1YB7A

Hydroxynitrile lyase from hevea brasiliensis in complex with 2,3-dimethyl-2-hydroxy-butyronitrile
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants of the enantioselectivity of the hydroxynitrile lyase from Hevea brasiliensis
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lyase
molecule keywords (S)-acetone-cyanohydrin lyase
total genus 100
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2004-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yb7A00
1SCKA 1BEZA 4MYDA 3PF9A 2V96A 1KU0A 1NU6A 2WIGA 4BVKA 5JYCA 3TGLA 3V1NA 3S2ZA 5AICA 4WJLA 5LKRA 1JMYA 5A7FA 2D5LA 5AK6A 1CUYA 4EY4A 2ONCA 1R4ZA 4FLMA 3FSGD 4HRXA 3WIBA 1P0QA 4B85A 1ISPA 3G9UA 2JF0A 4BZWA 2W22A 5FP0A 2VJCA 4HVTA 1C4XA 4UHDA 2C5GA 4X3CA 2O2GA 3SX4A 1AC5A 3FYUB 4ZV7A 1G66A 1UFOA 3G7NA 1JMKC 1DX6A 2XB6A 3TJMA 1JFRA 2ORYA 3F98A 1XZFA 3DYIA 4P92A 4LKOA 4AB1A 5FLKA 1YAHA 1DINA 1K6EA 1UOOA 3IUQA 3FLEA 2WUFA 4EBBA 1AURA 2VAVA 2Y2UA 4NMWA 1DWOA 1Y7IA 1UK9A 1SCQA 2B9VA 4BP9A 3HXKA 3DNMA 4Y2PA 3W9BA 1TK3A 2CB9A 4MEBA 5JADA 4UBNA 4ZWNA 5ALRA 5LKAA 1KEZA 4EY7A 2QUBA 1WCYA 5JARA 3W05A 3HACA 2OAEA 4OB8A 5T4EA 2NW6A 5JAUA 5LZ2A 2PPLA 1OCEA 1ZJ5A 4ZI5A 2GBFA 1YA8A 1BN7A 4QLAA 4AX4A 1JJFA 4EY8A 2WFLA 5IVIA 1H2XA 2ZYHA 3HABA 1YASA 4XIIA 4BATA 2C0PA 1EI9A 3V9AA 1ZD2P 3ANSA 3QPCA 2OCGA 2XMRA 2HA3A 4C4ZA 1N5RA 4UFPA 1RYYA 4GEGA 3ZLUA 3I2HA 4UHFA 2XMDA 1CUWA 1QGED 4J0IA 2QZPA 1YA4A 3QPDA 2VTVA 1EX9A 1YS1X 2HIHA 2RAUA 2FX5A 4E46A 1G5FA 1WB6A 2WILA 1QTIA 3CN9A 3V1KA 3O4GA 3DLTA 4WDRA 2QS9A 4U2GA 4B80A 2VEOA 3VDXA 3C87A 3WQHA 3KDAA 3LS2A 3NUZA 4G9EA 1TAHA 1TKRA 4IO0A 4TGLA 2OQIA 4BTVA 1SCIA 4G5XA 4KYVA 3GROA 2JGIA 3RKSA 4G8BA 2GYWA 3WI7A 1WPRA 4BDSA 4J03A 2XMQA 1W1IA 4KE9A 2WU3A 5AM4A 3BDIA 2G4LA 4OSEA 5HKBA 4FBMA 4QNNA 2WKWA 4PQEA 1MPXA 1YAJA 3O4IA 3F9CA 1AZWA 2O2HA 2WLSA 4GBGA 1T2NA 1XZBA 1IZ7A 1ZD5A 3DKKA 1YCDA 5AK5A 3OG9A 5FV4A 3SWWA 4GLBA 3WWOA 4KJXA 1VKHA 2XQGA 3LIIA 4O08A 3HJUA 5DLPA 1VOTA 1ZI8A 3VXKA 3R3UA 1LPMA 4Y2TA 3STTA 1JU3A 2HA5A 4KE6A 4LXIA 1WPXA 4RGYA 4X6XA 2WJ6A 1XZJA 4AN1A 5CT9A 2G5TA 4QEKA 3FYUA 1LZKA 4KAJA 1QFMA 5EGNA 2ZSIA 1MJ5A 5AOCA 2XUFA 1LBTA 2I78A 5A2GA 3UUEA 2ECFA 4N8SA 3PF8A 4K2AA 4FWBA 3MGAA 4UHCA 1W4LA 2J4CA 4W1RA 5KBYA 2OG1A 5AM1A 2XQIA 1GXSA 1WHTA 4DYHA 4LHEA 3T4UA 4H7HA 5JZBA 4FDMA 2C4HA 5HF9A 1TCAA 5CH5A 4BAZA 2I3ZA 1DX4A 1R50A 3QMWA 5YASA 2ZJ6A 1U4NA 3R3XA 3BIWA 3GFFA 3B12A 1AMNA 4LIPD 3KXPA 5EFZA 3WL5A 1MAAA 1GPLA 3ILSA 3ZLVA 1BE0A 3SC2A 3M82A 4X95A 4CCYB 1BS9A 1HBJA 4X91A 3VVLA 2DR0A 5LIPA 3MUOA 3R40A 5A71A 4FNMA 5SYMA 4YASA 1MNQA 5ALTA 5E4JA 4ITVA 3I6YA 2FUKA 5AHXA 4G1FA 1YB6A 1UWCA 2JBWA 4WFIA 1C7IA 4EY6A 5AJHA 5EHNA 5C81A 1QIMA 4DGQA 1A88A 2EDCA 1UK6A 1DQZA 4DNPA 1B6GA 4PSCA 1ORVA 4FKBA 3OC0A 1OXMA 2Z8XA 5CRIA 4L0CA 3H2IA 4F21A 3IUJA 1ACLA 1XZCA 4KRYA 1CUXA 3GZJA 2OGSA 1MU0A 3D0KA 2XUAA 4I3FA 2BJHA 1X2BA 1LPPA 2ROQA 3ZI7A 4Z49A 2QVBA 3O95A 3FYUC 1CPYA 2ZJ7A 4U2DA 4XWGA 3AIKA 3C6XA 4L9AA 4OYYA 4C4YA 1HKHA 5AH0A 2V9ZA 1JJBA 4DMCA 2Y2VA 2H7XA 1CUVA 4I4CA 5I8PA 5AKLA 1MT3A 5ALVA 2HL6A 4DLNA 4C4XA 2XLBA 4LYEA 4OPMA 3F97A 4PW0A 4X71A 4H77A 3IURA 1EH5A 4QLOA 2DSNA 1XROA 4FTWA 2HA7A 1BRTA 1MN6A 1TQHA 5AI6A 4DSZA 5I9IA 3WK4A 1ZGBA 4Q34A 3FWHA 4C6HA 1P0MA 3RARA 2WIJA 4CG2A 1EDDA 3NWOA 3P2MA 3L1HA 5CT4A 3WK6A 1FSSA 3WMRA 4FBLA 2XUHA 3AZOA 3MVEA 5JAOA 3AIMA 4NZZA 3ZV7A 2PSJA 3G0DA 1UXOA 5DYTA 3HRHA 3QMMA 2QT9A 1BU8A 2CEKA 2WHPA 3I6MA 3OOSA 2HU5A 4L3WA 4HAIA 1H2ZA 4B82A 2XUOA 1UKCA 5AP9A 1F0NA 4EUSA 1EB8A 2HU7A 1USWA 2VATA 1ZICA 1R88A 4H7KA 4C88A 3A70A 4OB7A 4FMPA 3V1LA 4BB0A 3EBLA 3C6ZA 4GECA 1AUOA 5K3AA 5K3EA 2JEYA 3HLKA 4UBOA 1R1DA 3I2JA 2XMSA 2QXTA 3H0CA 1VXOA 1W75A 1XQXA 4CIBA 3H1BA 2OAGA 4QA9A 4IHAA 1QLWA 3OTQA 3IB3A 2WIFA 1ZI6A 1QIEA 2X76A 1DQYA 1WOMA 2E3JA 4CCYA 2W6CX 4QWWA 4QZVA 1NX9A 1AKNA 4FFVA 3MUNA 1XRRA 1QE3A 3EF3A 2I3DA 1U2EA 3RK4A 3BWXA 4DNOA 2J3QA 3WA6A 1EK1A 1L7AA 4KACA 2WM2A 4QDXA 2AXEA 3O4JA 3HZOA 1A7UA 4Q3LA 5LZ7A 3IULA 1BCRA 4L72A 2C5FA 3W06A 4CI9A 5HKAA 3VJMA 2XI4A 4ZXFA 5AO9A 3G9ZA 1N5MA 2PL5A 5JZSA 3D5EA 2Z5GA 3LP5A 1D07A 2XUPA 3N2ZB 2JGMA 5HF6A 1MTZA 2LIPA 3E3AA 2WG2A 1IZ8A 5I7UA 5D6OA 4OCZA 1E66A 5BV7A 1C7JA 2RONA 2OCLA 3E1GA 4X7BA 4ZGBA 1SFRA 3G9TA 2GYUA 2XQFA 2PUHA 5ALPA 4EHBA 3HSSA 4UFOA 4A5SA 3PICA 1VJ5A 1AQLA 5A7GA 1U8EA 3WJ1A 1GZ7A 5AI5A 4ZV9A 5HZGA 2O7RA 4UBMA 3AUKA 3VJLA 4LYDA 3IVMA 2Z3WA 3WL7A 5ALKA 2XQKA 2QM0A 3I6ZA 1ZD3A 4NVRA 2DQZA 2R8BA 2BGRA 5IH7A 1AGYA 3WKCA 3I1IA 3IUNA 4H18A 4P08A 1S8OA 4Y2UA 3I2FA 5CT8A 4JUIA 5LYYA 3WK9A 2B20A 4AN0A 1E5TA 1MX1A 4D9JA 1CRLA 3PFCA 1UOQA 5HQ3A 5JD6A 5C8VA 3C45A 2RGUA 5LP1A 1XQYA 3DEAA 2JGFA 1L7RA 2ACKA 1UK7A 2WSLA 5EHZA 1MO2A 3WYNA 4ZRDA 5HK8A 4MWTA 4AO8A 3QPAA 2QUAA 1CUDA 4MQLA 3ICWA 4GDMA 4H7DA 3DOHA 4B84A 2C0QA 1ZD4A 2DHEA 3OM8A 3O9MA 2PBLA 1CUJA 4OUKX 4W9RA 1ACJA 2QJRA 2VAXA 1J2EA 5ALJA 5ESRA 1CUEA 3WL6A 3H18A 3R3ZA 1Y7HA 3WKDA 1EXWA 4F5ZA 2V97A 3D4LA 1R9MA 1FFAA 3LLCA 5AKIA 2RI6A 4Y2QA 1XZEA 4IH9A 1BROA 2CBGA 4FLEA 4B0OA 3ESBA 2BUBA 4HTAA 4MWSA 3IBTA 3GBSA 1YB7A 3DCNA 3SK0A 5JALA 4E14A 3I2IA 1ZIXA 1HLGA 1Q83A 4TVKA 3DD5A 1J07A 4X97A 2PVSA 5E4TA 3V48A 2ZVDA 4DMHA 3I1YA 4RE6A 3C70A 1QIHA 2WFMA 2ZYIA 1O6GA 4PV7A 3G0CA 5AKXA 3ZLTA 1E8MA 4HS9A 3EQ7A 1PV1A 3A2LA 1XRQA 3V1MA 4WCVA 4W1PA 4I19A 2DFPA 4AO7A 2IITA 2H7CA 3FAKA 1LZLA 4DMKA 4EZIA 4OD0A 4GHWA 5JATA 1XLUA 3HYSA 4JEIA 4GWLA 1LPBB 3KSRA 4BYMA 1A8UA 4UFNA 1JU4A 5CBKA 2WG1A 4Q05A 2Y6UA 1XKLA 3STWA 2PM8A 1CIJA 2I03A 3STUA 4X6UA 3QBJA 5IVDA 5FRDA 5AKEA 5AKHA 1YSCA 4G4JA 4B0PA 1LPNA 2WQZA 4WY8A 3R41A 3T52A 1ZJ4A 2JIDA 5AI0A 1DWPA 5BWBA 2DCMA 4X90A 1IVYA 5FOQA 4MJ3A 3QH4A 3I28A 4RE5A 1JI3A 2WIKA 2YYSA 2XUGA 4WFKA 3AINA 1H2WA 2WHPB 3D59A 5D3KA 1K4YA 1WB5A 1CUCA 3D2AA 2WU4A 5DTJA 3FLAA 4DSAA 3PDCA 1E8DA 4ROTA 4BC1A 3C6BA 2FJPA 4GI1A 1DU4A 5AI4A 2QOEA 5ALEA 1IUOA 5DWDA 5K3FB 1W76A 2B61A 4JNCA 1VLQA 3FCXA 4KR0A 2OLEA 1CUUA 1HL7A 3RLIA 3C8DA 2HA0A 5JD4A 5JIBA 4X92A 3WKBA 3M81A 1XLWA 1F0PA 4J0KA 5AK4A 1G4HA 2XUDA 3C6YA 4OU5A 3DL4A 3FLBA 4RPCA 3Q8WA 4P9NA 2C7BA 2J4FA 2RHTA 3L1JA 1QTRA 4BCCA 3ZWQA 1LNSA 2WTNA 4HXEB 5AKKA 3FNBA 5JZ9A 1HQDA 5DYYA 3LCRA 1VZ3A 3R0VA 2VJBA 1QIFA 1QIIA 3FSGA 1XZDA 4BVLA 3IA2A 4UBLA 1FFBA 4X94A 4QE3A 5AKJA 2OCKA 2P8SA 2GZRA 1EVQA 2PSHA 1L7QA 4W1SA 4ARAA 4BE9A 2BUAA 3FCYA 1P0PA 2H9YA 5JAHA 4UBIA 4B6GA 5HFAA 5FXMA 5HK9A 5AKGA 2VA9A 4DTCA 5CMLA 5JAPA 2EDAA 1QIGA 3UUFA 5AI9A 2BKLA 3G0BA 1UT6A 1FJ2A 2FJ0A 4MEAA 4B9EA 3STXA 1XRLA 1GKKA 1G42A 2XDWA 3ED1A 5ALSA 4AMZA 3PI6A 4UBJA 4W1QA 2YXPX 3BDVA 4KE8A 4CG1A 2UZ0A 1VA4A 2ZYSA 4Y7DA 2B4KA 5DTIA 2JGKA 2XT0A 4N5IX 2QMQA 4X93A 2PU5A 5AK3A 4QWMA 2GBIA 1JKMA 4PF1A 1VXRA 1EA5A 4B83A 3D2CA 1CQWA 1GQRA 2JGLA 1B41A 3GA7A 5H3HA 3H2KA 3CXUA 6YASA 4H7FA 3WWEA 1E3QA 1XQWA 5LZ5A 4BBZA 1DT3A 5J3JA 5CXXA 4UHEA 3AILA 4B81A 4ARBA 3FVRA 3PE6A 3QVMA 5DYWA 3HC7A 2ZSHA 4GW3A 4XJVA 2XUJA 1RP1A 3E4DA 3C43A 2WHRA 4AZ0A 2XMZA 5LZ8A 4UBKA 1X2EA 2VF2A 4QDOA 1RWQA 1CFJA 2VT6A 1A8SA 3BJRA 2DQYA 4G8CA 4WDQA 4OU4A 2XMBA 5AOAA 2QRUA 5A62A 4CIAA 4RNCA 3ESDA 2HM7A 4BE4A 1SOMA 1CUIA 4S0XA 3DL7A 4FHZA 1FFEA 5SYNA 1W6RA 3WJ2A 5T4HA 2H7YA 5K3FA 2HFKA 4EY5A 3JYHA 3U0VA 2WIDA 5ALLA 4ETWA 2RIPA 2DHCA 4J0GA 3S8YA 3ICVA 3O4HA 3AIOA 1ORWA 1A8QA 3QYJA 2QTBA 4AO6A 1YR2A 5ALYA 5IVHA 1X70A 3FBWA 4IH4A 3GUUA 3WWPA 3BIXA 4J0CA 1Q0RA 5IVKA 4X85A 1ZIYA 5ALIA 4A16A 1F8UA 1CVLA 1UK8A 1DT5A 3ANTA 1XRPA 3H2GA 1QJ4A 2BAGA 3WZLA 3H1AA 4JH0A 5ALHA 5FKJA 1CQZA 4YPVA 4BP8A 4MXDA 1ODCA 1I6WA 3IIIA 2VJDA 3WKAA 1XZMA 4DMFA 4N8EA 3KOOA 4Q3OA 2XUKA 4E15A 1GGVA 3H04A 4G4IA 4GXNA 2VT7A 4G9GA 2XE4A 4AXBA 3C8HA 3C5WP 3DS8A 2ACEA 4HRYA 2RHWA 3BF7A 4PNZA 5HF8A 4K5QA 5AM5A 2WUEA 1QFSA 4UUQA 4A23A 3W9UA 5K3DA 4K6KA 1F6WA 4BC0A 1TCCA 3LIPA 5ALGA 2ES4A 1QIDA 4AMYA 2HRQA 2HA4A 4M0FA 5AIAA 1QO9A 2JEZA 3DDUA 5EI5A 4BAGA 5LLSA 4F0JA 3DKRA 1CUHA 2QXUA 2Y1KA 4NS4A 5AKYA 1UZAA 4ZREA 4HXFB 2GBCA 2AJDA 3VISA 5C8ZA 1MX5A 4C87A 2GBGA 3A6ZA 1XFDA 5LZ9A 1JJIA 5A6VA 5AM0A 1LGYA 1IUNA 4XX1A 1TIBA 2QKYA 4KRXA 1SC9A 3NOXA 1GKLA 1CUAA 3QM1A 5CH3A 2WFLB 3BXPA 5ALNA 1Q0ZA 3G0GA 4U2FA 1ZGCA 2BUCA 1GQSA 1K5PA 4Q1VA 1XZAA 5CURA 2Y6VA 3BE8A 2HHAA 2WUGA 4OYLA 4FNGA 3G9XA 1CUZA 2VSQA 5ALXA 5F4ZA 4OB6A 2CZQA 3H17A 1HPLA 4G8DA 4J0HA 1UOPA 1QOZA 5AKZA 1K63A 5FDFA 4FOLA 5A7HA 1JT2A 2Q0XA 2JGEA 2QR5A 2WTMA 3ESAA 4M0MA 2HA2A 4YK7A 1R3DA 1DTEA 1WHSA 5E4YA 1DWQA 1HDEA 5K5EA 4LXGA 3IDAA 3FVTA 5ALWA 2D0DA 5HF5A 5KWJA 1R9NA 4B9AA 4Y2JA 3D2BA 2YH2A 5FUMA 1IUPA 2XMCA 3K9BA 4Y2SA 1ODSA 3WK5A 2ZJFA 3UMJA 2CUTA 2JGJA 5HFNA 1NU8A 4G4GA 2OXEA 1Y37A 2QJWA 3O9VA 2J3DA 1BEEA 5AIBA 2HDWA 1EDBA 5IKXA 3WWCA 4AZ3A 1XZIA 1YS2X 4U2EA 2VJAA 3WZMA 3KD2A 4IH1A 1E89A 1LPAB 2WJ3A 5LZ4A 1FFDA 1LPOA 4DM7A 4QDZA 3G0IA 2HADA 2BCEA 3EQ8A 4N5HX 4M0EA 2HA6A 5ALZA 3GELA 3CN7A 1H22A 3FOBA 3WWDA 3TRDA 2XUIA 3ZPXA 3B5EA 5CH8A 3X3HA 3WK7A 4CG3A 2HFJA 4INZA 2ZYRA 1IMJA 3A2MA 4XVCA 3YASA 1W52X 4PO3X 4H7JA 3DQZA 4B7ZA 4BRSA 1GPKA 1T4MA 4KE7A 1PFQA 5AM3A 4KEAA 2WG0A 4W63A 1XKTA 1TCBA 3N0TA 4X00A 4MYSA 3K2IA 2CJPA 3AJAA 3G8YA 5DNWA 4J3JA 1AX9A 1ZI9A 3JW8A 4BTLA 4BRZA 2IIVA 4BCBA 1VE7A 1EK2A 2CMFA 2OGZA 2XUQA 3K6KA 3PUIA 3O0DA 1WM1A 5CXUA 4Y2VA 3QITA 2PSDA 5KWIA 3NGMA 4C01A 2XQJA 1H2YA 5T4FA 4IQ4A 1LLFA 5CW2A 1EHYA 3HEAA 5EHQA 2HU8A 2AJCA 1MAHA 1FFCA 1LPSA 5DNVA 3IUMA 5ALQA 3WK8A 5BOVA 5E2IA 4J0DA 1LBSA 5K3CA 1ETHA 4PSUA 4Y9SA 4BZZA 1GT6A 4H0CA 1QZ3A 5BWCA 4UHHA 4P93A 1THTA 2EEPA 2PSFA 2PUJA 1QONA 4BDTA 3F96A 5EIAA 1QIJA 4H7IA 1P0IA 2C58A 3BL8A 3R3VA 2YASA 1UKBA 2XMGA 1ZOIA 1QIKA 2Z8ZA 5AI8A 4J7AA 3VKFA 3DYVA 3EQ9A 4Y2YA 4EA6A 3R3WA 2GZSA 3F8SA 2CKMA 3KWJA 1CUBA 5T4BA 4UPDA 2X8BA 3VJKA 3RM3A 3ESCA 3JWEA 3WA7A 4H7EA 1PJAA 5CT5A 4U2CA 1CV2A 4QDUA 3BF8A 5DNUA 2G63A 1VA5A 2PSEA 2PX6A 3H2HA 2PKYX 4K6GA 3F67A 2IX9A 3Q0TA 4YX9A 1EDEA 2AJLI 5ALDA 1EB9A 5FPQA 4QDTA 4U2BA 1KU6A 3HI4A 2OGTA 2XLCA 2OPHA 1CEXA 1THGA 3QMVA 2G5PA 4BVJA 5DJ5A 2V98A 3OPMA 3A2NA 3EIOA 5EIHA 3WLAA 4Q82A 3PUHA 4KAFA 3C5VA 2OQVA 3WYDA 1Z68A 1N1MA 3B3QA 4UHBA 4Q3KA 4J0JA 3D3NA 2BGNA 1U65A 4C89A 2AJBA 3VVMA 1CR6A 1XLVA 1GPNA 4BAUA 3AFIA 1OILA 2GYVA 3G02A 4CCWA 4N8DA 4KAAA 3CCBA 4JYPA 4DNFA 1XRMA 4X6YA 3M3DA 1EVEA 2OCIA 3CCCA 4EB0A 3E0XA 5CTAA 3TEJA 1J1IA 3WKEA 5ALMA 4F60A 1BCSA 5ALUA 4FLFA 3OURA 2DHDA 2WHQA 4HZGA 4DIUA 3DOIA 2PU7A 4HXGA 5C7YA 1CLEA 3STVA 3H2JA 3U1TA 1H23A 4WY5A 3WL8A 3L1IA 1XZLA 1QO7A 3WIOA 3D7RA 3KWFA 4E11A 1O6FA 2AJ8A 3PFBA 4CFSA 1VE6A 1WB4A 5KREA 2K2QB 2WUDA 4FFWA 1CUGA 1M33A 2O2IA 5D7BA 1CUFA 2H1IA 5EIEA 1K8QA 4K6HA 3QZUA 5CT6A 1XZGA 5EHXA 3FYTA 3W04A 2R11A 2HRRA 1UKAA 4TPKA 1MX9A 1VZ2A 4V2IA 4Y2XA 4PSDA 4AQDA 1XZKA 3BJMA 2O7VA 2WJ4A 2WFZA 4WFJA 3W2TA 4Y2RA 3I2KA 5ISMA 3STYA 1EINA 4LXHA 3DJYA 7YASA 3AZPA 5D3ZA 1ODTC 1N8SA 3M83A 5FPPA 3R3YA 1XZHA 4MQMA 5ALFA 1BN6A 1XRNA 2VQ6A 4H35A 5AOBA 4JYMA 2X5XA 3I2GA 3AZQA 5JANA 5HQ3B 1E8NA 2BFNA 3H19A 1J06A 5ALOA 5AM2A 5JASA 1XQVA 4DNQA 1CUSA 4BCDA 5K3BA 5HCUA 2Z3ZA 5C8XA 1MNAA 5JD5A 1TRHA 1Q84A
chains in the Genus database with same CATH superfamily
1FFXB 3NP7A 1DKUA 1BEZA 3WFZA 4MYDA 4ARZA 2JASA 4RVFA 2WIGA 3TGLA 4ASUA 5CVVA 1ISIA 4YRBA 4K9DA 3WSWA 1GN9A 1N77A 1BEUB 2BEVB 2BFCA 2EQAA 5DHTA 1OUMA 2JVKA 4WJLA 1GTMA 4MI9A 1GL3A 4S04A 3IIEA 3T5DA 1BX0A 3ZU6A 3TDNA 5CITA 1U9IC 1WLSA 4D9FA 4EVRA 2TECE 3F4BA 1U8AA 3CUSA 1FW6A 5DKFA 1F7VA 2FB9A 3FSGD 4FLMA 4HRXA 2PUFA 3TXAA 4NEHB 3THWB 2FPLA 2CNKA 1PN3A 1BKDR 1OTXA 1VDZA 3IBCA 4P5PA 3Q9NA 3SJCA 4BO5A 5KIAA 1DRKA 2C96A 2JGDB 5KMGB 1WA5A 1F51E 1K7YA 1QM5A 2HBRA 2PZ8A 1W4CA 4TKLA 4JGGA 5T6MA 1N25A 2ZBUA 1WF6A 4YROA 4JC4A 1LU9A 1NNLA 1ZLXA 1PWXA 3AEKB 1KJNA 3GLQA 3ABOB 3EWSA 2FR0A 1O77A 3TM4A 4HVTA 3UMRA 3JWIA 4I1SA 4RHUA 4X3CA 4DAOA 2ZR0A 1KXJA 2F6RA 4AVYA 2HNBA 3EXAA 5EKUA 1QGZA 2JJQA 1H2EA 2GZ3A 4P4GA 5KUTA 2IELA 2WZBA 3E22A 3ER9A 4NTZA 3ZOZA 1IYZA 2G08A 2GSWA 1FRFS 5TPZA 3ZKWA 1UFOA 4YJGB 5JDIC 1JTEA 3CO0S 1JMKC 3P9XA 1GPDG 1YWGO 4E08A 4Y0NA 1GVHA 2YIDA 1TEZA 3I5AA 2HK8A 2Y1DA 2ZRBA 1G2QA 4HDNB 4I0WB 1JFRA 2BFFB 4X63A 3TLCA 3T1VA 2X4LA 3O8BA 3DQQA 1OPXA 1T6ZA 3K9NA 4IUBS 3RAEC 1WHTB 2HF2A 4UDOA 2RGCA 2H48A 1TKBA 3W4IA 1V6AA 3AEUB 3CNEA 3LQ2A 4PR3A 4G0MA 3DSRA 2SKEA 2KJQA 1M5UA 4NPAA 1WTCA 1NYQA 1XNQB 3R3SA 3OP4A 2H57A 2JK1A 3A1VA 3T7EA 2AMYA 4HR7A 2W6MA 3H8WA 3RYTC 1EHCA 2ZJ8A 2C5HA 5FLKA 5FUWA 4F3RA 4ENSA 1K6EA 1UOOA 1Y5MA 3R7NA 2Q1XA 3CWQA 2BT4A 1T8UA 3LSYA 1KQOA 1RWXA 1V7QA 3PQ3A 1JSRA 4ZQFA 1WQ3A 2DG2A 3BN3A 3L1UA 5AVZA 4UJ3A 2WNIA 3NOOA 4O2RA 4EBBA 4QL3A 5CLLA 1UODA 3JQBC 4FB4A 4CMCA 1UIRA 1SCQA 3L0OA 4TN5A 3PLNA 4NC9A 5TQ0B 4XCVA 1GA4A 3OTIA 2NU8B 5DXAA 5F2OA 3L7NA 1J8QA 1UC9A 1JQAA 5K45A 1M72A 3DNMA 5NLLA 1R6DA 3F47A 3MA0A 2QZZA 2XXBA 5BWMA 3TE6A 5JVDF 4JR1A 1Z2AA 1DMRA 2CB9A 1AKVA 2Z6QA 2OSBA 4Q3EA 4NQRA 3B78A 3ZWDA 3GUZA 3JQ7B 3E5RA 1MB2A 2A67A 3RTGA 2FPPB 2VPZA 1LY1A 1PAUA 1O0SA 2UVPB 1BE6A 4EY7A 2QUBA 4CTMA 1N36B 4PHGA 1WCYA 4OYHA 3SAJA 2RAFA 5JARA 1W88A 1SVNA 2X2FA 4WECA 1SVIA 4OB8A 2VDJA 3ELYA 3ZY3A 2RC5A 3W0LB 2P3SA 3O83A 2IS1A 1DPGA 3BZWA 1FEZA 2ZWOA 1QH8A 2FCAA 2BKXA 3B6EA 1SWVA 5A0FA 2WOOA 4IHQA 1K7SN 2A3RA 2O8NA 2VWQA 2XRYA 3HCEA 1ZJ5A 4Q4AB 3QHAA 5P21A 1YA8A 2CXXA 1V8ZA 4O4IB 1GOTA 4GICA 5HBGA 1X8LA 3HKBB 5JSHA 2GAOA 4QLAA 4B8YA 2IPLA 2B83A 2YWBA 4IOLA 1YRWA 2AVNA 4TZKA 5CK4A 5EWMA 3WO1A 5IUJC 3HDGA 4WI1A 3O2NA 3L4BC 2WFLA 3HJTA 4I6EA 3VZPA 2YWHA 3FDJA 1AKUA 2ZYHA 3HABA 5B7GA 3EA5A 4XIIA 1XVUA 2GLTA 2OUIA 2IGTA 2OKGA 5H9VA 4TKVA 1E6EA 4FINA 3V9AA 2XGOA 4K28A 5HIAA 2PTHA 2O8CB 4JJKA 4C9BA 1RWMA 1Q7EA 1V8DA 1DFHA 1QCYA 4L5IA 1R2QA 2WWXA 3EEQA 3RRNA 2DBYA 2AEEA 4X8OA 1XGKA 3OBBA 3SBDA 3PHHA 2CDRA 2X5KO 1N5RA 4P7KA 1YQTA 4RZSA 2BONA 2FMKA 3M6AA 3V80A 2ZUBA 3GDGA 3KB8A 4UFPA 4EYKA 3A4MA 3U2QA 2ZCVA 4O2AF 2PT9A 4O1MA 3CJTA 5A4KA 3E7XA 2JFOA 3GH3A 4EI2A 5A9RA 3ZY4A 2KM1A 1Z4NA 3U7JA 2IUSA 5AUNB 1PCXA 4JJZA 1RQNA 2XMDA 3WL3A 4F71A 2IYSA 1S8NA 4H31A 4ITUA 1S0UA 2IYTA 3V4ZA 1CUWA 2O7QA 2QLFA 1E99A 1JH8A 3L6DA 2Q1YA 4HATA 4QECA 4YACA 2QZPA 3EVZA 1OBOA 3RNOA 3VU0A 4HUQA 3W90A 4PN7A 1YA4A 3QPDA 3EUAA 4KQJA 1H66A 1YS1X 3LRPA 2CLHB 4GX0A 2FX5A 1SBTA 1NVVQ 3UXMA 2JLXA 1L3CA 1L5YA 1G8GA 2FGKA 3ABZA 3JQQA 5E7IA 3VU3A 1W5EA 5DHFA 2CLLB 3BSWA 1G8SA 4D81A 1QTIA 3CN9A 4RA6A 3P19A 3FOAA 3RK1A 3B9RA 5SY9A 4RU1A 4AZ3B 3DLTA 4QREA 4RZ3A 3AEYA 4R1TA 3OPYI 2ZSEA 2QORA 2IYZA 4U7TB 4XWKA 3INGA 3C87A 3G82C 3MGBA 2CDBA 3QXCA 2PGNA 4HAUA 3WQHA 2Z1NA 4CMJA 3KDAA 3AY7A 1Y5RA 3PRJA 1TAHA 3FYHA 4LOIA 4TGLA 5EJIA 4A10A 1QPZA 3FCUB 4OLAA 4BKOA 5AW3A 3LVRE 1TM2A 4B7UA 5KWVA 1OY1A 4YCAA 1WF3A 1PHRA 3N6RA 2WM3A 1QYCA 4Z2AA 2ZT5A 4ZCPA 3ESZA 2JVJA 2G9RA 1DIOB 2A0XA 2FUCA 2NPIA 3DMHA 1WPRA 3PHJA 1N7HA 3R6TA 4JT9A 1ATZA 3WLFA 4MMYB 1THZA 3BZBA 2YMMA 4AY4A 4D4GA 5HIKA 5CNMA 2Z2KA 3O31A 7MHTA 3BIOA 5AVJA 1I01A 4EMTA 2XMQA 3BSYA 1XMJA 1BRMA 2ZIAA 4KE9A 1N7GA 2WJWA 5FB3A 2WU3A 2JD0A 1DJOA 4TMVA 3VNAA 4BYGA 4F92B 1ZO8A 4GOXA 2G4LA 4GI3A 4OSEA 1DAGA 1XTVA 3BERA 1JJ7A 5HKBA 2GNPA 2OBXA 4FBMA 4QNNA 2WKWA 3MTAA 1Y7LA 3ZW8A 4AUEA 2Y1OA 4Z3KA 4E30A 5EZ5A 5KSWB 3RAJA 1A5AB 1T0PA 5IXYA 1ZHHA 2P1DA 5IM5A 1JDVA 1LWNA 1W581 2WV9A 3ZHRA 3F9CA 1KIMA 2O2HA 4W9NA 3VTAA 1SXQA 4NXNB 1DJPA 3WADA 3SSAA 2PGLA 4QOGA 1T2NA 1XZBA 4EZBA 5B4TA 1MR3F 4GO1A 1YR8A 2B6HA 5HWSA 4I9NA 5CUQA 1K8RA 1EGVB 1RXYA 2I99A 3NHAA 4PVCA 2O1WA 2QGFA 4US2R 5KOHB 3A6KA 2BHLA 4JD5A 4DZZA 4KTVE 3C16C 4CMAA 1TUGA 1C7ZA 3I5YA 3FHTA 1RZ3A 5A1TA 1M2JA 2R1UA 5D86A 3H1PA 1G2IA 1V8FA 3S1AB 3SHWA 4LY6A 1XPJA 1Y1TA 3DVLA 4UU1A 4UOEA 1P72A 4G4SP 4INPA 5C8YB 1ZMTA 4QGGA 1LPMA 3C2QA 2HMVA 2ZGVA 3GLKA 4OHMA 5EERA 3EXEA 2ATXA 5J2TF 4ZIRB 1QF7A 2DEUA 2VDMB 4GOND 2OHFA 3S2SA 3OQ1A 5JNSA 4KE6A 4QNRA 1JYFA 5GAJA 4MLCA 4RGYA 4X6XA 2JFBA 2WJ6A 3ZHBA 5BVHB 2A33A 1HH4A 4QEKA 1R6AA 4CNBA 1L4KA 4XPIA 2J4DA 3DE1X 4KO1S 1TK2A 2FLKA 4D8UA 1BCRB 5I4IA 4PYNA 1IXYA 1MJ5A 2O3TA 1VIMA 1SHLA 1D9ZA 1YVDA 2XUFA 5KDLA 4YCMA 4V0KA 3R20A 2J7KA 4NG4A 3HSKA 3EHDA 3M9WA 4R1SA 5KHAA 3W9YA 4G5OA 1IJBA 4K2AA 3PF8A 3Q7IA 1YZFA 4PIMA 5EPEA 4K6OA 1W4LA 4YP1A 3ROZA 4CMHA 2YDYA 1CBUA 1TCUA 1ZKMA 4I9HA 4MGZR 4PLVA 5AM1A 1W6UA 4B87A 5KBYA 1OH6A 5F98A 4INAA 5LDHA 1WHTA 2ZLBA 4XM2A 5DT2A 2G25A 3AUUA 3W4JA 2XRFA 4TTAA 2ZITA 2VZEA 2IS6A 3FKQA 4U0JA 4DYHA 1KQGA 2FN4A 1T0BA 3GG2A 4U8GA 3SVZA 2XVYA 3FGNA 4KK4A 5KYXA 2J87A 3OICA 1JVSA 2GPNA 4FDMA 4GYJA 1OW3B 2AG1A 2C4HA 3MN1A 5HF9A 1TCAA 5TEWA 4CN9A 3M6XA 4D0LB 4D3FA 2LR0A 1PS8A 5DM1A 1DX4A 1NY5A 2JKZA 3EVBA 3HA2A 2MHCA 1R50A 1GLGA 2VUTA 1KZ1A 3L82B 2Q5QA 2BM1A 2D0PB 3HDQA 2YIVX 5YASA 1CC1S 2ZAMA 5EESA 3R3XA 3UPTA 1CS4C 3BIWA 3IDSA 1QCCA 1FBNA 2Y77A 3CLVA 4YDHB 3B12A 2BELA 4JA0A 1R8JA 5IASA 1KY4A 3LYHA 4G07A 1FUIA 4O02B 1CT9A 3T5CA 5A03A 1P3JA 5CD1A 1WBBA 4UATA 1EGMB 3DTVA 3R1IA 4U3JB 4MW6A 4LIPD 2B1RA 1J97A 2HQBA 4ARZB 1PKXA 1TIPA 2QL9A 4GKVA 1O94D 5DSXA 1GZ6A 5EFZA 1J9ZA 3JYOA 3ZQ4A 2LCIA 1X86B 1SEVA 4AQ7A 4EITA 3GFVA 5E9JA 1P33A 4HCJA 4HNHA 1J4AA 5LMNB 2VP4A 3ZGZA 2PT5A 2H2HA 1VJRA 1XCMA 3LKBA 4JVOA 5CYOA 3SBXA 4COOA 4CCYB 4KPEC 1BS9A 2CFSA 5FR2A 1HM5A 2IHJA 3VVLA 2FUG1 2PX0A 2DR0A 2IHVA 4DCJA 3UQZA 5L4NA 3MUOA 3U16A 5DBIA 4MV6A 4YCCA 4HF7A 5G41A 1XCPA 4YFVA 2G76A 3OPYA 2FZ4A 1E2FA 4YASA 1MNQA 4IILA 5B53A 3O2QB 1MJGA 2VHCA 4HNQA 4BHTA 5E4JA 1RHQA 5CD9A 3AL2A 1TE2A 1PBTA 2DFVA 3NI2A 1TAGA 3C5CA 2JGDA 1EGHA 4FYKA 1UJNA 4V24A 4AUKA 2IHNA 3L0PA 4G1FA 1OROA 2IEIA 1IN7A 2IXEA 3PIIA 2NYRA 3T0FA 4D9KA 5HUJA 4MDEA 3GDOA 2PUWA 4EF4A 4C4PA 5BV0A 4QSMA 4QOSA 3E7DA 1T91A 1VCNA 1VSUA 1NF8A 3L7OA 4MW4A 1OF1A 3QTLA 3H5RA 4RQBA 5IC6A 1N3YA 2IPMA 3F5SA 5DN6D 1EZZA 2QAGC 3ESXA 4RM3A 4KX3A 1I2BA 4RGQA 3IDFA 4XIJA 1U98A 2EDCA 1UK6A 1DAMA 1DEXA 3FMGA 1DQZA 1ZH8A 4L1KA 1G7CA 4TMFA 1YBVA 1ODKA 2GO1A 1W85B 1ORVA 4FKBA 1IZYA 1VLZA 2DWPA 1A95A 4IL5A 3HNOA 3AW8A 4F2GA 5DM4A 2YV1A 3NOQA 2XSZA 2ZTVA 3SZGA 3IEVA 2AYXA 3H2IA 3TUZC 4L8VA 1E7YA 3QY0A 4BU1A 1CY7A 1XU7A 3AB7A 5DHRA 4HI0E 4F21A 1ACLA 1XZCA 3PKIA 5COQA 3JQ9A 4N0QA 4MW0A 4KRYA 4XFJA 2H5LA 3UUWA 3W1WA 2JLQA 5JNVA 1MW8X 2G5CA 3GZJA 3NRCA 2EWMA 2G1KA 1MHTA 1K8ZB 4FJ1A 4Q7MB 4BZXA 1MU0A 5LBIA 1IZ9A 1NR1A 4J9UE 4I3FA 3UCEA 3BRCA 4RDXA 4EO4A 5JAQA 5D1NA 1E4YA 4PRZA 3JCZA 1BVYF 5B7PA 4L75A 1YR1A 2QZSA 4QKQA 3KSUA 2JLSA 3EZ2A 1RC8A 1ZVVA 4OKIA 5EYPA 4EG3A 2IYOA 3H42B 1LPPA 4U0KA 3ZI7A 4CV3A 5I9LA 4MARA 3BCHA 1ZNWA 1RRPA 3QYAA 3O95A 2A7XA 5F9MA 2XOKA 1CPYA 3RVPA 4B75A 2V7EA 4HQLA 3OWOA 4KGXA 4UTVA 3TINA 2QAJA 1TYAE 2HK9A 1IB0A 3NFYA 2HMTA 1G20A 2I33A 2DUUA 4C4YA 5LN1A 3NTVA 4TLDA 3TQOA 2O8DA 2NTEA 3LO5A 1RMYA 3QVSA 3NDJA 2Y2VA 4I81A 2R8XA 2ID9A 4J90A 1MO3A 1D2MA 2BGIA 2C04A 1PDWA 2WMNB 3OE1A 1KE1A 2X7XA 2XODA 2OCXA 3LOUA 4P86A 4TMZA 4MQFA 2ZBGA 3W2HA 1YJXA 1PZNA 1UBSB 1G8JA 3PUJA 4G97A 5AKLA 3RRBA 1BYIA 1JQBA 1QUFA 1MT3A 1B76A 2ZS7A 3AY6A 4J4TA 1ZEMA 4MVYA 5J58A 2GCOA 3UMYA 2ECPA 3EPLA 4P2BA 4DLNA 3MJVA 2Q4OA 1NONA 1UP6A 1J00A 2GTHA 4PW0A 3IL2A 3BSSA 2CMGA 4Z6KA 3OC6A 1G5TA 1BDJA 3IURA 3JD4A 1ZJZA 3SM9A 4QLOA 4EPRA 3JALB 2AE1A 3MB5A 4EG0A 4R6WA 1Z7BA 2WWTA 2I2FA 4CKWB 4ALLA 3TB4A 1WXXA 1KFEB 4TZ0A 4QHYA 3GMTA 2PKRA 3ZVLA 2BGUA 3GAMA 4S12A 3RVBA 2WAMA 1MN6A 4UCWA 5LDGA 3FDZB 3PQ6A 4TQAA 2WJAA 5E7JA 4BUCA 5C1PA 3IVAA 1ZGBA 1U6IA 4Q34A 4QAJA 1E0JA 2CN1A 2UU9B 3EFOA 3G5AA 2VP6A 1KOGA 3IKMB 3HU5A 3CX8A 1W2HA 2DECA 1L7NA 5EAIA 1P0MA 3TDMA 2R84A 3AF3A 5DVZA 1K66A 3VBEA 4HHEA 4WK0B 3ACBA 2X5OA 3QLJA 2PUEA 4MKHA 1ES9A 2B4TO 1W7AA 3MYYA 3MBOA 1EWQA 1JR3D 1J8MF 2ZBDA 1LK7A 2R44A 2EV9A 1M8JA 5CT4A 3ZDEA 3A1DA 4YT5A 3A1CA 5FNVF 3VPXA 2OBBA 3FJOA 4AS3A 4C1BA 5COBA 4YUVA 2XUHA 2I7DA 4LBZA 1JB1A 4LDNA 2OHXA 5JAOA 2C7OA 4NZZA 1NM5C 2ZVJA 1XNGA 2PUGA 1YOVA 2QQGA 3AR2A 4CNQA 4JJIA 1LNQA 2NZXA 3T9FA 5DYTA 2J59A 3CXRA 2IKQA 5ESXA 4ISBA 4JDUA 1WJGA 3ADPA 1KMNA 1U0LA 3HRHA 4WGGA 3GLRA 1QRAA 1BU8A 4N7BA 1BHJA 1LKZA 4AMUA 3HXPA 1NQVA 1XVAA 2E85A 2K7ZA 1UAGA 3KEQA 3G13A 2J0VA 3OQVA 4HAIA 1RHUA 1GR1A 5CB4B 1J90A 3DEJA 5KTPA 4IKOA 3HB9A 1S2NA 3JATA 2VF8A 1KK3A 2I87A 2VPWA 3WMWA 3RUHA 2PMBA 4KMOA 1Z06A 4FDVA 1EB8A 3UK1A 1QGDA 3L40A 2VATA 4JJGA 3DHYA 3GLSA 3WV5A 2ZYWX 1HUQA 4BQRA 2ZUCA 3DO8A 1IBCA 4CLHA 3EIWA 4CRWB 4TTRA 3SZRA 3T3EA 4DG8A 3T1OA 4LNHA 2PZLA 4NZOA 3S28A 4FSXA 3TX6A 5E3JA 5B1HA 2RHLA 2DKNA 3PE4A 3Q41A 4P4SA 3G89A 3U26A 5K6RA 4DCNA 4Z1OA 2AH5A 3WC4A 2QRQA 5JI2E 2AB0A 5DPMA 5IVPA 4FK8A 1EK5A 1Z62A 2CNWD 2KYRA 2ZI6A 2XRZA 2W2LA 1AUOA 1T9BA 1TPZA 2I6TA 3OWHA 4IEFB 5K3EA 2Z5FA 1R1DA 2VAWA 4P0QB 4JP3A 2V58A 1EDZA 2XMSA 4N5NA 3WHPA 3BAZA 4QPPA 3UA3A 1CZLA 3R7BA 1F06A 4KGDA 3ECCA 4LWPA 4Q3CA 1JWLA 3A04A 1L7XA 1PGOA 1WS6A 2OAGA 1X1AA 4QA9A 2I8CA 1XXLA 4DS3A 3LTEA 2C5SA 2XITA 3OTQA 2VR1A 2COKA 1RM0A 2W5UA 3B1FA 3PGXA 4CJXA 2WWYA 1U3CA 3BD7A 3CZQA 3SYMA 1DXQA 1L8AA 3TGPA 5CK5A 1QYXA 1SMKA 1WOMA 2E3JA 2EIHA 1J0XO 1RJ9A 1ZRMA 4CCYA 3FPAA 5LQKA 5ITSA 3QXHA 4PG7A 1EYZA 1MHPA 1YVPA 4PTZA 1I51A 1Q5PA 4QXRA 2Q4EA 3ZIAA 3KIPA 4W8OA 2TMGA 4M22A 1K3UB 3N6XA 3NVAA 1Z0AA 1DKOA 1QYIA 1BHSA 1K5GA 1O94C 2OQ2A 1DMSA 5D3QA 1MH1A 3GZNB 1UM9B 4RIGA 1NJ6A 1C4WA 3PQEA 4M8KA 4OL0A 4NYJQ 4OYRA 1JDZA 4KGZA 4WOKA 3A0RB 1AKTA 3CZCA 1TUIA 4UZEA 2GAFA 1FFXA 3Q2KA 3R9KA 4A6PA 1FE8A 2AD5A 3TZ6A 2WM2A 4QDXA 5DBOA 5FWYA 3O4JA 5L3ZA 1J1UA 3QMPA 2BE7A 1D4FA 4Q3LA 5LZ7A 2C00A 4S2UA 5K3OA 5F7JA 1BCRA 1PFYA 4CN8A 4E5DA 2EFEB 3CURA 1SKYE 3LKDA 3W06A 4OG2A 3F6RA 1KARA 2P90A 2MSEB 3GMSA 3PYLA 1U7UA 3E9CA 3QLEA 3VJMA 2OOSA 4ZXFA 1G5PA 5JFOA 1SVLA 3BQ9A 3E3NA 2P69A 5KSPA 3RUFA 5DHAA 3N5CA 1U8TA 2P3LA 3D5EA 3LP5A 4HLDA 4JMLA 2XGGA 4DV6B 4ZQIA 2E89A 2Q9AA 1G4UR 2E18A 4KFRA 5B58C 4KNWA 2PKQO 3H7IA 2YY6A 1CY1A 3DT9A 2AFHA 2H5EA 1IZ8A 3WNVA 5G0WA 4EJMA 4FFNA 3ZHYA 2JC3A 2X1VA 3IQHX 2GEUA 4OCZA 4RHCA 5F7ZA 4NZMA 1TJNA 2ST1A 3BB1A 3V8VA 3OZBA 2XCSB 1QMGA 1T35A 2BKAA 4ZARA 2RONA 3U6BA 4NPHA 2OCLA 4LHXA 1WIWA 3E1GA 1KJ8A 1RXEA 3K5HA 3QG5A 5BSTA 4BN5A 4MGKR 4FU0A 4OI0A 1JLRA 1ZW6A 4URXR 4V38A 5FWNA 3VNVA 3I0NA 4FFBA 1KZ6A 4YRRA 2GSDA 1XCOA 2WR8A 5FUVA 4QYIA 4MUIA 2A35A 2OPBA 5F77A 4EGJA 3G9TA 1GNQA 3SSMA 1AK1A 4AZTA 1AZTA 1GUZA 4X8MA 2C5AA 1E3WA 2DJIA 1DIBA 3GLUA 1EFCA 3T7AA 1LQUA 2H1VA 2Z2XA 1Y9EA 3NHMA 2AR0A 4Y6QA 1TMKA 4CT5A 3PUWA 3NBZC 4DYVA 1G3IA 2JFUA 1X77A 1Z6AA 4DEXA 5LP6B 4OQLA 3DB2A 1E3WB 3LX6A 3VR5D 4C0WA 5I7EA 3HVHA 1Z83A 2B69A 1GZ7A 2IFTA 2QRPA 3G2HA 1VGVA 5IXJA 2IGBA 2J5RA 2VAPA 2XZLA 1XE3A 3CZPA 1K97A 1LTQA 4FP9A 3DPIA 5ANRB 3RYIB 1P4AA 5LYJB 2HIGA 1BWRA 3G2IA 3I9V6 4JVLA 3IVMA 4LYDA 3ZJUA 2E2WA 3RWOA 4YV1A 2H52A 5HZMA 2HV8A 3CVJA 3P9IA 3I6ZA 2AW3A 4U5QA 3UMGA 2IHYA 2DQZA 1FRQA 2R8BA 4EKDA 3WWZA 1I6LA 1ZU4A 3TZCA 3PEUA 1AGYA 5BSEA 4B31A 2Q0QA 1GAJA 2G09A 1NT4A 2OD2A 5IDWA 4H18A 3IUNA 1F1JA 3B48A 3DCYA 3GJ4A 3UGTA 2Z4SA 4AG6A 3FD8A 4EVQA 4AS1A 3TLMA 4F96A 4CM8A 1OIVA 2ATVA 2IUFA 1NL3A 3A3NA 1N3BA 3I2FA 3K94A 1CNMA 3OZTA 5CT8A 5IJAA 4CQNA 5FNZA 3PL1A 1NC1A 2GDZA 2B34A 4JUIA 4JU9A 4Y1RA 4ZU3A 5E0KB 5LYYA 2VHUA 4QUJA 4E5MA 3OZEA 4UTRA 3I62A 4OBBA 2L2QA 1JFLA 3BOSA 3NR2A 2FDCA 1S9DA 4XX0B 5JZVA 2B20A 1WZNA 1I5EA 2H5JA 4WMLA 1OX4B 5HTOA 1E0AA 2ZJBA 2VNSA 2XTAA 2ZRQA 2G8NA 4YDRA 3AM5A 4FNAA 5ICMA 5TMPA 4NECA 1S1CA 3ZDBA 1T1RA 1FVFA 1PJLA 3AG6A 5L40A 1C8KA 3C45A 2CGEA 4BMCA 1OZGA 3M1IA 3HNPA 4GMGA 4EFNA 5MDHA 4TTPA 5AVTA 1HT2E 3DEAA 1S8FA 3IV7A 1L7RA 2ACKA 3RC2A 1JQJC 3RB8A 4E5YA 1F7UA 1X1DA 2AA3A 2GPWA 4MS1B 3WYNA 4ZAYA 3QPAA 2P6OA 4DCPA 1T5TA 3LNTA 2QUAA 1CUDA 1NRIA 3DFUA 4RY2A 1XPUA 4HWPA 1NJ8A 2HQSA 3VKHA 1CZRA 4KU4A 2AFIE 3ICWA 2FZEA 1XJ0A 3N58A 5JNTA 1K9VF 4WKBA 3VYTB 2GEVA 1VMEA 4JR2A 1AQUA 5F12A 1S3IA 2DHEA 2FWMX 3D7SA 3KQQA 4UOQA 5I8WA 1QFYA 2PX8A 5AVSA 2PBLA 4NPCA 2RGAA 4W9RA 1SG0A 1J2EA 3GJ6A 3CRRA 3RU2A 2F3PA 3JD3A 4YNBA 3NBXX 3H18A 3M6MD 1TC2A 2CVOA 1QS0A 2FV8A 5CU7A 1TVKA 3PPXA 5T8KC 3RKUA 4OUDA 2A4KA 1BWSA 1JIXA 3U3MA 2A9OA 2R7MA 4F5ZA 3RAGA 4CMEA 1G8PA 1QHFA 2ZSUA 1QUEA 4R9UC 1SUEA 4HH4A 4YAWA 3GA0A 2HT6A 2AOXA 1QCZA 2J48A 4YN3A 2RI6A 4TTVA 2SKCA 3T3HA 2PJRA 2BSAA 1WCIA 5HKOA 4UVDA 1L5SA 1V16B 4BU0A 1PDVA 4XJSA 5ITVA 1DKLA 4Q4HB 2WAOA 4UMVA 1IXSB 2C83A 3I61A 2RK6A 4L28A 4Q47A 2FMFA 1E79D 4TKZA 3S44A 3WO0A 3O8QA 1G8YA 1KAHA 4L95C 2PJZA 3BORA 3QEJA 4XD2A 3RKRA 3VO8A 2ZYDA 5IT4A 1YB2A 1B6TA 4MWSA 4TV9F 3N2NA 3S8MA 4OL9A 5IHPA 4NCJA 4DXAA 3J81A 4F9FA 1CJCA 2WYIA 1AF4A 2W98A 2IYWA 3KHSA 2C5EA 4FOTA 4NYIQ 1RJEA 2ZETA 1V1JA 4TVKA 3DM9B 2NV2B 1N6PA 3DD5A 3OJFA 1A4UA 1I7PA 3Q6MA 4C3VA 2VP3A 1PUIA 3OM0A 5BURA 1J2UA 1MLDA 2IF0A 4CEIB 5B7QA 2ZPUA 4O4JF 4DE5A 1JNYA 2O2JA 2ZVDA 3M1YA 1M1XB 2DPLA 3I34X 4DW8A 3EDYA 4FI3C 4NBLA 3A9WA 1NMSA 1QIHA 4DG9A 5I4KA 5K8TA 2SECE 2RSLA 5F78A 2VHVA 5KYTA 4OXRA 1EK0A 2UZ1A 4YJ2A 1P7WA 4YCNA 4KIUA 4L5CA 4IZOA 4IDNA 3RSZA 3G0CA 4M37A 1DELA 4RCYA 3R6LA 1ZL0A 2D2EA 2C3OA 3ZLTA 5BYBA 1GAEO 2DY0A 2KI5A 1C1XB 5EZYF 2GF9A 3VNBA 3U0BA 4AJ1A 3V1MA 2PZFA 3QU9A 4D56A 3H16A 2FN9A 4XDHA 2O48X 3KT6A 1FUKA 4WKPA 5KTKA 3K32A 4CIYA 1SBHA 3HXOA 2ZAYA 4JL8A 5IEJA 4GBMA 4B48A 1CDZA 2ALJA 3LCUA 4EZIA 2E5LB 4OQZA 1VI6A 4GKKB 1OV4A 2PD4A 2DT5A 3P2KA 1FSZA 1YB1A 2B25A 3PFKA 4G6ZA 4JCOA 4JJEA 4XSGA 3L4SO 3WP0A 4DNXA 4LHYA 2DMRA 4JEIA 5CG2A 4FMCF 3JD1A 2JJ2D 2JIOA 4KDRA 1LPBB 1ZNQO 1EBUA 2BEJA 2D7CA 1S3GA 3QTBA 4IJVA 4L8LA 3SX0A 1KMHB 3WJAA 1MF7A 1R8QA 3WAKA 3L0ZA 1FP1D 3AQIA 2O52A 1G20E 3NBUA 2X2OA 2VJMA 1LDYA 3L9XA 2W2QA 2W6JA 2WG1A 1K08A 1FPQA 1EESA 1JBEA 3TW8B 2GBPA 3CISA 3O74A 4IYJA 4EWLA 5KVAA 4DIOA 2H31A 1FMTA 2L19A 3RIHA 4RELA 3ZCVA 1OX6A 1X3SA 1ESCA 2HUNA 3HB5X 4FX5A 1WMDA 2F00A 2VJMB 5CJ2A 5ARBA 4J7UA 5A9TA 2YL2A 1K86A 1T9KA 5EZSA 3WMGA 1EUYA 1NJGA 5K8IA 2NLOA 4NAHA 4G3XA 1QG4A 4R8LA 4W5TA 5AXAA 1E7MA 1HT3A 1B2RA 1ZK3A 4JJ6A 2C3UA 1CRQA 4BB5A 2UYCA 1ISMA 1NSTA 1ZEJA 4G4JA 1XNHA 3AU8A 3K0FB 4WK6A 2F48A 1RWKA 2JLWA 4GF5A 1Z5WA 3ZNQA 1PG2A 2QG9A 4OXNA 4HPWA 2PKCA 4PQFA 3ZYZA 3R41A 4NOJA 1ISSA 2VTKA 4O4LA 5TDHA 2Z2IA 3IV9A 3DZ8A 3VZBA 3UAZA 4OQPA 5AI0A 4I4TA 1EVJA 1SBZA 3KEOA 1DWPA 1U1IA 4PX3A 5LM3A 1OSNA 1L1RA 3IKVA 5THXA 5HDBB 1ZOPA 5FH9A 2R96A 4P36A 2QGNA 3V97A 4ARUA 2IXAA 1PWYE 2WD7A 4WN9A 3A27A 4HADA 3ZWKA 5CYGA 5H70A 2GAJA 4GSKA 3ACDA 2XUGA 2MSDB 3CYFA 3KB2A 1OX5A 1CY2A 4P3NA 5KI6A 4X3PA 3JAMA 1JDJA 3AINA 1N3LA 4JXJA 4BNJA 1PSWA 4BFUA 5CB8A 2P11A 1AXRA 3D59A 1L7MA 1XU9A 3P9RA 3UWSA 4E0BA 3F6EX 1NG9A 1VKZA 3AQ4A 5BY2A 1B6RA 3ZJYA 4NZYA 4F5WA 1XJQA 5DTJA 5EMLA 2AJTA 4BO7A 1C9YA 1NR5A 4DSAA 2HX1A 3LCJA 1YU6A 1LVUA 2WICA 2YRFA 3W6OA 4CPDA 3HFJA 1ILWA 3PK0A 4BC1A 2EQBA 3C6BA 1QH9A 3K0HA 3OQPA 1W49A 3QJ5A 3BTUA 3FYCA 4RMNA 3ZW9A 3M5DA 3TVTA 4MPDA 4B44A 4KLCA 2B94A 2PA0A 5KNBH 2XVMA 4UCQA 5K09A 4L02A 2VF4X 5AI4A 4JI2B 1ZA1A 2GKGA 3G2OA 2A86A 4ER0A 2YC2C 4HL6A 4JL5A 4YPFA 5K3FB 5TT1A 4F8JA 2Y1XA 2A78A 3MMSA 4QHSA 1VLQA 1Y5IA 3FCXA 1E2HA 1QQ6A 3IOYA 3I01A 2WTAA 3QLUA 3A4LA 2AK2A 3RLIA 4FEAA 1GT91 2O8VA 3I2YX 4UZSA 1YVEI 3HWX1 1NZDA 4HEJA 1KMQA 2ZK7A 5L9AA 5KJCA 4X92A 4MUXA 4HAYA 3B5IA 1TW2A 1F0PA 4L9WA 4HQRA 4IRUB 5AK4A 3LECA 2OZLB 4I46A 3ILYA 3VC2A 3TRKA 2XUDA 3EZYA 1LFAA 2RCYA 3H1EA 4RVSA 1VG0B 2ZRCA 1BC5A 1SM4A 2RHOA 3C6YA 4YXWA 3W8DA 5BUSA 3KSAC 4OU5A 5IAOA 2AIRA 4Q1BA 4PYMA 3HL0A 3SHTA 5F23A 2CV1A 1XTRA 2QMZA 5J2UA 1E9RA 1BQEA 1NUPA 2C8JA 2Y4NA 3BMOB 1N6LA 3Q8WA 4PR0A 3RH0A 5IC4A 1VFNA 4PEVA 3M4XA 3LQ1A 2QE7A 3PQ5A 1ODIA 6AT1A 2IXGA 1WD5A 1JR2A 1NNI1 2J0UA 2ZIFA 3OJLA 4REQA 5E2BA 5LD2C 3L1JA 2Z6AA 1XL1A 3MK31 1GPBA 1O7JA 1UP4A 2GB4A 5IJ0B 4XM1A 4BCCA 1ECCA 1P1HA 2PKEA 4PG8A 5C35A 1AHHA 3EMDA 4ZVNA 2VP2A 4CQLA 4RQUA 3FG9A 3ZU5A 4R69A 3R24A 5IWCA 1D1QA 2AWNA 2X0NA 2EW8A 1T9GS 1PVVA 3AFHA 5CNJA 5DYYA 3LCRA 4GL4A 4WT7A 2DU8A 1KRHA 2ZJ1A 4D0GA 5BSFA 3ZDXB 4IFIA 2GK3A 4GI2A 4D9EA 1HDXA 4LJYA 5TQVA 3ZDAA 4LZOA 5CNIA 1CD5A 4WBNA 2JLZA 4TYNA 1T2DA 2GF2A 3F0TA 1G63A 2I1WA 1AD2A 1PEKE 1QIIA 1WV1A 3FSGA 3NATA 3TMYA 1NOIA 2X8JB 2LV8A 1QV6A 3GFPA 1J7JA 1OI7A 2Q29A 1QK4A 1V8BA 1CVRA 1KK1A 2O3SA 5GVRA 4E3ZA 4OM7A 4OFWA 3QK7A 4WBNB 1EFHA 3TTWA 2UXBB 2GZRA 1EVQA 3LBHA 2C42A 5LLDA 3A36A 1SOWA 4FWTA 2BUAA 2H16A 3I5XA 3MJ4A 1KTIA 4NJEB 1CJMA 2H9YA 3T9BA 4UCXA 3DEIA 4EA8A 2F3UA 2H17A 2V6FA 1JDNA 2DTDA 4GOKA 1E2UA 1JLKA 4UBIA 3TNLA 2EW1A 3HP4A 3LRTA 3OY7A 5AKGA 2WWIA 2P67A 4WK4B 5CMLA 4LNUB 1MJNA 1U0OC 1WCIB 3IO5A 3LO8A 4MHTA 4KWHA 3ZE8A 2HEGA 1V2HE 4OBWA 3ZE2B 4R71A 1UT6A 2QLLA 3L7IA 2DB3A 1V37A 3U6KA 3DHWC 1NX6A 3R2JA 2P4HX 4WERA 2FEKA 3VC3A 4TLEA 4R2KA 1RPAA 1E1QD 2I0FA 1Z88A 2WYOA 2ZYVX 3QWHA 4BLVA 1MFZA 1S3FA 3RFXA 3MGCA 4MYTA 1I3NA 4XVUA 3KVOA 3N53A 4F9EA 1FC0A 3STXA 1Q7GA 2V03A 1E3IA 2DCUA 3AWIA 1NG1A 3DFFA 4LMAA 4RZHA 3PC7A 3PQ4A 4HEA6 1OYYA 4IEIA 4M88A 4YRQA 4FYIA 3FPLA 3MCWA 3TD2A 1U94A 5JRZA 3JQPA 5I47A 2BH9A 2NSDA 3CNBA 4P2GA 4W1QA 3WR5A 5HJ5A 3CO5A 4KE8A 1HE5A 1KEEB 5EKXA 2ZR8A 4O33A 4ZANA 4YYEA 4N41A 1UFRA 3N7AA 4P5DA 4M38A 3ZE9A 5BXQC 1EWTA 1T9AA 1LJLA 3KYCB 4Y7DA 5LA6F 1C5KA 4TUYA 4F3TA 1TVMA 3IP8A 1CU1A 2EZTA 2ZRGA 2KLHA 1WMEA 2P0AA 1U3TA 1JZTA 3I45A 3V8BA 1G9TA 4N5IX 2Y99A 1PI3A 1U2QA 5KHLB 4ZOBA 2R79A 2GM4A 3LQRA 3W3AH 3U7EB 3MTIA 1PVOA 5CIYA 2VBCA 4B3JA 3QW2A 1T29A 4PF1A 3D3QA 3FMIA 4BKMA 4NFSA 1VXRA 1WUHS 5HKLA 4RLFA 2SHKA 3WIVA 4RNDB 3VAAA 1KBOA 4O3MA 4B83A 3KETA 2Y93A 4CF5A 4CWAA 3PHIA 1YIAA 2Z3VA 3ROMA 1LC3A 2HOQA 2VLIA 1F6DA 1B41A 3L02A 2BHSA 2NAFA 2GAAA 4OIFA 5GZ3A 1Y9JA 2WT8A 2R1VA 5HYVA 4L9RA 3GA7A 3RQSA 5H3HA 3H2KA 2IU0A 3ZWWA 1O6BA 2HLHA 2WYUA 4Z9FA 1M0WA 3S5JA 2R1TB 5K0EA 5HA5A 4BQOA 2F43B 3WWEA 1PR3A 1TUBA 5LZ5A 1M8GA 1DT3A 3ZD9A 2ZTHA 4CHGA 3KC2A 1HNZB 3AILA 1LDMA 2ZUVA 4RSHA 4ANFA 1VP9A 3RU9A 1UADA 3CW9A 2GETA 3KZXA 3PE6A 3QKWA 4XRRA 5F7OA 3COJA 1Z7GA 3QVMA 1XMSA 3KM0A 4EFLA 4ENTA 2AEJA 2HCJB 3DUFB 2O14A 1BDIA 1BS1A 1NTOA 5CA0F 1NNEA 3HC7A 3TO5A 2VDUE 3T41A 2ZT6A 1FMFA 4EAQA 4NCKA 3F3KA 3KKLA 4ZEOA 2D1FA 4V3CA 3RSFA 1KI8A 1RP1A 1SU4A 1ZM2A 3E0QA 3E4DA 3PNKA 4GWGA 4HGQA 3SS8A 4D9BA 1DC4A 3ASZA 2PMWB 2I91A 3SF8A 3LP6A 3DXZA 4X45A 4RJLA 5EE9A 3T61A 4N7MA 4HDAA 4TL6A 4X66B 4A7PA 3M89A 2XMZA 1VL5A 3C5EA 5LQJA 2VQFB 3T4XA 1XZQA 5LZ8A 4UBKA 4B43A 3GN1A 4A26A 4B6JA 3OX4A 3L8CA 4F4FA 4Q7EA 1I2ZA 2VF2A 3MUFA 3NVMB 2Q2WA 1R00A 2HF7A 1CR1A 2JL1A 3DWIA 4I50B 4LNAA 1A4RA 1SQ5A 2VT6A 1W94A 4OJMX 4TZTA 1SO8A 3H5WA 3G5TA 2DZDA 2Q9UA 4WEQA 5IF9A 3BJRA 3GVIA 5EPOA 5JECA 2BFDB 2C2WA 3QEMA 3FZEA 2DQYA 4MWGA 3HL4A 1RJDA 2TSYB 3BFXA 4QUEA 5REQA 1VCMA 5J4KA 4GWKA 3H9BA 5JY1A 5EJ5A 4A9AA 2CK3A 3MJTA 4CIAA 3ESDA 2QD2A 3R74A 5M5BA 4YALA 1N6NA 1QRDA 4ZU6X 4EQ6A 1RXWA 5AW2A 3IE1A 1HSZA 3WLHA 1M7BA 2XTNA 1U11A 3BGIA 3AHGA 2RH9B 2QTVB 5I7FA 1P2FA 5KNBA 1CJBA 1M10A 4PNPA 4RJJA 5SYNA 4BNZA 1XX6A 4ACBA 3LU1A 1HETA 4DXHA 1W6RA 5J2UB 2QN7A 1KPGA 5T4HA 1JXMA 1D5WA 3VR4A 1TMYA 3W6ZA 4XH9B 3A32A 5M04A 2ARKA 1PFKA 2CMKA 4YS6A 5K3FA 4MRMB 4HDRB 1IM2A 1CRPA 1O9GA 4IS2A 3JYHA 2QTFA 5TQ0A 3EQ6A 3VPBA 1Q17A 1M2NA 5LPNA 3K70D 2AC7A 1T15A 4Q0MA 4PSAA 1E6CA 4KQCA 2TS1A 3HRIA 4HNVA 1QB7A 3S8YA 3K9LA 2QPOA 1AQIA 3RJZA 1V5IA 3ICVA 4B3BA 2IBTA 4G0VA 1TO6A 1MBZA 3O4HA 1QYWA 4B17A 4LV6A 2RGEA 1AJEA 1HLPA 2R6AA 2C78A 3U7QA 2ZTSA 1XBTA 3GK3A 1ACMA 3MS7A 2JBAA 2OEPA 3RLFA 5CXQA 4ND8A 2O9JA 4OJYA 3JVUA 3LQ4A 3ULKA 1DTSA 1O54A 2IYFA 5DGIA 4DT1A 1QTNA 2QMOA 1Z0FA 1GADO 3CUKA 3E22B 1TD9A 1O96A 4LYJA 5AXBA 2HBZA 3S7ZA 2VPXA 1J7KA 1Q0RA 3FMPB 4BP1A 3LWBA 2P5SA 3ILVA 5IJXA 1JWBB 5FT9A 1J8FA 4MZXA 3TNJA 3DBHB 3RUIA 1RI3A 3H2GA 4J8PA 2BAGA 4OH1A 1U2RA 1PL0A 2IEBA 1NOJA 3EULA 1DRJA 1RNLA 4JAVC 1R5NA 2B1GA 3G8DA 3URKA 2WAXA 2FWBA 4DR3B 1JXAA 3O38A 3PVSA 4ZOLF 5FPHA 1L4NA 5BOSB 3RODA 2JD2A 1ODCA 3LCMA 1OFGA 4KVAA 2VJDA 3R77A 4UUMA 4TLMB 2VO1A 3WKAA 4B7XA 3JX9A 2IZZA 5A04A 2O0LA 5F9FA 4HYQA 3N0XA 1E1CA 4PCUA 4PRLA 4LWZA 3BFVA 3SJBA 3OUZA 4Q3OA 1YFLA 2F3QA 1E5LA 2VUIB 4TWBA 4TT3D 1U0SY 2DUJA 2VF7A 2WUWE 3FNEA 1MRZA 3OX1A 1HL3A 5JHHB 1QP7A 3MXOA 2PMEA 4ZAXA 5E4FA 4G9GA 5H68A 4AXBA 5FULA 4KRGA 2XDQA 3KTAB 3RASA 4BNNA 4EMBA 2BPOA 2ACEA 4BMZA 4MVXA 3ENQA 3BF7A 4L5YA 2A58A 3QE2A 3ZY2A 3TCKA 4PAQA 5HF8A 3P0HA 4XYMA 2P2DA 2GJAA 4DM4A 1NYTA 1YUMA 2EG5A 4MUFA 1N3IA 2W2OA 1SB9A 1W30A 2WUEA 1JJAA 5BYJA 5SYAA 3ZEAA 4BO4A 3LLSA 3N8HA 4A23A 1R8XA 1H65A 2JEOA 4IVRA 3GQVA 5FF9A 5DTMA 5K3DA 1F6WA 2AGVA 4HQKA 4NH0A 1BYUA 1TCCA 3VQTA 3VRHA 4DRXA 5ALGA 4UNIA 5KYGA 5H16A 2HRQA 3Q3HA 5IAJA 1GSIA 2NZ8A 1UZLA 2JCXA 4NAUA 1YRHA 3LPMA 2WSYB 4QU8A 3EPHA 4HNRA 3D5TA 2J0SA 2OKCA 3DHNA 2HSGA 4JXZA 1HYBA 1TLLA 3PFGA 2O8DB 4IG4A 3Q72A 1XP8A 4IIJA 4PAMA 4BAGA 4F0JA 2PGJA 3C14C 2ZPAA 3HCOA 3AOEC 2PUVA 1CUHA 2LZ0A 3DKRA 3E9QA 3JQAD 3SZMA 2H1CA 3TUJC 2Y1KA 4LNUA 3GPLA 5FFFA 2UYHA 2EL9A 5KSZA 5IZCC 3T3OA 3DLAA 2R2GA 2M2IA 3DMTA 4UPEA 3N75A 2XB4A 2GBCA 2OESA 3FVVA 1PL8A 3FJ1A 4KWCA 3TKLA 1VI5A 2O1SA 3O1IC 2AJDA 2I65A 2YWEA 1GQYA 1L8LA 4B3FX 5CLQA 3ENWA 4FN4A 2Q49A 1J70A 1R0BA 4Z86A 3OZAA 4BBJA 3PEFA 4XD7D 3UOGA 3KPWA 1XFDA 2E4WA 1G5IA 5EVJA 1U1CA 2W83A 1CK4A 1XT6A 3RUAA 5BWNA 1Y80A 2K6GA 2P65A 2P1ZA 1HDIA 2YC4C 3EPKA 1AQJA 1NLYA 1RAAA 2D2VA 3P27A 3IQFA 4GR4A 2JFPA 4JJFA 4XOIA 3WRWA 3CVYA 3J81k 4B2YA 4DDKA 1GTRA 1XWFA 4HQFA 4OHBA 4C7KA 4KFCA 1T3LA 3L2OB 3NEYA 1GGNA 5CLIA 3IIKA 2WE8A 5EA2A 1RQLA 1C81A 3SG0A 1AVTA 1LWOA 1VECA 4I50F 1BQ3A 2AL7A 1I4LD 3JQEA 1K5PA 4BMPB 3FUWA 1PWHA 3RBVA 3BFJA 2BHNA 3RRMA 2H1SA 2J6BA 3BZUA 2O3UA 3QRWA 1C8VB 4OYLA 3VPAA 3IVRA 4FNGA 4RZIA 5KYWB 2YXLA 2PXAA 2N47A 2BGLA 2VSQA 2I7TA 5ALXA 4QEZA 1J20A 4EF6A 1T0HB 5IK2D 1N9GA 3H17A 1HPLA 3FCOA 1LBHA 3RVOA 4DJTA 1BDHA 5F3WB 1UXIA 2JRLA 1MDBA 4RF2A 4Q4LA 3UC9A 3I52A 1E77A 1ZVKA 4A6DA 2YWDA 3LK6A 3WGJA 1UOPA 1A5TA 3PS9A 5CM2Z 2GYYA 1XN1A 2PFGA 2RH8A 2VHTA 4O4HA 4NV1A 4DA7A 4IVPA 5A7HA 1VDMA 1NJ2A 1QYRA 2WJVA 3OH8A 2ZJOA 4OUDB 3SXPA 3SF8B 2OYSA 3N8NA 4TV8B 4XDYA 1Z28A 3CT4A 2IODA 3EGCA 3MWDA 4RPGA 4LF5B 2KSQA 1C9EA 2R6GA 1BS2A 1SQ6A 1TZKA 3H5LA 3HKDB 4NJMB 5F3RA 3WQQA 3TBKA 5K9ZA 2O5RA 1R3DA 3RS3A 1SBCA 3T5AA 3N2KA 3DVQX 3BHMA 3QKRA 4GMFA 4Q15A 4BVAA 3ZGVA 3G1TA 1HDEA 3DUFA 4E1AA 1KSHA 3EY9A 3KKKA 3G49A 4FYJA 4MLZA 1H8EA 1ZIPA 3ICEA 2WQ6A 2P8JA 1IVSA 1C2YA 3GAZA 2CXUA 2NNLD 1N6OA 5AESA 2D5BA 2PV0A 4RTNA 4IIBA 3OO1A 3DDCA 4P54A 2ZUFA 3D02A 3V4SA 3GRCA 3WTBA 4GPAA 1R9NA 3TIFA 3VSBA 3ZH9B 4B9AA 5KWJA 1XJWA 3FKJA 3NGLA 3OEED 5TB5A 4ZCRA 4QQFA 2I8LA 3D2BA 1RAIA 1P81A 1IUPA 2V9CA 2NNWB 4EA9A 2R4TA 4DEVA 4EJ6A 2APJA 3SKYA 4C4RA 2X0JA 2QY9A 2ZG6A 4FYPA 1MOZA 1I7LA 5HFNA 1KPIA 1HEYA 3QTTA 3TZLA 3ZQJA 3H9QA 4Y3UA 4U7FA 4L8FA 5EMNA 5JT1A 4DYDA 1GTG1 3OTGA 4L73A 1VM6A 2FUG6 3T8YA 2V7PA 3K1AB 5LA6B 1UDBA 1HI9A 1I14A 4GM1A 4KAXA 3EDQA 2P40A 4QYWA 2RGRA 3PR2B 4JBNA 2H4XA 2QJWA 3DULA 3MHTA 4GIBA 1U80A 5AIBA 2HDWA 1EDBA 3GJZA 2QTGA 3L7KA 4ZTBA 3K9GA 3MT9A 2I5PO 2HUPA 3EH2A 2I1VB 4FFMA 1JLMA 3D6NB 3QHPA 4YRPA 2VYVA 4C4SA 4B3SB 1XD2A 2Y1WA 3GDWA 1GAXA 2XCIA 4OQDA 3MIIA 3VOAA 3CZ4A 4YRCA 4DZTA 2QUJA 4H6WA 2P6RA 4HDKA 3D31A 1W36C 3CLSD 5LZ4A 1R0KA 2HW8A 1FFDA 2FWIA 3QKSA 1XNJA 2BEWB 5KTYA 1TUBB 1Y5NA 1XD2B 2A5GA 3HRKA 5CFRA 1P1FA 1GILA 3OE7A 4N5HX 1KH3A 4R3NA 1X7DA 3IKTA 2HA6A 1WSAA 4M4SA 4EHJA 2CEAA 4RO0A 5G0TA 3WK5A 3CN7A 4K40A 2VHJA 4HVCA 1DL5A 1H22A 4HEA1 2ZUDA 4JSYA 3OA2A 1JAIA 1KMIY 2D5IA 2I71A 1N2CA 3CRZA 3LA6A 2Q3LA 1ZRHA 5DTRA 5IX8A 3RU7A 4B4OA 1V11B 2FR8C 1QJCA 4FVTA 1YC2A 4JCCA 4MQEB 4A8JA 4CTNA 2EFGA 2JLCA 4K9NA 3TJZA 4CUJA 3WRVA 5HM8A 1U3UA 1JVNA 1VYHA 4XVCA 3A2MA 3F6BX 3YASA 1E6WA 4ZOLA 3K8QA 2M9MA 2VPTA 3CS3A 3VI3B 1T4MA 2IUUA 1N34B 2IOFA 1F9EA 1PFQA 1RYMA 2ID7A 3B20A 3F74A 3BPSA 5J9FA 3ASUA 2XWJI 4E09A 4PBTA 5DM60 1E6KA 1P19A 2HHJA 4KEAA 5CIWA 4GOJA 3L0SA 4I99A 1EUZA 4ZVRA 5H02A 3V7FA 4BE7B 4BQIA 5ITZA 4RTOA 1C3OB 4TS4A 4TSKA 4D4KA 4Q9NA 5CDFA 4D9NA 1XCBA 3PENA 4WN9B 7ADHA 2UZAA 3CBQA 4YV0A 4EHHA 2DM6A 3W8RA 2AXPA 1KO1A 2OQRA 3K2IA 1TA4A 4RMGA 4F93B 2RHDA 1CTQA 2YXBA 1PEAA 2GCNA 2ZRKA 5DNWA 3JW8A 1B0UA 1ZI9A 2V7UA 4K05A 4LJ7A 4A0GA 3I04A 3V1YA 4BRZA 2IIVA 1E2EA 1YUNA 1A2KC 1VC2A 2YJZA 2PRYA 4DQDA 3I39X 1GPWB 1SCUB 3AETB 3TKAA 4GBJA 1AQNA 1M0SA 2ZI7A 4INOA 3LHSA 3DT6A 2XUQA 4A92A 3KZCA 1F3LA 3KUCA 4I6JA 4ZVLA 3K6KA 3PUIA 3MD0A 4D9MA 1AMOA 5CB6A 4PY2A 1GEGA 2I9KA 3T3PB 2DOKA 1KAOA 3R5SA 4AMBA 2G0AA 3GNSA 4IIJB 1VCHA 2ODQA 1M8FA 1GZ5A 4HFRA 5IK2A 4HAWA 4BIMA 4B8WA 1R5BA 4JI3B 5J2UF 3MD9A 3UFXB 2AHOA 2XQJA 3HU2A 3BMNB 3PCXA 3OQIB 3K1TA 1IY8A 1LLFA 5AVKA 1TTQB 5C0OE 1XZ8A 2VEDA 4ATNA 4CDGA 2YHIB 1G1MA 2IK8A 4H1TA 4WJKB 1NJSA 1TQDA 2VWHA 4KI7A 1APBA 1SJ9A 4IWXA 1YH3A 3DTVD 3FUVA 2GEBA 1II8B 2Q3CA 4RH1A 4FKMA 2I6SA 5E1OA 3UG7A 2FZVA 5EXSA 3FPHA 3LV8A 2VQEB 5EZYB 4B3MB 3UHAA 1P6UA 2C9ZA 2M1XA 2W48A 5DCYA 1EFRA 2P0EA 1CYEA 4G41A 1LPSA 2C84A 2E4AA 4EHAA 5HM6A 3U4HA 5ICCA 5DNVA 3IUMA 1BX1A 4MCAA 5IT5A 4NYMR 5ALQA 4NCBA 4RSMA 3ACCA 5E8RA 1RVV1 3HFRA 3WXBA 4X20B 5L6MB 2IA5A 3IFSA 2I4MA 3IPXA 1HTWA 3U49A 2JJ2A 1NXWA 1CZHA 4CKWA 4LVCA 1GT6A 1MC1A 4IDAA 2FF7A 3K9HA 5CGQB 5BWCA 1A2BA 4KITB 1V41E 3GJTA 3R6WA 3ELBA 2HMAA 1DO0A 2XAAA 4Z2YA 3BCUA 3WLPA 1ULBA 3OCWA 4F5EA 2EEPA 4D1YA 2A30A 2NQ8A 2DFTA 4BLUA 1A27A 3P5SA 4XM0A 1P6QA 2Y0DA 4LDJA 4LQLA 1OWPA 2WP0A 2XIJA 3QVGB 4WGFA 2EXXA 3E9NA 4OKNA 5EG5A 3S2YA 4XUEA 2QRNA 3GPBA 1YI8A 3S68A 4RSRA 1E3LA 3R3VA 1KO4A 2R8OA 2Z98A 3FOEC 3PZRA 4JBIA 2IXDA 4BVBA 4DKJA 3ZGNA 1R9JA 1AE1A 1E3TA 2XMGA 1QIKA 3N70A 3NWBA 1QNLA 2Y92A 4C5BA 3BXOA 2CVFA 2OC9A 4QXMA 3BEOA 3K72B 5DLQC 4OY3A 3VSDA 4F4DA 1NNSA 1XTUA 2C4KA 1AU9A 2GZSA 3SKVA 4A1OA 1GY8A 1QR2A 1RR6A 3PDUA 4TL9A 3OQNA 1YZNA 4KXMA 5FYQA 1IJKA 3JYLA 1QC5B 4JJ4A 1GZUA 2X8BA 5T4BA 4G0QA 3T06B 1BOOA 3QVLA 4RJIA 2H4ZA 4FR0A 4H7EA 1PJAA 2YV5A 1NQAO 3ZGLA 1QAMA 4YB8A 2DBZA 1K92A 2ZWVA 3KNZA 4F11A 4NCAA 5LQSA 1IQRA 2BR5A 4M1ZA 3G85A 4UQOA 1YR6A 5K8JB 4R8RA 1FX1A 1XZPA 4N01A 1KJ9A 3COZA 3ITEA 4HSEA 2YUTA 1KOLA 5M7EA 9ABPA 3IYLW 4MV9A 3DLHA 4GMHA 3IX7A 3P9NA 3IMGA 1Z15A 4E5PA 3OIYA 1V35A 5JOQA 3AB8A 3CUUA 1C3EA 3LHIA 1RJWA 2H11A 4K6GA 4LDQA 4UVIA 4B2PA 1YQ9A 4HC4A 1KYIA 1NBHA 4FYWA 4W6ZA 3CX6A 3ZWMA 4M8NE 2L69A 3HA5A 2CHEA 4YX9A 5CBPA 2FWRA 1USIA 4GZ5A 1RS0A 4LCBA 4MV4A 4OXQA 2G0NA 1AQ6A 8AT1A 3FNIA 3QKTA 3QV1A 4KIFA 1D4ZA 2BE9A 4OI1A 4J75A 5I9NA 2W4IA 1KU6A 4HEQA 2OGTA 3EMVA 2HMSA 3SNHA 5EUBA 1P29A 1UFKA 2X4IA 3I23A 4NMLA 5HCNA 2H63A 1Q92A 2G5PA 5JCJA 1C3LA 5DZSA 5BVGB 3AVUA 4TUYB 3EIXA 1JQ3A 4Y9TA 3VZSA 5DJ5A 1Q7BA 3W5AA 2V98A 4LBWA 4F4HA 2CFTA 4CTKA 4JP1A 2I2CA 2GVNA 1OBCA 2QQEA 4C43A 2J7PA 3UK2A 5EIHA 3WLAA 2QTLA 2NQ2C 2FN3A 1T1JA 2HPHA 3CIOA 4KAFA 1G9XA 5GIPE 3C5VA 4C76A 1OASA 4A2PA 1IB6A 3MCZA 4BKQA 3EZ7A 4CHTA 1E62A 3ZXUB 4GKJB 3NM4A 1OC2A 1D3AA 1KY5A 5JYBA 2G9ZA 4A73A 5CNKA 5EE3A 3QOYA 1N1MA 9LDBA 4LJ5A 4A16A 5CVJA 4J4HA 4BX9A 2P9TA 4NOLA 4R3WA 4Z1MD 1KK2A 4ZGGA 1RFLA 4B46A 2GEFA 3C5HA 4LQDA 1YOVB 3DO5A 5IDVA 2DBRA 2BGNA 3RSCA 1CJVC 4C89A 3KEMA 3C3PA 2VCEA 5I9SA 1LF0A 4G1MB 1L1QA 5IP5A 4DA9A 4JELA 1NBAA 1PJRA 3UEOA 4FD2A 5BPFA 1WPGA 3DMGA 2GRJA 2QPTA 1CR6A 4EG8A 1XLVA 2QAIA 3OVMA 1JFSA 5JJLA 1GPNA 1BGXT 1AKMA 3RU3A 3I05A 3UGKA 3VZRA 3C7DB 1KVQA 1RQRA 3HWSA 2RGBA 1HZJA 2PS3A 4CLEA 1L5GB 2P9QA 3TVDA 3I5UA 3ORHA 3RS7A 3LOQA 4AURA 2X8LA 1PYDA 1RAEA 3QFSA 3O94A 5KNBD 3SQMA 2Q46A 3FPSA 3INNA 3FA2A 3G02A 3ZWBA 1JEAA 2W00A 4JKOA 5FAKA 3DBLB 4OATA 2R86A 3CCBA 3JQFA 4WSOA 3A06A 4JYPA 4MHSA 1UBTS 1L0BA 2N42A 4PAOA 4X6YA 3M3DA 3GMDA 4OQFA 4J94A 4PQRA 1FFHA 1U2TA 3EAGA 4EB0A 4J1NA 5FFMA 1ESNA 1XFAA 1R4AA 3E0XA 4TVBA 2EBWA 3QA9A 3QUTA 1U3DA 3TEJA 4ENRA 3KOYA 4NYMQ 1SC3A 1N2CB 1ZC3A 4OTZA 3WKEA 4AMVA 4TYQA 5KYXB 3HYTA 1L5WA 2CLCX 4XIYA 2DX7A 1PP4A 4U4AA 4I5DA 2GN8A 1EFTA 4FLFA 4DLAA 2DHDA 1E92A 2ZBQA 5A3VA 4E5UA 3OAAA 4HZGA 4L07A 3VR3A 3DOIA 4OAPA 5CM9C 2MSKA 4Q9HA 1CP3A 1CLEA 1QMPA 1Z18A 2I80A 3KVRA 3H2JA 3T3NA 1QH1A 3U1TA 2FEAA 3IEPA 1SCUA 2JVIA 3ICCA 4ZPXA 5CDHA 3AUXA 3MGKA 3UHOA 4WY5A 1FQOA 3UWDA 3C1UA 1THMA 3WIOA 4J49A 1KDRA 1RC1A 1BE8A 1W2GA 3KQMA 3D7RA 2DPGA 2CLIB 4PZYA 3UB3A 1D2RA 5A6SB 5J2TB 2P7IA 1B00A 2V6IA 3N76A 2R7KA 3GGJA 1OWNA 3A9SA 3OECA 2B8WA 2GHTA 4BLPA 4CFSA 3W5HA 4L16A 2K2QB 3OP1A 4PSKA 3EG9A 1OYOA 4HAZA 4QYXA 2H1IA 1UBRS 1K5HA 5H0IA 3V7WA 3HHPA 3MEQA 4K6HA 1IRIA 4QQ8A 4S1PA 4W8HA 1JIVA 1FZTA 1MDFA 2WOJA 4QSHA 2BBTA 1YKFA 3IXQA 3OZDA 5EHXA 1P73A 2BFOA 2O2DA 2R11A 1GUFA 3B52X 4I08A 4MGHA 1HE4A 2HRRA 5FBVB 2CLMB 2XNDD 5A0TA 1UPBA 2PEZA 4TPKA 5EWLB 2WJIA 1GU0A 2WI8A 3TE7A 1VZ2A 4ALMA 4EPWA 3GLFE 4EUNA 2Q50A 1EBFA 2A9JA 1ID1A 2LBPA 2WWHA 3BMCA 2AOTA 1R8YA 3C3AA 4PSDA 4V2IA 4Y2XA 1MXFA 1NMQA 3RJTA 1HMYA 4LF7B 3Q4GA 4H60A 8ATCA 2OYCA 3NDBB 1Q0TA 2CLFB 4PPQA 3JARB 5IBPA 1OYWA 3M6FA 1XXHA 1BE1A 3IAFA 3PC3A 2JHGA 4GYWA 4X7PA 3GLGE 1GGJA 1T2UA 1N33B 1YS7A 1NN1A 4TWZA 2HXGA 4NDAA 4XR9A 3DA8A 3RANA 3I4FA 1ECJA 1DDIA 2KQUA 5ISMA 1GG2A 4D43A 3QUBA 5KX5F 1RE0A 3KO8A 3AZPA 4OQEA 4AWAA 2C95A 5EWMB 1COWD 4D98A 3ZV3A 3ETCA 3W5DA 4JI0B 2Z6UA 1D8AA 2Y27A