1YB7A

Hydroxynitrile lyase from hevea brasiliensis in complex with 2,3-dimethyl-2-hydroxy-butyronitrile
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants of the enantioselectivity of the hydroxynitrile lyase from Hevea brasiliensis
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lyase
molecule keywords (S)-acetone-cyanohydrin lyase
total genus 100
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2004-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yb7A00
5AKLA 2XUHA 4K5QA 5FPQA 4X97A 4UHCA 2DQZA 4H0CA 3QBJA 3QPCA 4IH1A 2CEKA 3DKKA 1ACLA 5JATA 1VZ3A 2WIKA 3R41A 4MEAA 1DX4A 1ZJ5A 3H2GA 1QIEA 4EY6A 1L7AA 2VF2A 2WG2A 5HCUA 1UT6A 1OILA 4J0HA 5HFNA 3W05A 4BE4A 2ZSIA 2OGTA 1Q83A 5IVDA 2VAVA 4KE9A 3DJYA 1EK1A 3R3VA 2XUIA 4G1FA 5ALQA 3O4GA 4U2BA 4X00A 3OPMA 1XRQA 3H2HA 1XFDA 2Y1KA 3WL8A 5DNVA 4UBLA 1UZAA 2HU7A 2QVBA 1GT6A 4JNCA 1BN6A 2HRQA 5IH7A 1U8EA 3F67A 2HU8A 1CV2A 3DOHA 1DWOA 2WJ4A 1RP1A 2PKYX 3GROA 3WK9A 4RNCA 2WU3A 3D5EA 3PF9A 1BCRA 4IHAA 2AJCA 3WKAA 5K3CA 5BOVA 2FUKA 1LNSA 4H7FA 3O4HA 3V1LA 3VKFA 1UK9A 2RGUA 1R88A 4DSZA 2X76A 5EHXA 4I3FA 3TJMA 4BRZA 2WUFA 2PSJA 2WTMA 3CN9A 4C01A 4QA9A 2WIDA 2J3QA 1WB4A 5EHQA 4Y2TA 3PUHA 1E8DA 1MO2A 5CH5A 1C7JA 3WIOA 1BEEA 4EBBA 1WB5A 5D3ZA 4FLFA 2OCLA 3A70A 1ODSA 3QPAA 3WL7A 4FLMA 1X70A 4NMWA 4PO3X 5AHXA 5I8PA 1EINA 4PSDA 2K2QB 3FVRA 1UXOA 3FNBA 2JF0A 2WG0A 4P92A 3C5VA 2WUGA 3KWJA 2CMFA 3H18A 4DMCA 1G4HA 4FFWA 3H1BA 3C6BA 5EIAA 4WFIA 5HF6A 4BZZA 2QT9A 4PSCA 1XRLA 5T4EA 3B5EA 3D2AA 1F0PA 4OB6A 3QITA 3WK4A 4G4IA 4B83A 4KAJA 5HF8A 1W1IA 4DLNA 3IULA 5DYYA 1YS1X 1EDDA 4EHBA 4Q3KA 1ORVA 1UKAA 2AJDA 3FLEA 3C43A 1P0QA 4S0XA 3Q0TA 4DTCA 2C4HA 1LPAB 4A5SA 2PX6A 5AKZA 4N8DA 4L9AA 1H2YA 4IQ4A 5DWDA 3WIBA 1JJFA 5FP0A 3WL5A 2G4LA 4WFJA 1MX9A 3FSGD 5HZGA 4DSAA 5A7HA 4C4YA 3NOXA 3MVEA 1QONA 1W75A 3BIWA 2Z3WA 4ZV9A 3K6KA 5CH8A 1ISPA 3K9BA 1R1DA 4OB8A 4B9EA 1CIJA 4DMFA 1P0IA 5AK4A 5AKYA 1QFSA 1S8OA 5AKGA 3G8YA 2XUJA 2BKLA 1EDBA 5D7BA 3ESAA 5JYCA 1XZJA 2BGNA 1QIFA 3WL6A 3VVMA 3WMRA 3D4LA 4B81A 5IKXA 3H04A 5JZSA 5FLKA 4NZZA 2DQYA 4P9NA 2O7VA 5CBKA 3F9CA 1CUCA 1BROA 5CXUA 1K5PA 3U0VA 2XQJA 5FPPA 2RAUA 4G8CA 4BP9A 4OD0A 4ROTA 1ACJA 1MN6A 1XLWA 4OCZA 4OYYA 3C5WP 5A6VA 4X71A 2H7CA 2HA5A 1MX1A 4QZVA 3I6MA 1MJ5A 3AINA 5F4ZA 3UUFA 3F8SA 1TIBA 1RWQA 2ES4A 4EY4A 2QUAA 3I2FA 4Y2VA 5CT6A 2Y2UA 3WWCA 5AKJA 1W52X 1BCSA 4EA6A 5AI5A 5ESRA 4J3JA 4Q34A 5K3FA 4X92A 2HU5A 5K3EA 5ALWA 5E4YA 5DLPA 2YH2A 4KAFA 3DYVA 1E8NA 1A8SA 4FTWA 3AZQA 4H7KA 1BS9A 4CCYB 4CIAA 4CG3A 1ETHA 3NUZA 3VXKA 5AOCA 3WKBA 5JD4A 5AKHA 4HXEB 3WK5A 4OU4A 5BWCA 3V48A 3KSRA 5ALNA 1GGVA 1XRMA 2PPLA 5E4JA 2DHEA 1N5RA 3HACA 3EIOA 3R3UA 1LLFA 2XQFA 3PI6A 3IUMA 2PSFA 3R3ZA 1IUOA 2EDAA 2C0PA 3W04A 4HVTA 1XZCA 1QZ3A 3GA7A 1QIDA 3G0CA 1MU0A 3LS2A 2D0DA 1K6EA 1LPMA 3EBLA 1J07A 2PU7A 3IVMA 2XMCA 1CEXA 4ARBA 1VJ5A 4B6GA 1IZ8A 4QDTA 4BC1A 4X7BA 2DCMA 4BDSA 4ZXFA 4XVCA 2O2GA 2WHQA 1XRPA 4X85A 2OXEA 4Y2YA 2XMDA 5CT5A 1YSCA 4JEIA 3PICA 5AI6A 2PUHA 3DQZA 3F98A 1IUNA 2I03A 1K63A 2ROQA 3D59A 5AI8A 4MYSA 2VT7A 3C45A 3BF8A 4QEKA 2O2IA 2HRRA 2QUBA 1DWQA 2BUAA 4ITVA 1XLVA 1AKNA 3FVTA 3QMWA 2GYUA 2WLSA 2XE4A 4AO6A 1SCIA 3KWFA 1FJ2A 2XQKA 4TVKA 1BE0A 5E2IA 4EY5A 4BYMA 1OCEA 4YASA 5ALTA 1KU0A 2G5PA 4DM7A 2ORYA 4UHDA 2Y6UA 3QYJA 1TRHA 2WHPA 5FV4A 1YA8A 5HK8A 4BAGA 3I6ZA 4UFNA 1J2EA 2V9ZA 4BVKA 5CRIA 3WWOA 2B9VA 1QIIA 1VOTA 1FFBA 2OLEA 3VVLA 2JGEA 3E1GA 1MAHA 4G8BA 5KREA 1JJIA 4FNMA 1XRNA 1MTZA 2UZ0A 1UWCA 2Z8XA 5LLSA 2VQ6A 3WJ2A 4EB0A 4U2FA 4AN0A 2DSNA 5ALYA 4B0OA 4UHBA 4HRXA 2WKWA 2GZSA 5AKKA 5KBYA 1ZD3A 5E4TA 5IVKA 1CLEA 1H22A 1UK6A 1JU3A 2OQVA 5BV7A 4YX9A 3V1KA 4G9GA 4UFOA 3RKSA 1IVYA 2XUDA 2GYVA 2WIGA 2IX9A 2PSHA 2WHRA 5AK3A 3ICWA 3FYTA 3FCXA 3TGLA 4C87A 1YA4A 5FKJA 1CUHA 3TEJA 4F5ZA 5DYWA 2X8BA 1ZICA 3M81A 2Y6VA 1DWPA 5CT9A 2HDWA 4BDTA 3PFCA 4C88A 1CUFA 1L7RA 1MAAA 2WFZA 2ZJ6A 2C7BA 5ALGA 1EI9A 5AIBA 3JWEA 4KAAA 1EXWA 3BXPA 1XZAA 4DMHA 4PQEA 4M0FA 2DR0A 5LKRA 1X2BA 3E4DA 5EFZA 3STUA 5EHZA 4FLEA 1YCDA 4Q82A 4XIIA 4IH9A 4M0EA 1H2WA 1ZI6A 3R3YA 5ALZA 4INZA 4W1PA 1UOPA 1U65A 2QOEA 3X3HA 5K3DA 5ALKA 1ZGCA 3T4UA 1EK2A 3FLBA 1CFJA 4CI9A 5JADA 4B82A 1ZOIA 1WM1A 4OUKX 1EH5A 2HM7A 1HLGA 5AK5A 3YASA 4XWGA 3O9VA 4BVLA 4LKOA 3O9MA 2WSLA 1VE6A 3WK6A 4C4ZA 1EB8A 4OSEA 4DIUA 5AJHA 4FFVA 2PU5A 1QFMA 1ZI9A 3W06A 1WHSA 4B7ZA 2VTVA 4LXHA 1R3DA 4W1SA 4HZGA 5JARA 3N2ZB 2XUFA 4X6YA 3HXKA 2XDWA 5C7YA 4X6UA 2Z8ZA 2CUTA 2BCEA 3WKCA 1Q84A 2GBGA 2R8BA 3KDAA 5C8VA 1FFDA 2J3DA 4BP8A 2HA6A 2V98A 3EF3A 1UOOA 2JEYA 4P08A 2WG1A 3C6XA 4RE5A 1U2EA 4H7EA 4E15A 1G66A 1YR2A 2RHWA 1XZFA 1MPXA 1A88A 1DT5A 3BE8A 1WPRA 5ALSA 3LCRA 5ALUA 5I7UA 4UFPA 3AILA 3LP5A 4D9JA 5EIHA 2BUBA 1VE7A 2JGLA 2HIHA 4X91A 1A8QA 2HADA 1QIGA 4O08A 3W9UA 4MYDA 3I2GA 4UUQA 3OM8A 1AURA 4LXGA 7YASA 4J0DA 3O95A 4E11A 2R11A 5AK6A 5LZ8A 1ORWA 3IBTA 3KXPA 4AO8A 5CMLA 4JYMA 2ONCA 3SX4A 4X6XA 1QIMA 1IZ7A 3ESDA 5BWBA 1ZD2P 5JD5A 1D07A 4UBMA 1CUXA 4Q3OA 4QNNA 4UBJA 3R40A 3L1HA 1ZIXA 2WTNA 3B12A 5ALMA 3WA6A 2JGMA 4H7HA 4AMYA 1LPBB 3HYSA 2WIFA 3FAKA 4OPMA 3MUOA 2J4CA 4DGQA 3HSSA 1KEZA 1XLUA 5AH0A 2BUCA 2XMZA 4AZ3A 4K6GA 3DS8A 4Y7DA 4MQLA 2PUJA 2CBGA 1AMNA 3HEAA 1T4MA 1CUWA 1XZLA 5K5EA 4PW0A 4FKBA 5AM0A 4Q05A 3CN7A 4KE6A 3ZLUA 1SCQA 2BAGA 1TCBA 4KYVA 3DKRA 5ALOA 4G8DA 1BEZA 3R3XA 4BRSA 4B9AA 2OG1A 1WOMA 2H9YA 3MGAA 4H18A 1H23A 4J0KA 4X93A 2AJBA 3LIIA 4I19A 4PF1A 3PE6A 3BL8A 4M0MA 1AGYA 4BAUA 2BGRA 4H7JA 1XKLA 2JGFA 3S8YA 5A7FA 2GBIA 3D3NA 2FX5A 2HA2A 4HXGA 2QXUA 2ZSHA 1B6GA 4Y2PA 3M82A 2B61A 2HL6A 2RI6A 2WUEA 4GI1A 1QIJA 2QS9A 5AO9A 4LHEA 1TKRA 3SK0A 5AM1A 2I3DA 4A16A 1XZIA 2X5XA 3LIPA 3BDIA 1QIKA 5HQ3B 1FFAA 3WK8A 3B3QA 4L72A 1CQWA 2OCGA 3OTQA 1K8QA 2CKMA 4UHFA 5DJ5A 3LLCA 3M3DA 2OAGA 2YXPX 3WA7A 1E89A 2Y2VA 1XZDA 4BC0A 5ALPA 4NS4A 3HJUA 1EX9A 2JGJA 1C7IA 4Y2XA 5ALDA 4AXBA 1TK3A 4MQMA 3OOSA 4IH4A 2P8SA 3OC0A 5HQ3A 3G0DA 4BTLA 2XMBA 1Y7IA 4AB1A 2JIDA 4QDOA 2XUKA 5AP9A 1QGED 5K3FB 5ALXA 2G5TA 3H19A 4GBGA 1I6WA 2G63A 2QM0A 2WIJA 3I1YA 2GBFA 3ANSA 4U2CA 3I2JA 4UHHA 5JALA 1XQWA 4J0IA 3HLKA 2C5GA 4X90A 5CT8A 4E46A 4UPDA 5J3JA 1EVEA 3FYUB 1E5TA 4J0JA 1TAHA 5C81A 1SOMA 4X3CA 4RE6A 4OB7A 3VDXA 3ICVA 4OYLA 1LPPA 1Y37A 3N0TA 5C8ZA 3FWHA 3WWDA 4G4GA 4F60A 3V9AA 2WFLA 5FOQA 3ZWQA 3HI4A 1CUEA 4PV7A 1CUDA 5CH3A 1QTRA 3MUNA 3DEAA 4AN1A 3WQHA 4H35A 5KWJA 5LZ4A 4J03A 3IUNA 1Z68A 5AOAA 5KWIA 1Q0RA 4C4XA 5CTAA 2XUGA 5SYNA 2Z3ZA 2XUAA 5JAUA 3WI7A 5FDFA 4KRXA 2WQZA 1IUPA 5EIEA 1XZMA 4GDMA 1UKCA 4ZWNA 3U1TA 1LPOA 1ZJ4A 4WCVA 5ALLA 2WUDA 4UHEA 1F0NA 2IITA 1M33A 2J4FA 3DLTA 3A6ZA 3IIIA 3HABA 1GQRA 4BATA 4QDUA 1DTEA 4MWSA 4GXNA 5ALRA 1CUIA 1QTIA 2QXTA 2WFMA 4EY7A 2VJAA 5ALFA 4TGLA 2PL5A 4U2EA 4ZREA 1QOZA 3AIKA 4BVJA 4L0CA 2H7XA 3H1AA 5LZ5A 2B20A 3EQ9A 1PV1A 4UBKA 1UK7A 3FCYA 4PSUA 4BCBA 4DMKA 4KJXA 4YPVA 5EI5A 5T4FA 2ZYRA 2BFNA 5ALJA 2I78A 4N5IX 2YYSA 2OCKA 3H17A 3I2IA 5LP1A 2EEPA 5HFAA 1HDEA 3OURA 1HPLA 3KD2A 4Z49A 4BZWA 4H7DA 2DHDA 2XI4A 5D3KA 1P0MA 3O4IA 4CG2A 3PFBA 4DNFA 4MJ3A 4N5HX 3VJMA 2XT0A 2VJBA 5A2GA 4RGYA 2QZPA 1ZD5A 4GWLA 4RPCA 4ARAA 3D0KA 1XZEA 4KRYA 3CXUA 3R3WA 5I9IA 1H2ZA 5AM3A 2JEZA 3V1NA 5LYYA 1NX9A 3CCCA 4FHZA 3VJLA 3ESCA 3C6YA 1FSSA 5JZBA 1LGYA 2W6CX 1THGA 1GKLA 3ED1A 1GPLA 1U4NA 4XX1A 2WJ6A 2XUQA 2AXEA 1YS2X 1O6FA 5ALVA 3QPDA 3QZUA 1BN7A 4W1RA 3SC2A 5ISMA 3F97A 1MNQA 4IO0A 1NU8A 3G0BA 2DHCA 3HZOA 3G0IA 3E0XA 3C6ZA 3IB3A 2ACEA 1JMYA 5A62A 4ZGBA 1YAJA 1VXRA 1GPKA 4CCYA 3BWXA 3WKDA 4BE9A 3C8DA 4HAIA 4CFSA 2PM8A 3BDVA 4HS9A 4BTVA 3M83A 4KE7A 1CUYA 3STTA 4W1QA 1TCAA 3IDAA 3HRHA 4MWTA 3FYUA 3RK4A 2HA4A 3WYNA 5AI0A 2OCIA 2XUPA 1XZKA 5JANA 5C8XA 3FLAA 2QMQA 1CUSA 3F96A 3Q8WA 2V97A 1Y7HA 1TCCA 3WK7A 2VJCA 2HA7A 1DQYA 4H77A 3ZPXA 4F0JA 1CQZA 5DTIA 3OG9A 3G9XA 3RM3A 2QR5A 1XKTA 3RARA 4UBIA 4MXDA 2WJ3A 4B85A 1GXSA 4QWWA 1R9NA 4P93A 3T52A 2OGSA 1HKHA 2O2HA 2D5LA 1A8UA 4FMPA 1YB7A 5AIAA 5D6OA 2B4KA 4AQDA 1B41A 1Q0ZA 3GUUA 2WU4A 3STXA 5JAPA 1R9MA 3WZMA 3DCNA 3VJKA 5DNUA 2CJPA 2JBWA 1R4ZA 5CW2A 4BAZA 1JMKC 5AKEA 2ZYSA 3I2HA 3DNMA 1K4YA 1MNAA 4HTAA 4LYDA 2ZVDA 4W9RA 3PDCA 1JI3A 2HFJA 5LZ7A 3H2IA 1XQVA 1XZBA 5HKAA 5HF5A 5FXMA 1N8SA 1JT2A 4B84A 1LZKA 2VT6A 4L3WA 2WFLB 5DYTA 2CB9A 2C0QA 1WPXA 1RYYA 1XRRA 2JGKA 2NW6A 4GW3A 5A71A 2QJRA 4WDQA 5T4HA 3ZLTA 1EHYA 1YB6A 2VAXA 3GFFA 3L1IA 4FNGA 1YASA 4BCCA 4KE8A 4K6KA 1GKKA 2YASA 1HBJA 1LBSA 4EZIA 1AQLA 4CG1A 4ETWA 2FJPA 4GLBA 4OU5A 1PJAA 1VA4A 1DQZA 1CUZA 2HHAA 2WILA 4C6HA 5JIBA 3D2BA 4WY5A 3WWEA 1CUVA 4UBOA 4Y2JA 1YAHA 5AI4A 1XZGA 1XROA 4DNQA 1ODTC 3QMVA 2C5FA 2V96A 1W76A 1LZLA 4WFKA 4FBLA 2VEOA 2WM2A 1NU6A 4X95A 1PFQA 3FBWA 3NWOA 3QH4A 2XMQA 4AZ0A 3BJRA 4EY8A 3QMMA 3GZJA 1DX6A 2VJDA 1JJBA 1UK8A 5HF9A 1FFEA 1WB6A 2DFPA 2HA3A 1UFOA 5CURA 5FUMA 1WCYA 3I6YA 5K3BA 2W22A 1ZI8A 4QWMA 3BIXA 1AC5A 4Q3LA 2RONA 3G0GA 1VKHA 2E3JA 3BF7A 3UUEA 3FSGA 2GBCA 3DOIA 3L1JA 3CCBA 4FWBA 1DU4A 1ODCA 4NVRA 2PSEA 5JD6A 3IURA 4HRYA 3ZLVA 1H2XA 3QVMA 1R50A 1CUJA 5YASA 4G5XA 1W4LA 4ZI5A 4QDXA 3TRDA 5AM4A 1JKMA 5CT4A 3ESBA 4J0CA 3I1IA 3FYUC 4DNPA 5ALEA 4CIBA 2FJ0A 3V1MA 4C89A 5ALIA 3BJMA 5DNWA 3KOOA 5JAOA 1DINA 4ZV7A 1J1IA 3AIMA 5JAHA 1SFRA 4WDRA 4GEGA 5HKBA 3D7RA 4J7AA 3DDUA 4KEAA 1GQSA 1CUBA 3P2MA 1UKBA 4QDZA 4JYPA 4E14A 1P0PA 3A2LA 1N1MA 4Y2RA 3IUJA 5CXXA 4BB0A 1JFRA 3O0DA 1VLQA 5AKIA 5ALHA 5AI9A 1GZ7A 3AZPA 2OGZA 2OAEA 4A23A 1LPNA 2CZQA 2JGIA 2GYWA 3PF8A 4G9EA 3H2KA 2XMSA 4BBZA 1SC9A 5AM5A 5EHNA 2I3ZA 3STWA 2PVSA 4LXIA 2H7YA 5AICA 4JH0A 3G9UA 1MX5A 1EDEA 3WYDA 1G5FA 2ZYIA 2C58A 5A7GA 3G9ZA 5H3HA 4I4CA 5AOBA 4AX4A 3C87A 2ACKA 3W9BA 3WJ1A 4UBNA 3I2KA 4FDMA 2ECFA 3SWWA 3I28A 6YASA 5FRDA 3K2IA 2Q0XA 4HXFB 4GHWA 3EQ8A 3STYA 1VZ2A 1XZHA 4V2IA 3R0VA 3C8HA 1UOQA 4EUSA 3ILSA 1IMJA 3DYIA 4F21A 4FOLA 2H1IA 1QO7A 3ANTA 2XMGA 3UMJA 4JUIA 3JW8A 4Y2QA 5LZ9A 3G02A 2IIVA 3AZOA 4G4JA 1F8UA 1USWA 3RLIA 1J06A 3A2MA 1KU6A 1N5MA 1L7QA 5IVIA 4AO7A 2XQIA 2BJHA 3AJAA 4CCWA 3QM1A 4PNZA 3AIOA 5SYMA 1CUGA 3IUQA 2ZYHA 2PBLA 4Q1VA 1BU8A 1XQYA 1CRLA 3G9TA 3G7NA 3NGMA 1GPNA 1LBTA 4K6HA 1QJ4A 1LPSA 4KR0A 3VISA 4FBMA 3W2TA 1VXOA 1XQXA 2VATA 4XJVA 1MT3A 5HK9A 1ZIYA 2RIPA 2AJLI 2AJ8A 3E3AA 4LIPD 5LZ2A 2O7RA 4ZRDA 4YK7A 1E66A 1VA5A 1EB9A 1BRTA 1AUOA 4J0GA 5JZ9A 4W63A 4QLAA 1THTA 1X2EA 3WLAA 1W6RA 4BCDA 4KACA 3AUKA 4TPKA 2GZRA 3WZLA 1QIHA 1O6GA 4LYEA 1E3QA 4X94A 2XLCA 4MEBA 3DD5A 1DT3A 2VA9A 3ZV7A 4Y2SA 2XQGA 3H2JA 1CR6A 3PUIA 3EQ7A 4Y2UA 1G42A 4U2DA 1HQDA 3O4JA 4H7IA 1QE3A 4DYHA 2LIPA 1HL7A 4N8EA 3H0CA 3DL7A 2EDCA 3JYHA 3GBSA 3AFIA 4B80A 2QJWA 4WY8A 4QE3A 5AKXA 3ZI7A 2WHPB 3GELA 3STVA 4B0PA 1ZD4A 2QTBA 2RHTA 1AX9A 1JU4A 2XMRA 3HC7A 3WWPA 2QRUA 1CVLA 2PSDA 2XB6A 5AM2A 1WHTA 5EGNA 1F6WA 5JASA 4AMZA 4U2GA 5LKAA 2Z5GA 1CUAA 3A2NA 1CUUA 1EA5A 4QLOA 4WJLA 1E8MA 2XLBA 1FFCA 3D2CA 4N8SA 1OXMA 3WKEA 1CPYA 1QO9A 1C4XA 1SCKA 2HA0A 1A7UA 2HFKA 5DTJA 3FOBA 2OQIA 1T2NA 3DL4A 5LIPA 1EVQA 2ZJ7A 4GECA 2VSQA 1TQHA 3C70A 5K3AA 4K2AA 2QKYA 4Y9SA 1ZGBA 2XUOA 5T4BA 3IA2A 1QLWA 2OPHA 4DNOA 5IVHA 3S2ZA 2ZJFA 1AZWA
chains in the Genus database with same CATH superfamily
2JIRA 5AKLA 1RTKA 4B74A 1ZRSA 2O14A 1ULUA 2AQIA 2G8LA 4IRXA 3DOEA 2VPYA 5FOXA 3EEQA 3PS9A 3V2IA 1RZ3A 4Z0PA 3B2EA 3DBHB 4UHCA 2BR3A 1KDOA 3HM2A 1PCXA 3LUCA 1MQ8B 1S3FA 3IVAA 4MDYA 2BZ0A 1KMHB 4MDHA 4MHSA 5BN4B 5JOQA 3DKKA 5KNCH 3KQVA 4EFNA 1VZ3A 5CD1A 3KYIB 1E96A 1L7VC 1SOUA 3NONA 4I1OA 1T1RA 4JASB 3MJVA 3V55A 2WKRA 2Q99A 3H2GA 1FFWA 4B3SB 2B0JA 1Z3CA 1YS4A 3ZKWA 2FW8A 3A1TA 1QIEA 3G8AA 4RVNA 4CLEA 4AS1A 5CR9A 3RKRA 1CWUA 2YW9A 3O91A 2VF2A 4PLTA 4LF5B 1ABBA 2BD0A 3ORHA 2OCYC 4IVPA 4RSRA 2VEDA 3W6OA 2WG2A 5HCUA 1CIVA 5TQ0B 1VTKA 1OILA 4FX5A 3LYLA 1U81A 4UQPA 4CLRB 4KWTA 1KYVA 5J59A 2BKVA 3FNHA 4BE4A 4OG2A 1E4YA 2OGTA 5IVDA 1W0CA 3SC4A 3UN1A 2IGBA 2R8YA 5TLSA 2WJZB 2VXCA 3FPGA 1HZZC 5FCDA 2B4YA 2VFAA 3A4NA 4RH0A 2XUIA 4IFBA 3MWFA 4U8HA 1O0CA 2OBBA 5A0FA 4LV5B 1G41A 3H11B 1U90A 3P2OA 5CHEA 3RQIA 2F8MA 1H2BA 2HO5A 3A3OA 3IRVA 4QNMA 2ZUTA 4G24A 4CLHA 1UMBA 1MJGM 3LY8A 3IAS6 4LXYA 1WTAA 1RW4A 4Y6SA 3QNWA 3VR3A 3W6NA 4B48A 2YWRA 4UBLA 1NUHA 221PA 3VU9A 3QX3A 2ZI7A 4R8KA 4S1OA 4DARA 1IH8A 2FQXA 2O8EB 2SBTA 3PFFA 3B51X 4K7JA 2HRQA 4FOTA 4NY1A 4O5OA 5IH7A 1ID8A 4HAZA 1GL9B 2HLHA 1OBFO 4BP3A 4MUEA 3OJXA 5TEWA 4C4SA 2B30A 1YOBA 3G5TA 3NANA 4J9UE 2HU8A 4NBTA 5AJXA 4BIIA 3SPXA 5B57C 3S1SA 1Y48E 2WABA 3EDOA 5DM0A 1E1CA 2OBLA 4NMMA 1RRFA 2D2VA 1JDSA 4O1MA 2PS9A 1X3LA 4I50B 3SQOA 2GJ8A 2GQ0A 3DT6A 4TSRA 1DDOA 1Y81A 3AU9A 2WJ4A 4FFMA 1FVHA 4KXVA 1W1UA 2A94A 2C9YA 2M98A 3B1JA 4MRMB 1CSEE 4URUR 4BFCA 5KCZA 4IXNA 3CLHA 4X41A 1JYFA 5EJGA 4RNCA 4ECEA 1RDFA 1PZFA 3OCVA 2P6MA 2I2BA 3DMFA 5GZ1A 1CVRA 4EH1A 4FC7A 9MHTA 4FI3C 3MYRA 1DIBA 3SIRA 3MHTA 3PF9A 4GZ6A 2FPGB 5HIIA 1BCRA 4IHAA 2BFFA 3OJLA 1H8ED 3R7DA 1E3SA 3CVUA 4BMVA 2CK3A 3MBKA 4A0FA 2E4UA 2GRAA 4BKRA 4RZIA 4A8TA 1P1RA 3HCNA 1SVSA 3S8MA 4F93B 4RTKA 3MQ4A 2F1HA 2NUPB 1U8CB 2AQHA 3KUKA 1WCXA 1EVYA 2FUKA 1Z26A 1J6UA 1COZA 2J30A 2JHAA 3HZRA 4FE7A 4H7FA 1GZHB 1T8TA 2VJQA 3V1LA 3KT3A 3RCBA 3PYXA 1UK9A 4CIDA 2GEUA 2QRNA 3OJFA 1H5UA 5KJFA 1OAOA 1TX4B 3F7TA 4LXXA 2PJRA 4DSZA 4L5AA 5EHXA 4BMDA 2WMNB 4I3FA 2NSLA 1Z8FA 3URMA 2PSJA 4UM8B 5KDOA 1G3QA 2WIDA 2Z83A 1IY0A 1VGQA 2WIBA 4Y2TA 5EHQA 4BFVA 3TR0A 2A1TS 1FCJA 3OOHA 5P8WA 4P7KA 1TCUA 2B5OA 5BQ5A 2JJ8A 4F5YA 4YLYA 2VA8A 1E8DA 4YO7A 3NH9A 2XADA 4TLLB 4GXQA 1SBCA 4OXQA 4EHIA 1BEEA 2OZKA 1AIPA 1WXGA 3NOOA 4GOND 5ERXA 1L9XA 2OGWA 3RUFA 1JZTA 2F2TA 3SR3A 4W5RA 2R96A 2PUVA 1M72A 2HWKA 4II2A 5MN4A 2EF1A 4E6EA 3A70A 2VP5A 3QPAA 4OHKA 3WL7A 5SZIA 1NW4A 3HR8A 4CETA 3LRXA 4FLMA 3ELYA 1E1LA 1VLZA 1Y6JA 1X70A 1QF6A 2KQUA 3UJ8A 3KOYA 5GP1A 2I4LA 2RH8A 3OPYB 3AF2A 4QU0A 4RBNA 3UGQA 5I8PA 1T5BA 3W0LB 4RJJA 2C3UA 4Y1GA 4PSDA 3ESQA 2BBSA 1E2KA 3KT8A 2W6ID 4HDRA 3RT1A 5SZJA 5TQ0A 4MRNA 2D0IA 3FFWA 4FFBA 3C5VA 3OFKA 4S1TA 3RVKA 2WUGA 3TSCA 3CX7A 3VAZA 3AVUA 1WE2A 2G1AA 4CE6A 5FO1A 4C7VA 4UTRA 5I01A 3T7KA 3U44A 3BWCA 3H18A 2P1DA 1JT9A 3CO0S 3H1BA 4INOA 1XD2B 3R9WA 2B5VA 2CL7X 4E03A 4F46A 1PNQA 4KFCA 1QVZA 1LS1A 2O8VA 4HDCA 1CCWA 1NE7A 1TM7E 2HK6A 5LCXA 3JU3A 4I46A 5B2EA 4IOMA 5KMGA 3TQFA 4GT1A 2M1XA 1SU7A 4QG3A 4JLKA 1D8TA 1XRLA 3JYNA 2X6TA 1P6QA 2MYNA 1VYTA 3Q3GE 4GX5A 3B5EA 2ASEA 2VTEA 3DMNA 4OB6A 5EMHA 4YDRA 1B6RA 2C9CA 2H0RA 3NJ4A 5ECYA 4IJMA 1D1PA 2O19A 2A1UB 3HUDA 4LSGA 3EVZA 4JV5B 3AO0B 3FTPA 4DLNA 3FDIA 1XTVA 1Z4KA 3IULA 3VTAA 4C78A 1SNYA 1S1CA 4XSHA 4IVNA 1EDDA 2GZ3A 2B34A 3KBBA 4R2JA 4N47A 4ZMRA 5FTJA 4U7TB 1LC0A 3Q6MA 4XKJA 3LDUA 2I2AA 1LLUA 4ZEXA 3ODPA 3WLLA 5KKCA 3RC7A 3C43A 3OLWA 4MV8A 3VO9A 1P0QA 1TK9A 1ZH2A 5L3RA 4QASA 4F4UA 4IYRA 4S0XA 5AW7A 2WZQA 3GT7A 3Q0TA 3VNUA 4LOJA 4IY1A 2NZ2A 4M4SA 1Z5UA 3NP7A 2YCBA 5DB4A 2RARA 4CM6A 1VKZA 5AKZA 5B1SA 4D5EA 2I4MA 3LUBA 2OO5A 4IQ4A 2UV8A 4LS3A 2PL9A 1J00A 1O8CA 2H48A 2JFNA 3GH1A 1L1EA 3QVLA 4AWXA 4CKWA 5GIPE 3D31A 5IG2A 1UXKA 1JJFA 4P32A 4K40A 3L8ZA 4FJ1A 4G3XA 3OQVA 1NFRA 8LDHA 1CB0A 4KBFA 4M1WA 4K3UA 3ZTTA 3ZXXA 4DPLA 3C14C 3OEHA 3H1FA 1SKMA 1PZMA 1Q22A 2SCUA 5AMXA 2WY2D 1KE1A 1CQIA 1NKVA 1VI6A 4MQEB 1MX9A 1Y1SA 3L49A 5DCUA 5EWMA 3LPAA 3TKYA 1AK9A 3R0XA 3PSHA 4DSAA 1NUTA 3FZNA 1QV7A 3ZH2A 4CQLB 1YRBA 4KTVE 1WCIB 5I9BA 4CLRA 5LU9A 1HT1E 1XL0A 1ZISA 4CV0A 1H8HA 4QYMA 3BIWA 3BRQA 2Z3WA 3PHJA 4KIJA 2HHHB 1CVIA 1BFKA 1Y4DE 5CH8A 4D99A 3W6ZA 3GFVA 2Q4TA 4OQ4A 1VIYA 3FUTA 3K9BA 1ODKA 5H16A 1L4FA 4QJIA 3WLRA 2Z9BA 1X6VA 4D7AA 5CDSA 5HIAA 2OB2A 4KQIA 3W5SA 5JBQA 4IUYA 1SCUA 2R7AA 1ILWA 1RWOA 2YJNA 4G0QA 4IDGA 4IHJF 5KOJA 3S6JA 3GFPA 4Q37A 5HS6A 3ZNPA 1X1QA 3CLKA 3GLUA 4EG1A 2XEXA 3D0OA 4C7OB 3EGEA 5B53A 3MS4A 4F4IA 1DC3A 1H66A 1OV4A 1QUEA 2EYUA 2RH4A 3O5AA 1YFJA 3RFFA 2PD3A 2VRCA 1YJQA 2JCBA 1NBME 1RQNA 3GG2A 1UBMS 1J0CA 4HDRB 1X14A 3E8SA 3QVOA 4TSFA 3TE6A 1P61B 4K9DA 4XX0B 3WL6A 5C5DA 5KTOA 3K2QA 2IXBA 1KAHA 3WMRA 1MAWA 3ETHA 3R3JA 3NTOA 2P6NA 4S1PA 1YIOA 1E0DA 1WW8A 1TVMA 3PIIA 3RANA 2I4TA 3L5KA 2BEKA 4WEOA 4WXRA 3F5MA 1V3UA 4C5AA 1O94D 3KS9A 5COQA 2GFIA 3H04A 4R51A 3QKRB 1HEIA 5THXA 1LDEA 3I2YX 1IC6A 4XLLA 4P9NA 4CKZA 1MHTA 1FMFA 4TXNA 2E4AA 1WZUA 5KVQA 1V7CA 2PD6A 1U0EA 1S8FA 1SCUB 1Y3FE 3K6SB 1F7UA 2WU1A 1MT0A 2JRCA 1CUCA 1N5OX 2ZUVA 5F7ZA 3DDHA 3TNDA 3QW4B 2IZZA 2QJFA 3S5JA 4B43A 5CXUA 1VHWA 2EFYA 4RSMA 3RASA 3U0VA 5JY6A 1TLTA 3H97A 3HP7A 3HWSA 3W7AA 4YQZA 3ZJVA 4ITRC 4TQGA 3D6FA 4K26A 1ACJA 1D4ZA 4GG1A 3KQLA 1CQXA 1CK4A 2JI6A 1U4SA 1RRPA 3G7UA 3L6UA 1N0UA 2Q3BA 4JC5A 4A6EA 5JMOA 3G88A 1E3IA 1JA0A 3C6MA 1S2DA 2XKAA 3C5WP 4DIEA 2V7WA 1K27A 4EY3A 3GCGA 5JH7F 4R98A 4G1VA 1M2NA 4OQFA 5JT1A 2XWQA 4OSPA 2GD6A 3GT0A 3L7OA 3MJ4A 4JT2A 4IVRA 4OFWA 4B6QA 4F3KA 4XLTA 4JFAA 4HDMA 4DKXA 1B8NA 1OC2A 4KGXA 2ZUDA 5KSYA 5TMPA 1F06A 1Y8RB 1T6YA 1LK7A 1ZD1A 1TJYA 1LTKA 2DQSA 2OD7A 3FETA 1L3CA 3KAJA 1GKUB 3AQIA 2OEPA 3I2FA 4ZTZB 1Q91A 2IZ1A 3OE7A 1FDIA 4HMPA 1Z6GA 2RAFA 1A98A 1C9EA 2RH5A 2Y2UA 4H31A 3D6JA 1FSZA 2B3DA 5E2BA 2CFSA 2P30A 2P62A 2WVJA 3D64A 1Q0QA 3AY7A 4EA6A 3I9LA 3NEYA 4OBEA 4AMGA 1QH1A 1VCHA 4CTKA 3C8ZA 1QJCA 2FPLA 2ZSUA 4YJ3B 4JWKA 4MIEA 3I04M 5IM4A 2D1FA 1ONBA 2O57A 3L4EA 4R7GA 1R5OA 2HU5A 2IP2A 4TTRA 4X92A 1AGPA 2C8VA 2ZUUA 3QVUA 5KYKA 2XZOA 1XP8A 3GK3A 1KKMA 4L3OA 5ALWA 2ZQYA 2PLAA 1DC4A 5IDYA 1GADO 2LCIA 1RM3A 4GYWA 1YDFA 2AEJA 3DYVA 5C46F 5LA6B 1E8NA 3T3MB 3W3AD 1A8SA 2XWPA 3AZQA 4FTWA 3ZWOA 4CTOA 1SBNE 2ZYVX 4MGHA 1CEEA 4H7KA 1F2UB 1JSCA 4HBGA 4KUEA 3T7RA 4DMLA 3UC9A 4MUKA 1AKTA 1GDTA 1ZAKA 3AL2A 3PTAA 1SXHA 1E3WA 1MC5A 2A9RA 1NBIA 3VXKA 4OGKA 4L8LA 5C18A 1YVPA 4GBJA 5GONF 3M6LA 4HLCA 4HXEB 1IIRA 4D0SA 2REQB 4JT8A 4KPUA 3Q7QA 1WD5A 2IRWA 1PLJA 4PHGA 3ZVNA 4WBNA 4B3JA 4WUVA 2VYNA 5I5EA 4M7PA 5ALNA 3JAMA 1M0SA 1UFVA 4JEUA 1DAIA 5E4JA 2POCA 3V6MA 5IZ4A 4FFBB 4GMXA 2XMPA 1EDZA 1PTJA 3AI1A 5B58T 4XD7D 4DR6B 4N3AA 4HWRA 3A4MA 3OTIA 3SN6A 1IJFA 2PSFA 2HSEA 2WDZA 1QHHB 5I7HA 2XITA 3A6HA 4YGXB 5AJTA 5JFTA 3F5FA 2E4WA 4D3YA 2BMDA 2QU7A 1I4OA 1USKA 1II0A 3R76A 1V5IA 1XVIA 3ND6A 3GA7A 3LH5A 1L4NA 3G0CA 4YMHA 3HMKA 5IDWA 3VYTB 1U7DA 4MS3A 2WSYB 4R2KA 4ESHA 1GUZA 1B2LA 1U8YA 2ATCA 4ED9A 1DKPA 4AKHA 1M1UA 3H5TA 3QLUC 4J1SA 5MGBA 4V1CB 1SEPA 3KHKA 3ZCVA 2GOYA 1GCGA 2Q9UA 3EE6A 1LPMA 4IEFB 2YCLA 5K8JB 4JMPA 1YIDA 2XMCA 3R7BA 3KZVA 1ISJA 1M73E 2PGLA 4R4JA 5IF3A 4DUPA 1AMUA 2DY0A 2PWBA 2J67A 3THYA 1HORA 2IZOA 4ZO7A 4TWZA 3ZY5A 1JDZA 1EXNA 4D9EA 4ZQFA 4NR0A 1FSFA 3B3JA 3D6HA 5DULA 4C9BA 4LDQA 3GAZA 1DAMA 1IPFA 4TXMA 5G1NA 4EYSA 1NOJA 1NPDA 4GE3A 5JRZA 3COJA 3OMLA 4RJLA 2OP0A 3L5OA 3VFDA 2IYOA 4FILA 4XVCA 421PA 2ZRPA 4R01A 2A0FA 5TSDA 2CFRA 1FDSA 4RVDA 4BWYA 4YECA 4RZHA 4X85A 1KOGA 2X1LA 2IYQA 3VOAA 1GDDA 4P35A 4Y2YA 1IK6A 3DWGA 1X1RA 5CT5A 5CLFA 1P7VA 4TV9F 5JQGF 2DHRA 1AO0A 1UWVA 3L0DA 3E4CA 3OE5A 1QBKC 4I4NA 4TMYA 3SDSA 1JR3D 2OC9A 1F3LA 1TO6A 4G09A 1E9SA 4DSTA 3D4NA 4MAAA 2I03A 1K63A 1INLA 3EUAA 3HA2A 4FCCA 1UQTA 4MYSA 3UF0A 1EFVB 3GBPA 3BF8A 4RA9B 3QFHA 4DAEA 5KDDA 5FQNA 4ZXPA 2J5BA 1V11A 1VI2A 2HRRA 2QUBA 4IDBA 4PLHA 5DYGA 1CW2B 3RSGA 1A77A 4J75A 1YGPA 1T9KA 4N5LA 4R2LA 4W5HA 3VQTA 3IE1A 2AQKA 1AKNA 2ZJAA 3HN2A 4K3VA 2LCQA 4YBRA 2I4NA 2GCOA 4KLCA 2Y05A 5F7OA 4G97A 1XCLA 1Q7EA 2F62A 2GYUA 3QMWA 4XD2A 1NVFA 3E8MA 4PRZA 5K0FA 5DTMA 2A1IA 2PQMA 3CURA 1QHSA 3W8EA 1SCIA 3WO1A 4HAYA 4OL9A 1OWNA 1E7RA 2R86A 3CHYA 5TVKA 3JQQA 3L8GA 1FJ2A 1JFFB 2CJYA 1YRLA 2FZEA 2YHIB 4LOHA 3UOGA 5J23A 3PEYA 3BE5A 3EVEA 4BYMA 3ZJTA 1RQ7A 2ZTSA 3SAJA 3WNDA 4RV5A 4MV3A 1TPYA 5KVAA 4X8OA 4DDUA 1UJ6A 4DM7A 3BSYA 2COUA 1I2DA 9ATCA 3NFRA 2FG6C 3IKVA 3OLZA 3CF2A 1SQ6A 3JQRA 2OV3A 4DG9A 3MOSA 2A92A 2Y6UA 1DRUA 4BBJA 1E2UA 2GR9A 2ID8A 2JS7A 1YWGO 2R6DA 2ZB7A 1QH8B 2R25B 1U2QA 4O2AF 2AFHB 1VE1A 2B1QA 2KB0A 5LMNB 3JQAB 1MB0A 3RHZA 2DPLA 3ZY2A 1LLQA 3GJ7A 4DLKA 4Y9UA 5EJ6A 1DIRA 4UFNA 3K1AA 2HCTA 3LKBA 4B31A 5KJCA 3U7IA 3C24A 5H8WA 3TLKA 3E6AA 3WV5A 3RBZA 3WWOA 2B9VA 2G8NA 1DBSA 3DE7X 5DM1A 3I01A 1ZY2A 4FZ5A 3HU2A 3IHKA 2WAAA 4PEVA 4Z9YA 1K3TA 1DEAA 2ZVJA 3T95A 3JQEA 1DEKA 1KGSA 1NN3A 3IBSA 3K0FA 4CTNA 4RJTA 3CYFA 1A1SA 1ULAA 5J4VA 5C7YA 3RVLA 2H8GA 4QBTA 1QX4A 2YNMA 2B4QA 3FDXA 3JWJA 1P91A 2DPHA 3V6LA 1GSAA 1UBKS 3IE2A 4NZOA 3V4LA 3PQEA 1JJIA 4FNMA 3KETA 5ER9A 2IYUA 1TXGA 2P79A 2F43A 2W7TA 1UWCA 3JPYA 2YRXA 4BMXA 1U0JA 2VQ6A 1PNVA 1TZBA 1B8PA 4IQ8A 3D7NA 4TXLA 2PNJA 4OQLA 2FV8A 3ASYA 1F6BA 4EHNA 4E12A 4PZPA 4U2FA 4PSVA 1V9LA 1CNMA 3MC1A 3CEHA 2RGGA 4NBUA 1QE5A 1EM6A 1ZD8A 4HGQA 1FMTA 2P3OA 2V7UA 5TMBA 1GV0A 3RODA 1V41E 2CGEA 1JIIA 3HXMA 1ZHFA 5KYWB 2OA0A 4DJTA 2XODA 5AKKA 1YC2A 3T1YB 1J2UA 3SR0A 4ZVPA 3HCFA 2JASA 2KI5A 4QOHA 1KY4A 1PDWA 1UXHA 1ZRNA 5AHOA 3KB1A 2FY8A 4II3A 5E4TA 5AXCA 4TYNA 5IVKA 4AKGA 1N3LA 3UATA 1Q3TA 2W4MA 3BD8A 2YWHA 3MPUA 5E6RB 5LQDA 4PGHA 2X41A 1GTJ1 4EVRA 5BV7A 1I5EA 4YX9A 4RGQA 4G9GA 4X7MA 1WMDA 5DM60 1IVYA 1PGQA 1X7XB 2GYVA 5GTDA 1LBQA 3EMVA 1Q7BA 1Y3DE 1XD2A 2WIGA 3BHJA 4RY9A 1CQJA 2Q21A 4GXRA 2E48A 4LUCA 1W49A 1TL7C 4HQRA 4HNTA 4I9FA 4R71A 3PXGA 4ARCA 1LBHA 3ICWA 3U5ZB 3BZUA 1G2OA 4D4MA 1O9HA 1YBAA 3Q1LA 3VR4H 4C87A 3H6GA 1YA4A 5FKJA 5GY7A 5AVUA 4CKYA 1CRWG 1MABA 4OK6A 5FBKA 3LF2A 3K1AB 1GRCA 1P18A 2VK8A 4QBGB 5A5VA 2UZ4A 2X8BA 2ZAOA 3DCJA 5EWLA 4F4JA 2DT8A 3AEKB 2GETA 3O0TA 3W5CA 2VJOA 4HD8A 4I66A 2X8JA 1KNQA 2W70A 3A6JA 4PZCA 2V6FA 1CQPA 4MVJE 4UPVA 1G8JA 1DWPA 5CX1A 3WRXC 2GYYA 2ZRMA 1Z07A 4NZPA 4B5LA 5JISA 3AEUB 1DCKA 5D6NA 3PFCA 4GX1A 1XPOA 1CUFA 2QTCA 1MAAA 2AR9A 4BECA 1SQSA 1Y5IA 3AK4A 5IJ9B 2VHVA 3HUTA 3MOIA 2JIPA 2C7BA 4D98A 2R3SA 1OW3B 1ZOOA 1SG6A 3B48A 4ZI7B 1UM9A 1FSGA 1S2IA 5GOTA 1OA0A 1X1AA 4KAAA 1EXWA 1Y1RA 4M83A 2W6NA 3D5TA 3LY7A 2HHLA 4WCFC 4GMHA 2DR0A 1DIAA 3CNQS 4O4HA 4TWJA 4D56A 4ENWA 2ZXFA 3IEUA 5JEEA 1WBJB 3FTFA 5LKRA 4JI7B 4LRQA 4L78A 4M9SA 4AP9A 1PJLA 3E4DA 5EFZA 4URXR 5K0ZA 1Z12A 1ZM2A 4YRNA 3BXXA 4AF6A 3RUPA 1AF4A 1N2OA 1H2WA 3FI9A 3IBFA 4OLBA 3DUFA 1N2HA 4F7DA 2H11A 5I9SA 5BR7A 3UM9A 3WICA 3NCHA 2A1TR 2O8CB 1KVQA 4BVHA 1O54A 2GHQA 2XYGA 4LCEA 4UNQA 1E4OA 1ORIA 4BNTA 4C43A 3ZD6A 3OEWA 3AJRA 2QOEA 1RHMA 2JA1A 3AFGA 5K3DA 4CCSA 4U0JA 4BMYA 3UB3A 3E48A 4OP2A 1ZGCA 2PGJA 3CLRC 1JDVA 4RW0A 5BMVF 1YFZA 1NX6A 4YCCA 1NMYA 2HMTA 3AOEA 3VX4A 1QQTA 3AU8A 4XFKA 4MHTA 2PYDA 4G1EB 3PHCA 3ZVLA 5U1PA 4AIIA 1P9RA 2ECKA 2Q2VA 4QEZA 5BWOA 1IEQA 3L02A 3PQ5A 2HT6A 1O7JA 4JI3B 2O1WA 2BM8A 1ZOIA 1EFHA 2YWDA 2ORIA 3V7UA 3QX7A 2Q2QA 4X6LA 1TOAA 1M8KA 2WC1A 4JBHA 4C0KA 2NYUA 1PX0A 3RIGA 4OM7A 1V7QA 5BORA 3KUDA 5IF9A 3VDRA 1I3OA 2H63A 2ZBQA 3H2YA 1Z35A 2LD4A 3JAKB 4J0EA 4NPHA 4BKOA 1K8RA 2GBLC 2IW3A 5AVJA 4WA7A 4A0GA 3QUTA 2RHCA 1OTXA 1UIRA 2Q9AA 4FOOA 4MWCA 4I9HA 1FFGA 3GPIA 1U0RA 1CC1S 2F59A 2ZYTX 4IGIA 1PFKA 2BSQA 4BVLA 3VZDA 4GO1A 5LL6P 4GOOD 1WMBA 2CV2A 4HDSA 4YVFA 3KDPA 2V4ZA 4F38A 3CV3A 3EXEA 2YZ7A 3NCTA 4IL5A 2D2XA 3BIJA 1V7ZA 4OAOA 4C4ZA 2ZRIA 1X80A 3NTRA 1WU7A 3R44A 1EB8A 3PPXA 1D9ZA 2VDOB 2ZB3A 4NZNA 1GRRA 4G0UA 3SC6A 2D13A 2V7PA 2HWXA 3NYRA 2ODEA 3P9KA 1XCPA 2AA3A 3GEEA 1FP1D 4PHHA 3L0ZA 3CUUA 3MJCA 3QFSA 1L7EA 1QFMA 2VXOA 3V4PB 1WHSA 3W06A 5HJEA 4NFYA 3G5AA 1P5JA 4GR9A 2HSZA 4MR8B 5FR2A 2TMYA 1FDRA 4PPQA 3VZQA 2FX3A 3A9SA 3QHPA 1PLLA 4KQFA 3ECAA 3UQZA 3WGMA 4DSOA 3PC7A 4DC0A 3MJTA 5BNWA 3N0RA 1R3DA 4PVDA 1I4TD 4IV5A 2IVFA 3QIVA 3EAQA 1BX0A 5AVQA 4DZZA 2C8JA 2FRDC 2IF2A 5JXJA 3QUSA 2TS1A 4D74A 1VIVA 2JIMA 2C97A 3EH1A 2GVZC 2BHTA 4Q4CA 1ODLA 1AHNA 4QOSA 4MS4B 1XWFA 2XD4A 4X6UA 4EZBA 2CUTA 3IDQA 4OH1A 1R00A 2W2LA 2GAOA 4L5YA 4PHCA 5EJAA 5CEFA 3ND8A 2JL1A 2VWHA 3T4PA 4LC9A 1RM0A 1K6IA 2I62A 1OX6A 1TJNA 1W4ZA 5LBTA 1O08A 1PTJC 2J3LA 5IP5A 4LRTB 4WJKB 1NXQA 3AVTA 1GCOA 4U6QA 3CUWA 3RRZA 4IW3B 1NN5A 1F9AA 4DQUA 4L8VA 2A4KA 1I5RA 3R0JA 1ZNZA 4BO3A 5C1OA 4IDDA 2HA6A 2W98A 3PDHA 3NG1A 4OXKA 5DV9A 5I8WA 2CV0A 1UOOA 3BX1A 2R8ZA 3BTUA 1N5KA 2VYQA 3F47A 4X7PA 3KHTA 1OLUA 1IYZA 2AOTB 2L2QA 2WG1A 3IT2A 2C95A 2VRBA 2PTGA 3C6XA 1F14A 1D2NA 4IHQA 1J25A 1UM8A 3CIOA 4E15A 1KDPA 4G2NA 4RX1A 3LVQE 3WGVA 1YR2A 4FYVA 3OTHA 4XGIA 1U0SY 2Q4BA 5BVGB 1WPRA 2DH5A 2UYHA 4D6XA 5ALUA 3FA2A 1EG7A 2QP4A 2H16A 3GMSA 3RK0A 1NVUQ 4HFMA 2Z6AA 5A5DA 1BJRE 1T5SA 2UDPA 3AR7A 2B4RO 3MLAA 4BPRA 1NVEA 2W6IA 4PAQA 5UKDA 1F5SA 2IU3A 3LSYA 4NDAA 4BBPA 1WG8A 2QMZA 2OM2A 1NXXA 4X1KB 5BWNA 5BURA 5FA8A 4EYOA 3K8ZA 1PW7A 1IK4A 1YQ9A 2M6SA 4RFSA 2OAQ1 1QQBA 2MHCA 3UKDA 4DF3A 3HL4A 2C54A 3A3PA 4H0NA 2Z08A 2HIHA 1K8XB 4X91A 5J5VA 4B3HA 4ZYXA 3QG5A 5J4LA 5LMUB 4XVQA 5TF0A 1MGOA 1J56A 3LO8A 1QIGA 1A2QA 3HKCA 4FHGA 4H17A 4QG7A 5U4QA 1V8PA 4O08A 4ZQCB 3W9UA 4CU5A 2CV1A 2FB9A 2JBAA 4F86A 1V1MA 3DZDA 1N5DA 2X6RA 3CBQA 1SUFA 2BEVA 2REXB 1C2YA 2RK6A 3BWMA 3ASZA 3GLVA 3OM8A 1NNUA 4LXGA 3CLSD 1SD5A 5F1KA 7YASA 3KE8A 3EPRA 4AX8A 1J9ZA 1O0SA 2GJAA 3C3PA 4RMIA 5AK6A 4B6JA 2QZ9A 2ZVQX 2PUWA 1ORWA 2VQEB 3BQMB 1COWD 1E64A 4RIGA 3VPDA 1YFLA 1G6HA 3K0CA 4NOKA 5KQGA 3G1UA 4WHMA 3O03A 4S35A 5LBIA 1NAIA 2HEGA 1PZEA 1Z8HA 4HC4A 4V2UA 5K8UA 4JQOA 5CIQA 4BTEA 1TGYA 2R6AA 3ESDA 4PZAA 1JEAA 5FTMA 1JLLB 3VBCA 3OBBA 4KQHA 4UBMA 4E30A 2FPPB 1HZZA 4QNNA 3COVA 3G23A 4HDKB 3IKJA 4I36A 5GIOE 2QTMA 2JFOA 1XDBA 2BFAA 1TD1A 4FYWA 1Y5NA 2YW2A 1D4FA 3WC4A 1WULS 1JSLA 4TZTA 3SEAA 2NXJA 2G3YA 1YZHA 2Y9PB 1U7WA 4HAOA 1DBPA 5LQSA 1PYDA 2P2CA 2ZAGA 3REOA 1LPBB 2LBPA 3N2IA 1T3HA 2WIFA 3FAKA 3EY9A 2DMRA 3PITA 2FXVA 4LJKA 4OPMA 1E3DA 1OQAA 2J4CA 2L69A 2VZ8A 3Q7IA 1UZUA 4M9QA 3CMCO 3COZA 4M7OA 4RJ2A 3T7AA 1OZHA 1QCZA 3KQOA 1ZIPA 4QUGA 4AKEA 1XLUA 2XMZA 1CZRA 4A82A 1S4MA 4MUNA 2JAHA 3ZHYA 2JFFA 1BFUA 3VAAA 3D0RA 3DOOA 4XDYA 1RC1A 2FMUA 3D6MA 3HEAA 1CUWA 1H6CA 1XZLA 2AZMA 4Q93A 2DFDA 3EH2A 4R81A 3HCWA 4URVR 2HMUA 1I94B 3RREA 2FMTA 4PW0A 4X84A 2PMWB 4FKBA 5CNMA 4UKDA 1J70A 1PU2A 5AM0A 3B1FA 2BN4A 5TC4A 1D1QA 4E07A 5JVDA 2HTEA 4H6XA 2X0DA 1MJNA 1P7ZA 3ZLUA 1SCQA 3TG2A 4QOGA 5FQOA 4DC9A 3LNCA 4G8DA 5DLDA 5FNZA 1M2VA 3CBGA 4RHFA 5LQKA 1MHPA 1OGYA 3Q9NA 4PCLA 3R3XA 4Y9TA 1W87A 1C2TA 1SCNE 1G8HA 1L5ZA 3JQ9C 1MP0A 3HUEA 1TJPB 1WU8A 1UPTA 3JPWA 3TW4A 5HKKA 4PR0A 4YXWA 1XFAA 1JG6A 3L0PA 4WKCA 2Q7DA 1U9CA 3IDOA 1UXGA 1BOFA 2ADOA 1UDAA 1XN4A 3FWNA 2EZTA 3T4XA 4EG7A 1EFPA 1Z2OX 1H23A 3CVJA 2Y4OA 3M4NA 3QU7A 2X86A 1VJTA 1G7SA 3LIIA 1JYSA 4FWIB 5BV1A 2P90A 4UVEA 3HXOA 4W4TA 4CMHA 2QLLA 4N5DA 1VI5A 3BFJA 2YMLA 3BVPA 4ZYZA 4O1IA 4GR5A 3ZWYA 4K9NA 4OK3A 5LP6C 5EZQA 4LMPA 1WUTA 1TB4A 3PRYA 2C03A 3G2JA 1UFRA 3KOMA 2G0AA 3PLRA 4O3MA 3KQYA 5FT9A 3VPFA 4D4GA 1J99A 1XKLA 3QEBZ 1NNEA 2E6UX 4L95C 1JHUA 4AP5A 2GBIA 3I9MA 4WZ6A 4UOZA 1BGWA 1ZP6A 5BN3B 1XJ5A 2Z5FA 3O3OB 4QDJA 3T4EA 4OBWA 4HXGA 3P2YA 5LJLA 2ZSHA 4QEDA 1B6GA 4QO7A 5DLYA 4Y2PA 3M82A 5BN4A 3KV1A 4N82A 4RDCA 4YJGA 3ZQKA 4FYJA 3N28A 3PENA 1KC3A 1RLJA 5NULA 4LFCB 4A2PA 4C0QC 3T5GA 1RLUA 1LTHR 1ZWKA 4L1KA 1L0BA 3GIWA 4IVQA 4MRAA 4DLRA 4FB5A 2WT8A 2F67A 2HQRA 3R23A 1GPUA 4XOUA 4C30A 4QJBA 3D6TB 3T54A 5I7WA 5IUNC 3E7WA 1K97A 3KLBA 1ZQ9A 3PPWA 3SEQA 3C3KA 4GX2A 1Z13A 1ZW1A 4F7WA 3K70D 4HNAB 4LHEA 4ZALA 2QMUA 4M7RA 4DANA 2BI4A 4CIYA 5AM1A 3ER8A 1KIFA 2I3DA 4GOMD 3SU8A 2X5XA 5COAA 3B78A 1I2BA 1F8GA 4NXMB 2WHEA 1F3OA 1EJ2A 2X2OA 4J07A 4CL8A 1NHGA 2PQ6A 2PMKA 4KXMA 2R1TB 3KR1A 2CXRA 5DJ5A 4MV0A 1QP8A 1G8SA 3M3DA 4CWAA 3GUYA 3CW2A 5B4UA 4J1TC 5CNJA 3GCWA 2FDXA 3L1VA 4IG9A 1JHVA 1O5TA 1L5WA 2H9IA 2QROA 4DIDA 2FR0A 5DHUA 4BC0A 4QDKA 5ALPA 2RIRA 2J9GA 2FQ1A 3FGPA 4GWKA 4J9VA 3SBXA 2ALJA 4CR7A 3SX0A 2QR3A 3HM9A 3MJEA 1NQWA 2JGJA 2WW8A 4PXYA 1I5OA 1C7IA 1V95A 3B2QA 4AXBA 4D2IA 1KQPA 4MQMA 3R7WA 2JAUA 4IH4A 1G5HA 4DA6A 4LECA 3AF5A 3ROXA 3IE0A 4NPAA 3ZHUA 2A3RA 5HQ3A 4NI5A 2V54A 3G0DA 4L0DA 3EK2A 2PSSA 2O7NA 2EBFX 4UM5A 3EC2A 2DECA 1XX6A 1ST3A 4CMCA 4AB1A 3AR5A 3F78A 2GHIA 1YI8A 3R5KA 5DHRA 4C0AC 2XUKA 2HWUA 2VBCA 4MTCA 3QE4A 4Q7LA 1BXRB 4W6QA 3RNLA 5AVTA 5TQ2B 3D3EA 1VMKA 2R65A 3A2KA 1XEAA 1TAUA 3WSWA 1WXHA 4MQ5A 4A10A 2A0YA 4PLGA 5AOVA 3ZHXA 1OI2A 3DCIA 1A72A 4MI6A 2I8LA 2Z98A 3CPEA 4NP6A 3TQHA 4HUQB 3U7RA 4R8VA 3FSJX 2WIJA 1XKXA 2Q8PA 4LE2A 3DP9A 4P4TA 3WFIA 3ANSA 3KQMA 3HB9A 1Y6QA 3LYUA 4L7VA 3UG6A 3Q10A 3DZIA 3IPCA 4LJLA 3LQFA 3AHJA 3OUUA 1GT91 5KIAA 4RHUA 1F7VA 1JJ7A 4I1RA 4LYJA 4TS1A 2RD2A 1FTNA 1EAYA 4X90A 3WQRA 5CLJA 4N1AA 2CJWA 3CUKA 1DIGA 1DLJA 1T4BA 2OXFA 2ZWPA 3B1XA 3FSEA 3WIEA 5F2NA 5J3JA 3AEKA 3DONA 5T67A 3HSKA 1VP3A 5EWLB 1J8FA 1LW6E 2QRVB 3KJQA 4OHVA 2ZUEA 1JAHA 1OU0A 4N3NA 3FSRA 4PX9A 1BE6A 2IA5A 2EIHA 4N03A 2QRVA 3HDGA 2JFWA 3BXHA 4WEQA 2FSUA 4MX8A 3JQ7A 4MMYB 1BFDA 5ESWA 2O2XA 1B8UA 1LPPA 5LQCA 5EJ8A 3S44A 3WYEA 4HQNA 2XCTB 3PDIB 3UJDA 5C53B 3G6KA 3N0TA 2GPYA 3ZGOA 5C8ZA 3KQNA 3K16A 2CJXA 3ICPA 5ILQA 5T41A 3IC5A 3PGA1 1Q20A 1CUEA 4EEXA 3A1NA 3ZR4B 1SURA 4DMRA 1WPGA 1VYVA 2PMBA 1J0BA 2X5OA 3V4SA 4P3XA 3QHQA 4AN1A 4BXOA 5KWJA 1PD0A 4LAFA 5LWHA 2MJLA 1NL3A 2DGDA 5HIJA 2F7SA 1K6JA 2NM0A 3GPDG 4LWZA 2MIIA 2JGAA 2E4XA 3IQDB 3IUNA 1B15A 1O94A 2O5CA 1EIWA 4J1QA 2H57A 3L6OO 3EDQA 5BR8B 4NEHB 4CLXA 4YQYA 5CB0A 1Q0RA 1P60A 1XLTA 2YS6A 2PMCA 4E4TA 1YR6A 2FHSA 3F7NA 4KQKA 1FYDA 3HKBB 1FF9A 2FG7C 5SYNA 2JIOA 1QWSA 2Z3ZA 2WWRA 3P32A 1P81A 3L01A 1NASA 3GLTA 5GZ3A 2O3JA 3WI7A 1P31A 2HLDD 4DQDA 2NWQA 1O95A 3KIPA 4MI9A 2IDMA 1WDTA 3GLGB 3EFBA 4M38A 3CMMA 5KYUA 3JR7A 4LZPA 3WGJA 1X86B 2Y66A 3KAKA 2CSXA 1EUCA 4RLQA 1ZN9A 1HO3A 2OAP1 3JRXA 2G40A 4MRVA 3UMRA 3OKCA 2PWZA 2ZUFA 2BKUA 2YOGA 2XT9A 5LYJA 5EIEA 2DWCA 4IDQA 4BLWA 4KUGA 3Q7EA 2I3BA 4UZSA 3OX1A 1JQEA 2C4MA 1ZJ4A 1DKNA 2WUDA 3L07A 3TXYA 3IXMA 3NNSA 3DE1X 1AUPA 4TYMA 4UTXA 1BVUA 1M33A 4R1TA 3A28A 1CE8A 1RPAA 4XZ3A 3TO5A 4ZODA 1RJEA 1GQRA 1IZ0A 4BATA 1KNXA 4OHYA 2I5PO 1FQJA 1KFEB 4D9NA 1Y8QB 4MWSA 5EFOA 3FOEC 4AY6A 2DYKA 4GXNA 2FR8C 1TYDE 3IS3A 3TOCA 3S81A 2P75A 2PY6A 3LE8A 3HB4X 3Q3VA 1AU9A 4M87A 1PNRA 5GVRA 5TT1A 2C8LA 1QTIA 1PZGA 2QXTA 2WD9A 2WFMA 3FPJA 3VI4B 5JSZB 3G1WA 2ASVA 2RGXA 1O1YA 3L93A 4MPRA 1L7XA 3LRPA 2CUNA 2NU9A 2PJZA 4DDVA 4JKYA 4IZIA 4WWHA 4CJXA 3CS3A 4PTZA 1C8LA 4FYPA 3ZJ4A 4X8MA 3T9FA 2PL5A 1KMHA 4HG2A 1O03A 2WD8A 4E08A 1G3IA 1MOPA 2DWQA 3OETA 3MTAA 5EJ5A 2D54A 3TLZA 2Z2IA 3DV2A 3P0HA 5ITVA 2GGSA 3OA0A 1LLDA 2H7XA 3BHNA 3H1AA 1X39A 3L9WA 1ETUA 4IF4A 3DZGA 4Q3BA 5LZ5A 3JSXA 2YIDA 3DBIA 4FFSA 2B20A 3GJ5A 1V2GA 1PV1A 3DM5A 3KU4A 5U4XA 3T9CA 2YN0A 4UBKA 3UGTA 1WF3A 3DE4X 1YZFA 1U8XX 2NYVA 3B5IA 1YK0A 4IDFA 5CB8A 1KK2A 1G20E 1R6AA 3P0IA 5EJIA 3IO3A 2FDRA 3DAYA 3W4KA 5BSGA 2XGMA 1WY7A 1BG6A 1WDLA 3ONVA 2BFNA 4HY3A 4GRIA 4LF6B 2YWBA 4GQIA 4QL3A 1M8JA 2YYSA 1NVWQ 5BVGA 3H17A 3KVRA 1G18A 2OBFA 3I2IA 3HWRA 3NV9A 1I3KA 4NBNA 1UFQA 2C77A 2FPXA 2Q28A 3IAXA 5HFAA 5A5EA 4O29A 5LP1A 2JFQA 4ZO6A 4Z49A 1Z38A 3WJ7A 1GFWA 3KJHA 4YI5A 3F8TA 1DQSA 4DYVA 1U7XA 2DHDA 1OFUX 1U9IA 2VJMA 3GX1A 2ZSBA 3CXRA 3MOGA 2JZCA 1P0MA 1LV7A 4L5BA 3GD5A 3O4IA 2Z8YM 3ZJYA 2H59A 1G291 1WA5A 2B7CA 1E3JA 3PFBA 4D0GA 4DNFA 4F9TA 2EP8A 4B2LA 3VJMA 2XT0A 2WI8A 3LQQA 3OQOA 1CG6A 3LQ1A 4HLNA 1E2EA 4QQKA 3CEMA 4RGYA 3NEJA 4BNNA 1EFUA 5A2GA 2WEKA 1ZD5A 1A2KC 3VDMA 1I3CA 4JLUA 1E2IA 1KJNA 4RPCA 2CNKA 2GM9A 1S3SA 1SXGA 2Z1DA 2M6KA 2QYTA 2R8XA 2RB4A 3H2SA 2FUEA 4BNHA 3L8EA 3IGFA 4BX0A 4CCAA 4RAQA 2RH9B 4EGQA 1DDIA 2FPSA 2XDYA 5ELLA 7REQA 1H2ZA 1JXOA 2CMDA 2IDZA 4MW1A 4N4AA 4P7JA 1ZMBA 3TTVA 5IZCA 3ORQA 2JEZA 3V1NA 1XDZA 2WHXA 3O8OB 4C08A 1DKQA 1JIJA 5L7YA 3V1YA 1N4DA 1YQWA 3VJLA 2Y3IA 2XGJA 3IAAA 4EMSA 4Q9KA 5D00A 5EY5B 3U4DA 1GR1A 2R84A 3A10A 1P4GA 4DABA 3VSBA 4Z3OA 2MSDB 2O2ZA 3F90A 3NM6B 3TZQA 1ZLYA 4ARSA 4EJ2A 1SU4A 5ILOA 1GPLA 4V1CA 3JARB 3QX9A 1NW3A 1YZYA 4M1OA 3VR6D 5DGCA 2BYTA 1Z5WA 4LWPA 1KH1A 1NJSA 2I4RA 3QVTA 4YONB 1EDOA 1O6FA 4K03A 2CVPA 2VHZA 2IXTA 3QZUA 3IERA 4I3HA 2QPLA 3BQNB 5IT0A 2RGCA 3I45A 1Q16A 4W1RA 4MICA 3JVDA 4JBWA 5EMLA 4QUJA 3SC2A 1UBNA 4Y9RA 4C5BA 5HWSA 4URYR 2JKZA 5J43A 3QE2A 3F97A 4IGKA 2YV5A 1Y9EA 3J7AC 2WJHA 1MNQA 2QMEA 1TLLA 1T36A 4KQCA 4KSYA 4EL5A 2JANA 3CNOA 3TLJA 3ZW9A 5IBCA 3T1TA 5KO2A 2IXFA 4WNAB 2ZRGA 3C41J 4QPZA 2YHBA 2KX7A 3ZS8A 1ZH6A 3ZU4A 1PR9A 2DHCA 5CFLA 1P75A 4MW6A 2OOKA 3WJAA 2J6BA 3AVPA 3GRRA 3E0XA 3VYUB 1IBKB 2IXDA 2N47A 4REMA 1SQ0A 3KR2A 4RZSA 1FX0A 2NX2A 2B6NA 4PQYA 1TQ6A 5FI1B 2B2CA 4DW8A 1TTTA 2A7QA 1YDEA 5J4YA 2J31A 2Q9CA 3W1WA 1HOXA 4B7AA 1VXRA 2AMVA 4ZVVA 4E13A 1KZ1A 2HNAA 3O6VA 4EARA 5B1DA 4HYQA 4YT4A 2XTAA 1KGDA 2MSKA 3EMKA 4JU8A 4TS3A 4PNPA 5BQOA 4ZHSA 1BIFA 5A1JA 1BE8A 1M1YB 1SBIA 4NBWA 5JAMA 5DSZA 2PM8A 1FVFA 4DV3B 2FPIB 4HS9A 4OOFA 1HMPA 1R18A 2XZTA 4BTVA 2VP9A 1EWYA 2XNCA 2AX3A 4KE7A 2GJ4A 1CUYA 2WUVA 4HQKA 3STTA 4NOJA 4Q7QA 2B2XA 4MP6A 3QEAZ 1N6LA 1A9PA 1TF2A 2PCJA 3IDAA 2LKDA 3QVWA 4XIFA 4XYMA 2D2FA 2VK2A 3FYUA 5E1OA 4ZCSA 2I99A 4I55F 3RRNA 3ZIAD 5LPNA 4Z4EA 2ZR7A 4Y6RA 5REQB 1YQGA 2OHJA 4XFDA 4F72A 4PQRA 5C8XA 3ZE2B 3U1BA 3ZWWA 1IOVA 3BQ9A 3U26A 3ZEAA 1NDQA 4DA8A 3CW8X 1ZK2A 2GT1A 5BSKA 1CUSA 5JSUA 1JBKA 4C22A 2QVYX 3Q8WA 2WF9A 4D57A 1MD9A 2F3RA 3JRWA 4ZYTA 2EV9A 3NUGA 3G8CA 1UFKA 3NHAA 4G37A 5CFNA 4IHJA 4Q4JA 1V8DA 5BVHB 2F4VB 1QZUA 4NLLA 1P2UA 5EP3A 5HSGA 1RPZA 4CXMA 2IYZA 3DPIA 3OH8A 2XDQA 5G4KA 3S28A 1Z08A 3ZPXA 1CZUA 3VU9B 1MF7A 5E3IA 1JEJA 3IP3A 1NOKA 3I8XA 1NI5A 1G21A 3FKJA 3M0EA 1Y5MA 2O5VA 3NALA 4G56A 3Q9LA 1ECGA 2QR5A 2VDVE 4WK4B 1GZDA 1T6NA 3RARA 1WCIA 4YYEA 4AUNA 2BLLA 3W3AH 3BD9A 2ONKA 4WZAE 4OREX 1A95A 2B78A 2DWPA 1GXSA 3N2EA 4RTNA 3GXBA 2O52A 1H85A 5EP2A 4DIFA 1OLXA 2OSVA 1CT9A 2ZI9A 5D7NA 3RJZA 3NUQA 4P93A 3VU8A 4XQGA 4B44A 3F0TA 4KQ2A 4YY3B 1YIAA 2E9SA 1NQ5A 1Z0KA 2NQTA 2WNIA 2ODQA 4DCMA 2CL5A 4KPGA 1SPXA 1ZK4A 4H08A 2DQKA 1J39A 4IRUB 1MORA 1A9ZA 3KAQA 1O97C 3PVZA 4ZZ2A 4AQDA 4QAJA 5CG1A 1LFDB 1NT2A 1YBFA 2Y1LA 1C0LA 1HMYA 2YMQA 3GDHA 3KNZA 3DCNA 4YV0A 4MO2A 2ZS8A 4OJNA 1E9RA 2CY0A 13PKA 1V1MB 3MD9A 3VUFA 2E4YA 2IL1A 2HRZA 1F38A 4BAZA 5J40A 4BV3A 2R6FA 1HDIA 4KLAA 3RU9A 3I2HA 2W5UA 3VVBA 2Q27A 1MNAA 3B60A 2DC1A 3H5VA 4E22A 4HTAA 4E70A 4XFJA 1J8QA 1IN7A 3M2PA 4WVLA 3IBGA 4QQRA 5F1OA 3QVSA 1M75A 4HRAA 1T9GS 2FN3A 1DBVO 2ZSDA 1HQYE 3EASA 4W9RA 4YR9A 1P4SA 4UULA 1ADJA 2WF8A 3VMMA 3KBOA 1TYAE 3LCUA 2II6A 3O7MA 4C2BA 4WN9B 2DLNA 2EFEB 2M6LA 3L8MA 3LBFA 3EFOB 3HO6A 5LZ7A 1XQVA 4GPZA 4OMDA 5ULLA 3UWPA 3THWB 1EVLA 1MRSA 3BILA 1IRXA 4QTUB 1G2IA 2VBIA 3C1OA 3DGFC 4XYLA 4BX2A 1KTIA 2VZLA 1JT2A 1RHQA 3QI2A 4EL0A 4G36A 1NBOA 3ROFA 2W2LD 3DTVA 3SP1A 3HXTA 1S0UA 4YRAA 4URHA 4ENUA 4L8FA 4NL4H 4L3WA 2WFLB 1ODIA 2AYYA 1GG2A 2XCRB 2AVNA 4JB2A 3EISA 2JGKA 4GW3A 2BGIA 5A71A 1L4KA 1H3EA 5BW4A 4WDQA 3DYBA 3JQGA 3L7BA 3L6CA 4I5GA 3GLQA 4FVTA 1OV6A 3CVXA 1QGYA 4YREA 3RGWS 1I4LD 3V3KA 4DRXB 1PRYA 4M86A 1V45E 1H4QA 3GFOA 4GYYA 4XQ0A 3IYLW 5EA2A 4GLOA 2P6UA 4FNGA 4BCCA 2GPWA 1PWHA 1GKIA 2QN1A 2YVUA 1NFQA 1SVUA 2QD4A 3IEIA 3NT2A 4K6KA 4NCJA 3OO1A 5G0UA 3KK0A 1LBSA 2DM6A 4P0PB 4WASA 5BRAA 5DNCA 3B6JA 2CVQA 4XJTA 3NIDB 4FOSA 2C3PA 1XMPA 1R16A 3GA0A 3FCOA 2FJPA 1BD3A 1QORA 3LDHA 1GGFA 2CDNA 1HQKA 4Q47A 4YRZA 1VE9A 4HEQA 4S04A 2HHAA 3VZRA 4C6HA 1RWVA 1HE1C 3VYWA 1T5TA 5JAIA 1B23P 2DJ5A 1Z3IX 1UWKA 1BGXT 1ZVKA 2XDQB 2ZB2A 5ICFA 2FW7A 1ZVQA 1YAHA 2JAXA 5AI4A 4W5OA 1JNXX 3IVXA 4YALA 5KAPA 1Q74A 1X7HA 3LX6A 1VKOA 4IHJB 4WW0A 5D3MB 3R7LA 5KSWB 1OB2A 1KP9A 2GEJA 3LBNA 2C5FA 3NBAA 4G81A 4JNKA 4NJOA 4HH3C 5CPBA 1ULTA 2Z58A 1HTTA 1CETA 1W96A 2P69A 4XQEA 1WNFA 3FBWA 2I1VB 3E9DA 3FJOA 4EJFA 1AZSC 1DEHA 3BJRA 2Q3MA 2JD1A 1IXZA 1Z29A 1C1DB 3MAJA 1ESNA 2QMYA 1YQXA 3QMMA 4LY6A 4EHHA 5A3VA 4YPOA 1PSWA 4KVZA 4PRKA 1IOZA 4MH0R 3WLEA 2XYHA 5A3SA 3A7DA 4H3HB 2DFPA 1FNCA 4BKUA 2QE7A 3PWTA 4RXMA 5A05A 3B9BA 3BMQA 1BMFA 1T13A 5TIIA 1UFOA 2POQX 4NAHA 5CLQA 5D87A 5FUMA 1NDHA 2QGFA 3COWA 4DXHA 1Q15A 1W47A 1HE5A 2JW5A 3IL2A 5E9AA 1F1JA 1UBUS 2UZIR 1HYGA 2GPNA 3A8TA 5L3ZA 4D41A 1EWRA 2AK3A 1OTHA 1ZI8A 4L4UA 3V46A 2LZ0A 2ECPA 1JIKA 4D82A 4BB6A 4PX3A 2G7MC 2J9YB 3H0KA 3HYRA 3T7CA 4MUFA 4RZUA 1ENYA 3OP1A 5B64A 3OFNA 4OHZA 4HUTA 1E2DA 4J2TA 4D4IA 4DMMA 1QH9A 3NM5A 1B4DA 1FNBA 2XXJA 2YC2C 3DM9B 3LHSA 4Q18A 5KQPA 1KIMA 5FR1A 4F2GA 2QM8A 3U0BA 2ZREA 2Q3HA 3L4SO 3EFHA 3I64A 4MPJA 3T5AA 4KNYA 1PAUA 1M8GA 3IURA 5LP6F 3C3CA 4L8YA 3LDAA 4W7SA 5EUQB 1TTHA 4PTYA 1KZ7B 4HRYA 3P1JA 4EPYA 1H2XA 4F4CA 5HIKA 3ZDBA 2XWBF 1XZNA 1GFSA 2AR0A 2A9PA 3K32A 3LK7A 1FRVA 5EAIA 2IH2A 4YO8A 3N75A 3TNJA 4MVWA 1TQDA 2Y76A 3A31A 3E9RA 3JQ9A 4NG5A 1PEKE 2OESA 3LOUA 4YRKA 1KERA 5BSHA 2FWNA 2B92A 1OIWA 2WAXA 5K8LA 4D92A 2XB4A 3HBFA 4WSOA 3WTBA 1XTBA 1A82A 1NWHA 3MBIA 4POAA 1JR3E 2H08A 4WKGA 5MFPA 4CM1A 3IDSA 1DRVA 2JJMA 5EXDA 1W88A 1X74A 3ESBA 1NNLA 5BSEA 4EOGA 1OXXK 2JIZD 1VE3A 3NHBA 5DOZA 2V3CC 3FN4A 2CUKA 1SWWA 3RB8A 2I1LA 5K8IA 4PHFA 1VG0B 1NC1A 5EESA 1JTFA 4HGZA 1Z7GA 2PZBA 3OM1A 4WIAA 2XVZA 3C7KA 3OSUA 2I22A 4KIGA 4HDNA 4NONA 5DGXA 1CR0A 2FJ0A 3RJ9A 4CTJA 3V1MA 3B1ZA 4M8KA 3FDFA 1YZLA 4DR2B 1PL6A 4XUDA 3EZFA 2HNBA 4C4TA 1A5AB 2CVFA 2O07A 3BJMA 5DNWA 3NRJA 5G3YA 3ZUPA 1XNRB 5FPTA 1WQ4A 1DRJA 1A5BB 3NHJA 2B35A 2GTHA 4EUEA 4WBNB 4L50A 3C8MA 4PX5A 1Z7BA 4JP2A 4Q66C 3RG8A 3SYRA 4A0HA 3UMYA 2WWHA 3E9NA 4BGIA 2H5EA 3N2GA 1GG9A 4GGMX 1EP2B 4JDUA 2N1MA 3GVHA 3RHTA 4ND8A 3USES 1CY7A 2QG9A 4BN0A 1VJDA 3AL0C 4WDRA 4EM6A 3C0KA 1QFJA 5EYPB 4LK2A 2C59A 5E7IA 5HKBA 3I73A 4LJ7A 1XXHA 4EUHA 4J7AA 3DDUA 3UBMA 4LBWA 4EKEA 4W63A 1GILA 2F3SA 3IV9A 4PX2A 1CUBA 2HY7A 4DY4A 2Q2WA 3GAAA 1KPHA 1DWUA 3S99A 1UKBA 2VWGA 3DKVA 3TRKA 4ER6A 2PUEA 1SM4A 4Z4FA 2A9KA 5EPUA 4JZKA 5HE9A 1RLMA 1XDDA 3M7IA 4KV7A 3A2LA 4ATNA 1N1MA 4Y2RA 5BNIA 1VSBA 4G5SA 4O1HA 1FDWA 1QV6A 1I2MA 2R7KA 1CY1A 5DISB 2WTUA 2ANCA 2JKVA 5AKIA 3MTQA 7AT1A 4Y0NA 1KP3A 3AZPA 2BGTA 3PUWA 4KIUA 1LPNA 4WLFA 4MPDA 3K15A 3WQSB 3P9SA 1PWYE 2ZU0C 3Q5EA 4M60A 4YAFA 3ZKAA 2AZXA 1QYDA 5EHNA 1H69A 1LWNA 4E32A 2G4VA 1SK8A 2WB4A 3B6KA 3G5MA 2YDXA 3P20A 2G1UA 5G02A 1VJ0A 5AICA 3S70A 3HFRA 3AG5A 3GEHA 1E9EA 4NJEB 3UJBA 2G5CA 2WK1A 1G5FA 2JJ2A 3SKXA 4Z7NB 2F8LA 1RYMA 4HNRA 4BFUA 2APJA 4IMIB 2WPNA 1L7DA 3FNQA 5K0CA 1MV8A 1XAHA 4MIOA 3C1UA 2ONJA 5BQ3A 5AOBA 1DTWB 4J4HA 3H5OA 1EHIA 4AX4A 2HOQA 1R3UA 3HBAA 4O4JF 1T29A 4Y1RA 5DNYB 3FNEA 2ACKA 3TSZA 4ROSA 2QYHA 4WZAA 4BIMA 1RWPA 2PLNA 3DSRA 1C9KA 5TPZD 2CK3D 4YLEA 3GDFA 3IT0A 4FDMA 3I28A 1GPAA 4IIJF 3NWBA 4F2WA 5FRDA 1MAVA 2Q6VA 4QJ4A 1U0TA 2D1RA 2Q0XA 3K2IA 4HXFB 4GHWA 3UG7A 2VH2A 4DL9A 3AB7A 4FK8A 3M1YA 3UMBA 5I7EA 4J29A 3KSBC 2A58A 3STYA 3KJIA 3LUJA 4FT4A 4Z3KA 2VKQA 5M29A 3TUIC 3VA7A 1RBQA 2PUDA 1NRJB 2QJTA 1H2RS 4V2IA 1FVXA 3R0VA 4WX2B 2R7MA 4MV1A 4ZO4A 1ZOSA 3FGZA 4NEGA 1UOQA 1ML4A 2F8TA 2XDAA 3LOPA 4D8XA 1PX2A 4F9EA 3MRSA 3M6WA 3I58A 1GZ5A 3I53A 3HI6A 3I5AA 4FSHA 4B09A 5A0VA 3ANYB 2GJSA 4BVFA 5GM2A 4RD6A 1I2AA 2J0QA 1PL7A 3Q0IA 3TLBA 3TMYA 3UMJA 4INJA 2XV1A 5CLGA 5HKKD 1ICEA 3WFJA 1P6UA 2CNNA 3VOTA 1DIOB 2NPOA 4OMFG 5LM3A 3TTWA 1G9SA 1A27A 1XJWA 3KKEA 3NIFB 4AWBA 4P7FA 2ABWA 3SQXA 3GP8A 4NARA 3BXEA 4AY2A 1NTOA 4NZYA 5H80A 4ENPA 2J7PD 4JK3A 5IJXA 1YRWA 5HGJA 7ADHA 5KNCD 3EARA 1MC8A 5H5JA 1N1GA 1PWZA 4G4JA 2P1RA 1F8UA 2OFWA 2VIIA 2JLCA 2QDXA 2VF5X 4TVOA 3O75A 3GZNB 1W1WA 4A73A 4ZEWA 1IHXA 1XVTA 4XUCA 3R77A 4TUYB 4K8RB 1KU6A 1OB5A 4FYYA 2X8JB 3HBNA 3FPAA 1DAPA 3GUVA 1N1DA 3HCBA 3NGLA 2VDPB 1JB1A 1JKJB 1V5EA 1MQ9A 2AF4C 2H06A 2RKBA 4M55A 5FUBA 1PN3A 3WXMA 5F9MA 4RA6B 2NTEA 5D1HA 1EUDA 1HXHA 2AWOA 2UZ1A 5SYMA 1CUGA 1JH9A 4FXPA 1KETA 4D8TA 3L8CA 2QLTA 1F8XA 2ZYHA 2C2BA 1J0AA 3MTDA 1YVUA 1J9GA 3VHXB 4NKRA 1FFXB 3FTDA 5B3KA 1ATIA 3A3YA 3I4LA 4DR1B 3TQTA 2O23A 4I1UA 5A3RA 1CRLA 5FOTA 1W5FA 3G9TA 1P7PA 4X8HA 2HK8A 2DBYA 3G79A 5KX5B 4IG4A 1G8AA 1A8IA 5IW8A 3LWNA 2XE8A 4RMHA 5KX5A 3CGGA 4MV5A 3DGEC 1G5PA 1Q0HA 4H60A 4F6CA 1KI8A 2AFVA 4EW6A 2B25A 1FTQA 2V6BA 4KR0A 2YFHA 4UATA 5EXPA 1CJUC 1DKOA 1Y7PA 3MD0A 1S9DA 1YRHA 1T8UA 2VATA 1GQQA 2A5DA 3NKFA 4WERA 2EHDA 2ZIGA 1DFIA 1QGAA 1R2QA 1ZIYA 2R44A 2X2FA 3KOZA 3QYAA 4MMXB 2R1UA 1G4UR 1JV2B 2XB9A 4QICA 5G3ZA 2AJ8A 1U3WA 5IZCC 3E3AA 1JSZA 3MMZA 4Q7MB 4CM4A 3N58A 1EB9A 1BRTA 1AUOA 2XVMA 4NOLA 1FDOA 4J0GA 4GDFA 1IN8A 4GP7A 4WD3A 2J0VA 1T9HA 4C6TA 1T43A 2EBUA 3BBPA 3PBKA 3PKJA 1RM5A 2VN8A 5AUPB 1N32B 4BGUA 1SUIA 1THTA 3WLAA 1W6RA 3C3XA 4IMJB 3IV7A 2GZRA 3WZLA 3O82A 1QNLA 3NU1A 4DB2A 5DHQA 1QIHA 1O6GA 1NP3A 3QGMA 1QYRA 4LYEA 2QVGA 5F2EA 3ZCTA 4ZQEA 4DWVA 2G71A 3EXAA 1L5RA 3CZRA 5I9LA 4JI8B 4MEBA 1OH5A 1SOWA 3DD5A 2J46A 3ZV7A 1OREA 3ZV3A 1ZIDA 3HNRA 3GYBA 3JVUA 4CGYA 3H2JA 1P8AA 2DBRA 2UUPA 4TMZA 1CR6A 3CEAA 3EQ7A 4G5RA 4D97A 1GA4A 1VHLA 1G42A 2WJVA 4U2DA 4IIJB 3VYVA 1KO5A 2JKYA 2ZYUX 5LP6A 3ZN2A 3ZWPA 3BWYA 3KZ1E 4QRDA 1LH0A 1L3BA 3ZHCA 2XA2A 1FMCA 1HL7A 1EBBA 3DXZA 4EWLA 3DE5X 3Q8XB 4Z4GA 3EXG2 2BGLA 3NGXA 4UUAA 3GBSA 3EJWA 3WSTA 3M6XA 4FR0A 2I80A 3U9SA 3BMQB 1RRVA 1RI4A 2WWTA 4F8JA 4ZU1X 2AKAB 1KSHA 4V38A 3EA0A 3NM4A 2D4HA 2VZ0A 3OZSA 4KX5A 4QE3A 2PKCA 2Z57A 2JFZA 5BQFA 2XA1A 1U7HA 3AI7A 1QH8A 1GTL1 3JASA 2PMEA 5L95A 2WHPB 1L7NA 3LF1A 4HNHA 2YXBA 2WTEA 3D4OA 5CVJA 3OECA 4JVLA 5TR9A 5E8JA 2OYSA 1M6HA 1E0KA 2DU8A 1N8KA 1RI3A 5ARBA 2VRCD 2EFCB