1YB6A

Hydroxynitrile lyase from hevea brasiliensis in complex with mandelonitrile
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
256
structure length
256
Chain Sequence
b'AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-acetone-cyanohydrin lyase
publication title Structural determinants of the enantioselectivity of the hydroxynitrile lyase from Hevea brasiliensis
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lyase
total genus 104
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2004-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yb6A00
3WK8A 1UZAA 4GW3A 2XMSA 5DYWA 1UKBA 4LHEA 4BB0A 3TRDA 4YX9A 4QDUA 3AIOA 4PSDA 5AIBA 3PICA 1XRNA 5FP0A 4ARBA 2QVBA 3DYIA 3EF3A 3WZMA 4F5ZA 2Y6UA 1KU6A 1TAHA 4ROTA 4EA6A 2JF0A 3QPDA 4HAIA 5ALTA 5BWBA 4B80A 5DYTA 4N8SA 1U4NA 2G5PA 5FPPA 1RYYA 3O9MA 1XQWA 1MAAA 4Y2XA 4Y7DA 1LPAB 4C87A 2JGEA 3R41A 1ACJA 3IA2A 2PSHA 2WIKA 4WDRA 1JJFA 5D3ZA 4KR0A 2D5LA 1IUPA 3PDCA 2PPLA 4X94A 4B7ZA 5A2GA 3I2HA 3R40A 4W9RA 3WKCA 3WKEA 4U2EA 4Y2JA 2PKYX 1U65A 5HK8A 4OB7A 2HA7A 3R3ZA 2B9VA 2B20A 4C4YA 4UHCA 4B84A 5JAOA 2XMBA 2XUHA 5K3BA 4J0HA 1A8UA 1EA5A 3MUNA 5CH8A 4HS9A 4BVKA 4LXHA 1A7UA 3I1IA 4KE8A 5ALJA 3AZPA 3WK5A 2PM8A 1I6WA 1ZI9A 3QPCA 5LZ9A 1JMKC 4NMWA 3H2GA 3PUHA 1H2ZA 2WIFA 1G66A 2JGIA 3STUA 3ILSA 4JUIA 1ODTC 1Q0ZA 4J0CA 1GPNA 3C70A 5LLSA 2HA4A 3FCYA 4DLNA 4BCBA 1T2NA 2HA5A 1UK9A 4KAFA 1AQLA 1YAJA 1E3QA 3GELA 3LLCA 3AZOA 1LBTA 1Q83A 1XQVA 4UUQA 3G0GA 3ED1A 4AMZA 1UKAA 2QKYA 4CFSA 3IULA 4GECA 4EB0A 1MTZA 3DJYA 2W22A 2RI6A 1CRLA 2PSJA 3DOIA 4X85A 5JZBA 5ALSA 1U8EA 3NUZA 1XRMA 1BRTA 2QUBA 1VJ5A 3VDXA 1ZI8A 4ARAA 2XUIA 5DWDA 1TQHA 1CPYA 1ZJ5A 4UHBA 5ALDA 3ZI7A 4E14A 5KBYA 1J06A 3I6MA 4DSZA 5AH0A 4X3CA 4K2AA 4GEGA 1QE3A 1R1DA 2VAXA 5JD6A 3G02A 1IUNA 2AJLI 3KWJA 1XZGA 4BVLA 1C7IA 1O6GA 5KWIA 3OM8A 1QTRA 3WK9A 1ZJ4A 2FUKA 1ORVA 4BDTA 3D2CA 4C6HA 2ZJ7A 3G9TA 4LKOA 1VLQA 1E5TA 4G8BA 4M0EA 1OCEA 3W06A 5BV7A 4C4ZA 5D3KA 2CMFA 2I03A 1UWCA 3K9BA 3UUEA 4Y2SA 4BE4A 5AK5A 1OXMA 4J3JA 3HZOA 2VJBA 1CUEA 4ZV7A 5D6OA 5IVIA 4QLOA 4FNGA 4B9EA 3O0DA 5H3HA 3R3XA 1JJBA 3DD5A 2JGLA 3DLTA 1ACLA 1QOZA 1FFCA 1JMYA 2ZSHA 1ISPA 3TJMA 1FFEA 4L3WA 4PF1A 3EQ9A 4UBJA 4RGYA 3ZWQA 1QIMA 3STTA 4F0JA 2H9YA 2QS9A 3R3WA 3A70A 3DOHA 4UBIA 5HF9A 2BFNA 4EHBA 1LNSA 1ZICA 1ZOIA 2C5FA 2VJAA 2GYWA 1XQXA 3WWOA 4X6XA 3SWWA 1N8SA 1MX1A 1EK1A 1CUHA 5DNVA 4K6KA 2WFLA 1NX9A 5AM1A 1OILA 1QIGA 2XE4A 5AKJA 1CUBA 4X00A 2PBLA 2OQIA 4TPKA 3WK6A 4FTWA 3S2ZA 3V1KA 1ORWA 2WFMA 3D59A 4GI1A 2OAEA 2VAVA 5ALMA 5FOQA 4UHEA 5JANA 4W1QA 3C6ZA 5CT6A 4I3FA 5ALYA 2ACKA 3R0VA 1VA5A 4ZGBA 2OCKA 4QEKA 2XUKA 3N0TA 1T4MA 1F6WA 5AM3A 3HACA 4WJLA 4J7AA 1A88A 3JW8A 4MQMA 2XLCA 1WPRA 3H18A 5K3AA 2WG0A 4QWWA 4LYEA 5CT4A 4AXBA 3HC7A 1W6RA 2CJPA 3WQHA 5LP1A 2VJCA 5IVKA 2WHPB 2B61A 4MYSA 1YR2A 2AJCA 1VKHA 3QBJA 4PW0A 1ZGCA 2O2GA 3WYDA 5DNUA 4Z49A 3NOXA 4C01A 2OGTA 4X95A 5EFZA 1W75A 2Z3WA 5CRIA 3FSGA 3WWPA 3G9UA 1J2EA 3LP5A 4OU4A 5JAPA 1EVEA 3IVMA 1THTA 3KOOA 2BKLA 3C8HA 1B6GA 4DNPA 1X2BA 5AKYA 1DQYA 1XZEA 2G5TA 3W9UA 4B85A 2DR0A 2QOEA 2JEYA 3SK0A 3ANTA 3KWFA 1H2YA 3PI6A 1EVQA 4XIIA 2BAGA 1AURA 3OG9A 5AI6A 4H7HA 3DL7A 5HCUA 1EDDA 4ZWNA 3QMVA 4GLBA 4FLFA 2WG1A 5AM0A 4BC1A 4G8CA 4PQEA 5IVDA 5A71A 3W05A 4XWGA 3VKFA 5YASA 1CUYA 1UOQA 4HRXA 2X8BA 4WFIA 4JNCA 4E15A 5HKAA 5ALQA 1J07A 3GUUA 3PUIA 4B0OA 4EBBA 5AKEA 3HSSA 1GQSA 5AOBA 2OAGA 4BYMA 2QUAA 4NS4A 2NW6A 3OURA 5CMLA 3FYTA 3DL4A 5HQ3A 1CUVA 2YYSA 2HADA 1WCYA 3KSRA 4G9EA 4X6YA 1QJ4A 3NGMA 3STWA 4A16A 3WL6A 3QVMA 1QIDA 1GZ7A 1CQWA 1UK8A 1XKLA 1XQYA 4H35A 5IH7A 5AHXA 3HABA 5ALZA 3IUNA 2BJHA 4XX1A 2O2HA 4MEAA 2FJPA 1L7RA 2OG1A 4KEAA 3B5EA 4YPVA 4K6HA 3IUJA 3G0DA 3QITA 4UBMA 3O4GA 1R3DA 3G9XA 4J0IA 2WILA 4BCCA 4CIAA 3VXKA 4KRXA 4FKBA 5BOVA 3BDIA 2OCLA 5FUMA 3D3NA 3Q8WA 1C7JA 2IITA 4BBZA 4P93A 1XLUA 1BEEA 4FFWA 1XZAA 2XUDA 3FYUC 1XZDA 1Z68A 4X97A 3V48A 3PFBA 5JASA 2Q0XA 4MEBA 5JATA 2V98A 1UKCA 1GGVA 1SOMA 2XQIA 1E8MA 1AUOA 2H1IA 3FLEA 1H2XA 4KAJA 2JGFA 3IUQA 3M83A 3C5WP 5SYMA 1F8UA 2ROQA 5T4EA 1Y7HA 2GBFA 3GFFA 4C4XA 1TIBA 1MN6A 2DHDA 4OYYA 1EDBA 3H1AA 1F0NA 4B82A 2EDAA 3ESBA 1WOMA 1CIJA 1ETHA 2JGMA 2XMZA 4F60A 2CKMA 1BN6A 4UFPA 1FSSA 2H7XA 1AZWA 2GYVA 4Q3KA 3AIKA 1J1IA 4L0CA 1QLWA 3VJLA 3O95A 2ONCA 3QH4A 3G7NA 5DTJA 4WFKA 1DWPA 2H7CA 3WYNA 1JT2A 1F0PA 1SCKA 4IH9A 4JEIA 5KWJA 1EX9A 4Y2PA 4BRSA 5E2IA 1DWQA 2ZJFA 2WJ6A 1CVLA 2WHRA 5ALPA 4LXGA 4QDXA 1RP1A 2ZYIA 5EIEA 5AKLA 3JYHA 4DYHA 4MWSA 3STVA 4OUKX 2ES4A 3H19A 1DINA 4BAZA 4AX4A 4MQLA 3BWXA 4H7EA 5EIAA 2WTMA 1MU0A 3VVMA 3L1HA 2PUJA 4WY5A 4OYLA 2WU4A 4ZXFA 1NU8A 3G8YA 1BS9A 4H77A 1XRRA 3BF7A 4IH1A 4N5HX 4Y2QA 3PFCA 5CH3A 1JU4A 2HFJA 4G9GA 3U0VA 4BVJA 2DQYA 3WKAA 2WUDA 4H7IA 2LIPA 4S0XA 2WFZA 1ZD2P 4H7DA 4HXGA 1VOTA 3E0XA 3WWDA 1WPXA 3HYSA 5JADA 4QWMA 2XMQA 1FJ2A 2AJDA 3ESDA 1CUCA 5SYNA 4B9AA 1LPSA 3A2LA 3V9AA 4MJ3A 4Y2TA 4CIBA 1Y37A 3DQZA 1L7AA 2WHPA 2EEPA 4HZGA 4TVKA 4F21A 2BCEA 4J0JA 3CCBA 3IUMA 5FDFA 5F4ZA 1K6EA 3WKBA 3RM3A 2GZRA 4BP9A 2C58A 2PSDA 1EXWA 3DCNA 4Y2YA 5A62A 3WLAA 5D7BA 1PJAA 3S8YA 3QMMA 5E4JA 2HA2A 2Z5GA 3DS8A 2O7VA 3H2JA 3L1JA 3IIIA 2V9ZA 5JAHA 3HLKA 3WWCA 2XLBA 4UFOA 2OLEA 4KRYA 2RAUA 1CUJA 1YASA 4PNZA 1TCBA 1DT3A 3X3HA 4Q3LA 4G8DA 4AZ3A 2ACEA 4Q82A 1QIJA 4BE9A 2Z3ZA 5A6VA 1PFQA 4PV7A 3C6YA 5AKHA 1JU3A 4L9AA 1GQRA 4DTCA 3KDAA 1D07A 5CW2A 4ZV9A 3WA6A 4JYMA 1E66A 5LKAA 3BL8A 2QXTA 3N2ZB 4PSUA 2C4HA 3WL7A 3IURA 4N8DA 2HA6A 1TK3A 2BGRA 2ECFA 3WK4A 2WKWA 2RHTA 4A23A 4U2DA 4OPMA 3BXPA 3C87A 1CUDA 3AJAA 1XLWA 4UHHA 1W52X 3VJMA 4WCVA 5EHQA 1QTIA 2X76A 4RE5A 5CTAA 4QNNA 2WUGA 5AOAA 3DDUA 4DNFA 2Z8ZA 3D2BA 4QZVA 4YK7A 3WJ1A 5A7FA 4GBGA 2XB6A 1WM1A 2QXUA 3PE6A 5K3FB 3FYUB 3GA7A 3QMWA 2WIJA 1WHTA 1QIKA 1XZKA 1MNAA 2OCGA 4G1FA 2XQKA 4QA9A 4MYDA 3LIPA 3AFIA 4KAAA 2XUGA 1SCQA 2OCIA 1ZIYA 4G4GA 2WIDA 3C6BA 2DFPA 3A2MA 5AIAA 2K2QB 4FBMA 1KU0A 1LZKA 3LS2A 3LCRA 2HU7A 2GBGA 3OTQA 5FKJA 2WHQA 5JZSA 4H7JA 2OQVA 5CT9A 2IX9A 4RPCA 4C89A 3BJMA 3KXPA 2XMDA 4FHZA 4AO8A 4FOLA 2HHAA 3G9ZA 1O6FA 4OB8A 2Z8XA 3ZLUA 1ZGBA 2I3DA 4GWLA 2QTBA 3DYVA 1BROA 1YB7A 1EB8A 1CV2A 1MNQA 4WY8A 1YAHA 1XZBA 4UPDA 3ICVA 5AJHA 3STXA 1CEXA 1PV1A 2I78A 5FLKA 5JIBA 3MUOA 1QIFA 1IUOA 4P92A 5HF5A 1FFDA 4HVTA 3Q0TA 4AB1A 1A8SA 4W1SA 3AUKA 5ESRA 3F96A 4TGLA 2WSLA 2QRUA 4ZRDA 3H17A 1E8NA 3FWHA 2XQJA 1A8QA 2HM7A 1NU6A 2OGZA 4UHDA 5HK9A 4DIUA 1UT6A 2WJ4A 1HKHA 4X92A 3OC0A 5HF8A 3WJ2A 1LGYA 3BJRA 5C8VA 5EIHA 2ZYHA 1TCCA 2WUFA 2VSQA 1AGYA 3DKRA 1W76A 3FBWA 1EK2A 4M0MA 6YASA 3HEAA 3E4DA 1VZ2A 5CBKA 4L72A 1N5MA 2OGSA 3I1YA 2AXEA 1AX9A 2QJWA 1P0IA 1HL7A 1LPMA 3ZLVA 4AMYA 1M33A 1XKTA 3G0BA 1W4LA 1L7QA 4G4JA 5ALKA 1TRHA 2VATA 1MPXA 4QDOA 2O2IA 2PSFA 1QONA 2D0DA 1Q84A 5AI0A 5ALXA 3QM1A 2VEOA 2FJ0A 2I3ZA 1XROA 2XI4A 2XMCA 5CXUA 4QDZA 1VXRA 3TGLA 1VE7A 3ZLTA 3W9BA 1C4XA 5JD4A 3OOSA 5FPQA 3CXUA 1UXOA 3I6YA 1DX6A 4X6UA 4XVCA 5JD5A 4LYDA 4J0KA 3F97A 3EBLA 3VVLA 5LZ4A 3BIWA 2C5GA 3F9CA 5I7UA 2UZ0A 3YASA 1LPBB 5IKXA 4EZIA 1XRQA 1IMJA 3DKKA 4MWTA 2HA3A 2RHWA 1K4YA 5AICA 4DGQA 4AZ0A 1YA4A 3EIOA 4I4CA 2HRRA 4WFJA 4Y9SA 3MVEA 3U1TA 3QPAA 1LBSA 3BDVA 4HXEB 4P08A 4IQ4A 5LYYA 3I2JA 5AKIA 4PSCA 2WM2A 1MT3A 5LZ5A 5C8ZA 4FNMA 1YS1X 3L1IA 3VJKA 1EINA 3GBSA 1R88A 1YS2X 2CB9A 3QYJA 1GKLA 1CUXA 4C88A 3WI7A 1JJIA 2ZYRA 1W1IA 1BEZA 3BE8A 4K5QA 1CUWA 2XQGA 5DYYA 4G4IA 4FLEA 3O4HA 1R50A 2PL5A 4IH4A 1MX9A 3EQ7A 3IB3A 1EDEA 1K63A 1WB4A 3GROA 2ZYSA 5CURA 3I6ZA 5EHZA 4KE9A 1IVYA 3D0KA 5DNWA 1RWQA 1QO7A 4UBKA 1BN7A 2RONA 2J4FA 4UBNA 7YASA 1CUSA 4BRZA 3RKSA 2PVSA 4DNQA 1YSCA 2PU7A 1YB6A 4HRYA 2XDWA 1K5PA 2HU8A 1HLGA 2J3DA 1XZFA 2XUOA 3HJUA 5EHXA 2VT7A 3WWEA 1CUIA 3ICWA 2WLSA 4LIPD 2XUQA 2Y6VA 1SFRA 4Q3OA 1VXOA 1DWOA 3JWEA 2AJBA 3AIMA 4OD0A 1BU8A 3G0IA 4BTLA 1UK6A 2RGUA 4U2GA 3ZV7A 4HTAA 4DNOA 4EY7A 5E4TA 1IZ8A 3UMJA 1LPPA 3PF8A 4BZZA 2QMQA 1CFJA 1QO9A 2ZSIA 4MXDA 1ZIXA 3WIBA 2OPHA 4EY4A 5JAUA 3F67A 1AKNA 4RNCA 2XUJA 1N5RA 1G4HA 3R3UA 3FCXA 4FDMA 5K3FA 2HDWA 1P0PA 3FYUA 4B81A 4JH0A 1N1MA 2BUAA 2WUEA 5A7GA 5AKKA 3H04A 3MGAA 3O4IA 5AK6A 2CBGA 1IZ7A 5HQ3B 5HKBA 4DMHA 5AK3A 4KACA 2H7YA 2QM0A 5ALLA 1YA8A 4X7BA 3AZQA 3RK4A 5ALWA 3E3AA 1QIEA 1EHYA 2HRQA 2JGJA 3I2KA 2XUAA 2Y2VA 3HXKA 5AKZA 3A2NA 4GHWA 2J3QA 1XRLA 3D7RA 3ZPXA 2DSNA 2C0QA 3M82A 5AM2A 1P0QA 2VJDA 5ALEA 5ALFA 1MO2A 3V1NA 1R9NA 3EQ8A 1G42A 3WL5A 4OB6A 1ZD5A 3CCCA 4BAGA 4DSAA 3I2IA 2JEZA 1XZJA 5J3JA 4H0CA 2J4CA 2O7RA 2QJRA 4BP8A 4E11A 4KJXA 1TKRA 4X71A 1DX4A 1AC5A 2WTNA 1H22A 3KD2A 1P0MA 5ALGA 1XRPA 1XZCA 2VQ6A 1LPOA 3FVRA 3RARA 4B6GA 4BCDA 1JKMA 2XMRA 1EB9A 4Y2VA 1Q0RA 3HRHA 4A5SA 4X91A 5AP9A 4BATA 3V1LA 2GBCA 2Y2UA 4G5XA 1UK7A 4J0GA 5K5EA 4CCYB 3K2IA 5CXXA 4FWBA 4EUSA 1XZLA 1VE6A 4N5IX 4DMCA 4Q1VA 2ORYA 2EDCA 5I9IA 1GT6A 3H2KA 1XLVA 1QIHA 2YH2A 5T4BA 2ZJ6A 2DHEA 1S8OA 1SCIA 2C7BA 2G4LA 4CG3A 3FLBA 1HBJA 3SC2A 4CI9A 4O08A 1THGA 1XFDA 4GXNA 5AO9A 3RLIA 2XUFA 3OPMA 5ALOA 4DM7A 5LIPA 4I19A 3H2HA 2VTVA 2RIPA 3WKDA 2WU3A 3IDAA 4XJVA 2BUCA 1CR6A 4U2FA 2AJ8A 5E4YA 3HI4A 3FNBA 2PUHA 4KE6A 4FLMA 1TCAA 3FLAA 2CZQA 3I28A 1ODCA 5LZ7A 5HZGA 3AILA 5JZ9A 1QFSA 2R11A 1BCRA 3WL8A 1CUGA 4PO3X 4KYVA 2WJ3A 2QR5A 1DU4A 5K3DA 4QE3A 4UBOA 3CN7A 4H18A 2BUBA 1CLEA 1ZD3A 3F8SA 1CUUA 4Q05A 1UOOA 2B4KA 3ESAA 4UBLA 4IO0A 3WK7A 5LKRA 5AOCA 1ZI6A 5EI5A 5ALVA 3G0CA 3E1GA 3VISA 4QLAA 1UFOA 4JYPA 4J0DA 2C0PA 2XUPA 3GZJA 1R4ZA 3H2IA 2JGKA 1JI3A 4RE6A 3WMRA 2Y1KA 2ZVDA 2VT6A 3R3VA 2GZSA 2QT9A 3M81A 5ALNA 1H2WA 1UOPA 4P9NA 5CT5A 1VA4A 3W2TA 2HL6A 2GYUA 4DMKA 3FOBA 3K6KA 5CT8A 5FXMA 5EHNA 5HFNA 1CUAA 5T4FA 4Y2UA 5ALUA 3NWOA 4UFNA 5JALA 5C7YA 3CN9A 1LZLA 4EY8A 3ESCA 1FFBA 3UUFA 4EY6A 4BAUA 2GBIA 1DTEA 4LXIA 4Q34A 1FFAA 3T4UA 5AKXA 5KREA 1QGED 5ALRA 4BDSA 1LPNA 4V2IA 2OXEA 4BZWA 5AI5A 2WG2A 3O4JA 2YASA 5C8XA 1E89A 4AN0A 1AMNA 2DQZA 2P8SA 4QDTA 4UHFA 2FX5A 3H1BA 5AK4A 5AI4A 4AN1A 3QZUA 4BTVA 5C81A 5AM4A 4FFVA 4H7FA 1HQDA 5AM5A 1R9MA 3FAKA 1HPLA 4NZZA 4INZA 3W04A 4Y2RA 5BWCA 3O9VA 4W1PA 1GKKA 2CUTA 5LZ2A 1BCSA 2PU5A 4X93A 2V96A 1WB5A 2V97A 3B12A 3H0CA 5A7HA 2DCMA 5CH5A 1XZIA 4CCWA 2WQZA 1ZD4A 3C8DA 4AO6A 4ZI5A 3D4LA 4B83A 3BF8A 1X2EA 4OU5A 1B41A 3FSGD 1BE0A 4J03A 4ZREA 2VA9A 2W6CX 1MAHA 2JBWA 4HXFB 2IIVA 4M0FA 4GDMA 4W1RA 5LZ8A 3F98A 1DT5A 1G5FA 2R8BA 3D5EA 5K3CA 2HIHA 1MJ5A 5AKGA 1E8DA 1GPLA 3C43A 3WZLA 2G63A 1VZ3A 2E3JA 4FMPA 4OCZA 3D2AA 3I2FA 1GPKA 3FVTA 1SC9A 3IBTA 3V1MA 1USWA 1H23A 2JIDA 4YASA 4ITVA 4CG1A 3M3DA 4ETWA 3I2GA 2CEKA 3PF9A 4EY5A 4W63A 2BGNA 3T52A 2HFKA 1Y7IA 2PSEA 1JFRA 1QFMA 2VF2A 5HF6A 1YCDA 1U2EA 2HA0A 4FBLA 3TEJA 1WHSA 3SX4A 4AO7A 1MX5A 3DNMA 4B0PA 3R3YA 4K6GA 2XT0A 5ALHA 4BC0A 1CUFA 4CG2A 3AINA 1DQZA 2YXPX 5I8PA 2QZPA 1X70A 5DJ5A 1CQZA 1WB6A 4NVRA 1CUZA 3C45A 4AQDA 3ANSA 5FRDA 4DMFA 1LLFA 3C5VA 4X90A 2WFLB 3STYA 3WIOA 5K3EA 2XMGA 5IVHA 3BIXA 4H7KA 3A6ZA 5FV4A 5JYCA 5AI8A 3DEAA 4KE7A 2DHCA 4N8EA 5JARA 1EH5A 4OSEA 5ALIA 5DTIA 4IHAA 2XQFA 2HU5A 1ODSA 1HDEA 1QZ3A 5AI9A 1K8QA 3WA7A 2PX6A 3P2MA 1KEZA 5EGNA 1EI9A 3C6XA 5HFAA 4U2CA 4D9JA 5DLPA 5T4HA 4E46A 1XZMA 1GXSA 2X5XA 1QIIA 1XZHA 5ISMA 4CCYA 4WDQA 2WIGA 4U2BA 3LIIA 3B3QA
chains in the Genus database with same CATH superfamily
1CJKC 4K9OA 4CTJA 1OI2A 3Q8MA 1T4GA 3RPEA 3SG0A 1XN4A 2XMSA 3E5MA 5JWHA 5DYWA 1O94A 3NTLA 1UKBA 4TUYA 1G5PA 4BB0A 3TRDA 2WJPA 1G64A 2R8ZA 4P35A 5E8RA 3D64A 1TQ4A 3TI7A 1L4HA 1ADJA 3I5AA 1WEKA 5EZYF 3THYB 3C3PA 4PSDA 2PQMA 3PICA 2R6HA 3RSLA 4BUJA 1GTZA 4BEWA 3FGOA 3LC7O 3I6QA 1NQ5A 5JC8A 1JG7A 2BBWA 2ZBRA 5FLEX 4MWOA 3RANA 3PYXA 4BO0A 4UUBA 5JR3A 4NU5A 4OXRA 1NQUA 4TSKA 4ZOBA 4HMOA 4TQGA 2UVPB 4ARBA 4X65B 5M2QA 2ZM5A 3DYIA 3EF3A 3G6WA 3I3OA 2AFRA 4NJOA 1L5FA 3A9SA 4N3NA 4GZLA 1H1LA 1NUQA 2J6HA 1FSZA 2R84A 4F5ZA 2ISQA 3TB4A 4L8YA 4OA5A 4EA6A 5CXQA 3KE9A 2JF0A 3E5HA 1BO6A 4KQEA 1RMQA 1KFEB 4B80A 1WCXA 2ZATA 1QKKA 1XTVA 1ZJYA 1B73A 2RGEA 3MA0A 4L2IB 3FH0A 4N8SA 5EESA 5I7AA 5CITA 3ICQB 5AW6A 1VI6A 1XAIA 4G89A 4IJ6A 4KPGA 2XVYA 4PCAA 1ZM2A 5FWDA 4X60A 2Z43A 3KJHA 4Y2XA 2CJFA 1LLDA 4UZSA 4C87A 2HJHA 2HCBA 3EXHB 2R2GA 3JWGA 1LDBA 1NV9A 3S27A 4D9NA 3VZCA 4DR2B 2OL4A 1NPYA 3FRJA 5K0JA 2V8BA 3IPCA 3OECA 4K40A 1TT5A 1T5TA 2HCFA 2PSHA 2DLDA 3L8ZA 2WIKA 2XTMA 3FNGA 4JASB 4MV0A 4MV5A 3EC1A 4X1YB 5KCZA 1SC1A 5HOEA 3QE2A 1OLSA 4MJXA 4F3KA 1MA3A 2VBFA 3H6KA 2PL3A 1XYGA 2O3JA 1C7QA 2V7VA 2JD1A 3JQAA 4JC0A 2EKLA 3OJ0A 4HHEA 1Z0KA 1P9WA 2VO1A 3IAS6 4AWXA 2J0SA 1F14A 2HO5A 2JJ2D 3NHYA 1U9IA 4G1UC 4G36A 4J94A 3ZI4A 4AZSA 4B7ZA 4AMVA 2PH5A 5CLIA 2R1UA 3TLXA 2O9JA 3TQRA 5K4GA 1TDJA 1Y8QB 1FFWA 1FYWA 4J91A 1CE8B 3TCKA 2GH1A 1B0AA 1LNQA 3DPUA 2GCNA 4OSPA 1V8FA 2X14A 3E9MA 3EH1A 5DSXA 1SVKA 5F4BA 5JWRA 2TMYA 3KT3A 4KIUA 4YJ3B 3UJCA 4P86A 3COPA 1JR3A 4FK8A 3RS3A 1V43A 4ZTZB 3IS3A 3KU4A 1XVAA 4PPYA 2ANCA 1U65A 1W36D 2AMFA 3V2UA 4E1BA 3F6SA 1P17A 4KO8A 1PHRA 2HA7A 2KS6A 3R3ZA 5F5LA 4JLSA 1FU8A 2FZLA 1NC3A 1RWWA 2J8ZA 1U7OA 1SC4A 1SG0A 3LM8A 5B3KA 5E3HA 4F6RA 4C4OA 4P0QB 6Q21A 3A58B 5KQGA 1M7BA 1WMFA 3CC8A 5IJXA 3U17A 3IIMA 1ZFNA 2C9ZA 3NDIA 3C48A 1U7ZA 1QAMA 4JI8B 4J0HA 1A8UA 4KIWA 3MUNA 4EW3A 1NN5A 1MEJA 3QUTA 2R96A 1EWQA 4ZQFA 4JFRA 1TYAE 4BVKA 3RSSA 3M6LA 3VR6D 1UJ4A 3DHYA 3MCWA 1Z5NA 2GXSA 4HTFA 5CNKA 1H9BA 4YNBA 5ALJA 3AZPA 2OORA 2Q3EA 2PM8A 4MAMA 2NZ2A 1ZI9A 1O8CA 1H05A 4ZFNA 3SZ3A 5LZ9A 1JMKC 2B9EA 4NMWA 1JKJB 2QTLA 1EK6A 3ZHOA 4AC9A 4EHNA 2HNKA 1L4FA 2XBLA 4CTNA 3OFND 2WIFA 1PEDA 4LPKA 4JUIA 1ODTC 2H8GA 1ZUD1 3E35A 1VDZA 3PLRA 4G0YA 4J0CA 4LKRA 2QVLA 4Z0NA 5FA6A 3PVSA 5LNK6 1GPNA 4YRQA 1XNGA 5ECGC 3M2TA 4BBAA 3GLHB 5DNEA 3G2KA 1GA6A 4F56A 2YJ6A 4WL0A 3VUFA 1D6JA 5LLTA 4YHBA 4RTNA 4NYIR 3EC2A 1TADA 3SLGA 4DLNA 3U1BA 3KYCB 2LGJA 1EVKA 3W8FA 3AW8A 4F46A 1CJBA 3K1ZA 3DP9A 1C8BA 2JK1A 3WO1A 3LG2A 1D4FA 1QHHB 1FFGA 1XJQA 5FBRB 2NYUA 2HA5A 3MWFA 1I2MA 2TECE 4R1UA 3UNXA 3WBFA 4KAFA 4QREA 3UG6A 3A7DA 4I14A 2IS1A 3ECSA 2VH1A 3GNTA 1ZRSA 3C3DA 1R6BX 5TT1A 1RAAA 3IP3A 3KNZA 1FDVA 4HJRA 3H9BA 3AKEA 4WK6A 4RNDB 1RLTA 2BYTA 1YT5A 3GELA 3LLCA 5KSOA 4NBSA 2GM4A 1AK1A 1AKUA 3R09A 3R4VA 4ACAA 3ZGZA 4KQXA 3W90A 1AZLA 2WVGA 4LNUA 1EBFA 3VHXA 1F06A 1NDQA 1XTBA 3E48A 1H93A 2B6NA 1XXLA 3NYRA 3G0GA 4K1XA 3U1VA 2Y1XA 3RVDA 2E82A 3KFVA 3H2SA 3BXEA 4P0TA 4BV2A 3IULA 5FTMA 2Z5FA 1QVAA 1S6YA 1YJBA 2HXGA 1CRLA 1U8AA 2LP4Y 3DOIA 5EMKA 2JHPA 3GHHA 1E2QA 1E32A 1NYQA 1DO0A 4ZAZA 2PZJA 3I5XA 1EFUA 3KR0A 1Z83A 2OO7A 3EUAA 5JH7B 2OZLB 3IAAA 4CXMA 3SJAA 4REMA 1E94E 1JEEA 1TVEA 1ZRHA 2OGUA 4ARAA 4Z1MD 2WU0A 4KVAA 5DWDA 4ALKA 1IBCA 3R7BA 1TQHA 2WYHA 4DCUA 1P9NA 4J2OA 3V8RA 121PA 1PT6A 2P9EA 1KO5A 3MHPA 3SMVA 4KFCA 4KLRA 2V3CC 3F8TA 5LA6F 4A6DA 4HVCA 3FCAA 3AVUA 3IE0A 4FGLA 2BHTA 3QKRA 1TZKA 1WZIA 2IHKA 1RJWA 2VH5R 4XIJA 2J9FA 2QT1A 4JEHA 4DSZA 2X5KO 2VRCD 2R751 3LO8A 2O8CB 4RF4A 2OK7A 2V5AA 2X7HA 2NVBA 2COUA 1SVLA 2BMDA 4TYPA 4X3CA 4OH1A 4RSRA 2DR3A 3D7SA 3PQ7A 3PFWO 2C61A 2VBCA 1QE3A 1ZHHA 3KAKA 1HDIA 4N9WA 1R1DA 3DQPA 3DP7A 3HM2A 4B35A 5KOYA 4ZMRA 1E62A 2WNSA 4C78A 1IUNA 1W5BA 4JLJA 4EHKA 2RGXA 1G3UA 1NR1A 4LFAB 2EP7A 1YCHA 3HDGA 3QF4A 1O6GA 1Y5RA 4L8LA 5JE8A 4UU7A 2AG6A 5KWIA 2JW5A 3OVMA 4KNYA 1ZJ4A 1O96B 4XWYA 1KY4A 1UDBA 3QVTA 2H1OA 4C5BA 3C2QA 4ZMBA 3QGMA 3AUUA 2YVUA 2O07A 4PLGA 4H1WA 3G9TA 1P5FA 4M0EA 3V8VA 4X44A 1NIJA 1OCEA 2FGKA 4M7WA 2QZ9A 2VQSA 5IMBA 4OJYA 4W7IA 1L5NA 4IP0A 4NNOA 4TUYF 4ER3A 4W5TA 5KYVA 4E03A 5LQKA 4RK4A 1F8GA 4HDMB 3G8BA 2YJ3A 1N4DA 3IOBA 4M8NE 1NASA 3FVVA 4YCDA 4AF6A 2F1IA 2P9YA 1XB2A 1Z0SA 3JZMA 3VR4H 4I5GA 5TVKA 2AR0A 2I03A 2O8FB 2JFZA 2CLDX 1NT4A 5E2BA 3ENKA 1E79D 3ZD7A 3ESXA 3ED5A 3GZNB 1OXMA 3ZJTA 4J3JA 3UGJA 4IMJB 3O8QB 1VG1A 3OEYA 4NCIA 1CUEA 2PTHA 2RGYA 4GX0A 5ADWA 1UPUA 4PONA 4C4TA 3D8HA 3O0DA 1S3GA 4CKBA 2QP3A 4D81A 3HKBB 3ITKA 3H4MA 1JJBA 4GICA 3RABA 2J0UA 1NBWB 4CM9A 2WTUA 4DLPA 1KORA 1JMYA 1R7RA 4QGHA 1ISPA 4G24A 3A4TA 1FFXB 4P4UA 1DC4A 2BR4A 3S99A 5EWJB 1J70A 4KMRA 4XQ0A 3P2KA 2B82A 1N8NA 3MEQA 5KNDH 4D2IA 1NJ5A 1YZQA 2QW0X 1M6WA 2QZJA 4N1AA 3ZHXA 1OR8A 3GJ8A 1B93A 2D62A 3DXFA 1PI3A 5C53B 2V7QA 1JHPA 2FPRA 4JP5A 2PMBA 4UBJA 5EPEA 2GO1A 2D7DA 1AQIA 2CMKA 3BN3A 3FNIA 3ILYA 4AM8A 1V5FA 4N0EA 1C3JA 2R7KA 2YOGA 2ZAIA 2PRIA 3STTA 4C3VA 4YMVA 4ZYYA 2QS9A 5CYPA 1XCLA 2NU6B 4B4OA 2AW5A 3A70A 3OCZA 1Y34E 4RL4A 1JGTA 1SBTA 1K88A 5G4KB 3FFTA 2ZW9A 4CDGA 4YRRA 3HYCA 4GR9A 1JQAA 4HDAA 4MR8A 4YN3A 5TX7A 1XVUA 3O4RA 3AJ8A 4TV8A 3RJMA 3OJOA 3KR1A 2WPDD 3RBXA 3VR0A 2QTAA 2AX3A 2GEFA 3EOAI 2QL9A 2VJAA 3KELA 3TN7A 1XQXA 4DLVA 1MDFA 1ZD8A 1E7SA 3QY0A 4B2IA 1CVIA 4MV6A 1Z37A 1E5DA 4BLWA 1CUHA 4EG4A 1XK6A 1T8WA 1YC5A 4E1VA 4ZI3A 3KXLA 4PSAA 3U39A 4YFVA 2O3TA 1YL7A 3P94A 1CQIA 1C0PA 1T9HA 5AM1A 5ADUS 2QU7A 5JNLA 1UFQA 1ZXBA 1F3OA 1M0SA 1QIGA 1Q6ZA 2XE4A 4PRKA 2W71A 5D85A 4M38A 1JN0A 1W88A 3GGPA 4NENB 5CIYA 2CUZA 1KYVA 1OZAA 1V26A 2H0RA 2J6CA 1G8SA 3LCUA 3RS7A 4BZPA 4D8VA 1Z63A 1T0IA 1S2NA 3PNSA 1D1TA 3WK6A 2VL7A 3N2KA 1G3RA 4QO7A 1KSGA 3V8NA 3VNBA 2ZQYA 3V1KA 1OIWA 5GOZA 3PX3A 2VT3A 2RH4A 3LT1A 4L8GA 3DWIA 1T1JA 5ALMA 2FZVA 3N7AA 1QOQB 5TE9A 3UOWA 3KZ1E 4JJ8A 5CT6A 3T5BA 3P97A 1JA1A 3KOXA 1JFLA 3P9YA 5F2EA 1XWIA 3TFQA 4E5MA 4LNAA 5GV8A 4YQEA 4Q3EA 1R5BA 1NLFA 1S2DA 1JYEA 3FETA 1VYVA 3H5AA 2ATEA 5FL7D 3MFYA 5AFSA 2WJJA 1DG9A 2RHLA 4ZQHA 4Z4QA 5AESA 4ZTBA 4MQ6A 2UU9B 3F6CA 3L49A 4Y6SA 3ZU4A 4D9KA 1T3LA 2BFAA 3BD8A 3FDJA 2G9QA 2DFDA 2DETA 1A88A 3W6UA 3BB1A 3CG4A 2OZPA 3FYDA 3QVLA 3WYBA 1RQRA 3QVSA 4MTCA 1Z2NX 3CRMA 3T3MB 1P7ZA 1AS0A 2P3SA 1IY2A 2WTEA 3CZQA 3JQFC 1R8JA 4TXMA 1FTSA 2Q9BA 2WG0A 2C3MA 3N7UA 3NHLA 4LYEA 4RLHA 3CH5A 5CT4A 3ZV6A 4F9TA 4OIFA 1GUAA 2RBKA 1AF7A 3EXG1 4XARA 2IOFA 2OO3A 3EXFB 5U1PA 821PA 3LX5A 4FNOA 3CRRA 4A2WA 2VK2A 3TW8B 5IVKA 4M9CA 1ADGA 3HDVA 1Q0QA 2YV5A 4URHA 1IAQA 3LUHA 3KAJA 3TX2A 2FQXA 4DCGA 3KSDO 1U8CB 4NH4A 2Q6TA 4XX0A 2VP2A 5ESXA 4I55A 4PW0A 5THKA 3W6NA 4RV5A 1DMSA 4S2EA 1M1XB 4OG2A 5KAPA 2DH6A 5JJ5A 5DNUA 3AIIA 3WYDA 4D3DA 4Z49A 1JH9A 4NONA 3L7LA 3NOXA 4EYKA 2WAOA 3FBTA 4HBZA 2J5XA 4YV0A 3QHPA 3R5JA 3AY6A 2HLNA 2YINC 1W75A 5EFZA 3OEWA 1OFUA 2Z3WA 1JHXA 4LF9B 1YS6A 4HEHA 2LWIA 1DEOA 5SZJA 3WWPA 3ABQB 1J2EA 1QQAA 2Q9UA 2JZNA 4CT4B 4NG5A 5JAPA 2GTPA 1EVEA 1L4YA 1CY1A 1FNMA 3KOOA 2HIMA 1J8QA 2WM3A 1JG2A 4MKGA 5F52A 3ZVLA 2LW7A 4NJMA 4XYGA 2GCIA 3AL3A 2B25A 1IRXA 5AUNB 3ILVA 5TGZA 4BIIA 2EWVA 1V95A 3IODA 5AVZA 1APBA 2OXFA 2WJVA 3ADDA 5HS6A 1TM1E 4ENSA 2O5RA 2XGOA 1PJ2A 4FI3F 4MW7A 5FD8A 1KI2A 3FLMA 5JBNA 2G5TA 1Y5MA 1T6BY 1V3TA 2B78A 2DYKA 2HZ7A 2P9TA 3FUWA 3IR5A 3W6PA 4AJ1A 4E2ZA 1XMOB 4Z1OA 2O8BB 1BJRE 2FEPA 2QOEA 3HNPA 2QL7A 4X1OA 5KTYA 1X1AA 2JEYA 2RHJA 1KY3A 3DEFA 3SK0A 4DW8A 2QGNA 2FW6A 4RD2A 1H2YA 5DB4A 5G1OA 2QGZA 1U98A 3R77A 4TKZA 4K6OA 5CLHA 1H94A 3HU2A 4PIPA 3GLQA 3OG9A 4FZJA 1YHYA 4QELA 5H83A 3V8MA 1VG8A 1T36A 4A8JA 1PNTA 1NOJA 5EQJB 2HHHB 3UK1A 1EFKA 1K6IA 1QH0A 1TJ3A 2QD1A 2FP4B 1GUZA 2HU2A 1ISJA 1GY8A 1K5DA 3B1JA 3ROTA 4HZIA 2OUKA 3W3AH 3DL7A 5HCUA 3SCZA 4F2HA 5KUTA 1ZMRA 5FT9A 1D6NA 4DLYA 2PS3A 4EMTA 4JXXA 1COWA 3AVYA 4JXJA 4HQ0A 4AROA 4D4IA 4DYDA 1GL9B 2VQFB 3OT1B 4BC1A 5F3RA 1LFAA 1HE4A 1PWZA 4LDRA 3OFKA 2D1SA 2QTVA 1NY5A 1VMEA 3DMGA 2EZTA 2P1DA 3LHFA 2FQYA 2QTMA 4GGPA 4O29A 5F7ZA 3SX0A 5YASA 1RRCA 1K0UA 1VSUA 1EFCA 1S8FA 4R2MA 1ZAYA 1U4OA 4QJ4A 4KKVA 1JUDA 1I7DA 3AR8A 3GEIA 4F3YA 4RPIA 1NT2A 4B8WA 2QDKA 3T3PB 2AWOA 4RABA 1HQYE 1YVUA 4HADA 1PL8A 1MJGA 4B0OA 4BVAA 4C6TB 2DUJA 4OEHA 2IVZA 3GFSA 5KAMA 3I8SA 4WESB 3U7QA 4A8TA 1GQSA 2ATIA 2DKOA 3BVPA 3GLIA 1I36A 1A9YA 1GVHA 2W11A 5LUAA 1GQ2A 3LW7A 1WZUA 1US8A 2QIPA 2HHCA 1FMLA 1AY0A 1WUHS 3VDRA 3CBGA 4NS4A 1FLAA 3R75A 3ZJUA 4C7OB 4DBLC 5L4LA 2ZANA 3Q40A 3QLUC 3OPYA 3HBJA 3DL4A 4FWIB 3LPAA 3ZWCA 2ODEA 4EENA 4OJQA 1JHOA 1WQ4A 3OPVA 3EZ2A 3QTTA 5HGJA 1WW3A 2G0TA 1AKYA 5C34B 2MYTA 1XAHA 2OR3A 5LP6A 4DUGA 1SBZA 5IBPA 4CIDA 4HLCA 2JFBA 4ZC1A 3QVMA 1QIDA 3FOZA 1R8XA 3H5WA 1BXKA 1GZ7A 1CQWA 3MTEA 1UK8A 3OLWA 4HEA1 3KM0A 3VX4A 4E21A 5IKMA 4DB2A 1R8QA 4HX9A 4GX1A 1P2DA 3GA5A 1X19A 3ANYB 3SBDA 4E5KA 3RO7A 2J6IA 4TRNA 3KSZO 3A04A 5AHXA 1Y6JA 1R6TA 2Z2XA 3HABA 5GPBA 4BMPB 1ECPA 4D9EA 1GEEA 2BJHA 5EPOA 3JU3A 2HAEA 1JYFA 2R0QC 1QYCA 3BCRA 3KEFA 3DTNA 1RYNA 2NU8A 5BUCA 4LMPA 3AHDA 2WAYA 2WVHA 1CVRA 2FSPA 2ANBA 2IW3A 2O0JA 1WMAA 1CSEE 3CZ9A 1Q5PA 2BBSA 2RHBA 1FNSA 3QOFA 1CETA 4KEAA 1ORTA 4K6HA 4RVCA 3UVEA 4N7MA 2I4TA 4DG9A 4YP9A 4UASA 1KAOA 3BXXA 3R3YA 5E3JA 1EFPA 1KI8A 2XB4A 3A9UA 1ZOSA 4B87A 4BX8A 4QUHA 1R6UA 1TU3A 1ZINA 2AT1A 2PFGA 1PFWA 3FB1A 3OP1A 4BCCA 3VXKA 3UHJA 1QFYA 3BAFA 3UMGA 2PZMA 4KRXA 2NUTB 2IHTA 1JKIA 3R7FA 5BOVA 4AKSA 4CM4B 4G0UA 2FPSA 3P0HA 2GF2A 1O6CA 1Y3BE 3C5HA 1XO1A 4G4SO 5EIBD 2ZIVB 3ZXIA 4R0NA 4CMJA 5FUMA 4NJEA 4NHOA 3DE7X 2XV1A 2PSSA 5JBQA 4TV8F 5TLSA 3INNA 3V8QA 1BEEA 4FFWA 3HUTA 3KTDA 2MOKA 2B1RA 2F3UA 5JCZA 2CN1A 2QRMA 3PQ8A 4R2IA 3RC7A 5JQGA 2E9SA 1NQXA 2OLKA 2NP6A 3K94A 2WDPA 3FYUC 2V1XA 2WK1A 1Z68A 3N9IA 5AJWA 7ADHA 2OKCA 3B7PA 2IWRA 3U7IA 2IOQA 2BELA 4GG1A 2AX4A 1W0KD 3ACBA 2D0OB 2WZQA 3D3WA 3FGZA 4QQ8A 1J9EA 1GT91 2BFFB 4REOA 3ETNA 5KHAA 5JATA 5B2FA 2C99A 3KR2A 3QIVA 3PKJA 1UKCA 2XSZA 2HV9A 1OI3A 1W2GA 2B35A 2QRJA 2WAXA 3GK3A 4ZQEA 5CYGA 1E8MA 2J5QA 1WDKA 1MVLA 4R5MA 3EEFA 3TNDA 4LQDA 4LXUA 4FS3A 4ZAYA 1JQKA 3FLEA 1IG0A 3Q11A 3NHRA 3UEOA 5CAEA 5K0FA 1VPWA 2BBTA 4BLPA 3SF8A 1XHFA 1YE8A 3PGLA 3JASB 4H1UA 4JGGA 4TMVA 4WECA 3EPHA 3C41J 1GA1A 4URFA 2HRCA 5AW9A 2JI6A 4DG8A 2XTZA 1E92A 1N78A 3BWCA 3OPQA 1PFVA 3N53A 2FR0A 1J8YF 5T4EA 3HGTA 3FI0A 4JQOA 4NABA 3C3EA 1QRRA 4JQCA 4BU0A 3L92A 3GFFA 3CF4A 1FLNA 5CVUA 1AT1A 5FUWA 4L7VA 5EZYB 3E9YA 1L6RA 2CL6X 1R0XA 3E9EA 3EPLA 2R7NA 1DKMA 4KU4A 4O4HA 2HSJA 5TXGA 3VPXA 4FFLA 1E2KA 2ZIWB 4URXR 4KSBA 4UEJA 4KQ9A 2OD2A 2EBHX 2R1ZA 3VYWA 1MG5A 4JYBA 1Q1NA 4RPLA 4EO4A 5AXCA 3GYGA 4NQZA 3OZTA 4B82A 4IV8A 4GQAA 1N5OX 3VX3A 3O8CA 3W1VA 4BUCA 1NONA 3UBTA 3EFOA 4NOMA 3NBQA 1E2DA 1WOMA 2NX2A 4Q12A 4ZJZA 2F62A 3NDRA 4XKJA 4G0MA 1UPAA 1ETHA 4HZUB 4EO9A 4I3HA 4BMXA 1NG1A 4C7KA 3O2SB 1OZ0A 4FM9A 3GCGA 2NO6A 4JGBA 1V3QE 1ZMTA 2ZTUA 3HXOA 2DBRA 1DG1G 4OH7A 2QY9A 4UFPA 1QK5A 1LV8A 2R5WA 1AUPA 3AW9A 2VJYA 4I55F 3C15C 3PFKA 1MOPA 1QO0A 2PNFA 3Q0IA 3Q9LA 1EFAA 2VZLA 4Q3KA 5AUOB 4DT1A 4DCJA 1FNDA 4ZZ3A 1RFLA 1O6BA 4LA4A 4C04A 3FW1A 3MGGA 5IMSA 2ZRPA 3AL2A 4YQYA 3PJGA 1FSGA 3O95A 1A7JA 2Y1EA 3SYRA 5JNVA 1EDZA 1F20A 3QH4A 4XASA 1N3IA 1J0XO 3C4VA 3G7NA 4TT3D 4YDSA 5DCWA 4ZA2A 4ECEA 3HZRA 2IV3A 4U9IS 4PBSA 3RWMB 3UC9A 4BBJA 2VP3A 1B8OA 1NF9A 2WF5A 3KPWA 3LT5A 4UNQA 2ZIFA 5D84A 5KOIA 1A9XA 2NN3C 5H16A 2P0AA 2H7CA 3OEEA 2OHJA 3TLAA 3ST7A 2XITA 1TA4A 3AI3A 1DKNA 1ZNQO 3NEYA 4WZBE 4JEIA 3VC3A 3OQBA 4H4CA 5FOWA 4URWR 2DBZA 1V8BA 2ZJ0A 4UDNA 4CQMA 2QR3A 4OHPA 3C1UA 1DWQA 5KQSA 5CBPA 2RHCA 1CQJA 3IA7A 3QBVA 4PZPA 5CB4B 1Z62A 3F6PA 3NV9A 3OEHD 4BNDB 3HDTA 1C0IA 1RW4A 3TZEA 1S2LA 4DUYB 2EU8A 3HO6A 3HJTA 2ZYIA 5EIEA 4R8KA 5C1OA 4J9VA 1MO6A 3OZXA 4IG9A 5PNTA 2F43A 5FQNA 4BMSA 3H6HA 1H6DA 3JYHA 1G8JA 4DYHA 3SE0A 3U3KA 4BN5A 3TTXA 4MWSA 1KMMA 1OI7A 3S2FA 2VI5A 1GR1A 4D8TA 1MHPA 3VR4A 3RHZA 3H19A 3I0NA 1E3WA 3NCTA 5FYQA 1ZH0A 3DE1X 4ZJPA 2H4XA 4DCNA 1B0PA 5KYYB 4B3JA 3EASA 5EIAA 3TIXB 2ZQZA 2WTMA 4LGVA 1NXPA 4M46A 4AIIA 5ED4A 1DDIA 2NU7B 4GKBA 3L1HA 3ZWDA 3QSYA 1ZHOA 1U7TA 3K5IA 4WY5A 1FW8A 1U2GA 1U0LA 2PBFA 1GGKA 2XHZA 1OTXA 3EYWA 1W4ZA 1SZCA 1QVRA 1WXXA 5KHOC 1V47A 3C7TA 3WGVA 4JI6B 3BZWA 1UP4A 4MVJD 4E4TA 4KP7A 3H4IA 1SEVA 2PRSA 4H77A 1J97A 3SHTA 2FPGB 3G2LA 4ML3A 1G98A 4QOFA 4FZVA 1Y8RB 3LCMA 5HQJA 5KNDA 4N5HX 1N7GA 1P1IA 1PV4A 3HVHA 4IINA 2Z8YM 2JLXA 3L8DA 2DQKA 5CH3A 1M34A 3T7DA 3WLSA 1YMVA 2CLIB 5MN4A 4RMJA 4IZOA 2RB4A 1F0YA 4ALNA 3HUEA 2Z98A 1FCJA 1PX0A 1TLLA 3EGIA 4OQXA 3S55A 4E6PA 4MMYB 1UM9B 3PNOA 4BO7A 2OB1A 3N5KA 4Q0MA 4UHJA 3L7AA 3PC3A 3WKAA 3TEFA 1CKEA 4CTOA 3P9CA 4H7IA 4UJ5A 4EFMA 2LIPA 3LPNA 3COJA 2UZ3A 4B76A 1NPTO 2Q07A 4COOA 2VYCA 3QOXA 3PQFA 5I3CA 3PGXA 2GVZC 3Q85A 4D4GA 5LP6F 1PL6A 4WVLA 4HN4B 2C4KA 2GRAA 2PWAA 2JFGA 4Q4JB 4HPJB 3T1HB 2CJWB 4DA9A 2AA3A 3OO0A 3LPMA 1I6MA 4OMCA 1VDMA 3OETA 2H1VA 4IDHA 3GRPA 3D8BA 3ESDA 3GLVA 3TL2A 4L73A 5DGTA 4BWVA 3R3JA 1KO1A 2I1VB 4FX2A 1KY5A 3KEOA 4UAVA 3DAHA 1E4EB 2EFGA 3LY8A 4NEQA 2C00A 5SYNA 4EHFA 3LC2O 1LPSA 2I67A 3TRFA 3SVZA 4R8SA 1YJXA 1EQUA 3NJ4A 4N39A 5JPDA 4XR4A 1ULZA 1YI0A 4K9DA 1EWKA 1UEXC 1FE8A 2Q6IA 2FW7A 3O73A 3HYLA 4G5OA 3GPBA 5DHPA 1W9MA 4Y2TA 1JXQA 2FHPA 1QHYA 3KVOA 1BMDA 1JA0A 5FO1A 2JA2A 1M2VA 1T2UA 1RQ7A 5JSKA 4BMNA 4BXOA 2WHPA 5A02A 2HLDA 2YWGA 4M0UA 1YQUA 1Q19A 4HZGA 3H1TA 3LPDA 3O82A 3GUHA 5AUPB 5ESWA 3ZW9A 1H42A 1XD2A 1E2UA 2G77B 1JAYA 4HC4A 5SY9A 2BJWA 1I1QB 4J0JA 5FO0A 1NMQA 1X8KA 4UCXA 3CCBA 5DE3A 3SSAA 4C30A 1K8ZB 2NV2B 4A10A 3NS7A 1J5EB 5FDFA 4MW9A 1WV1A 5F4ZA 4OTZA 4TN5A 4LSGA 4E4YA 2VFAA 3E9DA 3QYAA 2AUTA 3DUFA 5BRJA 2CHGA 4UARA 5JQGF 3DTVD 1ZKMA 4HAXA 5F23A 4BP9A 4CYMA 4HV4A 4YT2A 4D8XA 5LMCA 1LF5A 4J3NA 3P71T 2IU0A 2H3HA 2PSDA 1EXWA 4BO4A 3L0PA 3F73A 3BWYA 5A62A 3WLAA 5D7BA 1LS1A 1H69A 5A5DA 4MUAA 2ZI5A 2H31A 3F4LA 5ES3A 2A5DA 5F3DA 1Z7YA 1DOHA 3DKPA 3KHUA 4ZI5A 1FLVA 3UV3A 4B48A 3DS8A 5CB6A 2PX4A 3H2JA 1G6Q1 2AL7A 4D3XA 4CF7A 1S7CA 1NNEA 1H0RA 1G3IA 2V9ZA 1DBSA 3HV2A 4LWOA 2BTEA 1QF7A 1IXYA 3I83A 5F64A 1PV2A 1TLTA 5A0VA 3SZUA 4UFOA 4H17A 2V7PA 3G5MA 1RVDA 1N3BA 2VNJA 5FBHA 1SKMA 4BVBA 1FJGB 3GDHA 1CUJA 5CFNA 5IDQA 2IVFA 1HV8A 1B43A 1T5SA 4H3HB 2QSJA 3BKXA 3KRTA 5A9SA 3MSXA 1G16A 2WINI 4GP9A 2IJGX 1E3LA 3PHHA 3X3HA 5EJGA 4ZTUB 3PGKA 1HDXA 2X0RA 1R12A 1AQJA 1X8JA 3T38A 5DMHA 2ACEA 3CUKA 4NIMA 5DBGA 5L3RA 3S1SA 1WO8A 4O3FA 4PS1A 3DAFA 4PNPA 1C0EA 4O4HF 1EXNA 1JJVA 4NFHA 2VRBA 3SM3A 5A6VA 3N05A 5L40A 1U6JA 2BP7B 4Z9BA 3C6YA 4EWLA 2Z1MA 1J23A 4UQLA 3AVTA 1IXZA 1XVVA 2NYVA 1JU3A 3GPLA 2CY0A 4G41A 3THXA 1GQRA 1U1IA 5DRYA 1TE2A 1OZHA 2FN8A 1UZNA 1ZEJA 2CLEB 2AB0A 1PIWA 2DWCA 3M5PA 2CF5A 4J29A 2BGIA 1PQYA 1I4DD 4OY3A 1DFIA 3KSMA 1ZIOA 3QRWA 1TZCA 3WA6A 3NDBB 2ENUA 2FA9A 4KCGA 3SC3A 3UA4A 1NRXA 5CDUA 4ZYVA 3BL8A 5GJCA 1OH8A 2QXTA 3N2ZB 2XCQA 4FVTA 3N3BC 3VR6H 2H29A 5LUBA 4IILA 1NVXQ 1II8B 2B1GA 2C77A 2ZBEA 3IURA 1MJGM 2GD1O 4KQ6A 2OEPA 5TQVA 3ESQA 2FPWA 4HUQA 2C5HA 5M04A 2BHRA 4J2HA 1UPFA 4DB4A 3TL3A 2X0IA 1TK3A 2ALJA 4IZIA 4DHWA 1Q1BA 1RPJA 3WK4A 2WKWA 4H6PA 5F1KA 1JDSA 3PPWA 5JLJA 3P32A 2OBMA 1QHFA 2VXCA 3W3AA 2XE8A 1I2ZA 4JVMA 4CF6A 1C9YA 1NVVQ 4F9GA 5FBLB 3T61A 1MRNA 4BQNA 3DBHA 1GCOA 2KW5A 4CV0A 4IDGA 3OCVA 1XLWA 4KR9A 3KYBA 2XGGA 2ZBDA 3QEOA 2QTNA 3DAYA 4RDIA 4BKOA 1L3IA 3VJMA 4CKEB 1UJMA 3DMFA 4BL5A 4YRZA 1VJRA 1XZQA 4O2RA 2SHKA 1QGUB 3JVUA 2QI9F 4DPKA 1Z8HA 3VYSB 4MDFA 1KZGB 2JIZD 5HDBB 4ZO6A 3NNDA 4ZQBA 5TMPA 2YWEA 3LCJA 1D8AA 3D2BA 3WYCA 2R97A 4CCAA 5JAZA 4MR9A 4YK7A 2FWNA 5MDHA 5HUJA 4TOIA 3ZLBA 1FRNA 3V8BA 3WJ1A 2W9XA 1OH5A 2BMWA 1I7SB 3OWXA 2DOKA 5IWCA 1WM1A 1JFVA 2QXUA 3AU8A 4OXKA 2WWIA 2YQ4A 2PJUA 5K3FB 1T1RA 3QMWA 4PQGA 3EA4A 3TTUA 2WIJA 5JECA 1TJ5A 3W0LB 3VC2A 4F4CA 3EXIA 1XZKA 3BWVA 3F3MA 3R4CA 2XQKA 4ER0A 1VKJA 2PFSA 3PSAA 1Y9EA 1RABA 1N2XA 1SA0B 2J46A 5FWNA 3RQIA 1KMIY 2PANA 4A2PA 2HUNA 2E4YA 1YQGA 5JCJD 1IG3A 2BGTA 4BMYA 4F4DA 5JWOA 1L7MA 4QPDA 5KYGA 2YYZA 2BGWA 2X7XA 1XU4A 2C4WA 1OA0A 2Q5EA 4I9NA 1UFKA 4L9SA 3BGWA 3CUWA 3GLHE 3AVPA 5G0UA 3NP7A 1PTKA 3MQFA 3ZCRA 2WW8A 3B38A 4HDKB 1BMFD 4QO8A 4KPYA 2WT4A 4DKXA 2B4QA 2JKYA 4M0KA 4OQ4A 4H16A 1V8ZA 2YNMA 1BFDA 2O8DB 5CFOA 1U2PA 2N1MA 3A2MA 3H2ZA 3PTZA 4FBMA 4PC7A 4PO8A 4WI1A 1N92A 3RRMA 1R64A 4BMZA 4DADA 5LWHA 1G18A 4B43A 2P9HA 1LZKA 3HXLA 3LS2A 1L5LA 1YUMA 1Y63A 2HU7A 1Q7CA 3LVFO 2NV0A 2J1LA 4XSVA 2YBDA 4H7JA 2C7OA 3C3BA 3GVPA 5IYZB 2QVYX 1KSHA 1MDBA 4KXYA 2OZVA 3MTJA 4KK4A 1F2TB 2VPQA 2ZS7A 2I6GA 3BJMA 1XD8A 1UDWA 3L8GA 4BX3A 4ER5A 4F93B 4FHZA 4AO8A 5MFPA 4L8VA 2B2CA 3T7RA 2HHAA 1E7RA 1SCNE 3L43A 4OB8A 5EGSA 4CGYA 1IB0A 1YNSA 3BFXA 3DTVB 5HZMA 3GP3A 2B92A 5BYBA 4EIWA 5IUNC 5CFPA 2JG3A 3GJ0A 2O1XA 4NL4H 1YR9A 3OTWA 1OFVA 2QTBA 1U3CA 3TE6A 4YMHA 1Z2AA 5IJ9B 5HE9A 1U3VA 2WYWA 3QEJA 2WB2A 1SKUA 1MNQA 4LOAA 3SPXA 1FP4A 1MGPA 2L18A 2Q4BA 3SF0A 1DKRA 3QG1A 3M8KA 4G1VA 3L04A 3SYTA 2ZB3A 3O93A 4M9RA 1Z6TA 3KK0A 4LNUB 3EULA 4ENRA 1BWQA 1RXVA 4RK1A 4JT2A 5C2JB 4NCAA 1QX3A 1CEXA 1AKQA 3ZGYA 1PV1A 4B1FA 5DTEA 2V7WA 1D2HA 5BN5A 4EATA 1IUOA 5HF5A 1JDZA 5DDIP 4ZCTA 3IVGA 4XJXA 1QOPB 5F78A 3CF2A 5HBRA 4UEKA 3H3XA 5D5QA 4U8HA 2F3RA 1GKIA 2CFSA 4YA6A 5IBRA 5ESRA 6NULA 4UQOA 4RJJA 3OY7A 2MYNA 2FN4A 3P4YA 3PDIB 4MRNA 5DHTA 3EMKA 4RA6B 4CKWA 2GAAA 4NZ9A 4NMMA 1W19A 5JY1A 3B13B 2ZCVA 3C8MA 5LIRA 2YUIA 1UKEA 4HP8A 3EPRA 1Z35A 4J6EA 1BOOA 4DVJA 5KOHA 1XZNA 4KXQA 3FMIA 4K46A 4TMZA 3T94A 5EXSA 4CM8A 1R4NB 2F3TA 4ZRDA 2MSWA 2RJOA 5B30A 3D6VA 3NV7A 2ZSBA 1EA7A 3LY7A 3H11A 4GNKA 3TTSA 3K6JA 4I1VA 2F1KA 4CM7A 2XQJA 1FDTA 2WYUA 3DB1A 4QT4A 4WFQA 1Z29A 2OGZA 3HCOA 3ITDA 1WBJB 4JJZA 1FMJA 1EJ6A 3W8DA 3DMDA 4LCJA 4AJ9A 4YRIA 2QYHA 1RXIA 3VO8A 2CHUA 2JNWA 1HKHA 1UEJA 3G5UA 4URZR 3GLGB 3X1XA 4MIYA 4NYMQ 3SC2B 2D8MA 1NLYA 2I4RA 4EX7A 1FFHA 3GZ4A 4GZ5A 1C5KA 1DWUA 1P7PA 1RYBA 1XXHB 2IIBA 2TSYB 2XJ4A 3URMA 2C84A 4DLUA 5IAJA 1AGYA 3VNSA 3DKRA 3NASA 1RRKA 4WV3A 2F9MA 4ZYUA 4MUIA 4RKYA 2Y99A 5A03A 3RAFC 2NNLD 2GZ1A 2EQ5A 2H5JA 1G4UR 6YASA 3SLKA 3WQQA 1V7CA 1O94C 4ER6A 2PYZA 4KJZA 4CR8A 3L40A 1BS1A 4YAJA 1TM2A 1NBHA 3D02A 4K88A 1P29A 4ITRC 1KFCB 2IXDA 3JTEA 3I1YA 3M4ZA 3BE4A 2GD6A 3PGVA 4HYEA 1P4JA 1ISSA 3TG8A 1FDWA 4FDVA 3PA6A 3ZOZA 1N3LA 1MZVA 1LPMA 2VYVD 5HXAA 1CP2A 5GADl 1O0BA 3GB9A 2IA5A 4AMYA 2DPLA 4FT4A 1LJUA 1M33A 2B83A 1RPNA 2GZDA 3EBPA 4N4AA 4YJFA 5BV1A 5IX8A 4JK3A 1HUQA 1W4LA 1E2JA 3BFJA 1Z5GA 2HMWA 4IW3B 4V0MA 2NXNA 1XJCA 2HH9A 2BFBA 2GNAA 1KJZA 2H1RA 4QDOA 4A7PA 1VP3A 4BWGA 3GLUA 2DSTA 1WSBA 2WJZB 3O5AA 1DEXA 1RBZA 4NCNA 2J30A 3PBKA 2Z83A 2R6DA 4KMMA 1N2IA 3QKSA 4TMFA 3RTAA 1Q0LA 4CKBB 2BPOA 1SU7A 1JLHA 2EZUA 3L0SA 3JSAA 3QX7A 4DY6A 1BMQA 1XROA 5F1OA 3IIJA 3FSRA 2AZMA 2EQAA 3KL4A 4Q3AA 2ZRMA 4Q21A 2XMCA 1ZWKA 4K9SA 1QAOA 2OYRA 3UHFA 1BXZA 4FGWA 4C6SA 1V1RA 1U2SA 1OGYA 1YXMA 2J7PD 1GKUB 5AWFC 4PR0A 3I58A 1UADA 1XDZA 2YXEA 1SOUA 4FIZA 3C24A 3EOZA 4MUNA 4OHXA 3WGUA 5H81A 2G9VA 1ZXXA 1SHLA 4HGRA 4CQLB 3AF6A 4N0PA 3CIOA 3WFIA 3HB4X 5B58C 1IM8A 3UANA 3VPAA 1Z4NA 2O2YA 1GGFA 2EFCB 5AM5A 3I0ZA 4DHEA 1UXOA 3RRZA 3BFPA 3I6YA 4YAWA 4PZLA 3UM9A 3O8NA 4JOBA 1Q3KA 1UBEA 4J0KA 3RVKA 3SDSA 1YFKA 3F97A 2X9VA 3RAEC 1U9IC 3IBSA 2A86A 1CZUA 1BW9A 1E3SA 3BIWA 1BYIA 1LJ8A 1ZK4A 2C5GA 8LDHA 1AZSC 4M9QA 3ZBQA 3T5MA 2Z2KA 2P78A 4X7PA 3QUSA 3QXJA 2H57A 2OGWA 1U8XX 1YBMA 2VIIA 2UZ0A 4NH0A 4XR9A 3YASA 5BW4A 2YW2A 3NIFB 5JPCA 3ZY6A 5KNCD 4MAAA 2LBPA 5CDFA 1XRQA 1QR2A 4KPUA 1IMJA 3CNQS 3DKKA 2RHWA 1K4YA 3CEAA 6PFKA 2K2WA 1J99A 5GQSA 4IDCA 5JOQA 1YA4A 1LUAA 4IUCS 2XZLA 1GUDA 1WL8A 1ZH4A 5FA8A 1S4QA 2R8EA 5IDVA 1OAKA 1VIYA 4FMDF 2AKAB 4WFJA 5H3LA 4IGIA 2X77A 1GTJ1 2RAPA 1JHUA 3TM4A 1YJAA 4R6WA 3RYCA 3VM6A 3KTAA 3V4PB 3G1TA 4GKVA 4TWIA 4FU0A 5THQA 4DLRA 2X0FA 4WCFB 4HXEB 3M1IA 4UOZA 4EO7A 5AKIA 3UICA 3IHTA 4PSCA 4R01A 1MT3A 1EWRA 3OQPA 3MRVA 4D99A 3NHKA 4IYRA 2O2DA 2X8WA 3FNRA 3GT3A 1TYBE 3K7EA 1P7WA 3AUFA 3K92A 1VB3A 1YK1A 1B8PA 2JGRA 2R68A 3OMLA 3F6EX 4OATA 4X1KA 3F5DA 4RD4A 4RIHA 5AJTA 4KPFC 2OORC 5KOJB 1BVUA 5BN3B 5IRCD 1T9GR 1CY7A 2E55A 1UBMS 3IELA 3P2IA 4R84A 1EINA 3EG9A 2Z3VA 3GBSA 1R88A 4UUPA 4AY4A 2V1UA 2ZYUX 4KXVA 1X80A 3RC8A 3ZCVA 2ONKA 3PI7A 1FEZA 3WTBA 1D2MA 1I7LA 2JASA 4CL8A 4B6JA 4BO5A 2IU6A 1XRSB 1WXIA 2AF4C 2GZ3A 1VRWA 3ZKAA 1LQ2A 2XAAA 3M1YA 5I9TA 3EXEB 4QFCA 4YH1A 1V4NA 1ILWA 3ZE9A 3K0CA 3PEVA 3PXXA 2FG6C 5JMOA 2PIAA 4K5QA 1YR6A 2PT9A 1WULS 3Q5DA 5GIOE 4EHAA 4ZI7B 1E9EA 3PR3A 1SH7A 2WWVD 4UTNA 1GUYA 5DYYA 1IHUA 2CNOA 2QAJA 2QIOA 1MQAA 4G4IA 3LLUA 3HK2A 3JZIA 3FMPB 4J07A 2R65A 2FG7C 4GP6A 3GRVA 4M1OA 3RAPR 4UU1A 5CR9A 4QPNA 3GJ5A 1LC0A 3F49S 5BQ5A 4ETNA 4N6NA 4Q4AA 4XX0B 3EQ7A 3WV5A 2FSUA 2AR7A 2PXHA 2WT8A 3IB3A 1AS3A 4ESOA 1XPRA 3VPDA 1EDEA 1ZBDA 1U3FA 3GROA 3FX2A 4HB2A 2I2BA 1GPWB 1KQ3A 3GW8A 3T41A 4XD2A 3WLOA 3WIEA 4EQZA 4F1JA 4YMTA 2F3QA 3FI9A 3PQ3A 2AI3A 2DUWA 5KPJA 4AUNA 5JMTA 3W2IA 2X22A 4RGVA 3VO9A 4YPOA 3DBIA 2J3MA 3E81A 1SQ0A 4LZOA 4FN5A 1JQLB 1ZIPA 4RWEA 1D3AA 3N0RA 3BT7A 3JQ8B 1EP1B 3BMCA 3CW9A 1KHTA 1TI7A 3MMXA 1I51A 4I08A 1GLGA 1OXTA 1UP7A 2BE9A 2HJSA 2O1SA 2NOAA 2Y8EA 2C7RA 1EHIA 1G8HA 5H5JA 3LHDA 1CUSA 1FUEA 2NP7A 4UDOA 4V3CA 5HIMA 2C03A 4FI3C 3VOAA 4FUQA 1U0RA 1GR0A 4LJ4A 3CTPA 3DEHA 2PU7A 2I54A 1E7QA 2FFQA 1EIWA 1J90A 1ULUA 3VR1A 1WUKS 3G5AA 3U49A 1ZHFA 2VK8A 4NZMA 4CN8A 1B6SA 2I71A 2VT7A 4ILKA 3EB9A 2P5SA 1SQGA 1RJ9A 3MJHA 4LIPD 4NK5A 2W37A 1KSJA 4W5WA 5G0VA 3ZH2A 1Y82A 1M5UA 4NBUA 3T12A 2ONYA 3K0EA 4RH3A 3MHTA 1HYGA 2E4VA 4DC1A 2BM8A 2DUUA 3CMMA 1SUDA 5E7IA 3RNLA 1NZFA 4BTLA 3GFRA 5CEJA 4JN6B 3EPJA 2RGUA 3QA9A 1NBMD 2N3ZA 4HTAA 1LSUA 4ZAVA 3D6UA 4G2TA 2DBQA 1Y3FE 3DBRA 4CLHA 4I2NA 3LT4A 1WR8A 1J8VA 1IHOA 1FQOA 2W4MA 1X8LA 4FB4A 1JIVA 1HYQA 1E0AA 2HDOA 4MXDA 4ZAXA 1VJ0A 3A05A 3IQXA 4XUDA 3WAJA 1M8JA 2YOFA 4Q1AA 3TOSA 4BUZA 2Y77A 1V35A 1ZJJA 2NSLA 2H0AA 2ON6A 3BXGA 3FDIA 4JI1B 4ZC8A 2HJVA 2XNDA 1XQ6A 3MMSA 2WOJA 2HV8A 5AVUA 4IEEA 2NO0A 1GNRA 4EY4A 1WG8A 3FPBA 2VQ3A 1ZUWA 5LCXA 3V2HA 1F1BA 1G4HA 4L8WB 3NBXX 4JH0A 4PZCA 1RHQA 5B55A 2PPVA 3PNBA 3GEEA 3UAVA 4JEUA 3IGFA 3EIXA 3KB6A 2JBHA 2YY6A 3O91A 4U63A 2CGEA 5JO9A 3MGAA 5DNAA 4F91B 2JJ1D 5AK6A 1Y6ZA 4R83A 1SXHA 2YHIB 5D00A 4D4HA 3K0SA 4U5QA 1IZ7A 3RUDA 1Q22A 3DBLA 1FDSA 2HEGA 2XKKA 1G8PA 2SCUB 1I1OA 2Q1UA 3Q2IA 4C0JA 4LJRA 3KLMX 1Z88A 4ATNA 3A3NA 3G68A 1HM5A 4ADSG 3LDGA 4MMZB 3TAUA 1GGNA 3H1PA 2QUJA 3NTOA 4TKVB 5C3MA 2QM0A 4MUXA 4P82A 5ALLA 3CLSC 3IEVA 3TLYA 1Y80A 1QWOA 3VTFA 4YRLA 4EW6A 3OTGA 1Y8ZA 1YKFA 2K87A 2ZT7A 4B46A 4BX9A 1CYEA 1SVIA 2GSDA 2OSBA 4DR7B 2HNBA 3MCVA 5IZ4A 1QIEA 1EHYA 1PTJA 5TQ0B 1YE3A 2HRQA 3L7BA 4OX9B 2QSUA 2JGJA 3DMTA 5CLLA 3RVMA 3S3TA 3UG7A 4Z5XA 2BMFA 1W5AA 4N41A 4RVNA 1RM0A 1K5GA 4PGFA 1M8GA 4BFVA 1YZLA 5C3UA 4KFRA 3ZNPA 2C59A 5EHIA 2IHBA 4C0SA 4EVIA 1L4MA 5B36A 4PYQA 3ZLJA 1S89A 3TS1A 2J3QA 1IBMB 1XBTA 4BB6A 3FPLA 1O0SA 2ECQA 1WXHA 1JQ5A 1ORDA 2NU9A 2YVAA 4BNKA 5M7EA 1IHYA 4UD6A 2C0QA 3M82A 3A37A 4JT9A 1TC2A 2M6RA 1FY2A 1YQ9A 2JH9A 2C57A 3DFMA 3V1NA 1WXQA 2GM5A 2AXPA 1R9NA 4FFRA 2O8EB 2H1SA 4ABTA 3C3KA 3GT4A 4NJEB 4WVFA 2C2XA 4JKYA 2DCUA 3RLFA 5BVHA 4BAGA 4DSAA 1IPFA 3C1OA 3I2IA 3DLCA 4RUKA 3BAZA 4H0CA 1F8XA 4E2YA 3GVCA 5CDGA 3JAMA 2YDXA 4UKDA 1CQPA 4PAWA 3IEUA 1YVEI 2H2IA 1YRWA 2QJRA 4JBIA 1DKLA 3VVBA 4E5NA 2HK7A 1CRPA 2ZTHA 4CLRB 4EQ6B 2XDQB 4ENWA 1NBAA 1PS0A 1DX4A 1NLUA 2QD5A 4OJMX 4AMUA 3UK2A 3V6LA 1Q44A 4ZDWA 3UXYA 2FUG6 4L5JA 3KD2A 1P0MA 5TQ2B 2CLKB 1NMSA 1XRPA 3ONNA 3KSAC 3RRFA 3DCJA 1T4CB 1W48A 2I2XB 2VQ6A 2Z08A 4WZAA 1LJLA 1JWAB 3Q8LA 1H2FA 4BRUA 2OO5A 1HFEL 3LU1A 3LUAA 4KFSA 3L3BA 4CKCA 3KBOA 4Y2VA 5CCXA 4G5SA 4YRDA 5CAEB 3ZK7A 2FPUA 2VDUE 4DEXA 3BXHA 4IIJB 3L1VA 4ZAFA 3TUJC 4DV4B 2O5CA 1JE0A 5LQUA 2WAMA 3BS4A 3EXG2 5DX8A 3ESYA 1T8RA 1PJCA 4JELA 1A9RA 1X1TA 1UBTS 2ZYTX 4OJTA 3UFBA 4BATA 2BFCB 4EF4A 5C37A 4G5XA 2IY7A 1J20A 1IL0A 3HCPA 3HNOA 4CCYB 4CTMA 1DSSG 3G0OA 2GCOB 2VHTA 3KXDA 2X1MA 4IDNA 1EFHA 1MB4A 5CK4A 2N42A 5EY5B 4AJPA 5C52B 1XZLA 3ACDA 3VNRA 4UULA 3HKCB 1WU7A 1OXBB 1S3FA 2EDCA 3OFVA 1RI4A 4I1IA 5DW3A 1SCUB 2MSDB 4V38A 2A1UB 5AHWA 3DEZA 1KEWA 4I2VA 2NVUB 3S28A 1WCIB 2WWTA 4NE9A 1QNFA 2P6NA 2W2LD 3OY2A 5T4BA 1CY6A 3R7LA 4BMCA 3HDHA 2YV4A 4JY7A 4CETA 1WIWA 4I8IA 3V4ZA 2G09A 1K7SN 4RY2A 1IN6A 2L17A 4KXUA 3FLBA 3BA1A 5BSRA 4BECA 5KX5B 4CQNA 3CBQA 5ER6A 5C5EA 1OB5A 3RLIA 2XUFA 3UK6A 5JAQA 3ZZ1A 1YULA 4AVYA 1PVVA 1J0DA 1GQOA 2OVFA 4H6WA 4AUKA 4BVGA 2J0VA 3H2HA 3IOEA 1G21B 3KYDB 1VMAA 5I6DA 5A1TA 1ZESA 2D2FA 1RZ3A 2YVLA 3PFGA 4QYTA 4WCDA 1CULC 4UNRA 3B52X 3HG7A 3I9MA 3O4FA 4WBNA 3T1TA 3GI1A 2QF7A 1L7BA 3UMRA 3UT6A 2RIPA 4MS1B 5G53C 3WKDA 4TYNA 1Z34A 4KHZA 2AGVA 4A0SA 4BQSA 2Q6OA 4KWHA 4R3NA 3RSCA 3UJ9A 5E4YA 3JAKA 4ALIA 2WF6A 2ZE7A 3NT5A 4MVJH 5C1DA 4DJEC 1Z38A 2PT5A 4YGXB 2XCTB 3S8MA 2PUWA 2CZQA 2VHZA 1ODCA 1DC5A 5LZ7A 2HTFA 4K0KB 3AILA 2CNNA 4AY3A 5DLQC 3U26A 5REQA 1I30A 4P3YA 1WRBA 4RK6A 3SQWA 4DV0B 3DVRX 1BCRA 2AEFA 4LI0A 1CEYA 5KYTA 2P3LA 4KYVA 1FYEA 2WD8A 3WRXA 2WJ3A 3QKTA 4Y0AA 5I4IA 1N0WA 4XCVA 5E7JA 2JLQA 1E5QA 3PVZA 2Y0PA 3AL0C 5CA0B 3HB5X 1YRHA 1RACA 4QFDA 3RADC 1ADFA 2WMNB 5TGTA 1JWBB 3ONWA 3NZEA 4UBOA 5EWMB 4DC9A 3OFSA 3AQIA 3U16A 3B7WA 3IQWA 5K0ZA 4GWGA 3RUCA 2RSLA 3F8SA 4XA8A 2BSQA 3ETCA 3F2VA 1H5UA 2GK3A 2IHZA 3PPYA 3H87A 1BD4A 4PYRA 3FZNA 3OZ7A 3G6KA 4WEQA 2B4KA 3MZ0A 1DXHA 3M5DA 3ESAA 4A8JC 2F43B 4AK9A 2DFVA 2FVXA 4OYRA 3EQ6A 4I6GA 4UU0A 3V1YA 2XODA 3VNVA 4XM0A 2A9VA 1OX4A 3WADA 1Y3HA 4A0GA 5B7PA 1JTVA 1RDFA 4HO1X 5E6RA 3WLEA 5KSWB 1LDMA 1H1TA 1YHNA 1O9GA 3DULA 4WPGA 1J1UA 1TUIA 4X3OA 1Q15A 1F4VA 3QJ5A 1YL6A 5J4KA 2FE4A 4D4MA 1LVUA 1QYXA 1Y7TA 3VNQA 3WHIA 2A67A 4HQ6A 4C9BA 2C0PA 2XUPA 4LMAA 1H3EA 1ISFA 1R4ZA 2XQVA 3ZHYA 1M1NB 2JGKA 4WZZA 3WYEA 5FB3A 1JI3A 7AT1A 4N0QA 1Q16A 3M5CA 2NMVA 3HDQA 4M37A 2Y1KA 2IUFA 1RAFA 3JVEA 1DJLA 2PLAA 2QJTA 3VZPA 2F8SA 1IQUA 5FOXA 3UW3A 2GZSA 3M81A 3QLJA 4NSNA 4FEAA 1DQNA 5BNTA 1UOPA 3T99A 4O5OA 5CT5A 1TZ2A 3DTTA 4X41A 3TZQA 2AI1A 1XTTA 2HT1A 3O2JA 5DBOA 2GYUA 1T43A 4HGZA 2YWRA 5K2OA 1VHJA 1X7WB 3K6KA 1AK9A 1VBKA 1SKYE 2BRUA 3IAFA 3KQTA 3MILA 5CT8A 4WJZA 4WBXC 4Z99A 3S0JA 4HFMA 5I7RA 4HLDA 2M32A 2VWGA 3DWEX 4X1IA 5EHNA 3WC4A 3TUZC 2AYZA 3H99A 3MQ2A 1OJLA 4HDNA 2YJGA 3IYLW 4Y9TA 3WFJA 3EFEA 1MRZA 3UGQA 1JLSA 1XRJA 3NPAA 3IOCA 1FFYA 5JALA 5FUBA 3VR5D 3CN9A 3L79A 1V8OA 4PZYA 3RIEA 2FR8A 2QAGB 3AOEA 3ESCA 4O0MA 1G5HA 2VBIA 3FR7A 1GWNA 4NBLA 2GN0A 1SB9A 4TTPA 4HYQA 3EZFA 4C0BA 5EMMA 5SZIA 3KD3A 3AEZA 4AWAA 1QX4A 2NPIA 3CB2A 9ATCA 2NLOA 1OHHA 4Q24A 4LXIA 2F9LA 4Q34A 4XOUA 3FKQA 4H60A 1GDDA 2AH5A 3T4UA 3FBGA 4NOLA 3AJDA 3RROA 1ZSVA 1N2SA 3HRIA 3ND8A 4FFSA 3RHTA 3HP1A 2WNHA 1JBEA 4FFMA 3RVLA 4DC0A 2OXEA 5C7OO 1EEXB 1RYZA 3A31A 3WQBA 2H1HA 4BZWA 1XPJA 1ML3A 3CRNA 4IGEA 2YMQA 3VRHA 4C3OB 4GGMX 2OG2A 5FORA 1Z2CA 3I64A 3H9EO 2ZXEA 2ZXFA 5LN1A 2IY8A 2QRGA 3ZV4A 4A6PA 2CXHA 2P8SA 4D3FA 4HNVA 2C94A 5BMVA 2I6FA 4N9QA 4Z3DA 2ILVA 1GPMA 1P5JA 5A0FA 2QLJA 4EL5A 4WXHA 2BEUB 1D5WA 4YAFA 4BXOB 1CX9B 5AI4A 5K0CA 4BTVA 2FEKA 2XA1A 2UVQA 1H2HA 2VOJA 4MIEA 1C2TA 3GWGA 3LF2A 2IW1A 1QBGA 2MJLA 1JHDA 2QTTA 3I3SR 4FT2A 4H7FA 4IIVA 2PHZA 5AM4A 1R9MA 1R10A 3SSMA 1EDOA 3QYFA 4B3IA 4NZZA 3DW3X 4Y2RA 1CT9A 4JLPA 4MJLA 1P3Y1 5DM1A 5C5DA 5EINA 5F35A 1RWOA 3O9VA 1NSFA 1R0BA 3IBCA 4MPPA 2YVKA 4KPEC 2J32A 2IZOA 4W1PA 1KOJA 5A6SB 3ZZNA 4EA7A 5K20A 2GPNA 1HT3A 3NDJA 1YTLA 3N58A 1GTSA 1KQFA 4XDGA 3NIBA 5IAAA 4CHTA 2QN7A 3ZQUA 2AUMA 3SXPA 3QVVA 1I3NA 2CNLA 2E37A 2I7CA 3L6UA 2GJSA 1N25A 1ABEA 1FUUA 3MPOA 3Q6NA 4X93A 1KQNA 2LNDA 3TSAA 1EWVA 5DM4A 2V97A 1T8UA 1CERA 2FE1A 2HCTA 2WSIA 1CS4C 3A4NA 3RF7A 1O3YA 2B8EA 3DFUA 3H0CA 3OIYA 4O2AB 5A7HA 3BK7A 1Z74A 2PKXA 3KE8A 2Q49A 4P22A 1XZIA 4EJMA 5LXTF 3RFFA 5GGXA 4LMRA 4AZTA 3LYUA 4I36A 5LC1A 4QYIA 4WOCA 3URKA 1JHMA 2CZCA 3HUFA 3KLBA 4TYQA 4LEIA 2WQZA 4Y6GB 4E09A 3SKYA 1KL7A 1XN1A 3TBKA 3SLRA 2EARA 4CMAA 5FYDA 1ZLYA 2A5LA 4NBTA 3I6BA 1B26A 1KYIA 1ZQ1A 4QBKA 4RY9A 2HT6A 3NHPA 3BF8A 4B83A 1VM6A 4PE5B 2VUSA 3FSGD 1A72A 2G88A 1BE0A 3NQ41 4J03A 5DFAA 4RF2A 2D6FA 3AUXA 5KYNA 5JS2A 3DONA 3DHEA 3MJRA 1Y1PA 4M0FA 3RRBA 2ATCA 4GDMA 4J1QA 4W1RA 4O4IA 1Y7PA 5BWOA 2CWWA 4I1PA 1ZVKA 5K3CA 4D9CA 3HJGA 1TEXA 3C43A 3QOYA 1TQ2A 5K0EA 1X1SA 2E3JA 2KSQA 2D1RA 4TLAA 2JAWA 1T0PA 3U9LA 3MAJA 1TVKB 2ZJ5A 3I2FA 1C81A 3REGA 3W5HA 2EV9A 3ILHA 4PY2A 4EF5A 4NBVA 2FQWA 2NG1A 5K3SA 1VKZA 2I6XA 3FOCA 3M9WA 2IDZA 2OCDA 1UIMA 4FYJA 3PK0A 3VFDA 3E22B 2IP4A 1ILEA 4WQMA 1D2AA 1EGVB 2JIDA 4EPTA 3D0OA 3GGSA 4JUAA 4YACA 3X44A 4LDNA 4L78A 4EG7A 3RSQA 1X7HA 4WBNF 3HCWA 2HI0A 3QMPA 3I2GA 3BEDA 4FDAA 2VDVE 2NYAA 3KEMA 4MITA 4YLYA 3BZUA 4OGWA 3CISA 5GVSA 5KJ6A 1CLUA 4PN3A 4YRJA 5DI3A 3MOIA 4DBVO 1W0CA 3SHWA 4TTRA 4M8LA 1D2CA 3DXYA 3BWMA 4MPDA 2HFKA 3MB5A 3OTHA 1Y7IA 4MQUA 3GQBB 3AR3A 3KKMA 1ZW1A 4WOJA 1JFRA 3OJCA 3V9PA 2ZBFA 4EMBA 3M6UA 4I81A 1O03A 2YC4C 1COZA 2ZUSA 2X9LA 1QQ6A 3PD0A 2WABA 2YFQA 1WDTA 3LUKA 1K2WA 4RCVA 4PXAA 2QNIA 3W5VA 2IU3A 2NZYA 4W7SA 4L28A 1ZC4A 5H9WA 3QJYA 1QZUA 1WHSA 4OK5A 4EHLA 4AO7A 3P2EA 5AW2A 1KO8A 4I4IA 3HCAA 2POQX 2QI9C 2ZT8A 3P0FA 3IAM1 3PGA1 1LVGA 1PS9A 1RMYA 2JA1A 3IEMA 4NAHA 5E6SB 4MQFA 3AINA 1TZJA 2YXPX 3W79A 1CNEA 1E2EA 1UQTA 1TGVA 1EK5A 2NTYC 4FYHA 5D5PA 5JAIA 3VKVA 2OHHA 4C4RA 4A0HA 4NF2A 5JFTA 4F2GA 2O5VA 4CLOB 1QP7A 2EW1A 1FDOA 1X70A 3PA8A 5DJ5A 1T8PA 1CQZA 1NJ6A 3UMCA 3ZE1B 3HR8A 4FJ2A 3C45A 5BSTA 5DM70 3C3CA 4KW7A 4AQDA 2QYSA 3ANSA 2RKWA 1KE1A 4QFMA 1GQQA 3KQKA 4X90A 5HGXA 2WFLB 4NU6A 3L8CA 1WKBA 2X8JB 1A2KC 1RP7A 1YZTA 2AEJA 4XYMA 1ZN9A 3E58A 5IBQA 3T1VA 2AOXA 1SUEA 4DA4A 1PUJA 2W7TA 3EXIB 1MCZA 3P9NA 4F4IA 5JYCA 4KR7A 4GMXA 2NVOA 5L6LB 1OUMA 5DIFA 3HADA 4B6PA 2AV6A 3QXCA 1N2CE 4KE7A 4P7BA 3Q9SA 2B8WA 3HN7A 4BV9A 5KKNB 1DQRA 1U2GC 1N2HA 2XRYA 3N5C