4DMLA 1FCJA 2HKIA 1SZDA 4H0FA 3ZHUA 1T8UA 1N2OA 2AG5A 2XNSA 4TS4A 2O3JA 3L4KA 1UCFA 3DKKA 3EZFA 1WUJS 4ZP1A 4ZVQA 1JHMA 3BMQB 1OB2A 4K88A 4X24A 1DJOA 1PR0A 5A1JA 3R77A 1G5IA 3RS5A 1S3FA 2OK8A 1KYYA 5BYAA 2IYFA 2D5IA 4O3FA 2N75A 4YTEA 3QVLA 2HNKA 3BA6A 3PNQA 3PGJA 4Q4HB 5DSTA 1FFBA 4DPMA 1U0SY 1L5KA 2HFKA 3E9YA 3NIBA 1ZY2A 2IFTA 3GDWA 1ZGAA 2NPIA 5AJWA 3U13A 4J3NA 3ADCA 4XUEA 1YKFA 1JR3E 1B73A 3PQEA 1SA0B 4JL6A 5ENZA 2ZR8A 2GRJA 2IT1A 1BXRA 2CFSA 4RGVA 4WCFC 1MTZA 4YAWA 1PYGA 5G4LA 1DKNA 3SS9X 1JHUA 2RHRA 2XUGA 3MAAC 3N05A 4YJ2F 4AU1A 1TVMA 4O5OA 1XQVA 4O6VA 3WMEA 1H0KA 4CV1A 2IQIA 2IU6A 5CYOA 4HB3A 2BFCB 5DHFA 2M6KA 2JIBA 4EB0A 1NXOA 2QVXX 4EMUA 4LYEA 2GZHA 4IKEA 4JL5A 4JWTA 4V24A 2ECFA 1L5LA 4BUZA 5A9SA 5AQ1A 3A1FA 5EVJA 3SF8A 1D6NA 2ZRDA 3VX4A 2PBZA 4INAA 4DT1B 5A4AA 2BZSA 1H5UA 3BDIA 3QP9A 3U4DA 1DDIA 2WTUA 1SXPA 2WWWA 3SK0A 2CJWA 2FXVA 1Q77A 3EDQA 3IIMA 2Q4BA 4LA4A 1KMHB 1ORRA 3PT5A 4G0PA 3IBYA 4KAFA 1Z2NX 3KJZA 2JHCA 2J0EA 1TKCA 3AEQB 4ZYVA 2H2IA 4IDPA 4M6WB 4AP5A 5E7MA 1BDJA 3EDRA 5REQA 5LJIA 1BJTA 3X1ZA 1K7YA 1D1PA 2FAXA 2QHXA 1VJGA 2R5WA 3CTMA 4EW6A 3DOCA 1PE0A 2IXTA 1FSFA 2ATIA 4UULA 3AY6A 1ECBA 4H4DA 2J3QA 2IHYA 1EP3B 4AF6A 1Z2OX 2VYFA 1M1YA 1W49A 5AW5A 1KS2A 5TB5A 2PSFA 4FR5A 2C9DA 3HCRA 1GCGA 1YONA 4I2NA 4MWBA 5ESRA 3CNQS 1H2BA 2HSJA 2R1ZA 4RS4A 4LTDA 5AVJA 3DZIA 3ZXSA 4HATA 4MW2A 2JJ1A 4L7VA 3IEMA 4DJ5X 5BV8A 1USIA 2BFEB 2GWHA 5EKDA 4EW2A 3EIWA 1AZTA 3ABSB 2GZDA 3MWKA 3GCXA 3UWDA 1VL1A 3SMVA 3CONA 3TIXB 1RYBA 3U56A 3T54A 1RLIA 3KTAB 4ND6A 3I58A 1XMPA 3ZOZA 3NR2A 2J30A 1CWUA 2BDUA 4CLEA 5T41A 4EL5A 1E9FA 2VS1A 4O2BF 4XEUA 1GITA 3T1VA 2O05A 4C6HA 4QD3A 3WLLA 4D99A 4DC1A 1W75A 1ISRA 3A31A 5LBTA 1EA5A 2JA1A 5CXQA 2CFOA 4LOAA 3MBIA 1JLSA 1KY3A 1KU6A 2CXQA 4UNRA 2AKEA 3TLYA 4UZEA 5T67A 3M6VA 3OE1A 1HDIA 4HK4A 1QS0A 3C3DA 4M9ZA 1O95A 4GEKA 5LP6A 2RB4A 5LYJA 4QFCA 1GQYA 1NV8A 2ATXA 3VHXB 4EG4A 3EWNA 1CVRA 3SQLA 1F60A 1EX7A 1F8XA 2BEWB 4QUJA 1O6FA 1L4EA 2BTEA 2O8BA 2H00A 4OHZA 3EB9A 1QCYA 2OB1A 1MN6A 3OF5A 4L8VA 4NAVA 1T0BA 1A71A 1ZJWA 3KKOA 4B3GA 4J49A 1TM7E 4O4JB 3CNBA 1U90A 1DBQA 1B8UA 4CQLA 2V3WA 4P36A 2FUEA 4IQFA 4RPGA 1I4EB 4ER6A 3K0SA 1TIKA 2W11A 3KJGA 3ZHCA 4ZOCA 4BKRA 3ETDA 2IX9A 2AE1A 3O91A 3B6IA 2OECA 5KOJA 2PUGA 4QXOA 4GG1A 3RGWS 3S55A 4RJJA 2C4MA 5HZMA 4YJDA 1R9NA 3DO5A 3KSMA 5JZVA 1HYHA 4JK3A 3FNFA 1OLSB 3KK0A 3H1TA 4UTVA 3EUWA 5TSDA 4D4JA 2WJGA 4MXDA 1N6KA 1WG8A 1WW2A 2X0RA 3UJBA 5CX4A 3TPCA 4RIGA 5CDTA 4TKUA 5BO5A 2C00A 4UJ5A 2QU8A 3DAPA 4JGIA 3C6BA 3EARA 5JUWA 1P3Y1 3H9EO 4Y6QA 1T6YA 4EWLA 1WQ3A 4P81A 4QICA 4FMCF 3ET5A 4LHXA 3L77A 1L8XA 3EXHB 1X39A 1ZO8A 3ZTYA 4NZNA 1QX3A 1QRDA 1M5RA 3GEGA 3OH8A 2ORWA 5GWXA 2QS9A 3PQ7A 5FPHA 5C4MA 4HGPA 3UA3A 5LDDC 2ZSHA 4R98A 4BPBA 1T36A 2P27A 1G18A 2WU3A 4LFCB 3D8HA 4BMCA 3P52A 3UWSA 2FG6C 2R8XA 3PNVA 3L07A 1CUSA 1AMNA 5THXA 1O6CA 2ENWA 2EF1A 2Q99A 3QFSA 1JBKA 2B37A 3LFHA 3PKZA 5L7YA 3QU4A 3V1UA 1DG3A 1X19A 1EXDA 4PPYA 4R7TA 5KQGA 4DREA 3E8SA 5E3HA 4DDMA 1M73E 3W5DA 3ELWA 5CHEA 1TPYA 2W43A 1SEVA 2ZATA 5HBRA 4A7PA 3D8RA 5EWMA 1B6RA 1SUEA 2HHHB 2JASA 2JFGA 3D3JA 3VR0A 2HA0A 5B1IA 4NC9A 4KQ1A 4PZ0A 4F6LA 2FCRA 3H1BA 2INGX 4LSMA 4Q9HA 4NSNA 4DB2A 4JV5B 2CLIB 1A7UA 2JFUA 1K6MA 3HC7A 3U37A 1RXWA 2LWIA 2QN3A 4HPJB 2GJ4A 3T5PA 3H5IA 3M4ZA 2CXNA 4TYNA 1TUBA 2ES4A 1XZEA 1JB1A 1JJ7A 2VT6A 1O1YA 3D3NA 1C1XB 3O73A 4R6XA 4YV2A 1B6GA 3RRFA 5B1HA 3W06A 4U6QA 4NBVA 1L5QA 2P2SA 1XXHA 2Q9CA 2O14A 2XIJA 3FJ1A 3BE6A 1MH9A 3PGXA 1A4IA 1PZNA 3AETA 3COZA 1NPTO 2E18A 4MV6A 2J9GA 4DRYA 1HE2A 4KBGA 3RUEA 2O2DA 4ETWA 1L9XA 3UAZA 3Q8LA 1X7DA 3G1UA 4LZNA 4AP9A 1NN1A 4RF3A 2B99A 1SC3A 1U1GA 4Q01A 3SC3A 3R09A 4WVFA 3BORA 4QX6A 3PNLA 5BV2P 5JNVA 1LCIA 2R4QA 3D6TB 2R96A 4ZT4A 1I3CA 3KR2A 3WA7A 3BZWA 1ADCA 5I9BA 5JD3A 1QIMA 1Z28A 2P7HA 3DPSA 5AHOA 5AI8A 3TLGA 4NCAA 4PGGA 4B45A 1L4HA 1JFTA 4OX9Y 1XVVA 1NT4A 1ES9A 1W35A 3H8JA 1J07A 1JSCA 4YJ3B 3VHXA 4R9NA 5J40A 1NSYA 1Z0IA 2BHNA 2JAQA 3LY7A 4JUBA 4MLZA 2VVTA 2VJLA 2JZCA 1NXSA 3A14A 3JQ9A 1T8RA 2CSXA 2AV6A 4RK7A 1UOEA 1XWIA 4OAQA 1NBEA 3U6KA 3FPKA 1T29A 2FPLA 3K8YA 3O6VA 1O77A 2EERA 5CD1A 1AKYA 1GZ5A 1MC8A 3A4MA 4LYFA 6LDHA 4ZYYA 5A4FS 1V16A 3QRWA 3WGOA 1UKZA 4YY3B 2V5UA 3BL6A 4JC0A 3TMKA 1CQIB 1BHSA 3AFGA 4QQRA 1ID8A 3DBOB 1I2ZA 5I7VA 5IKPA 2SCUA 4HAOA 3BXGA 3I9JA 4REOA 3GLFE 3K9NA 3U09A 2ZSEA 4R1PA 4C4TA 5KDLA 3KTAA 1JDJA 3NV9A 3L0CA 4CWAA 2J9FB 3GEPA 3HJBA 4RFVA 4ZOBA 3GVXA 3IO3A 2P5TB 1GPLA 1SUWA 4RPCA 4XD7A 5ALRA 5JU6A 4ZEOA 2CXOA 4YFYA 2HK6A 3HSSA 2ZVDA 4L57A 2Q29A 2WTBA 4LCEA 1E1LA 1GFIA 3UJPA 4MUAA 1KFEB 4ZO9A 3O84A 4CUZA 4GXRA 4TMFA 1I1HA 2Q9BA 3JD4A 3BMNA 4YP5A 4K7JA 4XIIA 5FF9A 1FW8A 3BGDA 3R6WA 1N3IA 5L6MB 2X4IA 4RPIA 4RD2A 4Q9LA 1YF3A 1KS9A 3BSWA 2W6NA 1ZA2A 1D2AA 2WHPA 4CLRA 4YI3A 1QH0A 3X1WA 1O54A 1XA0A 2XQJA 1G7TA 5FOSA 1XAGA 5CB4B 1EFRA 3L0DA 4FEGA 4RXUA 2PA3A 2G9VA 2VRNA 2Z58A 4DXHA 1PVOA 1U1CA 5HE8A 4E0BA 1WCIB 5KAPA 3NRCA 4KR0A 3R0VA 5FJIA 1B0UA 1FUYB 2FEMA 2MSEB 1F2UB 4G0NA 4L6CA 5G3ZA 3BZBA 2ZUTA 3RV3A 4BMSA 4MQ4A 2HQSA 2RGYA 4LQCA 3MOSA 4RY8A 4BVGA 1II8A 2I5PO 3FWYA 1O57A 2VK2A 4M1MA 4I6EA 4QQNA 2O3QA 2Z5VA 1G6Q1 1GTVA 2IZ5A 4KPGA 4MKIA 3MSCA 4S2UA 1P6QA 1RI3A 1KR2A 2ROQA 2ERCA 1BA2A 2NSJA 2RB5A 2XQFA 4G5OA 2LIPA 3EBOA 1NXTA 1YR2A 1P4GA 4KLZA 4MR8B 5FTNA 3VVLA 2W6OA 4YCAA 2IZ7A 2OQIA 5K0NA 1SA0A 3NGXA 4DJJA 1U3GA 4I3FA 2C7RA 3BWBA 4PPGA 4TXLA 4M88A 2MMGA 4YPOA 1TT7A 2M6RA 3AEKB 1UBCA 2O3TA 5KINB 3R9IA 5A6VA 4AIIA 1GDTA 5LUAA 3LBIA 4HXEB 4NV3A 1CJBA 1TTHA 5LIRA 1LH0A 1E4YA 1DNPA 2JHFA 3IQIX 5CNMA 3DOEA 2AG8A 1VXOA 2W8BA 3TZQA 3FMPB 5AESA 4OBEA 3X1KA 4B8WA 3NXKA 1Q0ZA 3NUGA 3EXAA 1KOFA 1T9BA 2PO5A 5KKAA 5JFGA 5LL6P 1X2EA 2QI9C 4K81B 3U4MA 5LZ8A 4RTNA 3OETA 2NVWA 4ND8A 2VAWA 1HFKA 2O2XA 2PX2A 3HL0A 4J2TA 3VSEA 3K70D 2AHOA 1JKXA 4JEIA 3COSA 1L5SA 1GGEA 3F6YA 1Q19A 3NDIA 2A5GA 4ALMA 2QIOA 4DMRA 1YJ8A 2PXHA 4QC2A 4BVEA 2EKBA 4CLRB 5CDGA 2H1OA 5KYKA 3BK2A 3NHUA 5HTOA 1GZ4A 4GBGA 4LE1A 3CNHA 4BKUA 1QQTA 4ZWNA 5CLJA 3R6TA 2PM8A 4MJLA 5JIBA 4IHJB 4QDUA 2L0XA 5K0TA 2C7PA 1U0GA 1GPH1 2B4YA 3EFOA 4YJGA 3TKAA 1D8AA 2ON6A 5MGBA 1W47A 4OKSA 4BJ1A 1GT6A 2JDID 3ROMA 4CXMA 2QRLA 4V0ME 1N34B 3ND6A 3B7GA 2Q27A 1KH1A 4HVAA 4HWSA 4PYOA 5KVVA 3EXFA 1YIOA 4RC9A 1W19A 4EJ6A 2D5AA 5K8CA 1MC1A 2XRYA 3HKEB 3ZCPA 3DR3A 3DAYA 2WV9A 2QGNA 2CMKA 1KAQA 1H6AA 1WB4A 3D4OA 3QUCA 3SG0A 2CZCA 1BCRB 4D9NA 4AP6A 3EPPA 1DE0A 4ZANA 3GR6A 5D86A 4YUAA 4ZV4A 1QGZA 2W2LD 1NBIA 1PQPA 3BX1A 1P4JA 4EKIA 3AOEC 2FP4B 5I9IA 3DM5A 2AOTB 3LS2A 4KX3A 3K6SB 4TYMA 1FNSA 1MMFB 5EIHA 1C0PA 1QIIA 2JIPA 3EUAA 2ADMA 2VJKA 1IE3A 1ID1A 1N2HA 1OBOA 1CZKA 1PJLA 2W4IA 3RF6A 3THOA 1ZMOA 4RZ2A 4PLGA 4I8XA 1PG5A 4YJ3A 2JFFA 4DDUA 5C7OO 3EGDB 4Z2YA 3DTNA 3PCRB 5JNTA 4M8SA 1ZYUA 3TJMA 1KI3A 3KYCB 2OCYC 3L4EA 1N8SA 1ULSA 4PPQA 4TZKA 1Z7WA 2W8ZA 2KSQA 1C4OA 1D4FA 2XGOA 4ND7A 4QAJA 1F38A 4C4YA 1Z0SA 5E4YA 2UVPA 3V2IA 4PG7A 3R7LA 4PBRA 1PF7E 3SXUB 4MYRA 1A69A 4TTAA 2JANA 3BHNA 5IMBA 4IJWA 4WFJA 3QPAA 3AF2A 4HN9A 2OENG 3R41A 3RVQA 4KRYA 4KREA 2CHGA 2PBRA 3H4MA 1HLFA 3VHLB 2Z4TA 5M34A 2DR2A 4OQMA 1LV7A 2P75A 4EUSA 3HB0A 3JVDA 1AS3A 1MB2A 3PIIA 1FJHA 5SZKB 3IUBA 3K2EA 1MVNA 2H4FA 4PFKA 4E5SA 1S02A 1M2HA 4JQSA 3WISA 2COEA 2CYBA 3HDTA 3NYIA 4F5EA 1QHFA 5MN5A 2GBGA 3HM9A 1SD2A 1V4NA 2FV8A 2RHLA 2D2EA 3CRW1 3I9MA 4ENSA 3R75A 5JBQA 3RSFA 2VPQA 1JJFA 3EQ6A 5FBWB 4DIUA 3FTDA 5FYQA 3WJAA 4RMNA 3WS7A 4KE6A 1P1JA 4H4CA 4KNYA 1C0EA 3DLAA 1CF4A 4B17A 1JHAA 3ZK8A 4MA4A 1HGXA 4QWMA 1E5LA 3C5VA 5K51A 1UMBA 2EJWA 1OD6A 1YZNA 4LSGA 4N76A 3MBKA 3VC1A 3QWFA 4MKZA 5I5GA 1COWA 1EUDA 3T3EA 4RA6A 3N6XA 1XMVA 5CAEB 3TN7A 3PDIB 4C89A 1RWNA 4PFSA 3KT8A 3AVVA 2FETA 4QL3A 2DUWA 3CPHA 4PRLA 5H81A 4RVOA 2RAUA 1B1CA 2GHQA 5JZSA 2FZ4A 2LIVA 2J7PD 3S2ZA 4F45A 4BNYA 4DLNA 2QRMA 5CIWA 3DB2A 1J39A 1N75A 3N3BC 3U7EB 1GAXA 2VDKB 2AC7A 4QM7A 4MAFA 1EH5A 1PUXA 2DFKB 1E3MA 1WD7A 4RGYA 5EHIA 1OU4A 2BFBA 2BKLA 2QXUA 5DCLA 1G0OA 2Y92A 1FP1D 2HLPA 3CKYA 3GJ5A 4N5IX 3TLCA 5A62A 1HORA 1F20A 2PVPA 3TTXA 3Q7PA 4H35A 3K15A 1K1EA 4HEJA 4UXHA 1A8PA 1Y5NA 4YAOA 1U0TA 2Y0DA 4OATA 4BTLA 4CEIA 3GJ4A 1E9VA 3IQHX 4J1SA 3DOHA 2FPGB 3K8OE 4QREA 3HS3A 3U60B 3MGKA 4MV9A 4X0EA 2HJGA 1KDRA 4ZEXA 1XR3A 1CYDA 1EVIA 3A1NA 3L92A 4ZO8A 1VYUA 2P0EA 2RG1A 2PIAA 3RRYA 1MJFA 4HS4A 4H3SA 2CLEB 5BSEA 2GEBA 4OK5A 5ABPA 5BY2A 2YIJA 2AZDA 3EPRA 4QPCA 4MH0R 3TOXA 2R1TB 3ZHBA 1B4DA 1AF4A 4KRFA 4E5DA 2BH9A 3GCWA 3NWBA 4MUKA 1M1ZA 2VRWA 1D09A 4Q7LA 3W90A 4CDRA 3EZGA 1CFZA 3NAZA 1JI3A 2WWIA 4NF2A 3UXEA 4YMVA 2I3BA 5AVQA 3LCMA 2Y67A 4HGRA 2CWDA 2I1LA 4ZQBA 4UEKA 4JYBA 1W4BA 5A5GA 2ZYRA 2RHMA 2NU8A 2CLHB 4GWLA 3NATA 3RK1A 4GX0A 1SR8A 2QX7A 1ZAKA 4HLDA 4U8HA 3K70B 4MVJH 3UMCA 1J23A 3DDNA 3QTBA 5M3BA 2GB4A 4J8PA 5TJHA 3JWGA 1D04A 4IBOA 3GX1A 1YUNA 4JB3A 1AKRA 5H4HA 4BFTA 1RYYA 2HIAA 3I05A 2QTGA 4EY5A 5JXWA 2XOXA 1NI3A 2PZFA 1L5NA 4BFLA 1EUQA 1CT9A 3A6KA 3C3JA 3TGWA 4QBGB 4LMPA 5EP3A 1OC4A 2ZG6A 1S2OA 2WJYA 4G9GA 2BDTA 4X6UA 4OFXA 4EPTA 2IZZA 2VAVA 2JI6A 1YDEA 3ITDA 4LVUA 3EGDA 4BYGA 5D1NA 3W04A 2BFEA 2EBFX 3WSTA 2WMOB 4EGJA 4MV7A 3V97A 4EQ6B 1A2KC 2B7LA 2X58A 2HCFA 4E11A 2GMWA 2I87A 2FJ0A 1D0SA 1KKMA 2D1SA 4RF4A 3I61A 2DHEA 1IWPB 1HYBA 2LCQA 2XJ4A 4EYGA 1E6EA 4X92A 4DM4A 4UMVA 5D8DA 2AUMA 1N0VC 3I9OA 1RC8A 1TQHA 3H0CA 4YDSA 2H7VA 1C9NA 4QQFA 2HU8A 3EW9A 1KI1A 2Q5FA 1RBMA 1U0JA 3RO7A 3REGA 1UZUA 1PNVA 3HDJA 3UJ3X 2ECOA 2XKAA 2A9KA 4G0OA 3F4LA 4R0VA 1D6SA 1KQNA 3OP4A 5KZMB 5FOXA 2AVNA 3DUFA 4LJRA 2E4WA 1FX0A 3HUUA 1DWOA 3PA8A 4XPIB 4RTLA 5CGZA 4IV8A 4IWNA 4DIFA 1DQRA 1UT8A 1ZUHA 3C8MA 1OFUX 1H66A 1YZQA 1IULA 3S8MA 3TRDA 5BOSB 1YVPA 3EXG1 4AL4A 2XECA 5A9SB 1XLWA 3SYNA 4F8JA 2XUOA 3V3TA 3ETCA 3Q9LA 1IY8A 4TSFD 4UDYX 2ZJ5A 1GAWA 1Z18A 2UYYA 2MT9A 4UU1A 2VTDA 2PRZA 3E4DA 4ZOLB 4ZGWA 2OESA 1X9IA 5SY9A 3ZE1B 4DCVA 5JO0A 4AW9A 3RLIA 1AN9A 2OZVA 1AUPA 3FSGD 1NQUA 3R3ZA 4R2KA 4UEWA 4H7PA 1DLIA 3STTA 1PFGA 1JEYB 1KJQA 1JKJB 3R8XA 2P4EA 1FC0A 4TYYA 2K2WA 2HMAA 1BCSA 1NR7A 1AXRA 5L7TA 1UBMS 2RH8A 3RS7A 3VPSA 1SKAA 1L4UA 2OMKA 1O96B 1IOLA 5F7ZA 4L2IB 4EMTA 3GRKA 1YOVA 4K87A 4F2GA 2W5UA 1PQWA 2M1XA 2A3NA 2I6TA 3U7RA 1ZCBA 2QOEA 1EFTA 3TL3A 4YUZA 4DA6A 5T4HA 3TFQA 3DDZX 5LQRA 1LFDB 1M7HA 1VDMA 1EFLA 2Q3BA 4KE7A 1XTPA 2C2WA 5AKLA 4C01A 3FPFA 3H65A 5CVCA 1NVEA 3RYFB 3DMNA 3LIPA 2G8NA 4KXWA 4YMWA 1YE8A 5JVDA 3C4VA 1Z4JA 3O38A 3AGPA 2FEKA 4DJFC 1EX1A 2DFNA 1TD1A 3OTIA 2YYAA 3PFBA 5GAJA 2ZW9A 2PUBA 1V43A 2LZ0A 3NXSA 2YRXA 3ZXIA 5MGNA 1P60A 5ERGB 1X7WB 2VP0A 3ENKA 4MRNA 3W8EA 5AD1A 1KI8A 1N2CA 1TMKA 3OQNA 1KIFA 4A8JC 1JQAA 3DDSA 4EMBA 3VH2A 2WD7B 2FPPA 3ZUGA 5C8YF 3KZXA 4ZCRA 3TUIC 2YOGA 3DVAA 1DQZA 3DEZA 1QO9A 3H13A 4S1PA 1WXXA 4ITUA 1R74A 2NUPB 1JQLB 2JG3A 3DD1A 2RIRA 3NJ8A 2Z83A 3ZLJA 2QUJA 1ZN7A 2QL7A 2XA2A 1YI0A 4H15A 4MRMA 3AXSA 3LY9A 3E5RA 3TIVA 4EYSA 3PHCA 2W98A 2IGBA 1Z36A 4AZ0A 4RSGA 2I3DA 1VSTA 3IALA 3H6HA 1GRCA 3FFAA 1QVRA 4XRGA 1G64A 1IG0A 1ZVQA 1H1LA 4XSVA 1N8NA 2Z9CA 3U31A 4BNWA 4NBRA 5MDHA 1IEWA 5LLDA 5DHUA 1V2GA 1P1CA 3WAGA 1DBSA 1T0UA 4OXXA 4V0NA 4R2JA 1UFKA 1BD4A 2Q49A 1YB6A 1G8PA 4GPD1 1KOLA 5AJVB 3L04A 4WZZA 3SHTA 2X5KO 2R1VB 4OAOA 5JAZA 1CHNA 1CUUA 5K01A 3D4PA 3B1XA 1Q2XA 4WCFA 1KJNA 3ER6A 2VFAA 2GXUA 4BP8A 1NN5A 3NUZA 1R9GA 1XKXA 3JQBA 1V5WA 4OEHA 4Q5IA 5SY4A 4ASUD 5EJ4A 2OXFA 2GCPA 2E5LB 2PV7A 4ILKA 4O8ZA 2GD1O 1MAAA 2O5RA 2FSVC 3DM9B 5B4UA 2BBWA 1MC5A 4PLZA 3TRFA 4ZI7A 2P2GA 5JJIA 3G5AA 2AKYA 2CXHA 2IEBA 1EFKA 2JFHA 2ODBA 3PUWA 4GQIA 4NNJA 5FPQA 2HDWA 5I9TA 1RAEA 2LNDA 3PEWA 3I83A 1XC7A 4REQB 3ZDBA 4MYUA 1JP7A 1ZS9A 2VT2A 3N6RA 1XZFA 2RARA 2NYUA 5CXSA 3AR2A 4OREX 2IHVA 5FUBA 5AW9A 1Z8NA 2IS4A 1FMTA 3AL2A 5GONB 1AO0A 4GXTA 1NX6A 1N2CE 3SZMA 1BXGA 1KVTA 5K8IA 1P5JA 2J3IA 3BTOA 3HYNA 3IBTA 4NFYA 1MLDA 1QYWA 4G84A 4HLUC 4MUNA 1QE0A 4DAOA 4RCVA 1SVNA 1A9XA 4KE9A 3QXJA 5K20A 1WBDA 2KHZA 3EIOA 1R66A 3GJ0A 3PEVA 3AB7A 1G59A 1ILEA 3L6RA 5H70A 4Z4EA 4Y30A 2B1IA 3C43A 4DYHA 2NV6A 3P45A 3WWPA 4BAGA 1IYZA 1CUXA 4JA0A 4CCWA 3PB3A 4MK4A 2PKQP 4ZRDA 3ET4A 4DLYA 1FUIA 5F64A 1EINA 1W4LA 2EGHA 5AR1A 4AJ4A 7YASA 5FNVA 1UMCA 3O7WA 3ZZUA 3ANMA 3P4YA 4OG2A 4YDRA 3V2UA 4DM3A 1DRJA 1KI9A 3KJXA 2NSDA 2XX3A 3KPWA 2HR1A 2R3SA 5E1DA 1SHKA 4PANA 4UE6A 4MRPA 4Z9XA 1QHXA 1U4SA 4IDAA 3HTXA 4K6MA 4P4LA 2HW8A 4OLFA 2R62A 3AEZA 3GAFA 3KQTA 3KB6A 4JI5B 1VL8A 2YZMA 4JJKA 3EVDA 3G2IA 3CW8X 1BCRA 4E6PA 2CN1A 2C97A 1QU2A 2GFQA 3N2LA 2IUSA 1N6IA 1SKQA 1JGTA 2V7PA 1R9MA 4R9SA 2FR0A 3D5QA 1B0AA 1S8NA 4UAVA 5L4NA 3D5TA 1JHPA 7REQA 4Y1RA 3L0BA 1Y7HA 1OWPA 1QV9A 3H42B 3F3KA 2HI0A 2HMWA 4IOLA 1O9HA 1ZJZA 3M6AA 2PWAA 3CRVA 1NRJB 4AQDA 4NAUA 4TSRA 4WCFB 1ODTC 2PXAA 2GZ2A 5ITVA 4RVDA 3E5NA 1X1AA 3NH9A 4EYQA 5JCXA 4LXUA 1JYEA 4TRRA 3WDLA 3EOAI 3LPDA 1TCUA 2R8BA 1LVHA 3GLVA 3QY9A 3GXOA 4YAFA 2JIZD 2UUCB 3EDMA 3QEMA 3NHRA 3IHKA 2QA5A 2HSZA 3FYSA 3WSWA 4EHNA 1QHNA 1LSUA 1HSZA 2WNSA 4ZOEA 2VDJA 3VZQA 1XKTA 2QQFA 1W2GA 2CNNA 2JIZA 4D98A 4FFBA 4BQSA 1I7DA 4NAHA 3IJRA 1QB7A 5DGHA 3WK5A 3KWLA 5F77A 4CL8A 2G88A 1QK3A 3QFCA 5DCUA 3CRQA 2GAFA 2IYOA 1JR3D 2PR7A 3V6MA 2OHFA 1JA9A 3L84A 3LUHA 2QLTA 3ENZA 1V95A 1U3UA 4TV8A 4HWGA 5J4KA 4GBJA 1T3SA 4AUNA 1F5SA 5KTKA 4R2MA 1P7CA 4MA0A 4NFSA 3VAYA 1UP6A 5KCMA 4IOJA 4CMCA 2X7JA 4FFDA 1Y6FA 5K0EA 4N5MA 4MW5A 5H68A 3WMXA 1UBOS 5LQKA 3HZOA 1XTKA 2R7MA 4NOJA 1DEXA 2GNAA 3EIFA 3Q5EA 2R6DA 4N47A 3SZ3A 5BR1A 2YW9A 3BQMB 5CA0F 1CUFA 1C9EA 4PZYA 2CHFA 3CE9A 1PR9A 1YS6A 2HDNB 3VZCA 1F0YA 4KN6A 3VU3A 1E3TA 1RZ3A 4RWEA 2O23A 3D7RA 3W77A 3B70A 2IIQA 3WJ7A 4G09A 3ZDEA 5IDYA 1C3OB 1YDFA 2D5CA 1CB7A 1G2QA 1M1UA 2OZEA 2PZMA 3HBLA 1CUZA 1PZHA 3LUCA 3AYZB 4ZT5A 5TS2A 3RAFC 2CMHA 3IPYA 3W2FA 1N0WA 1G291 1X7GA 3IUEA 4LGVA 3L8HA 3K9FC 5AXDA 4MSUA 2X0FA 2PRIA 1H2HA 2H1RA 1EK6A 4Z49A 4FGWA 3PYMA 4Y2GA 2A9JA 3S1AA 3WK7A 2KM1A 4E5KA 1LB1B 2F8MA 2PS0A 1KF0A 3FDZB 3EWSA 4LOKA 4JBXA 4MGYR 1MIOA 4J1TC 3PC8A 2E7ZA 3D7LA 3R6LA 2Q1XA 1XU7A 5T5QA 3ONNA 3VOSA 3A2KA 1JFFA 1XD2B 1MHPA 2QZSA 1GLNA 2BV3A 4M53A 3CUTA 5T64A 4LSZA 4NCBA 4BLOA 1N9ZA 4BMZA 4O5AA 3OQBA 2I3ZA 4J4HA 2QVGA 4ZEVA 2R6GA 2WMNB 3TNYA 3VDNB 1XZBA 3MYRA 1Q50A 3ISVA 4I5FA 2BGUA 2VT7A 2A9RA 1DV2A 4XAQA 3RNOA 5J4VA 4B4OA 3TQHA 4IKOA 4AJ9A 2XMDA 3B6KA 1RHQA 1UKEA 1ZN8A 1ZRMA 2OCDA 3L6BA 4GMDA 4KVGA 4KXUA 1A7JA 1ULBA 2OZLA 2PANA 4RV5A 3SBEA 3HB9A 5TIIA 5DTJA 1F9EA 5KTRA 1XQ9A 4CTKA 4D9FA 3JZIA 4P3KA 3Q7TA 2ZI3A 4UPVA 3GMSA 3NALA 1XT6A 1WSAA 2C3MA 3AOGA 1LW6E 1RVDA 4BO2A 4AJ1A 1RRCA 1REQA 5FWXB 3UYLA 3M5DA 4GOMD 2WC1A 1PLJA 3RHTA 1BVUA 1C1HA 3CZPA 1ZHOA 5ED4A 2NO0A 1YJBA 2F6RA 4PZUA 3TL2A 2VHQA 2G0AA 3PICA 1L4GA 2O0LA 1QHEA 3SHQA 9ATCA 1L7MA 2G9QA 3H3XA 4OB6A 1BOFA 3URKA 4RCZA 1GGNA 1YBMA 2QUAA 3WKAA 1SNYA 2XUQA 5LZ9A 2HK7A 2CUZA 3NCHA 5FPTA 2XYRA 5REQB 3W2EA 4CEHB 3VKWA 1R6XA 5CYPA 1EVLA 1QVWA 1VE3A 1NUAA 1TD9A 4E3ZA 3F73A 1R6BX 2ERYA 1A5SB 2IPOA 3TOCA 1G6KA 4KZKA 2ZAIA 1XEXB 5HKOA 4KUGA 3BIJA 1C8KA 1QG6A 3MMNA 1NQOA 2FMXA 2QPTA 2X9NA 2CBXA 2I22A 2VH2A 4WV3A 1T9HA 1YZLA 1FK8A 2ZUCA 3HDYA 1KC1A 4JASB 1VECA 4CLOB 1DEHA 2QN7A 3T5TA 2HMYB 2EHDA 3L9XA 4LI3X 1JJBA 3OTQA 4KNVA 4OFZA 2PSDA 4PC3A 1G8SA 3G2OA 4ABYA 5IEJA 4P5DA 4KACA 1XD8A 5T8KA 4OHPA 4EJ2A 3ZJYA 5J23A 5C9ZA 1PR5A 4KW7A 1ZC4A 2FZWA 1PTJA 4M76B 3MBOA 2ZKLA 1FSGA 3WKCA 2C2KA 2VJMB 2H85A 2WDPA 1SBYA 2VDQB 3QSYA 1CJKC 3QVKA 1T10A 2DBRA 5C1IA 4EY3A 2WM8A 3FAKA 2OCBA 2YY7A 3QMPA 4UW9A 3TZEA 2LCIA 1UT5A 4QOHA 3NM4A 3D3WB 1TMYA 3ZQKA 1EFDN 3NP7A 1VE7A 3DLBA 2WIDA 3AZPA 3KKQA 2QRHA 3CG0A 5IT5A 4NXMB 2PA0A 3R44A 1KXJA 5EWJB 4AJKA 1YI8A 5LBUA 2NU6B 3ZEAA 1Z83A 2JGDA 4BQOA 3AI1A 4OYYA 5B5SA 2IXBA 1YE5A 2QL9A 1WBJB 2Y2UA 4MQ6A 3S1SA 3JQFC 1DELA 1X14A 4ABTA 1VPEA 4IQ4A 4LF8B 2FQQA 2BEKA 1HZJA 1ZL0A 2F1IA 1QXSA 1S0UA 1SB9A 1X87A 2GTPA 2GCOA 3GEEA 3SYRA 4PZAA 2ISQA 5K8VA 1IBCA 4KHPB 1Z5NA 1MNQA 3CJRA 3VA7A 2O8DA 5NULA 5P8WA 2EG5A 1EX6A 2BFNA 3UICA 4A3SA 1EXVA 4D92A 3CX3A 4L0QA 1CE8B 1G63A 1SIUA 3MELA 3CLSC 4S12A 4WINA 5EWMB 3RSSA 3TQFA 4AXXA 4QKQA 5ISMA 4JLSA 2NTVA 2IH4A 3WGIA 5LNK6 5HZKA 3JPYA 5KNBD 3WO1A 1KP3A 2WHEA 1AZWA 4BLWA 4RTSA 4MVJI 3EGCA 3VNBA 5BMVA 3MB8A 4D42A 4EX6A 2YJTD 1ZA1A 3AR9A 5LBIA 3FXAA 3H18A 3K96A 3BRQA 3BIFA 3GRRA 2GK4A 4FWBA 4YJKA 5CU7A 3VO8A 5C8DA 2JAWA 3GFPA 3UW1A 3HSYA 2A5LA 3GXBA 3JWEA 1ABEA 1W6RA 3A8TA 2YXPX 4OXNA 4MRVA 5EXEA 5T3UA 3OIYA 4ZDKA 5TARA 1P5RA 4G0VA 2FE4A 4RV4A 2BHTA 1G8KA 4ZK2A 1IOVA 1N8TA 3JVEA 1ISJA 5IULC 1P8JA 1DFHA 1N9GA 1W4RA 1W0JD 1U8TA 2A14A 2IL1A 3I9NA 1W2HA 2EFHB 2GEVA 4GR9A 3ES9A 4P4TA 2PLRA 3PDWA 5F2NA 1Q44A 5J4YA 1J33A 1OLSA 4LRTB 3VR6D 1M2FA 4A36A 3MUNA 4G56A 4EP1A 1O08A 2QN8A 3EISA 4J0KA 2P65A 3LDFA 3IJ5A 3IPXA 4MYTA 3ZPXA 1W5BA 5E6SA 1CUWA 1KMCA 3FYCA 2H2GA 4XIFA 2W2LA 4X44A 1GKLA 5AK0A 1HZZA 2J5XA 3FPAA 3K8QA 4RQUA 3TRIA 4EO9A 5HILA 3GPDG 3X1YA 4PVCA 3OX1A 1F14A 4RNCA 1DEKA 3PFGA 3SZOA 1P9LA 3AU9A 2XMQA 4PPFA 2IUUA 1G17A 2JC3A 5AXCA 1SXJE 4C0WA 3HCNA 1W1UA 2VQ3A 4U5QA 1TTPB 2A30A 1F1BA 2HHLA 3HDQA 3NHMA 4U63A 2V55B 2J3EA 1QVVA 1U0LA 4MVYA 3IKLA 1LEHA 3QFRA 2QB5A 3B52X 3C6KA 2RGNC 4AMUA 2EJCA 2W6QA 2ZB8A 3B1YA 1CKEA 4NARA 3E7DA 1G21B 2YY5A 3RYHA 3LKBA 5AMXA 3ONEA 4WE3A 3UATA 4RHYA 4CV3A 5BR4A 5KNDD 3TW6A 4OIFA 4DR7B 1VI2A 2HCTA 5CP8A 2X4DA 3UPDA 3SIPA 1KEEB 1L5FA 1YJXA 2CFRA 4UNIA 4XX0B 3TQSA 4INJA 1RKBA 1U5BB 2N42A 4GGOA 4XM1A 4U3JB 3EOZA 1NGSA 1N9GB 2ZIXB 3LBAA 4PYLA 5TLSA 1LJLA 3EAFA 4UXJA 3SNHA 3UB4A 1I14A 1JDSA 5E6RA 2GK6A 3I6ZA 2BONA 2VHUA 3D5EA 3BEOA 3K0CC 3PNOA 2NXJA 1JIXA 3Q0IA 4OK3A 5EE1A 3RVLA 3BDAA 1NLZA 3MILA 3R5FA 1YMVA 1BRTA 3HO8A 3Q3CA 4M7PA 3RIGA 5L4LA 2HJWA 5CT9A 2EJTA 1JIVA 2N3ZA 4E09A 3IQGX 4P2BA 2Q5EA 3A4LA 1MGPA 3HN6A 3NHAA 3BILA 3IE2A 5LZ7A 4E4TA 2PKYX 3D4BA 1V7PC 3PFFA 3MCWA 16PKA 3KPUA 3ZU5A 4CKCA 4P53A 4U6NA 3FW1A 2P69A 2XUFA 3I01A 1KJYA 2AF4C 4DJEC 2C8KA 2CZQA 4BN4A 1EESA 3UAWA 4YAIA 1RIIA 1G7RA 1T3ZA 2OLKA 1PZMA 2BGTA 5IF3A 1PFVA 4RTKA 5H4GA 2Q1TA 2QTBA 4IIXA 4KO4S 2J09A 3KSBC 2OOSA 1A3CA 1Q20A 4HWRA 1US8A 2JBAA 1FMFA 5F9FA 2D54A 2BOVA 3ICQB 1QHHA 2YQ4A 5A0VA 2PWPA 5ECWA 3LZ6A 5A03A 1PKXA 2C3PA 3KL2A 2E6KA 4FVTA 4XUDA 3MLAA 4N40A 2A9OA 3FYHA 1KI4A 1GCAA 2JGDB 2MIIA 4XKJA 3M6MD 2BHSA 4F2HA 3AU8A 1JR6A 2V03A 4HDQB 3EZ9A 2OCKA 1PQYA 1HE1C 1YL6A 1E77A 2D1FA 2GZ3A 4RWZA 3WQSB 1U3TA 4RMIA 1H5QA 2OCAA 1XVLA 3KPVA 4J0GA 3SAJA 1Z6QA 2FG5A 2OY0A 4HNSA 5JG7A 4FFMA 2ILVA 2ANBA 4ZMSA 5KJ6A 4BJ3A 5KYTA 1GGJA 2PUCA 4TLEA 5KSZA 1JG4A 4IG9A 5JNSA 1SKMA 3AF1A 3A9TA 2IOYA 3CT6A 3DZDA 1RW4A 3OPXA 4NPAA 3TD6A 2YNMA 5BVHB 1N5KA 3MEQA 3QPBA 4D4MA 2FX3A 3A3KA 4QBIA 5I4KA 2DULA 3FMOB 4X71A 4UBNA 4FFSA 2O07A 4J0QA 2BMEA 3IA7A 3M5WA 5G0WA 3OC6A 4EI2A 2H6EA 3K1JA 4BEBA 4ERNA 5C51B 2ZIGA 3WC4A 1IHUA 4O02B 3KB8A 2QDKA 2HLHA 4C7MA 3TCNA 3FTFA 1WDWB 2KI5A 1CDDA 1ZX1A 3NWPA 2IHBA 5EKTA 5ERYA 1JTFA 4ASUA 3CLRC 4HQNA 2LR0A 1PZEA 1U0NA 3Q9SA 3CCFA 4B6RA 4M9QA 3VU8A 1H2EA 1CY6A 2D13A 3GJXC 1VLVA 4KPUA 1YOVB 5KQPA 3UGJA 2PQMA 2ZE5A 5G0VA 1V8BA 3GNSA 2FLVA 2V4MA 1PW7A 5AVWA 4LN1A 3WK4A 4R40A 1NU8A 2FPKA 4RHUA 3JWJA 3JZDA 4FI3F 4REMA 1RTTA 4TTQA 4UHKA 4ARBA 3DC2A 1YHZA 4GKVA 1KAGA 4L9AA 4UZFA 1B23P 1NVMB 3L5OA 3OT1B 5FDFA 1ZKDA 4Q3AA 1FFYA 3EG9B 2I03A 2HPAA 3BWCA 5TQ0A 2XKJE 3WBJA 721PA 3AHDA 4NULA 4J76A 3KVVA 1TEXA 4MIOA 2QTVB 3NONA 4WUVA 5AI6A 1R1DA 2A7XA 4IJQA 3B8EA 2FPXA 3GT3A 2XAAA 4FK8A 1OI2A 1JJIA 4P4NA 2YZ2A 3NRBA 4IMRA 4AY4A 5JJLA 2JKYA 3CVXA 4FR2A 5JH7F 1ZFNA 3QPVA 4JJZA 2BZ1A 3NZEA 3IIJA 3PK0A 3WB2A 2CLCX 2FMIA 2NWQA 3OZUA 4XUGB 3V5NA 3RVRA 5JRJA 4MI3A 1QB8A 3I5YA 2WZDA 3L7OA 3L3BA 4YR7A 2B8JA 3I3OA 4H59A 1C3LA 3TQTA 1HG1A 1KR5A 3VZRA 4AKSA 1VTKA 1N2XA 4K9MA 1GPDG 1XDBA 1LWNA 1K7SN 1ONBA 1MF7A 2IYTA 2BHLA 4LXQA 4UCFA 5DASA 3GBVA 3K2IA 3UIEA 4E94A 4EFMA 2A88A 3LU1A 3RBZA 2UKDA 4QUAA 3ESYA 3OEYA 1SU4A 4JGGA 4YJHB 1TA0A 5LWQA 2E3JA 2Q2NA 4EA8A 4PW0A 3FKJA 2AOXA 3T7RA 2RC5A 1DXOA 2FDXA 2QRZA 2YDYA 4OHCA 3R4CA 4G9EA 5AKEA 1U5AA 2W2MA 3C7KA 3LVBA 4BWGA 3T3IA 2Q28A 3PXCX 1EZZA 3N9IA 4WLEA 2FQWA 1FYVA 4E2WA 4BV8A 2ZJ0A 3SXJA 1CY8A 1KEKA 2OGTA 4F21A 2JBAB 4CU5A 4GVPA 1Y3IA 2W2QA 3LPLA 2X0JA 3AT1A 4LHVA 1V1MA 3BE5A 2EATA 3C41J 2GRAA 1YU9A 3E35A 4WWHA 3IPLA 4WN9A 1F7UA 4YRNA 3NOOA 3FCOA 2VYND 1EG2A 3IIIA 3HZRA 3D8UA 1GUDA 3E0QA 1M2KA 3DVQX 5IYZF 2CDAA 1GCOA 4A82A 4FEYA 4BMOB 3VGJA 4D0LB 5J2UF 3SHOA 2VOJA 5EJIA 3W2HA 3LUAA 5BXQC 1K98A 1P1HA 4UHHA 3DFKA 3EJ6A 4HRYA 3SC6A 1GPKA 2H1IA 1GAQA 3O1LA 3YASA 2PMEA 4JELA 5EWLA 3FZNA 4JENA 1QQ7A 5AW2A 4Z3OA 4GRIA 2NQTA 3S40A 1R0SA 3MLEA 2AA3A 2ECPA 3WV5A 4HWOA 5TGZA 3TBFA 2OORA 2OAQ1 4G1UC 2DY1A 1OAOA 1FYEA 3KR9A 3VU9A 1A2BA 1TO2E 3W7VA 1VKOA 2A1TR 3TUZC 5COBA 1IQPA 1NF9A 1X1RA 2OC9A 3KTFA 3OICA 4RKEA 1AUXA 4JFRA 1U2ZA 2WICA 3FH0A 1IEXA 4XB2A 5AWFC 1P2TA 3JW8A 3VZBA 1SBZA 1J24A 1VPDA 1YZVA 3P27A 4TXHA 4QBFA 3EEQA 5E1OA 3RC1A 4JOCA 3T15A 2PXXA 3DMGA 3OU7A 3GFFA 2ZBDA 4WXYB 4YV1A 2ZBRA 3A9VA 4FFBB 3HWRA 2ZT6A 1B2LA 5JD4A 3DXYA 1SOVA 2AJCA 5IWAB 2HZBA 4BCCA 3V55A 3AWDA 4EPRA 3MUOA 5KYUB 2D4HA 5AI0A 4QODA 1RQXA 2XE6A 4YRTA 3PD1A 2GGSA 5CFOA 4ZZ3A 1M6EX 4ZT3A 3IO5A 5FTLA 3OZBA 3ROXA 2ID8A 4KWIA 5B3AA 1AKWA 1NJFA 2YVLA 5LU8A 5IX8A 4ISCA 3ZCVA 1SGWA 2VSOA 5JDIA 2JFQA 2WFAA 1UDCA 1SWVA 3GI1A 4ZHQA 4NMLA 4FFOA 1SC9A 1FDTA 3IMKA 3AH8A 5EXPA 4E03A 5IVIA 3W8DA 1F0KA 3PITA 5B12A 4LECA 2ZRFA 5DNEA 3AUSA 5DU2A 3QH4A 4A0RA 1UQRA 2D0IA 3WFJA 5SY6A 4AJIA 2XWBF 3IERA 3NIFB 4TYQA 3HP4A 1ATIA 1VL6A 2ZQYA 1FY2A 1QCDA 3GFOA 2PQ6A 5CEFA 1A8QA 4RJIA 5BNFA 5HFNA 2R8EA 2OYSA 4US0R 3F67A 2JIDA 1TDJA 3OTWA 1Q6YA 5KI6A 5J5VA 2IYQA 1VDZA 3ODPA 4N82A 3HM2A 4Q3BA 3ZCSA 3TTUA 4CNBA 3MWLA 2IYYA 5HE9A 1OX5A 4D0GA 1IVNA 1DAOA 2C57A 2GVZC 3ZE0B 4BFXA 5CB8A 1DSSG 4CUJA 3K0KA 4J16C 5HK8A 4WBNA 2RGUA 3E9MA 4IJVA 4LDQA 4ZPXA 3FUWA 4BIIA 3JQQA 4LJAA 3AEUA 5THQA 5HZHA 5HBGA 4JR1A 3ED1A 3CFYA 3P9PA 4ONEA 3AIKA 4DXAA 2EU8A 3NDJA 4EA7A 3SHWA 4KXQA 2W90A 3GJTA 3EZ7A 3SZUA 1LFAA 5FAKA 4EF6A 2IVFA 4P08A 4LZOA 2YJ4A 3B89A 4RSRA 4TVBA 5EJGA 2B30A 5AOAA 2VNKA 4PYQA 4Y2TA 121PA 1HDGO 1RZUA 2OWDA 4WVLA 2BKEA 1KDZA 4JZKA 4WASA 4CIVA 1UBKS 3GA0A 1NATA 2VNHA 2YOFA 3INTA 1FFGA 3B9PA 3OZSA 1PWYE 4LYAA 2FQYA 4XASA 2ZYDA 2C8JA 2FUG1 1U2GA 3KAPA 1B8PA 5K6AA 1BKYA 3MXTA 4XD2A 2CK3A 1X7YB 3R3UA 4ZI7B 3KQPA 1L3CA 3BICA 2APJA 1P0FA 2IQ5A 2OHGA 5JQWA 2GAJA 2I2BA 5A9RA 2KBFA 2XCUA 1Y9EA 3HN7A 1QTQA 3ADKA 4NECA 3PG5A 5KMGA 1BEEA 1GQOA 1L5RA 1U4NA 2QT9A 2C4VA 4FNOA 4II3A 2WIJA 2IWRA 1CZLA 1Y3FE 2N47A 5JJKA 1PR4A 4YRFA 4TLMB 1KYZA 1V3QE 2H1FA 2WPDD 4V0RA 1OYYA 1GTG1 1J20A 3UCFA 5I51A 3AHFA 3H9QA 3ZWNA 1PJQA 3HSKA 4DSTA 4JB0A 3EH1A 1QP7A 2K6GA 1OE0A 3ZWDA 1BVRA 4C5BA 1EVJA 3TPZA 2TRSB 2PUAA 3NJ4A 5EJ8A 3ZD6A 3FIJA 1Q0UA 2QP3A 3WZ2A 4MQLA 1NG1A 2H7YA 2V8OA 5DTIA 5F12A 3TXXA 2BMVA 4NEQA 3UYKA 4B6OA 1AKTA 5JPDA 4YJFA 3UH1A 4F93B 3CGWA 3NDRA 2PJDA 3KQUA 3I2KA 3WBBA 2ZTLA 4RQAA 4Q21A 5BOVA 3GGOA 5HQ3B 2QUHA 3G79A 3L6OO 4N0QA 2BI8A 2HF2A 2PFGA 2DKFA 3OEWA 4PTZA 1XQ1A 2D59A 2MYTA 4S1TA 1WY5A 1IG3A 1L2TA 5JPIA 4B43A 5A3JA 5IT9A 3FCAA 3JQ8B 5EZYF 5D3KA 3HKEA 1OGYA 1RRPA 1VHTA 4X1IB 4RELA 2ZJ7A 3V1LA 1EIWA 1YKGA 2BI4A 2PRJA 1PNTA 3WRWA 1BS9A 4R1QA 5EJ7A 3CR7A 4RE5A 3TB6A 5GVSA 1HQKA 2E1RA 1I6KA 3RVSA 2OHVA 1QF9A 5BQ3A 2WFMA 5KQMA 3TTWA 3KUUA 4PU0A 1TZJA 4UCXA 1N2GA 2CMGA 5ERXA 2DPXA 4FQ8A 4KXXA 1TYEB 2FW9A 2UVQA 3H75A 2ZYHA 5IJWA 2LE0A 5CT8A 4H3VA 1DX6A 4L3WA 3CSUA 1DAIA 1JALA 4B44A 4H4EA 2MMCA 1M6WA 1JLLB 1Y7TA 2HBYA 3QE3A 2JJMA 4GSLA 1YR8A 5KSPA 2XNKA 4GICA 4EYKA 4QO8A 4ZAZA 4N12A 1QP4A 4E5NA 5EE3A 4DLBA 2PMKA 1T1IA 1AKUA 3TW4A 2PKQO 5HGXA 1N0HA 4RH1A 4M6WA 4AVYA 3CLRD 2NZ2A 1HQYE 5TF0A 4URYR 3ZNQA 1U8FO 3HYSA 1LRLA 4LOJA 4BC0A 2F8SA 5JSKA 2DHDA 3DLIA 4IZOA 1B00A 3QE4A 1RHUA 1BFKA 3EDOA 1LBSA 2VDWA 2MJLA 4OLBA 3TQIA 2ZQ5A 5GGYA 1NVFA 2GUWA 5AM4A 5T4EA 4YRAA 5DEOA 2JI9A 5L3QB 2G67A 5J2UB 3GF4A 1N8KA 3NNDA 1DC6A 2UZIR 2YWEA 3UUEA 2FN8A 3W1VA 1ZSYA 2CYAA 2LTAA 4MRAA 4AX8A 5CEEA 1PK9A 5KYWB 2N1BA 2ZRIA 1ZN2A 2PZLA 3IUJA 5LB2A 3F6CA 3G89A 3KQQA 3MCVA 4Q3KA 5BUQA 3SN6A 4BGDA 1A1VA 1IHXA 4FLFA 2Z9BA 3PUHA 3NWEA 4MYSA 4WADA 1DBVO 1SKYB 4XLTA 1NIPA 4UTNA 5AJYA 1E5DA 3KQWA 5B1YA 3PC3A 1LQ2A 1O8CA 1JSLA 5TJ9A 4PSVA 5LZ4A 2HB6A 4IDCA 4W8HA 1I2MA 1TVEA 4BASA 3KYBA 1DARA 5KIAA 1Y81A 1IN8A 3A2NA 3RC7A 4N01A 2GILA 4A0GA 2IOHA 4BP1A 1Q0HA 4CIBA 3BHMA 4K9DA 2C7QA 1TO6A 3A04A 2AGVA 1RAHA 2HWWA 4L02A 4CEJA 3KAQA 4HNGA 3QVUA 1JFRA 2QNBA 3K0FB 5J5AA 1XP5A 4OKNA 4PPNA 5DLYA 5I9LA 1F48A 1IZYA 2I8AA 2YW2A 3L1VA 3RRMA 4WOCA 4D0NA 5I9NA 3EZ6A 4QTUB 1XCLA 2ATVA 2G71A 2WF7A 4NYJR 1KDTA 1T5LA 4CM3A 5I7SA 4JBYA 4MKGA 5JI3E 2G82A 1DHTA 1DQYA 3I6YA 1VLHA 5K3FB 2VG8A 2NV2B 1E69A 2DR0A 3VVBA 2I8CA 3KU4A 2RI6A 2HIGA 4WLUA 3OHMA 4ZQIA 1GY8A 4WNYA 4MWEA 3GH3A 3DLTA 3M9XA 4MEBA 5AHXA 3PX2A 3T3HA 2BEUA 3VBCA 3WY9A 3KJEA 3GNLA 4QJ3A 5KOIA 3BGOS 2NVBA 1KZ4A 1CDEA 1W1IA 1ZJYA 2P1ZA 2AXQA 2FW1A 2Q3HA 4JKOA 4Q1BA 2PT9A 5F4BA 5I9MA 4JI1B 3WNQA 2R86A 1Y5LA 1SCJA 3GGGA 1JB9A 4FI3C 4J9VA 2B9EA 3DAHA 4F9EA 1KYQA 3PXXA 1GCUA 2I3AA 5KS2A 1EWYA 2JGKA 1U65A 3PPYA 4NOLA 2WYOA 2E89A 3B1FA 3CZ5A 4JP8A 4RL6A 4ZVVA 3FTNA 2EFDB 2O8FA 1I7NA 3TQCA 2NYVA 4OXYA 1HY3A 1K7CA 2GDZA 1U8CB 3H7IA 2FTKE 1NFFA 3OZAA 5ITZB 1MT0A 1KK0A 2Z30A 4WK0B 3L41A 3LXRA 3SEAA 2P11A 4BBPA 5F9HA 3S2SA 1E9AA 5HNKA 1K75A 3U7HB 1WP4A 1Y34E 4FONA 4QUDA 2JEYA 1K63A 4GXNA 5DYGA 3MERA 1RXVA 3LM8A 2WU1A 2XDQB 1XYGA 2VJBA 3GT0A 2Y0CA 3LQQA 2HYIC 1IHOA 1Z2EA 3PXAA 2Y8EA 5HF9A 4EY7A 1P91A 1T2FA 1KYTA 1XDGA 1Z0ZA 2P1RA 4Y2UA 3BAZA 2AD5A 1S5PA 1BE8A 1GQFA 2QLMA 3H3JA 3I09A 3OQIB 5CRIA 5F1KA 5YASA 5DI9A 2F00A 4KXFB 1ZCFA 4OF4A 2G06A 2DXIA 3A6DA 4U7FA 2QVLA 3AHGA 2D1YA 3EVTA 3C3YA 3PXEA 4IF4A 4F38A 3AVYA 1KRXA 3VR6A 1DJNA 3P20A 2OFOA 2Z6VA 4LJLA 4TL9A 4A6PA 4E3WA 4I4LA 3RFTA 4XTRA 2P68A 2V6BA 1Q1EA 2WFZA 2WYVA 3O26A 1LDMA 3G8DA 5G40A 3P9SA 1QO0D 1JWAB 1Z6AA 2HIMA 4MROA 4W5RA 5TR9A 2W4QA 3C7CB 1TC1A 4HVTA 1A5BB 1NVXQ 1CW2B 3QVWA 4A8JA 4D9BA 2Z6UA 1P81A 1XNHA 4BQFA 1A5ZA 1PX0A 4QJ4A 3QUSA 4HWTA 4WLVA 4JUFA 2WINI 4AYXA 4X3OA 3OZ7A 1THGA 1KQOA 2P4UA 2B8NA 4K9OA 4AMVA 2AN9A 2GI4A 3C6XA 4Z4GA 3DE2X 3T5BA 2A4KA 3MXOA 3CF6R 3ZGYA 1SCNE 2GPYA 4FBMA 4FTWA 4NK5A 4DLZA 6NULA 2FLKA 1C8VB 5U4QA 1Y1PA 3O4JA 1RC0A 1KZ1A 5EUMA 4E13A 5BUCA 1U8ZA 4MQEA 5IJ0A 1Z6ZA 5D51S 4R31A 2GN8A 1E1RA 3R3VA 3DDUA 5FTMA 4HTFB 2M32A 3NNSA 5GADl 1EGHA 4HX5A 1KHHA 1EVEA 3ZCQA 1PK8A 5CAEA 5IPFA 4CTJA 4UPEA 1WHTB 3LRPA 4C1BA 1S3IA 3HPQA 4B6JA 2Q0HA 1DI0A 4M0UA 5CLQA 3TR6A 2O8FB 2JLBA 1XE3A 3DC7A 3PHJA 2W6JD 3P0EA 5EQFA 5LQCA 4ND5A 2I76A 2RHOA 4TKVA 1X80A 1DV1A 1KORA 3AF6A 3CNEA 1V1MB 4J9UE 2XHEA 2YVAA 1RS0A 4DDKA 4JYAB 1RI5A 1TJ5A 2XSZA 1RKXA 2R1VA 2ZYUX 3C24A 4N5NA 4TMVA 2VK1A 4TYPA 4YVFA 3WK6A 3EVCA 1GILA 5ALLA 2YJNA 2ZJAA 3K32A 1GG9A 1MJNA 1MX1A 3QZUA 4QO7A 4B3HA 5AFSA 1J1UA 3HVIA 1I1NA 5DSZA 2VH5R 1ODJA 3OT5A 1Y3BE 5FP0A 4NH0A 4YLEA 1MNAA 3KE8A 4R2WA 1P7YA 3IB3A 4FOOA 1KMNA 1ZMTA 1JE0A 1E1YA 4IDNA 3ETJA 4DIBA 4F7WA 3TGPA 4Q7QA 1MENA 1K5PA 4RHXA 4WNAA 5HVNA 5HIJA 3EZNA 3LHKA 1YH3A 3DMYA 5JQGA 4OI4A 3INYA 1JT9A 5TMDA 3KSRA 4NZPA 2XUZA 4UE3S 5EJFA 1WZEA 2VUTA 1NZFA 1XEWY 3RS0A 4CM9A 3VJMA 4ZYLA 4KQCA 4TWAA 4PZEA 3BD8A 4PNEA 5JSFA 4FHCA 3IL2A 5E9JA 2DTEA 3DPIA 4EGSA 1JV2B 1UOPA 5D7BA 4DCUA 1PS8A 5BSFA 4FYWA 3H5TA 3IVXA 3KS9A 4X60A 4D3DA 2BUCA 1RABA 4ESEA 1B6TA 4OBXA 1MEOA 2YC2C 3PGKA 2FSIA 4ALLA 5AH0A 2GM9A 3UJNA 3MT8A 4WZAE 1H6CA 3RSOA 5IHXA 5C80A 1D9ZA 1XDSA 2IZ0A 4K3VA 3CO5A 4QT0A 5TQ0B 3VOAA 3EPJA 4G5GA 4KV7A 4M0PA 2YFKA 2I3GA 1U81A 4B83A 3RYCA 3D1LA 2ZBUA 1U7XA 3I53A 3W2GA 1E1RD 3CT4A 4KWTA 1E2MA 5K6TA 5I7UA 5FTWA 3LGXA 2YNMD 2YDXA 3Q85A 3L1IA 4AG6A 3DXZA 2OD7A 5JAPA 4P6VF 3L46A 5JSQA 1KQFA 3QEKA 1HR0B 1Y48E 3MIZA 3LQKA 1K08A 2YN4A 1QO0A 3KJNA 2NNWB 2H5EA 4HGQA 4JQZA 4U7WA 4ZCQA 3SMQA 2ORYA 1JKJA 1N4DA 3C5CA 1P8AA 3LZCA 2CE7A 3DNPA 3KKMA 4M36A 3WWOA 4F5YA 2O50A 2BTQA 3WAKA 3TIFA 1JTEA 1SBHA 2FWJA 3A36A 3NS7A 4WLNA 5HUQA 3AHJA 3M6UA 4JI8B 2CV2A 8MHTA 1AX9A 5D2CA 3ZHSA 2OHIA 5C8VA 1GHTA 4JKYA 2CBZA 3U4IA 1BVYF 2BUBA 3LDGA 4TPKA 4MDFA 3AUTA 2IODA 2WWHA 1MRZA 1TAQA 1EFCA 4IFBA 4IHJA 2OSVA 3HGQA 3MMZA 2XBMA 3QLUC 4F85A 1XTJA 1DCTA 1PN3A 3M5PA 1M0SA 1B2RA 1OU0A 2ZUFA 1V8DA 3RTGA 3B3GA 4MS1A 2XCSB 5LQAA 3GP8A 2F7SA 4CG1A 1K9SA 1Q7EA 3MJSA 1D5CA 5DBGA 2ZE7A 2OEPA 3HEBA 3PVCA 2JCSA 3ANNA 5DDIP 4ENRA 1EHCA 1OX6A 2QM7A 3BCRA 4BMXA 2XMSA 2OCPA 5BOSA 1J25A 4CIXA 4ETIA 3D43A 5CM2Z 2CFCA 5JJCA 4R68A 4JXXA 4KO1S 1EK1A 2E21A 1NW7A 2DBVO 2JCGA 3R5KA 3ZU3A 2C94A 3MCAA 4AZSA 3BCSA 3BSFA 4RU1A 2WT4A