1YBWA

Protease domain of hgfa with no inhibitor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
253
structure length
246
Chain Sequence
ACGRRHKKIIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational lability in serine protease active sites: structures of hepatocyte growth factor activator (HGFA) alone and with the inhibitory domain from HGFA inhibitor-1B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Hepatocyte growth factor activator precursor
total genus 52
structure length 246
sequence length 253
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2004-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ybwA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ybwA01
1NFYA 1E35B 4LXBH 3PLBA 1EOLA 2GKVE 3E0PB 3SU2A 3URCA 5EPNA 4BTIB 3H7TA 2PKSC 1NRRH 1OP8A 3MH4A 1JOUB 1GBEA 1ZMNA 3P6ZB 1GCDA 1C1NA 4MVNA 2VJ1A 3HK6B 3ZVEA 3LGVA 3AW1A 3GY5A 5CHAC 5GCHF 4ABIA 4FU9A 1CT2E 2BD3A 2FP7B 2F91A 1O3CA 1O5BB 4XSKU 4H4FA 2G5VA 3QGJA 1GJAB 3GY2A 1C5NH 5HYOA 1BTYA 5L2ZH 4JYTA 1BA8B 4K1TA 4INKA 1TNJA 4TY6A 1SVPA 3CP7A 2EI8A 1NT1A 3FVFB 2Z9JA 1PQ5A 1LVYA 1WYKA 4Y0YE 1K2I1 4F4OC 1TQ0B 1OP2A 2BB4A 1SG8B 1ESTA 1L0ZA 3BEUA 1INCA 2G5NA 2GTBA 3MNCA 3SORA 1GBDA 1RXPA 3RC4A 2ZHDA 2BD8A 1GJ9B 3SJ8A 1Y5UT 3SNCA 1OYTH 2OUAA 3LH1A 2VU8E 1UTNA 2PHBA 2C3SA 1XKAC 1ZRKA 4Q2KA 1QTFA 3ATMA 3M7TA 4Y7BA 3ZZ4A 2EEKA 3ZZ7A 3VFEA 1YKTA 1ZGVA 4X6OA 4NG9H 3V7TA 2HGTH 1C4V2 3SQHE 2XC0A 1PYTD 1F5LA 3BTGE 1K9OE 2WYGA 1WV7H 2H9EH 3SUGA 3A7VA 4JZ1A 3ZZ8A 1D3DB 2Y7ZA 1T8NA 1HUTH 1A0JA 1IQEA 2OC7A 3S9AA 4FUEA 2CGAA 1SGFG 4WH8A 2UUFB 1AE8H 1HAVA 2P3TB 5JYIA 5JBBS 1O2PA 1C2LA 2Y5GA 4GSOA 4GHQA 4YT6H 3PB1E 5ESTE 1GI4A 1GPZA 3RXLA 3RXDA 4D7FA 1OS8A 1GI8B 1NC6A 2CHAB 1FY5A 3CS0A 1QB1A 1P10A 1QBOA 1YP9A 3DT0H 3PMBB 2BOHB 2ZDMA 3URDA 1DVAH 4O9VA 4SGBE 3MU1A 2HRVA 3E0NB 3S69A 5TCAA 3T5FH 5GWZA 5A8XA 3AAVA 3FANA 3JZ1B 5HM2A 1V2KT 3MO9A 2UUJB 5E0HA 1CA0B 1EZXC 1ZHMA 2FOGA 3O8CA 3RXEA 3T29A 2WPLS 1D3PB 1O37A 3FP8E 1E38B 2H5CA 3R0FA 4K8YA 1UK2A 1MTNC 1AWHB 1GG6C 1D6WA 2GMTB 4AB8A 1TOMH 3EAJA 3E90B 5F8XA 1O3DA 2TBSA 2AERH 5E0JA 5EXLA 3O8BA 1SLWB 1MZDA 1QGFA 5PTPA 3PV4A 2O8UA 3VB6A 3UTUH 1TOCB 1GBHA 3PWBA 3KNXA 3MU0A 1GI0A 1C5TA 1BOQA 1TX6A 2ZGBH 1GVKB 2IPHA 1CVWH 1O2ZA 3HGNA 1BUIA 1Z8RA 2ANYA 1LHCH 1P57B 2VIOA 4IMZA 4MPWA 1XM1A 2J9NA 1UTMA 2ASUB 3LC3A 1SI5H 1KLJH 3ZVAA 2A45B 1EJNA 4Y6DA 4THNH 1AWFH 2H2ZA 1QB6A 1SC8U 1QL7A 2QCYA 2A2XH 3M5NA 1ZYOA 1TMTH 1C5XB 2FWWA 1H9LB 5F03A 1ZGIA 2FMJA 4Y71A 2PSYA 2IN2A 1GBCA 1V2UT 4GUXA 3MHWU 4AG1A 1HBTH 1T7CA 3SJIA 3TVJB 2WUBA 4JZFH 5C5NA 2GMTC 1RS0A 1LVOA 2ZKSA 1S0RA 2VIPA 4H42U 3GY4A 4ZKOU 1BT7A 5C1XA 2CV3A 3RMMH 1GVZA 2QIQA 2Y81A 3GY7A 3UPEA 5E2OA 1Q31A 3D49H 4K3JA 5EW1H 2ZP0H 1HAXB 4I8HA 4ISIH 2V6NA 2VIQA 2RDLA 4AGKA 1P2KA 3F9EA 3MH5A 2A4RA 4H6TA 1O2LA 4AFSA 1DITH 1GJ4H 3LT3A 3LGWA 4X1RU 2FS9A 2GCHF 2A7CA 3A88A 3BIUH 5DP9A 4LOYH 1YPHE 1BMMH 2VWMA 1K1OA 3BN9A 2ZTXA 4YOGA 5JDUB 2OLGA 3A85A 3NUMA 1FN8A 2XTTB 3GDSA 1GJBB 2QV1A 2PGQB 4DW2U 3BG8A 3KQEA 1GJ8B 1GDUA 3NPSA 2CF8H 4DJZB 4LZ1H 2BVSH 1IHTH 5DP8A 3TJNA 1BRUP 1VR1H 2BTCE 2A4GA 5I25A 1GL1A 1MKWH 2GT8A 1W10U 3LJOA 4KELA 1GBTA 5J4QA 2P59A 2FOEA 2QA9E 1OSSA 2IOTA 3GOVB 3MNSA 1NU9A 2PTNA 4D8NA 1OOKB 4NIXA 3QTOH 5AFZH 2FYRA 2LPRA 5LGOA 4JK5A 1BBRK 3L6PA 4Q7ZA 2BX4A 3NWUA 3ZZ6A 5T6DA 5ABWA 4WH6A 3LGTA 3ELAH 4NWLA 2ZGJA 3VEQB 4X0WU 3SQEE 1BJVA 3P95A 4DY7B 2PKAA 2VB0A 1RFNA 2ZFQH 1P2IA 3K65B 1WTGH 1SGNE 3QUMP 1C2FA 1C9TA 4GLYA 2HALA 1IQNA 4GPGA 2WPKS 1O2TA 1V2VT 1XUFA 2G4UA 2H5DA 2J95A 2OTVA 4B75A 1ETTH 3V0XA 3UY9A 1O30A 1GJ7B 7ESTE 2DUCA 1KYNA 2FOHA 4FU8A 1PPGE 3A8CA 3GCHC 1QCPA 1O2KA 4A5TS 2UWLA 4INHA 1DS2E 2NU4E 2VINA 1B7XB 2ZGCA 1A61H 1FNIA 3U8RH 2QN5T 3N7OA 5C2ZA 5DPAA 1C5SA 3DA9B 1T4VH 3GDVA 3RM0H 2XBYA 2BD5A 2HPQH 1CT4E 3RXUA 1SHYA 2XWBI 1TX7A 3UNRA 7LPRA 1GJDB 4Y7AA 1HAGE 2Z9LA 4BOHA 3EA8A 1KXDA 1PPEE 3T27A 1ZTLA 2V35A 1O3IA 1J15A 3SJ9A 3H5CB 3PMJA 4OS1A 1TX8A 2WPJS 3RLWH 3U1JB 1ELTA 2RG3A 1T32A 3MNBA 3E3TA 5C3NA 3UOUA 7GCHG 4ZHAA 4JZDH 2P16A 4Q80A 4X6MA 1ZMJA 2CJIA 1TB6H 3ZVBA 2B7DH 1L1GA 1O2UA 2Z6BD 3GCHB 1AQ7A 6LPRA 1O3FA 1TAWA 3ZVGA 1N1LA 1VGCC 3SV2H 1N8OC 2H6MA 1OWKA 1EPTC 1NRNH 1KXBA 1Z1JA 5A0CA 3T28A 1HV7A 1K1NA 2BD2A 3MH7A 1O3HA 2QF0A 2SNWA 4ESTE 4Y79A 1O38A 8GCHG 1C5UA 4OS4A 1Y59T 1AN1E 2VIDA 3M3VA 1Y5AT 1O2IA 5H4IB 3M61U 1VITF 2ULLA 1DANH 1C5PA 1W2KH 4BTTB 2Y80A 2QXHA 1MD7A 2ZPSA 1DM4B 2OBOA 2OC1A 3NCLA 2D8WA 1TWXB 3STJA 4X8VH 4YZUA 1O3EA 1O3PB 3A84A 3SO3A 2ANKH 2XBWA 4R0IA 3E1XB 1E37B 2D2DA 2THFB 2P3FH 5JB8S 4DVAU 3H7OA 1DUAA 4UFEH 3U8OH 2F83A 5TCCA 3SZNA 1VGCB 2AMDA 1HAPH 1DT2A 2Q1JA 2O8MA 4K69A 4UFFH 1LTOA 3RMOH 1XMNB 4AFQA 3V12A 1FONA 1NU7B 1Y3WA 5JBAS 2BDGA 5DP6A 4X2WA 5J4SA 2VIVA 1O5FH 1TA6A 1ZJDA 3RXSA 5LPRA 4FUCA 1XX9A 1RGQA 2BD9A 2SGAA 4JYVH 1ACBE 1ELGA 3UWJH 4Q7YA 2AMQA 2BXTH 2C8YB 1VCWA 1PPCE 3RDZA 3SNDA 2G8TA 4WF8A 3SJOA 5LPEA 4AORA 2ZTZA 1W7XH 1O35A 2VGCB 4BTUB 1ZRBA 1O31A 1C2HA 4GCHF 2OD3B 3GYMA 2A4OA 1ANCA 1FMGA 4YTAA 1CHOG 5EQSA 1YBWA 2PR3A 4ABFA 4CBNA 2FO9A 5ESBA 3A89A 4X1SU 3SU4A 4X6PA 1C2EA 1LDTT 3D23A 3UNSA 1SGPE 5A8YA 1BTZA 3OY5U 1HPGA 1PQ8A 3QO6A 4UEHH 2NU0E 3A7ZA 1P01A 4A1VA 1BBRE 1EAUA 1ZTKA 3RXJA 1GCTB 3C27B 4A7IB 1O2VA 3F9HA 1DLEA 2JKHA 1SBWA 3T2NA 1T31A 2H1UA 2SGQE 3SUDA 3DFLA 3EA9A 1A7SA 1S81A 1THPB 1JBUH 1K1IA 2G52A 1YCPH 3TH4H 1S0QA 3D65E 3S7HB 1SGCA 4AYYB 2A5KA 4U01A 1XXFA 2BVXH 2Y5FA 3D62A 4ZROA 1AVXA 2J92A 2HPPH 3B23B 1P05A 1F7ZA 2BDBA 2J94A 1PYTC 5EU8A 3ZZDA 1AFEH 1EB2A 5FX6A 1S84A 4JZEH 1MMJN 5DP5A 4HTCH 2P93A 4CRBA 3A8AA 1GDNA 1LVMA 1SSXA 1GJ6A 4IS5A 3L3TA 2ZFTA 3SU6A 1SOZA 1YPEH 4ISNA 2ZHQH 3W94A 2SGPE 3SV9A 1GBLA 1QQ4A 1AU8A 4NSVA 4KTSA 3ENSB 1TNLA 4NFFA 4CRGA 2G51A 1LKBA 1GBJA 3RXQA 2BHGA 2FX4A 5FBEA 1ARBA 5GIBA 1LQEA 3AAUA 1T8LA 4M7GA 1ESBA 3UOPA 5LH8A 4BAKB 2FX6A 1G30B 1ZSJA 4JK6A 4MNYA 4MNWA 3K6ZA 1VJ9U 2C8XB 2FTMA 1AKSA 1W11U 2BDYA 2OP9A 4CHAC 3M7QA 1ORFA 4CRDA 1O2XA 3RXBA 1DX5M 1CHOF 5DKMA 2SNVA 2BVRH 2VH0A 2AYWA 2CHAC 4KKDA 1K22H 2AEIH 2Z9KA 2C4FH 2Y6TA 1P02A 1EUFA 4U32A 3K6YA 1MQ6A 1SGIB 4DCDA 1O3JA 1A5HA 1W0YH 4FVBA 4AYVB 3O8RA 4X1QU 1EAWA 3HK3B 5BPEA 2BD7A 3BTHE 1OWIA 1ZPZA 1HCGA 1YGCH 2O8LA 2GZ8A 1AUJA 1GDQA 2M5TA 4FUGA 4WWYA 2A7HA 2TGTA 2TGDA 3HPTB 4SGAE 3BG4C 1AIXH 1IQKA 5F6MA 3QDZB 1AGJA 1MTNB 2J2UA 4NZQA 1V2QT 1TA2A 2KAIB 1MH0A 1GHAG 2PUXB 4CRCA 1ABJH 2ZQ1A 1O39A 1L4ZA 3KGPA 4E06H 2FZZA 3QLPH 1FV9A 1XUKA 1O3MA 1LVBA 2TPIZ 2BY6X 4Y8XA 2XXLA 3PM3A 3RXPA 3SI3H 3VXEH 5GXPA 2BLVA 3SN8A 3F6UH 4X2YA 1O2HA 1GL0E 3BV9B 1SGDE 2A4QA 1TE0A 3T62A 1C2KA 1P8VC 1OWDA 4KTUA 4UD9H 4WMEA 2GDDA 2BQ6B 1OWJA 3F9FA 1O2QA 2TIOA 3Q3YA 1LHEH 3EGKH 1DSTA 2YOLA 3A8BA 2JH5D 2JH0D 3I77A 1C5RA 3TK5A 4MTBA 4NIVA 4NSYA 1THRH 4Y11E 1MTWA 5EXNA 1AFQC 1JRTA 3GY6A 2JETB 1QNJA 5EOKA 4X2VA 2FPZA 4IGDA 3B9FH 3BG4B 3PMAB 3RXOA 5HGGA 3S9BA 3P70B 3PLKA 1ANEA 2ZTYA 1YPJH 3M5MA 3UQOA 3BTQE 3BIVH 3MO3A 2J34A 2F3CE 1CBWB 1MZAA 1SGRE 4ZH8A 1ANDA 1FPCH 4AN7A 2ALPA 2PSXA 4CH8B 1YM0A 2AFQB 4DT7B 3SUEA 5DO4H 1VCQA 1LQDB 5L30H 1V2LT 4YM9A 1JIMA 3TGJE 3U98H 2ZEBA 3MNXA 1VITG 2I6QA 3UR9A 4ABJA 2SFAA 1SQTA 2W7SA 4TWYA 1KIGH 1FY8E 2ILNA 4NA8A 5EG4A 1YLDA 3DFJA 1ZSKA 1GBAA 1G36A 2ZDAH 2ZZUH 1Q3XA 3K2UA 3TJVA 1P09A 1B5GH 1BBRH 2Q6GA 1BCUH 1PPFE 4XOJA 2V0BA 3KF2A 3RLYH 2G81E 2W5EA 1V2WT 2SGFE 3RU4D 4CR9A 2DE8A 1QL9A 1SR5C 1AVWA 4WMDA 4X2XA 2GGVB 4B2CA 3BTME 2B8OH 2FDAA 2ZDNA 3ZZBA 5DP4A 1HIAB 1SQAA 1NRQH 1O5GH 1C1WH 4Y8ZA 2R3UA 1PJPA 4JMYA 1OX1A 2ANMH 4BXWA 1O5DH 3IWMA 1S6FA 1C2JA 2GT7A 1BJUA 1RD3B 2OINA 3RXFA 1C2GA 6CHAB 1C5MD 2WPIS 3RXKA 3SBKA 2P8OB 2R3YA 2NU1E 3SNEA 1CU1A 5GCHG 5T6GA 1KLIH 2XW9A 3OTJE 3EA7A 4I8GA 5A2MH 1G3CA 1KDQA 4J1YA 1YPGH 1L2EA 1F0RA 4O3TA 3SGAE 1Z71A 1F0UA 3KQBA 3BTTE 2CXVA 1C2IA 5F8ZA 4CH2B 3TH2H 1C1OA 3SUFA 4TY7A 3KIDU 2BLQA 2RA0A 5AFYH 2F9UA 4TYDA 3TGIE 1Y3VA 3AVZA 1RTLA 3IG6B 2C90B 1V6DA 1GMDG 3Q77A 1ZHRA 1TYNA 2ZGXH 1SQOA 1EX3A 1AB9B 3MU5A 1GGDC 1ELFA 1GI9B 1BMAA 1H8DH 3SV6A 3LH3A 2O8WA 4XBDA 1O0DH 4K1EA 3QZRA 1GHXH 1P03A 3TNSA 1K1LA 3VB4A 5SGAE 2ZA5A 4PROA 1TIOA 1XXDA 1P2NA 2QAAA 4MPXA 1O3KA 3FP6E 3BEFB 2BY7X 2ESTE 2P8OC 1ELAA 2F9VA 7KMEH 2P94A 1TRYA 1QBVH 1ZPCA 8KME2 4RSPA 3PTNA 1A46H 1LCYA 1SOTA 3KQCA 5AF9H 3SU3A 1FJSA 5EXMA 1EZQA 1Z1IA 1XVMA 1C1PA 1MD8A 1OXGA 5EQQA 4CHAB 2PGBB 1JWTA 4YOIA 4B74A 1Z8GA 1ELBA 1VCPA 1KXFA 1E36B 4FUHA 4ZAEA 2QXGA 1BB0B 1YF4A 3MTYA 1DWEH 2BLWA 1GI1A 3E91A 3M5LA 1HAVB 1GHZA 4ASHA 5JPMH 1EPTB 3IITA 4MNVA 4TPIZ 1TLDA 4BAOB 2YNAA 4ZMAH 1IQHA 4FUBA 3SHCH 3U1IB 2OXSA 4BAQB 1ZHPA 3QGNB 4CRAA 2VVVA 2STAE 4AOQA 4RKJB 3LDXH 4K8BA 4CREA 1O2OA 3LOXA 1KTSB 3RMNH 2GCHG 4R8TB 3P92A 1SGEE 1UK3A 1DXWA 4D9RA 3UWIA 3K9XB 5BRRE 2HWLB 2QYIA 3B8JA 3TU7H 1C5LH 4BAMB 2GDEH 1O2NA 4K60A 2BMGB 2AIPA 4J2YB 3A7XA 1G32B 1NPMA 3SI4H 4XBBA 3TGKE 2G4TA 3MI4A 4CRFA 1BTXA 3A82A 1T8MA 5EPYA 1E34B 4ZKNU 1MU6B 5K7RA 1XKBC 2Z94A 1O2SA 4WMFA 1Y3UA 2ZECA 3NXPA 1DFPA 5GJ4B 4NA9H 4FUFA 1IQFA 2OCVB 1SGYE 1IQGA 4YO9A 5JB9S 2ZDLA 1O33A 2HNTC 1THSH 4X1PU 3RXAA 1LHDH 2YNBA 4IC5A 1FAXA 3UREA 3Q3KA 1GVLA 4AFZA 1A5IA 1IQJA 2AGEX 2XCNA 1P2MA 2BY8X 1GMHG 2BDHA 1UVSH 3UR6A 1C1TA 2WINI 3P17H 4HZHA 3ZZAA 4B2BA 6GCHG 1GI5A 1M9UA 4ZKSU 4AG2A 1H4WA 3ATWA 1DWBH 2ZC9H 5DK1A 4K2YA 2ZIQH 1GBFA 3MFJA 1FZZA 2BXUH 1UCYH 2VGCC 2W3IA 2W7UA 1CBWC 3S7KB 5IDKA 1LPZB 3QN7A 1O3BA 3JZ2B 3F68H 4B71A 2VVCA 3GYLB 4DIHH 1SB1H 1CGIE 4ABBA 1C1QA 1C5OH 2PWXA 3P8NA 6GCHF 2BDAA 1ZTJA 2A0QB 1L1NA 4ISOA 2CF9H 3EYDA 3HATH 1J14A 2A1DB 3OY6U 4NFEA 1YPHC 3LJJA 1P3EA 1MKWK 2H9HA 4FUDA 1K28D 5DGJA 3E16B 2FIRH 4DOQA 3OX7U 2ZCKP 3ZYDA 1UVTH 1FLEE 4YT7H 1P04A 1EKBB 4BXSA 2V3OH 2HOBA 3V3MA 5CMXH 1O34A 3BTKE 1FQ3A 2TRMA 2SGEE 4F49A 3TNTA 1UVOA 1LPGB 2WV5A 1TBRH 3SNAA 3A86A 4IBLH 4JYUH 3LIWA 5C67A 5EW2H 2AMPA 4AX9H 1F2SE 2PFEA 3T26A 1S85A 5GPIB 1P0SH 4Z0KA 2PW8H 3ESTA 2V3HH 4BAHB 1EP6A 1OKXA 1O5CB 1GI7B 2GX4A 3SJKA 1S6HA 2RCEA 2Z3DA 1CGJE 1RRKA 1XUJA 2K1QA 2GZ9A 1ETRH 3QK1A 1DE7H 1C5WB 1K1JA 1HYLA 3QZQA 4XBCA 1YLCA 2KAIA 2FM2A 3ZYEA 4MQAA 2STBE 1WBGB 4Z6AH 1QHRB 4ZUHA 2WPHS 3VPKA 2WUCA 2W3KA 1P06A 1BMNH 1L1JA 5C20A 4O03A 1LMWB 2F9NA 1U6QA 3G01A 3OYPA 1H1BA 1WTHD 4MG3A 1TNHA 3ATLA 3OU0A 1WAYB 4XFQA 1GMDF 5DJ7A 1EJMA 1OYQA 4AGJA 1KDQB 1C1SA 3C1KA 4UFGH 1QBNA 2EI6A 4NGAH 1UHBA 3ATKA 2Z9IA 1BIOA 1DUEA 3UUZA 5EODA 1AZZA 1J16A 2FODA 3GCOA 3QX5H 2PTCE 2FLBH 3W95A 1G3DA 4K1SA 1P11E 4U2WA 1QY6A 3LC5A 1G2LA 1NROH 1E0FD 3VB5A 1UO6A 1PQ7A 1FPHH 1GMCG 3MO6A 4WJG2 1O3OA 1WCZA 1NESE 2FOMB 1SGQE 2W26A 1NFXA 4ZXXH 1BTPA 2ZU3A 2A5AA 1MCTA 3HGPA 3QWCH 3A7YA 4ZKRU 3HKIB 6ESTA 1BRBE 2FOCA 1RTKA 1SLXB 2NU3E 3T25A 1G2MA 3CS7A 1FIWA 1GI3A 2J38A 3TIUA 1C4Y2 1T8OA 2RA3A 4KP0A 3BTEE 1C1UH 4Q7XA 1B0EA 3GCTG 1AMHA 1A5GH 1P2OA 2FOBA 3MMGA 4UFDH 3KQDA 5B6OA 2XWAA 1GMHF 4JCNA 1JRSA 5DP3A 4YESB 1L4DA 4DG4A 1KTTB 1A4WH 1HNEE 5CE1A 5FXLA 5FBIA 1XUIA 1A1RA 8LPRA 2JETC 4DGJA 1IQMA 3RUOA 1UTPA 3STIA 1CQQA 1Y3YA 2XBVA 4FXGH 2VWOA 1MTVA 1SLUB 4I8JA 4NIWA 1G3BA 4CBOA 1F0SA 2ZG0H 3FZZA 3SU5A 3LONA 4NWKA 1CGHA 1AO5A 4GHTA 1EXFA 3ODDA 3FAOA 3GY3A 2PKAB 1Z8JB 1ZMLA 1ZPBA 2ZDVH 4ISHH 2FI5E 1P9SA 4ZHLU 1GJCB 2ANWA 1TGNA 3I29A 4ABDA 4I32A 4UDWH 2F9OA 1C5VA 1PFXC 3A81A 3S9CA 3E6PH 2FESH 1GBIA 3EQ0H 1K21H 1QR3E 3U8TH 1NRPH 1TALA 1J17T 1HXFH 2H9TH 3LGUA 5DP7A 1O2GH 3P8GA 1V2OT 2Q6DA 4A1XA 4WY3A 3GCNA 2FEQH 3UFAA 5HM9A 4X8TH 1OWEA 1N8OB 5A8ZA 2XC4A 3P8FA 2ZO3H 3MYWA 4I7YH 3UIRA 3SGBE 1N6XA 7GCHF 1UMAH 3A7WA 1O3NA 8ESTE 2G55A 4ZHMU 1DXPA 4KTCA 1MKXK 2OC0A 2BQ7B 4LK4A 1AKSB 2EA3A 2BZ6H 1TNKA 1W14U 5AVDA 4HGCA 1MBMA 1KSNA 1MTSA 1SGTA 3EDXB 4I8KA 4O97A 3SHAH 4ABAA 4ABGA 1ZJKA 1QRZA 1NTPA 1A0HB 1DY8A 4XDEA 4X6NA 2ODPA 1W3CA 4NIYA 1AZ8A 4E05H 1UTOA 1TQ7B 1GHVH 1XUHA 1QA7A 2Z3CA 2OQUA 1YCPK 1SGFA 2ZFFH 1HFDA 2QXJA 3ZVDA 1PPZA 1DOJA 1EJAA 2ODQA 2XBXA 1F5RA 1TPPA 3BTFE 4VGCB 2JH6D 1J8AA 4X8SH 5FCKA 1QA0A 2UWPA 3M5OA 3NK8A 3SV7A 1SFQB 2IJOB 1RIWC 3GDUA 2UUKB 5FCRA 1Z6JH 1BQYA 4MLFB 2A32A 1UCYE 1A3BH 2Y82A 1GHBF 1GMCF 2ZCHP 2BOKA 2FI4E 4GCHG 2P95A 5F8TA 1BDAA 1C5YB 1N6YA 3QTVH 5GDSH 1WQSA 3RM2H 3KN2A 4H6SB 2OC8A 2VH6A 3A7TA 3BF6H 1Y3XA 1AE5A 1VZQH 1Q2WA 1MKXH 1ESAA 1GGDB 3VGCC 1IOEA 1YPMH 5T3HA 1GI2A 1FXYA 1XVOA 4D76A 2PLXA 4E7NA 1HAYB 1UTJA 1QJ1B 1D4PB 1KXCA 1TFXA 3BTDE 3SW2B 1P2JA 2A7JA 4I31A 1V2MT 4TWWA 2F9BH 2FTLE 1JXPA 1V2PT 4O3UA 1ZOMA 1S82A 4VGCC 1UVPA 1D9IA 3Q76A 1UVUH 1RTFB 1H8IH 1YCPM 2GP9B 1W13U 3KL6A 1V2JT 2GCTC 4RN6A 3DUXH 3LPRA 2J4IA 3PTBA 1HJAC 1G3EA 3ITIA 3RC6A 2C8ZB 5TJXA 4JZIA 1KXEA 1YYY1 4ABEA 3SOSA 1CE5A 3E8LA 1KY9A 1TGBA 2ZPQA 2GZ7A 1ELCA 1NS3A 2VIWA 2XC5A 4D7GA 2FOFA 2QF3A 1NM6A 5JBTA 2FI3E 2CMYA 3M3SA 4FUIA 2ZFSA 3RXCA 1DPOA 1K1PA 4AFUA 3ZVFA 1SPJA 1TNIA 2ZU1A 2OQ5A 3VGCB 4U30A 1B0FA 1P3CA 2I6SA 1ABIH 5EQRA 4MNXA 1H9HE 4INLA 2FOAA 1MAYA 4GAWA 1IQLA 2BDCA 1BHXF 1YC0A 3M36A 5DG6A 1NFWA 2A5IA 3MU8A 1IQIA 2CN0H 1FDPA 2HNTF 2BY9X 1EAXA 1Z8IB 1Z7KA 1Y8TA 4TPYA 1EATA 1UTKA 2C93B 2GCTB 1A2CH 1HJAB 1GBKA 1C9PA 3BSQA 3LKWA 2VWLA 1HJ9A 2BDIA 5FHTA 1O3AA 1DWDH 4E7RG 2R0KA 3R3GB 5EGMA 3TITA 2TGPZ 1V2TT 1P2QA 1W12U 2A31A 1SLVB 2QGRA 5IYTA 3I78A 1UTQA 3VB3A 1BTHH 3TH3H 1D3QB 2LNCA 2ZHEH 1GHAF 4FUJA 1CHGA 1MTUA 2A2QH 1LPKB 4GVUA 4HI3A 2SGDE 2XCFA 3GCTF 3TJUA 2ZQ2A 4WXVA 2FYQA 4KGAA 3RXVA 1BITA 1V2NT 5K0HA 3S0NA 1MAXA 2G00A 4OGXA 3FZDA 1GJ5H 4CR5A 1GG6B 4X8UH 3BEIB 1ETSH 1AD8H 1PQAA 1F5KU 1ZR0A 5L2YH 1HAZB 2EC9H 2WYJA 1WQVH 3U69H 1O2RA 3SU1A 1ARCA 1D6RA 2BZAA 3V13A 3A83A 3PO1C 3VXFH 1K1MA 1HB0B 4A1TA 2EI7A 4MPVA 1BRCE 1TGSZ 2Z3EA 1SMFE 1ELVA 3CENA 4ZXYH 2UWOA 3RU4T 3MOCA 1O2WA 4IN1A 4XE4A 1W7GH 2BX3A 1ZSLA 2ZU2A 4Y10E 5E2PA 1BRAA 1GCTC 1IHSH 4ISLA 3RMLH 1MUEB 1ZLRA 5ETXA 1LO6A 1C1RA 1HDTH 1FAKH 1WSSH 2OBQA 3O8DA 1UHBB 4OS7A 1YPKH 3M7UA 1YPLH 1F92A 2ZDKA 3NZIA 3GICB 1O3LA 2FXRA 4YLQH 3RP2A 1BHXB 1TPSA 1C1MA 4B1TA 3A87A 1AFQB 2P3UB 2ZF0H 3UNQA 1BZXE 3SGQE 2AGIX 2ZI2H 4OGYA 4Y0ZE 1IAUA 4RKOB 1QRWA 1OP0A 2UUYA 1EAIA 1S5SA 5JBCS 1KXAA 1QIXB 3PYHA 5T6FA 1Z6EA 3TK6A 1TRNA 3ZV9A 4A6LA 1DLKB 3BTWE 4LZ4B 1EZUC 3UQVA 2PKSB 4NCYA 3WY8A 3PO1B 1JIRA 3RXMA 2ZNKH 3ZZ9A 2HVXA 3ZZ3A 5C1UA 5CHAB 5HMAA 3M3TA 1MQ5A 4B76A 1AUTC 1O3GA 1GBMA 3KEEA 1D3TB 1V2ST 2ZCLP 1HAOH 1QFKH 3DD2H 9LPRA 1ZZZA 1FY4A 3A8DA 1PPBH 3ODFA 5FX5A 2Z7FE 5A0AE 1J9CH 1HRTH 4IC6A 1AHTH 1NZQH 1C2MA 4QT8C 1TPOA 1DWCH 1TMUH 1G9IE 1O2YA 2WPMS 4OS2A 2R2MB 2FS8A 3ZV8A 5LPFA 3Q00A 1LHGH 1HXEH 1Y5BT 1W0ZU 1GBBA 3OSYA 1NRSH 5C5OA 1AI8H 1TABE 3M35A 1MBQA 3KHVA 4BANB 1C5QA 5G4BA 3FFGA 3TPIZ 1KLTA 5FAHA 2TGAA 1O2MA 1XUGA 2GD4B 1BMLA 1LKAA 3RXIA 4Y76A 1W8BH 2NWNA 2PV9B 4YLUA 1HAIH 2NU2E 2BM2A 1QJ6B 1ANBA 2BLOA 3GISB 3SNBA 1MCVA 5C1YA 1GI6A 1UTLM 2ZU5A 6CHAC 2PUQH 3AASA 1FIZA 2DE9A 3PROA 2B9LA 3ZZCA 4A92A 5AHGH 1SHHB 1SL3A 3P8OA 3TJOA 1WUNH 1HGTH 1GHWH 2GVFA 2Q6FA 1FN6A 3L33A 1CSOE 1ID5H 3MU4A 1O5AB 1H9IE 2GV7A 1QQUA 2B0FA 1X7AC 1O36A 2Y5HA 2QY0B 4AZ2B 5FPTA 1TPAE 3MH6A 1EP5A 2ZWLH 3LGYA 3TK9A 4WXIA 2XYAA 2FLRH 4NA7A 1SFIA 2WV4A 1HLTH 1ELEE 1V3XA 1QL8A 3ZZ5A 4NZLA 2BYAX 3Q3XA 1TBQH 2BY5X 5I46H 3LGIA 1JMOH 1UK4A 1C4U2 1CA0C 4UE7H 2D26C 5E0GA 2ZGHA 3RC5A 4B73A 1TGCA 3VB7A 1O32A 2HNTE 3SU0A 1TNGA 1DSUA 8GCHF 4OS6A 1P9UA 3F9GA 3PLPA 1G37A 4YOJA 3U9AH 4ABHA 1T4UH 1CO7E 3LU9B 4MPUA 1ELDE 2AGGX 4DURA 1DY9A 1NFUA 4D9QA 1QRXA 2ZPRA 1HIAA 4AB9A 4K5ZA 3KCGH 1EQ9A 1A3EH 2HLCA 1FY3A 9ESTA 1MU8B 2XRCA 1WU1A 3PMHB 4OS5A 1EZSC 2BQWB 2AS9A 1VJAU 1DICA 1FUJA 1CT0E 1BTUA 4IMQA 4BNRA 4I33A 2ODYB 1GHYH 1QB9A 1RJXB 1C5ZB 2Z9GA 4DIIH 5HXFA 1CA8B 1HJ8A 3TLOA 2D1JA 1PPHE 5A0BA 3RXTA 3ATIA 2GV6A 1LHFH 4Y8YA 4X1NU 2AIQA 5E8EH 4WVPE 2R0LA 3RXGA 1VITH 2AH4X 3RU4E 2C8WB 1DDJA 1QJ7B 1FI8A 3NKKA 3FP7E 4FVDA 3PWCA 1V2RT 2BD4A 1NN6A 1OPHB 1EB1H 4HFPB 1C2DA 2Y7XA 4B2AA 5FPYA 2R9PA 1GWAA 4I8LA 2O8TA 1O5EH 5L6NH 1EOJA 4UONA 1NO9H 3GY8A 2ZU4A 1TGTA 3MWIU 1NY22 2VVUA 1TBZH 2ALVA 2VNTA 3ZVCA 2B5TB 2O9QA 1S83A 1EPTA 1RIWB 1GHBG 1P12E 3M37A 1C1VH 1WOFA 2R2WU 1OWHA 1TRMA 3EE0B 2ZHFH 3DHKH 2QC2A 1UJ1A 4MDSA 3RXRA 1A0LA 2VWNA 3F1SB 1EASA 1HAHH 5FPSA 1F0TA 1BTWA 1AY6H 2ZFRH 3HKJB 4IN2A 2ZFPH 3RXHA 2XNIA 4IW4E 3SV8A 5A09A 3A80A 1O2JA 2QXIA 1UCYK 2ZHWH 1TMBH 1QURH 1AB9C 3AW0A 1AVGH 4FU7A 1TONA 1FY1A 2F9PA
chains in the Genus database with same CATH superfamily
1NFYA 1E35B 4LXBH 3PLBA 1EOLA 1NBME 2GKVE 3PV2A 5CHBA 3E0PB 3SU2A 3URCA 5EPNA 4BTIB 3H7TA 2PKSC 1NRRH 1E79D 1OP8A 3MH4A 1JOUB 1GBEA 1ZMNA 3P6ZB 1GCDA 1C1NA 4MVNA 2VJ1A 3HK6B 3ZVEA 3LGVA 3AW1A 3GY5A 5CHAC 5GCHF 4ABIA 2WV9A 4FU9A 1CT2E 3EE7A 2BD3A 2FP7B 2F91A 1O3CA 1O5BB 3CNRA 4XSKU 4H4FA 2G5VA 3QGJA 1GJAB 3GY2A 1C5NH 5HYOA 1BTYA 5L2ZH 2PP6A 4JYTA 1BA8B 4K1TA 4INKA 1TNJA 4TY6A 1SVPA 3CP7A 2EI8A 1NT1A 3FVFB 2Z9JA 1PQ5A 1LVYA 1WYKA 4Y0YE 1K2I1 4F4OC 1TQ0B 1OP2A 2BB4A 1SG8B 1ESTA 1L0ZA 3BEUA 1INCA 2G5NA 2GTBA 3MNCA 3SORA 1GBDA 1RXPA 3RC4A 4OM9A 2ZHDA 2BD8A 1GJ9B 3SJ8A 1Y5UT 3SNCA 1OYTH 2OUAA 3LH1A 2VU8E 1UTNA 2PHBA 2C3SA 1H8HD 1XKAC 1ZRKA 4Q2KA 1QTFA 3ATMA 3M7TA 4Y7BA 3ZZ4A 2EEKA 3ZZ7A 3VFEA 1YKTA 1ZGVA 4X6OA 4NG9H 3V7TA 2HGTH 1C4V2 2J98B 2KFWA 3SQHE 2XC0A 1PYTD 1F5LA 3BTGE 1K9OE 2WYGA 1WV7H 2H9EH 3SUGA 2QE7D 3A7VA 4JZ1A 3ZZ8A 1D3DB 2Y7ZA 1T8NA 1HUTH 1A0JA 1IQEA 2OC7A 3S9AA 4FUEA 2CGAA 1SGFG 4WH8A 2UUFB 1AE8H 1HAVA 2P3TB 5JYIA 5JBBS 1O2PA 1C2LA 2Y5GA 4GSOA 4GHQA 4YT6H 3PB1E 5ESTE 1GI4A 1GPZA 3RXLA 3RXDA 1MABB 4D7FA 1OS8A 1GI8B 1UW7A 1NC6A 2CHAB 1FY5A 3CS0A 1QB1A 1P10A 1QBOA 1YP9A 3DT0H 3PMBB 4Q4LA 2BOHB 2ZDMA 3URDA 3FN8A 1DVAH 4O9VA 4SGBE 3MU1A 2HRVA 3E0NB 3S69A 5TCAA 3T5FH 5GWZA 5A8XA 3AAVA 3FANA 3JZ1B 5KGOA 5HM2A 1V2KT 3MO9A 2UUJB 5E0HA 1CA0B 1EZXC 1ZHMA 2FOGA 3O8CA 3FOAA 3RXEA 3T29A 2WPLS 1D3PB 1O37A 3FP8E 2F4LA 1E38B 2H5CA 3R0FA 4K8YA 1UK2A 4B6FA 1MTNC 2KX4A 1AWHB 1GG6C 1D6WA 2GMTB 4AB8A 1TOMH 3EAJA 3E90B 5F8XA 1O3DA 2TBSA 2AERH 5E0JA 5EXLA 3O8BA 2KCOA 5HIZA 1SLWB 3OAAD 1MZDA 1QGFA 5PTPA 3PV4A 2O8UA 3VB6A 3UTUH 1TOCB 1GBHA 3PWBA 3KNXA 3MU0A 1GI0A 1C5TA 1BOQA 1TX6A 2ZGBH 1GVKB 2IPHA 1CVWH 1O2ZA 3HGNA 1BUIA 1Z8RA 2ANYA 1LHCH 1P57B 2VIOA 4IMZA 4MPWA 1XM1A 2J9NA 1UTMA 2ASUB 3LC3A 1SI5H 1KLJH 3ZVAA 2A45B 2J5UA 1EJNA 4Y6DA 4THNH 1AWFH 2H2ZA 5EJ1A 1QB6A 1SC8U 1QL7A 2QCYA 2A2XH 3UB0A 3M5NA 1YY3A 1ZYOA 1TMTH 1C5XB 2FWWA 1H9LB 5F03A 1ZGIA 2FMJA 4Y71A 2PSYA 2IN2A 1GBCA 1V2UT 4GUXA 3MHWU 4AG1A 1HBTH 1T7CA 3SJIA 3TVJB 2WUBA 4JZFH 5C5NA 2GMTC 1RS0A 1LVOA 2ZKSA 1S0RA 2VIPA 4H42U 2QF4A 3GY4A 4ZKOU 5C1XA 1BT7A 2CV3A 3RMMH 1GVZA 2QIQA 2Y81A 3GY7A 3UPEA 5E2OA 1Q31A 3D49H 4K3JA 5EW1H 2ZP0H 1HAXB 3DSOA 4I8HA 4ISIH 1COWD 2V6NA 2VIQA 2RDLA 4AGKA 1P2KA 3F9EA 3MH5A 2A4RA 4H6TA 1O2LA 4AFSA 1DITH 1GJ4H 3LT3A 3LGWA 4X1RU 2FS9A 2GCHF 2A7CA 3A88A 3BIUH 5DP9A 1KMHB 4LOYH 1YPHE 1BMMH 2VWMA 1K1OA 3BN9A 2ZTXA 5DSFA 4YOGA 5JDUB 2OLGA 3A85A 3NUMA 1FN8A 2XTTB 3GDSA 1GJBB 2QV1A 2PGQB 4DW2U 3BG8A 3KQEA 1GDUA 1GJ8B 3NPSA 2CF8H 4DJZB 4LZ1H 2BVSH 1IHTH 5DP8A 3TJNA 1BRUP 1VR1H 2BTCE 2OK5A 2A4GA 5I25A 1GL1A 1MKWH 2GT8A 1W10U 3LJOA 4KELA 1GBTA 2J97A 5J4QA 1YWUA 2P59A 2FOEA 2QA9E 1OSSA 2IOTA 3GOVB 3MNSA 1NU9A 2PTNA 4D8NA 1OOKB 2WHXA 3QTOH 4NIXA 2FYRA 2LPRA 5AFZH 5LGOA 4JK5A 1BBRK 3L6PA 4Q7ZA 2BX4A 3NWUA 3ZZ6A 5T6DA 5ABWA 4WH6A 3LGTA 5GNDA 3ELAH 4NWLA 2ZGJA 3VEQB 4X0WU 3SQEE 1BJVA 3P95A 4DY7B 2PKAA 2VB0A 1RFNA 2ZFQH 1P2IA 3K65B 1WTGH 1SGNE 3QUMP 1C2FA 1C9TA 4GLYA 2HALA 1IQNA 4GPGA 2WPKS 1O2TA 1V2VT 1XUFA 2G4UA 2H5DA 2J95A 2OTVA 4B75A 1ETTH 3V0XA 3UY9A 1O30A 1GJ7B 7ESTE 2DUCA 1KYNA 2FOHA 4FU8A 1PPGE 3KYGA 3A8CA 2K8IA 3GCHC 1QCPA 1O2KA 4A5TS 2UWLA 4INHA 1DS2E 2NU4E 2VINA 1B7XB 1SKYE 1A61H 1FNIA 2ZGCA 3U8RH 2QN5T 3N7OA 5C2ZA 3N7DA 5DPAA 1C5SA 3DA9B 1T4VH 3GDVA 3RM0H 2XBYA 2BD5A 2HPQH 1CT4E 3RXUA 1SHYA 2XWBI 1TX7A 3UNRA 7LPRA 1GJDB 4Y7AA 1HAGE 2Z9LA 4BOHA 3EA8A 1KXDA 1PPEE 3T27A 1ZTLA 2V35A 2IJD1 1O3IA 1J15A 3SJ9A 3H5CB 3PMJA 4OS1A 1TX8A 2WPJS 3RLWH 3U1JB 1ELTA 2RG3A 1T32A 3MNBA 4ACBA 3E3TA 5C3NA 3UOUA 7GCHG 4ZHAA 4JZDH 2P16A 4Q80A 4X6MA 1ZMJA 2CJIA 1TB6H 3ZVBA 2B7DH 1L1GA 1O2UA 2Z6BD 3GCHB 1AQ7A 6LPRA 2RFKC 1O3FA 1TAWA 3ZVGA 1N1LA 1VGCC 3SV2H 1N8OC 2H6MA 1OWKA 1EPTC 1NRNH 1KXBA 1Z1JA 5A0CA 3T28A 1HV7A 1K1NA 2BD2A 3MH7A 2GJGA 1O3HA 2QF0A 2SNWA 4ESTE 4Y79A 1O38A 8GCHG 1C5UA 4OS4A 1Y59T 1AN1E 2VIDA 3M3VA 1Y5AT 1O2IA 5H4IB 3M61U 1VITF 2ULLA 1DANH 1C5PA 1W2KH 4BTTB 2Y80A 2QXHA 1MD7A 2ZPSA 1DM4B 2OBOA 2OC1A 3NCLA 2D8WA 1TWXB 3STJA 4X8VH 4YZUA 1O3EA 1O3PB 3A84A 3SO3A 2ANKH 2XBWA 4R0IA 3E1XB 1E37B 2D2DA 2THFB 1E1QD 2P3FH 5JB8S 4DVAU 3H7OA 1DUAA 4UFEH 3U8OH 2F83A 5TCCA 3SZNA 1VGCB 2AMDA 1HAPH 1DT2A 2Q1JA 2O8MA 4K69A 4UFFH 1LTOA 3RMOH 1XMNB 4AFQA 3V12A 1FONA 1NU7B 1Y3WA 5JBAS 2BDGA 5DP6A 4X2WA 5J4SA 2VIVA 1O5FH 1TA6A 1ZJDA 3RXSA 5LPRA 4FUCA 1XX9A 3H09A 1RGQA 2BD9A 2SGAA 4JYVH 1ACBE 1ELGA 3UWJH 4Q7YA 2AMQA 2BXTH 2C8YB 1VCWA 1PPCE 3RDZA 3SNDA 2G8TA 4WF8A 3SJOA 5LPEA 4AORA 2ZTZA 1W7XH 1O35A 2VGCB 4BTUB 1ZRBA 1O31A 1C2HA 4GCHF 2OD3B 3GYMA 2A4OA 1ANCA 1FMGA 4YTAA 1CHOG 5EQSA 1YBWA 2J98A 2PR3A 4ABFA 4CBNA 2FO9A 5ESBA 3A89A 4X1SU 3SU4A 4X6PA 1C2EA 1LDTT 3D23A 3F2GA 3UNSA 1SGPE 5A8YA 1BTZA 3OY5U 1HPGA 1PQ8A 3QO6A 4UEHH 2NU0E 3A7ZA 1P01A 4A1VA 1WDIA 1BBRE 1EAUA 1ZTKA 3RXJA 1GCTB 3C27B 4A7IB 1O2VA 3F9HA 1DLEA 2JKHA 1SBWA 3T2NA 1T31A 2H1UA 2SGQE 3SUDA 3DFLA 3EA9A 1A7SA 1S81A 1THPB 1JBUH 1K1IA 2G52A 1FX0B 1YCPH 3TH4H 1S0QA 3D65E 3S7HB 1SGCA 4AYYB 2A5KA 4U01A 1XXFA 2BVXH 2KZ4A 2Y5FA 3D62A 4ZROA 1AVXA 2J92A 2HPPH 3B23B 1P05A 1F7ZA 2BDBA 2J94A 1PYTC 5EU8A 5EIYA 3ZZDA 1AFEH 1EB2A 5FX6A 5EJZA 1S84A 4JZEH 3F3BA 1MMJN 5DP5A 4HTCH 2P93A 4CRBA 3A8AA 1GDNA 1LVMA 1SSXA 1GJ6A 4IS5A 3L3TA 2ZFTA 3SU6A 1SOZA 1YPEH 4ISNA 2ZHQH 3W94A 2SGPE 3SV9A 1GBLA 1QQ4A 1AU8A 4NSVA 4KTSA 3ENSB 1TNLA 4NFFA 4CRGA 2G51A 1LKBA 1GBJA 3RXQA 2BHGA 2FX4A 5FBEA 1ARBA 5GIBA 1LQEA 3AAUA 1T8LA 4M7GA 1ESBA 3UOPA 5LH8A 4BAKB 2FX6A 2EY4C 1G30B 1ZSJA 4JK6A 4MNYA 4MNWA 3K6ZA 1VJ9U 2C8XB 2FTMA 1AKSA 1W11U 2BDYA 5C17A 2OP9A 4CHAC 3M7QA 1ORFA 4CRDA 3UAIC 1O2XA 3RXBA 1DX5M 1CHOF 5DKMA 2SNVA 2BVRH 2VH0A 2AYWA 2CHAC 4KKDA 1K22H 2AEIH 2Z9KA 4RT1A 2C4FH 2Y6TA 1P02A 3SZEA 1EUFA 4U32A 3K6YA 1MQ6A 1SGIB 4DCDA 1O3JA 1A5HA 1W0YH 4FVBA 4AYVB 2KR7A 3O8RA 4X1QU 1EAWA 3HK3B 5BPEA 2BD7A 3BTHE 1OWIA 1ZPZA 1HCGA 2KCPA 1YGCH 2O8LA 2GZ8A 1AUJA 1GDQA 2M5TA 4FUGA 4WWYA 2A7HA 2TGTA 2TGDA 3HPTB 4SGAE 3BG4C 1AIXH 1IQKA 5F6MA 3QDZB 1AGJA 1MTNB 2J2UA 4NZQA 1V2QT 1TA2A 2KAIB 1MH0A 1GHAG 2PUXB 2M2AA 2XOKD 4CRCA 1ABJH 2ZQ1A 3U28C 1O39A 1L4ZA 3KGPA 4E06H 1E1RD 2FZZA 3QLPH 1FV9A 1XUKA 1O3MA 1LVBA 2TPIZ 3AK5A 2BY6X 4Y8XA 2XXLA 3PM3A 3RXPA 3SI3H 3VXEH 5GXPA 2BLVA 3SN8A 3F6UH 4X2YA 5HIYA 1O2HA 1GL0E 3BV9B 1SGDE 2A4QA 1TE0A 3T62A 1C2KA 1W0JD 1P8VC 1OWDA 4KTUA 2HLDD 4UD9H 4WMEA 2GDDA 2BQ6B 1OWJA 3F9FA 1O2QA 2TIOA 3Q3YA 2JJ1D 1LHEH 3EGKH 1DSTA 2YOLA 3A8BA 2JH5D 2JH0D 3I77A 1C5RA 3TK5A 4MTBA 4NIVA 4NSYA 1THRH 4Y11E 1MTWA 5EXNA 1AFQC 1JRTA 3GY6A 2JETB 1QNJA 5EOKA 4X2VA 2FPZA 4IGDA 3B9FH 3BG4B 3PMAB 2WPDD 3RXOA 5HGGA 3S9BA 3P70B 3PLKA 1ANEA 2ZTYA 1YPJH 3M5MA 3UQOA 3BTQE 3BIVH 3MO3A 2J34A 2F3CE 1CBWB 1MZAA 1SGRE 4ZH8A 1ANDA 1FPCH 4AN7A 2ALPA 2PSXA 4CH8B 1YM0A 2AFQB 4DT7B 3SUEA 5DO4H 1VCQA 1LQDB 5L30H 1V2LT 4YM9A 1JIMA 3TGJE 3U98H 2ZEBA 3MNXA 1VITG 2I6QA 3UR9A 4ABJA 4P02A 2SFAA 1SQTA 2W7SA 4TWYA 1KIGH 1FY8E 4RT0A 2ILNA 4NA8A 5EG4A 1YLDA 3DFJA 1ZSKA 1GBAA 1G36A 2ZDAH 2ZZUH 1Q3XA 3K2UA 3TJVA 1P09A 5KEDA 1B5GH 1BBRH 2Q6GA 1BCUH 1PPFE 4XOJA 2V0BA 3KF2A 3RLYH 2G81E 2W5EA 3DSPA 1V2WT 2SGFE 3RU4D 4CR9A 2DE8A 1QL9A 2L6OA 1SR5C 1AVWA 4WMDA 4X2XA 2GGVB 4B2CA 3BTME 2B8OH 2FDAA 2ZDNA 3ZZBA 5DP4A 1HIAB 1SQAA 1NRQH 1O5GH 2RDEA 1C1WH 4Y8ZA 2R3UA 1PJPA 4JMYA 4AC9A 1OX1A 2ANMH 4BXWA 1O5DH 3IWMA 1S6FA 1C2JA 2GT7A 1BJUA 1RD3B 2OINA 3RXFA 1C2GA 6CHAB 1C5MD 2WPIS 3RXKA 3SBKA 2P8OB 2R3YA 2NU1E 3SNEA 1CU1A 5GCHG 5T6GA 1KLIH 2XW9A 3OTJE 3EA7A 4I8GA 5A2MH 1G3CA 1KDQA 4J1YA 1YPGH 1L2EA 1F0RA 3DSGA 4O3TA 3SGAE 1Z71A 1F0UA 3KQBA 3BTTE 2CXVA 1C2IA 5F8ZA 4CH2B 3TH2H 1C1OA 3SUFA 4TY7A 3KIDU 2BLQA 2RA0A 5AFYH 2F9UA 4TYDA 3TGIE 1Y3VA 3AVZA 1RTLA 3IG6B 2C90B 1V6DA 1GMDG 3Q77A 1ZHRA 1TYNA 2YMSD 2ZGXH 1SQOA 1EX3A 1AB9B 3MU5A 1GGDC 1ELFA 1GI9B 1BMAA 1H8DH 3SV6A 3LH3A 2O8WA 4XBDA 1O0DH 4K1EA 4Z1MD 3QZRA 1GHXH 1P03A 3TNSA 1K1LA 3VB4A 5SGAE 2ZA5A 4PROA 1TIOA 1XXDA 1P2NA 2QAAA 4MPXA 1O3KA 3FP6E 3BEFB 2BY7X 2ESTE 2P8OC 5EJLA 1ELAA 2F9VA 7KMEH 2P94A 1TRYA 1QBVH 1ZPCA 8KME2 4RSPA 3PTNA 1A46H 1LCYA 1SOTA 3KQCA 5AF9H 3SU3A 1FJSA 5EXMA 1EZQA 1Z1IA 1XVMA 1C1PA 1MD8A 1SQRA 1OXGA 5EQQA 4CHAB 2PGBB 1JWTA 4YOIA 4B74A 1Z8GA 1ELBA 1VCPA 1KXFA 1E36B 4FUHA 4ZAEA 2QXGA 1BB0B 1YF4A 3MTYA 1DWEH 2BLWA 1GI1A 3E91A 3M5LA 1HAVB 1GHZA 4ASHA 5JPMH 1EPTB 3IITA 4MNVA 4TPIZ 1TLDA 4BAOB 2AHME 2YNAA 4ZMAH 1IQHA 4FUBA 3SHCH 3U1IB 2OXSA 4BAQB 1ZHPA 3QGNB 4CRAA 2VVVA 2STAE 3NRLA 4AOQA 4RKJB 3LDXH 4K8BA 4CREA 1O2OA 3LOXA 1KTSB 3RMNH 2GCHG 4R8TB 3P92A 1SGEE 1UK3A 1DXWA 4D9RA 3UWIA 3K9XB 5BRRE 2HWLB 2QYIA 3B8JA 3TU7H 1C5LH 4BAMB 1H8ED 2GDEH 1O2NA 4K60A 2BMGB 2AIPA 4J2YB 3A7XA 1G32B 1NPMA 3SI4H 4XBBA 3TGKE 2G4TA 3MI4A 4CRFA 1BTXA 3A82A 1T8MA 2W6ID 5EPYA 1E34B 5C0UA 4ZKNU 1MU6B 5K7RA 1XKBC 2Z94A 1O2SA 4WMFA 1Y3UA 2ZECA 3NXPA 1DFPA 5GJ4B 4NA9H 4FUFA 1IQFA 2OCVB 1SGYE 1IQGA 3KQ5A 4YO9A 5JB9S 2ZDLA 1O33A 2HNTC 1THSH 4X1PU 3RXAA 1LHDH 2YNBA 4IC5A 1FAXA 3UREA 3Q3KA 1GVLA 2W6JD 4AFZA 1A5IA 1IQJA 2AGEX 2XCNA 4B6EA 3MQKC 1P2MA 2BY8X 1GMHG 2BDHA 1UVSH 3UR6A 1C1TA 2WINI 3P17H 4HZHA 3ZZAA 4B2BA 6GCHG 1GI5A 1M9UA 4ZKSU 4AG2A 1H4WA 3ATWA 1DWBH 2ZC9H 5DK1A 4K2YA 2ZIQH 1GBFA 3MFJA 1FZZA 2BXUH 1UCYH 2VGCC 2W3IA 2W7UA 1CBWC 3S7KB 5IDKA 2K0QA 1LPZB 3QN7A 1O3BA 3JZ2B 3F68H 4B71A 2VVCA 3GYLB 4DIHH 1SB1H 1CGIE 4ABBA 1C1QA 1C5OH 2PWXA 3P8NA 3PRBA 6GCHF 2BDAA 5FL7D 1ZTJA 2HVYB 2A0QB 1L1NA 4ISOA 2CF9H 3EYDA 3HATH 1J14A 5F53A 3F2HA 2A1DB 3OY6U 4NFEA 1YPHC 3LJJA 1P3EA 1MKWK 2H9HA 4FUDA 1K28D 5DGJA 3E16B 2FIRH 1BMFD 4DOQA 3OX7U 2V3MA 2ZCKP 5T1VA 3ZYDA 1UVTH 1FLEE 4YT7H 1P04A 1EKBB 4BXSA 1W0KD 2V3OH 2HOBA 3V3MA 5CMXH 1O34A 3BTKE 1FQ3A 2TRMA 2SGEE 4F49A 3TNTA 1UVOA 1LPGB 2WV5A 1TBRH 3SNAA 3A86A 4IBLH 4JYUH 3LIWA 5C67A 5EW2H 2AMPA 4AX9H 1F2SE 2PFEA 3T26A 1S85A 5GPIB 1P0SH 4Z0KA 2PW8H 3ESTA 4F55A 3KYFA 2V3HH 4BAHB 1EP6A 1OKXA 1O5CB 1GI7B 2GX4A 3SJKA 1S6HA 2RCEA 2Z3DA 1CGJE 1RRKA 1XUJA 2K1QA 2GZ9A 1ETRH 3QK1A 1DE7H 1C5WB 1K1JA 1HYLA 3QZQA 1WXRA 4XBCA 1YLCA 2KAIA 2FM2A 3ZYEA 4MQAA 2STBE 1WBGB 4Z6AH 1VKYA 1QHRB 3N99A 4ZUHA 4Q63A 2WPHS 3VPKA 2WUCA 2W3KA 1P06A 1BMNH 1L1JA 5C20A 4O03A 1LMWB 2F9NA 1U6QA 3G01A 3OYPA 1H1BA 1WTHD 4MG3A 1TNHA 3ATLA 3OU0A 1WAYB 4XFQA 1GMDF 5DJ7A 1EJMA 1OYQA 4AGJA 1KDQB 1C1SA 3C1KA 4UFGH 1QBNA 2EI6A 4NGAH 2CK3D 1UHBA 3ATKA 2Z9IA 1BIOA 1DUEA 3UUZA 5EODA 1AZZA 1J16A 2FODA 3GCOA 3OE7D 2PTCE 3QX5H 2FLBH 2WSSD 3W95A 1G3DA 4K1SA 1P11E 2F43B 4U2WA 1QY6A 3LC5A 1G2LA 1NROH 1E0FD 3VB5A 1UO6A 1PQ7A 1FPHH 1GMCG 3MO6A 4WJG2 1O3OA 1WCZA 1NESE 2FOMB 1SGQE 2W26A 1NFXA 4ZXXH 1BTPA 2ZU3A 2A5AA 1MCTA 3HGPA 3QWCH 3A7YA 4ZKRU 3HKIB 6ESTA 1BRBE 2FOCA 1RTKA 2LP6A 1SLXB 2NU3E 3T25A 1G2MA 3CS7A 1FIWA 1GI3A 2J38A 3TIUA 1C4Y2 1T8OA 5IK2D 4TT3D 2RA3A 4KP0A 3BTEE 1C1UH 4Q7XA 1B0EA 3GCTG 1AMHA 1A5GH 1P2OA 2FOBA 3MMGA 4UFDH 3KQDA 5B6OA 2XWAA 1GMHF 2YMSB 3OEHD 4JCNA 1JRSA 5DP3A 4YESB 1L4DA 4DG4A 1KTTB 1A4WH 1HNEE 5CE1A 5FXLA 5FBIA 2JIZD 1XUIA 1A1RA 8LPRA 2JETC 4DGJA 1IQMA 3RUOA 1UTPA 3STIA 1CQQA 1Y3YA 2XBVA 3N7EA 4FXGH 2VWOA 1MTVA 1SLUB 4I8JA 4NIWA 1G3BA 2LELA 4CBOA 1F0SA 2ZG0H 3FZZA 3SU5A 3LONA 4NWKA 1CGHA 1AO5A 4GHTA 1EXFA 3ODDA 3FAOA 3GY3A 2PKAB 1Z8JB 1ZMLA 1ZPBA 2ZDVH 4ISHH 2FI5E 1P9SA 4ZHLU 1GJCB 2ANWA 1TGNA 3I29A 4ABDA 4I32A 4UDWH 4ZCNA 2F9OA 1C5VA 1PFXC 3A81A 3S9CA 3E6PH 2FESH 1GBIA 3EQ0H 1K21H 1QR3E 4M9FA 3U8TH 2IPQX 1NRPH 1TALA 1J17T 1HXFH 2KM0A 2H9TH 3LGUA 5DP7A 1O2GH 3P8GA 1V2OT 2Q6DA 4A1XA 4WY3A 3SYJA 3GCNA 2FEQH 1QZ8A 3UFAA 5HM9A 4X8TH 1OWEA 1N8OB 1S6LA 5A8ZA 3WWBA 2XC4A 3P8FA 2ZO3H 3MYWA 4I7YH 3UIRA 3SGBE 1N6XA 4RI0A 1UMAH 4F48B 3A7WA 7GCHF 4YXWD 1O3NA 8ESTE 2G55A 4ZHMU 1DXPA 4KTCA 1MKXK 2OC0A 2BQ7B 4LK4A 2KCYA 1AKSB 2EA3A 2BZ6H 1TNKA 4ASUD 1W14U 5AVDA 4HGCA 1MBMA 1KSNA 1MTSA 1SGTA 3EDXB 4I8KA 4O97A 3SHAH 4ABAA 4ABGA 1ZJKA 1QRZA 1NTPA 1A0HB 1DY8A 4XDEA 4X6NA 2ODPA 1OHHD 1W3CA 4NIYA 1AZ8A 4FETA 4E05H 1UTOA 1TQ7B 1GHVH 1XUHA 1QA7A 2Z3CA 2OQUA 1YLNA 1YCPK 1SGFA 2ZFFH 1HFDA 2QXJA 3ZVDA 1PPZA 1DOJA 1EJAA 2ODQA 2XBXA 1F5RA 1TPPA 3BTFE 4VGCB 2JH6D 1J8AA 4X8SH 5FCKA 1QA0A 2UWPA 3M5OA 3NK8A 3SV7A 1SFQB 2IJOB 1RIWC 3GDUA 3OTPA 2UUKB 5FCRA 1Z6JH 1BQYA 4MLFB 2A32A 1UCYE 1A3BH 2Y82A 1GHBF 1GMCF 2ZCHP 2BOKA 1NBMD 2FI4E 4GCHG 2P95A 5F8TA 1BDAA 1C5YB 1N6YA 3QTVH 5GDSH 1WQSA 3RM2H 3KN2A 4H6SB 2OC8A 2VH6A 4TSFD 3A7TA 3BF6H 1Y3XA 1AE5A 1VZQH 1Q2WA 1MKXH 1ESAA 1GGDB 3VGCC 1IOEA 1YPMH 5T3HA 1GI2A 1FXYA 1XVOA 4D76A 2PLXA 4E7NA 1HAYB 1UTJA 1QJ1B 1D4PB 1KXCA 1TFXA 3BTDE 3SW2B 1P2JA 2A7JA 4I31A 1EFRD 1V2MT 4TWWA 2F9BH 2FTLE 1JXPA 1V2PT 4O3UA 1ZOMA 1S82A 4VGCC 1UVPA 1D9IA 3Q76A 1UVUH 1RTFB 1H8IH 1YCPM 2GP9B 1W13U 3KL6A 1V2JT 2GCTC 4RN6A 3DUXH 3LPRA 2J4IA 3PTBA 1HJAC 1G3EA 3GS9A 3ITIA 3RC6A 2C8ZB 5TJXA 4JZIA 1KXEA 1YYY1 4ABEA 3SOSA 1CE5A 3E8LA 1KY9A 1TGBA 2ZPQA 3F0OA 2GZ7A 1ELCA 1NS3A 2VIWA 2XC5A 4D7GA 2FOFA 2QF3A 1NM6A 5JBTA 4FOUC 2FI3E 2CMYA 3M3SA 4FUIA 2ZFSA 3RXCA 1DPOA 1K1PA 4AFUA 3F0PA 3ZVFA 1SPJA 1TNIA 2ZU1A 2OQ5A 3VGCB 4U30A 1B0FA 4ACAA 1P3CA 2I6SA 1ABIH 5EQRA 4MNXA 1H9HE 4INLA 2FOAA 1MAYA 4GAWA 1IQLA 2BDCA 1BHXF 1YC0A 3M36A 5DG6A 1NFWA 2A5IA 3MU8A 1IQIA 2CN0H 1FDPA 2HNTF 2BY9X 1EAXA 3OFND 1Z8IB 1Z7KA 1Y8TA 4TPYA 1EATA 3ZIAD 1UTKA 2C93B 2GCTB 1A2CH 1HJAB 1GBKA 1C9PA 3BSQA 3LKWA 2VWLA 1HJ9A 2BDIA 5FHTA 1O3AA 1DWDH 4E7RG 2R0KA 3R3GB 5EGMA 3TITA 2TGPZ 1V2TT 1P2QA 1W12U 5C0TA 2A31A 1SLVB 2QGRA 5IYTA 3I78A 1UTQA 3VB3A 1BTHH 3TH3H 1D3QB 2LNCA 2ZHEH 1GHAF 4FUJA 1CHGA 1MTUA 2A2QH 1K0HA 1LPKB 4GVUA 4HI3A 2SGDE 2XCFA 3GCTF 3TJUA 3PV5A 2ZQ2A 4WXVA 2FYQA 4KGAA 4XD7D 3RXVA 1BITA 1V2NT 3FKSD 5K0HA 3S0NA 1MAXA 2G00A 4OGXA 3FZDA 1GJ5H 4CR5A 1GG6B 4X8UH 3BEIB 1ETSH 1AD8H 1PQAA 1F5KU 1ZR0A 2QF5A 3OEED 5L2YH 2EQNA 1HAZB 2EC9H 2WYJA 1WQVH 3U69H 1O2RA 3SU1A 1ARCA 1D6RA 2BZAA 3V13A 3A83A 3PO1C 3VXFH 1K1MA 1HB0B 4A1TA 2EI7A 4MPVA 1BRCE 2JDID 1TGSZ 2Z3EA 1SMFE 1ELVA 3CENA 4DT4A 4ZXYH 2UWOA 3RU4T 3MOCA 1O2WA 4IN1A 4XE4A 1W7GH 2BX3A 3W1EA 1ZSLA 2ZU2A 4Y10E 5E2PA 1BRAA 1GCTC 1IHSH 2XNDD 4ISLA 3RMLH 1MUEB 1ZLRA 5ETXA 1LO6A 1C1RA 1HDTH 1FAKH 1WSSH 2OBQA 3O8DA 1UHBB 4OS7A 1YPKH 2V7QD 3M7UA 1YPLH 1F92A 2ZDKA 3NZIA 3GICB 1O3LA 2FXRA 4YLQH 3RP2A 1BHXB 1TPSA 1C1MA 4B1TA 3A87A 1AFQB 2P3UB 2ZF0H 3UNQA 3VG8A 1BZXE 3SGQE 4HG6A 2AGIX 2ZI2H 4OGYA 4Y0ZE 1IAUA 4RKOB 1QRWA 1OP0A 5CDFE 2UUYA 1EAIA 1S5SA 5JBCS 1KXAA 1QIXB 3PYHA 5T6FA 1Z6EA 3TK6A 1TRNA 3ZV9A 4A6LA 1DLKB 3BTWE 4LZ4B 1EZUC 3UQVA 2PKSB 4NCYA 3WY8A 3PO1B 1JIRA 3RXMA 2ZNKH 3ZZ9A 2HVXA 3ZZ3A 5C1UA 5CHAB 5HMAA 3M3TA 1MQ5A 4B76A 1AUTC 1O3GA 1GBMA 3KEEA 1D3TB 1V2ST 2ZCLP 1HAOH 1QFKH 3DD2H 9LPRA 1ZZZA 1FY4A 3A8DA 1PPBH 3ODFA 5FX5A 2Z7FE 5A0AE 1J9CH 1HRTH 4IC6A 1AHTH 1NZQH 1C2MA 4QT8C 1TPOA 1DWCH 1TMUH 1G9IE 1O2YA 2WPMS 4OS2A 2R2MB 2FS8A 3ZV8A 5LPFA 3FO8D 3Q00A 1LHGH 1HXEH 1Y5BT 1W0ZU 1GBBA 3OSYA 1NRSH 5C5OA 1AI8H 1TABE 3M35A 1MBQA 3KHVA 3PRDA 4BANB 1C5QA 5G4BA 3FFGA 3TPIZ 1KLTA 5FAHA 2TGAA 1O2MA 1XUGA 2GD4B 2WZQA 1BMLA 1LKAA 3RXIA 4Y76A 1W8BH 2NWNA 2PV9B 4YLUA 1HAIH 2NU2E 2BM2A 1QJ6B 1ANBA 2BLOA 3GISB 3SNBA 1MCVA 5C1YA 1GI6A 5B6LA 1UTLM 2ZU5A 6CHAC 2PUQH 3AASA 1FIZA 2DE9A 3PROA 2B9LA 3ZZCA 4A92A 5AHGH 1SHHB 1SL3A 3P8OA 3TJOA 1WUNH 1HGTH 1GHWH 2GVFA 2Q6FA 4XRNA 1FN6A 3L33A 4P00A 1CSOE 1ID5H 3MU4A 1O5AB 1H9IE 2GV7A 1QQUA 2B0FA 1X7AC 1O36A 2Y5HA 2QY0B 4AZ2B 5FPTA 1TPAE 3MH6A 1EP5A 2ZWLH 3LGYA 3TK9A 4WXIA 2XYAA 2FLRH 4NA7A 1SFIA 2WV4A 1HLTH 1ELEE 1V3XA 2KCAA 1QL8A 3ZZ5A 4NZLA 2BYAX 3Q3XA 1TBQH 2BY5X 2YMSC 5I46H 3LGIA 1JMOH 1UK4A 1C4U2 1CA0C 4UE7H 2D26C 5E0GA 2ZGHA 3RC5A 4B73A 1TGCA 3VB7A 5C94A 1O32A 2HNTE 3SU0A 1TNGA 1DSUA 8GCHF 4OS6A 2L74A 1P9UA 3F9GA 3PLPA 5HKKD 1G37A 4YOJA 3U9AH 4ABHA 1T4UH 1CO7E 3LU9B 4MPUA 1ELDE 2AGGX 4DURA 1DY9A 1NFUA 4D9QA 3F2FA 1QRXA 2ZPRA 1HIAA 4AB9A 4K5ZA 3KCGH 1EQ9A 1A3EH 2HLCA 1FY3A 2VBCA 9ESTA 1MU8B 2XRCA 1WU1A 3PMHB 4OS5A 3WW7A 1EZSC 2BQWB 2AS9A 1VJAU 1DICA 1FUJA 1CT0E 1BTUA 4IMQA 4BNRA 4I33A 2ODYB 1GHYH 1QB9A 1RJXB 1C5ZB 2Z9GA 4DIIH 5KECA 5HXFA 1CA8B 1HJ8A 3TLOA 2D1JA 1PPHE 5A0BA 3RXTA 3ATIA 2GV6A 1LHFH 4Y8YA 4X1NU 2AIQA 5E8EH 4WVPE 2R0LA 3RXGA 1VITH 2AH4X 3RU4E 2C8WB 1DDJA 1QJ7B 1FI8A 3NKKA 3FP7E 4FVDA 3PWCA 1V2RT 2BD4A 1NN6A 1OPHB 1EB1H 4HFPB 3WWFA 1C2DA 2Y7XA 4B2AA 5FPYA 2R9PA 1GWAA 4I8LA 2O8TA 1O5EH 5L6NH 1EOJA 4UONA 1NO9H 3GY8A 2ZU4A 1TGTA 3MWIU 1NY22 1TBZH 2ALVA 2VVUA 2VNTA 3ZVCA 2B5TB 2O9QA 1S83A 3DCLA 1EPTA 2JJ2D 1RIWB 1GHBG 1P12E 3M37A 1C1VH 1WOFA 2R2WU 1OWHA 1TRMA 3EE0B 2ZHFH 3DHKH 2QC2A 1UJ1A 4MDSA 3RXRA 1A0LA 2VWNA 3F1SB 1EASA 1HAHH 5FPSA 1F0TA 1BTWA 1AY6H 5DN6D 2ZFRH 3HKJB 4IN2A 2ZFPH 3RXHA 2XNIA 4IW4E 3SV8A 5A09A 3A80A 1O2JA 2QXIA 1UCYK 2ZHWH 1TMBH 1QURH 1AB9C 3AW0A 1AVGH 4FU7A 4I86A 1TONA 1FY1A 2F9PA
chains in the Genus database with same CATH topology
1NFYA 1E35B 4LXBH 3PLBA 1EOLA 2GKVE 3E0PB 3SU2A 3URCA 5EPNA 4BTIB 3H7TA 2PKSC 1NRRH 1OP8A 3MH4A 1JOUB 1GBEA 1ZMNA 3P6ZB 1GCDA 1C1NA 4MVNA 2VJ1A 3HK6B 3ZVEA 3LGVA 3AW1A 3GY5A 5CHAC 5GCHF 4ABIA 4FU9A 1CT2E 2BD3A 2FP7B 2F91A 1O3CA 1O5BB 4XSKU 4H4FA 2G5VA 3QGJA 1GJAB 3GY2A 1C5NH 5HYOA 1BTYA 5L2ZH 4JYTA 1BA8B 4K1TA 4INKA 1TNJA 4TY6A 1SVPA 3CP7A 2EI8A 1NT1A 3FVFB 2Z9JA 1PQ5A 1LVYA 1WYKA 4Y0YE 1K2I1 4F4OC 1TQ0B 1OP2A 2BB4A 1SG8B 1ESTA 1L0ZA 3BEUA 1INCA 2G5NA 2GTBA 3MNCA 3SORA 1GBDA 1RXPA 3RC4A 2ZHDA 2BD8A 1GJ9B 3SJ8A 1Y5UT 3SNCA 1OYTH 2OUAA 3LH1A 2VU8E 1UTNA 2PHBA 2C3SA 1XKAC 1ZRKA 4Q2KA 1QTFA 3ATMA 3M7TA 4Y7BA 3ZZ4A 2EEKA 3ZZ7A 3VFEA 1YKTA 1ZGVA 4X6OA 4NG9H 3V7TA 2HGTH 1C4V2 3SQHE 2XC0A 1PYTD 1F5LA 3BTGE 1K9OE 2WYGA 1WV7H 2H9EH 3SUGA 3A7VA 4JZ1A 3ZZ8A 1D3DB 2Y7ZA 1T8NA 1HUTH 1A0JA 1IQEA 2OC7A 3S9AA 4FUEA 2CGAA 1SGFG 4WH8A 2UUFB 1AE8H 1HAVA 2P3TB 5JYIA 5JBBS 1O2PA 1C2LA 2Y5GA 4GSOA 4GHQA 4YT6H 3PB1E 5ESTE 1GI4A 1GPZA 3RXLA 3RXDA 4D7FA 1OS8A 1GI8B 1NC6A 2CHAB 1FY5A 3CS0A 1QB1A 1P10A 1QBOA 1YP9A 3DT0H 3PMBB 2BOHB 2ZDMA 3URDA 1DVAH 4O9VA 4SGBE 3MU1A 2HRVA 3E0NB 3S69A 5TCAA 3T5FH 5GWZA 5A8XA 3AAVA 3FANA 3JZ1B 5HM2A 1V2KT 3MO9A 2UUJB 5E0HA 1CA0B 1EZXC 1ZHMA 2FOGA 3O8CA 3RXEA 3T29A 2WPLS 1D3PB 1O37A 3FP8E 1E38B 2H5CA 3R0FA 4K8YA 1UK2A 1MTNC 1AWHB 1GG6C 1D6WA 2GMTB 4AB8A 1TOMH 3EAJA 3E90B 5F8XA 1O3DA 2TBSA 2AERH 5E0JA 5EXLA 3O8BA 1SLWB 1MZDA 1QGFA 5PTPA 3PV4A 2O8UA 3VB6A 3UTUH 1TOCB 1GBHA 3PWBA 3KNXA 3MU0A 1GI0A 1C5TA 1BOQA 1TX6A 2ZGBH 1GVKB 2IPHA 1CVWH 1O2ZA 3HGNA 1BUIA 1Z8RA 2ANYA 1LHCH 1P57B 2VIOA 4IMZA 4MPWA 1XM1A 2J9NA 1UTMA 2ASUB 3LC3A 1SI5H 1KLJH 3ZVAA 2A45B 1EJNA 4Y6DA 4THNH 1AWFH 2H2ZA 1QB6A 1SC8U 1QL7A 2QCYA 2A2XH 3M5NA 1ZYOA 1TMTH 1C5XB 2FWWA 1H9LB 5F03A 1ZGIA 2FMJA 4Y71A 2PSYA 2IN2A 1GBCA 1V2UT 4GUXA 3MHWU 4AG1A 1HBTH 1T7CA 3SJIA 3TVJB 2WUBA 4JZFH 5C5NA 2GMTC 1RS0A 1LVOA 2ZKSA 1S0RA 2VIPA 4H42U 3GY4A 4ZKOU 1BT7A 5C1XA 2CV3A 3RMMH 1GVZA 2QIQA 2Y81A 3GY7A 3UPEA 5E2OA 1Q31A 3D49H 4K3JA 5EW1H 2ZP0H 1HAXB 4I8HA 4ISIH 2V6NA 2VIQA 2RDLA 4AGKA 1P2KA 3F9EA 3MH5A 2A4RA 4H6TA 1O2LA 4AFSA 1DITH 1GJ4H 3LT3A 3LGWA 4X1RU 2FS9A 2GCHF 2A7CA 3A88A 3BIUH 5DP9A 4LOYH 1YPHE 1BMMH 2VWMA 1K1OA 3BN9A 2ZTXA 4YOGA 5JDUB 2OLGA 3A85A 3NUMA 1FN8A 2XTTB 3GDSA 1GJBB 2QV1A 2PGQB 4DW2U 3BG8A 3KQEA 1GJ8B 1GDUA 3NPSA 2CF8H 4DJZB 4LZ1H 2BVSH 1IHTH 5DP8A 3TJNA 1BRUP 1VR1H 2BTCE 2A4GA 5I25A 1GL1A 1MKWH 2GT8A 1W10U 3LJOA 4KELA 1GBTA 5J4QA 2P59A 2FOEA 2QA9E 1OSSA 2IOTA 3GOVB 3MNSA 1NU9A 2PTNA 4D8NA 1OOKB 4NIXA 3QTOH 5AFZH 2FYRA 2LPRA 5LGOA 4JK5A 1BBRK 3L6PA 4Q7ZA 2BX4A 3NWUA 3ZZ6A 5T6DA 5ABWA 4WH6A 3LGTA 3ELAH 4NWLA 2ZGJA 3VEQB 4X0WU 3SQEE 1BJVA 3P95A 4DY7B 2PKAA 2VB0A 1RFNA 2ZFQH 1P2IA 3K65B 1WTGH 1SGNE 3QUMP 1C2FA 1C9TA 4GLYA 2HALA 1IQNA 4GPGA 2WPKS 1O2TA 1V2VT 1XUFA 2G4UA 2H5DA 2J95A 2OTVA 4B75A 1ETTH 3V0XA 3UY9A 1O30A 1GJ7B 7ESTE 2DUCA 1KYNA 2FOHA 4FU8A 1PPGE 3A8CA 3GCHC 1QCPA 1O2KA 4A5TS 2UWLA 4INHA 1DS2E 2NU4E 2VINA 1B7XB 2ZGCA 1A61H 1FNIA 3U8RH 2QN5T 3N7OA 5C2ZA 5DPAA 1C5SA 3DA9B 1T4VH 3GDVA 3RM0H 2XBYA 2BD5A 2HPQH 1CT4E 3RXUA 1SHYA 2XWBI 1TX7A 3UNRA 7LPRA 1GJDB 4Y7AA 1HAGE 2Z9LA 4BOHA 3EA8A 1KXDA 1PPEE 3T27A 1ZTLA 2V35A 1O3IA 1J15A 3SJ9A 3H5CB 3PMJA 4OS1A 1TX8A 2WPJS 3RLWH 3U1JB 1ELTA 2RG3A 1T32A 3MNBA 3E3TA 5C3NA 3UOUA 7GCHG 4ZHAA 4JZDH 2P16A 4Q80A 4X6MA 1ZMJA 2CJIA 1TB6H 3ZVBA 2B7DH 1L1GA 1O2UA 2Z6BD 3GCHB 1AQ7A 6LPRA 1O3FA 1TAWA 3ZVGA 1N1LA 1VGCC 3SV2H 1N8OC 2H6MA 1OWKA 1EPTC 1NRNH 1KXBA 1Z1JA 5A0CA 3T28A 1HV7A 1K1NA 2BD2A 3MH7A 1O3HA 2QF0A 2SNWA 4ESTE 4Y79A 1O38A 8GCHG 1C5UA 4OS4A 1Y59T 1AN1E 2VIDA 3M3VA 1Y5AT 1O2IA 5H4IB 3M61U 1VITF 2ULLA 1DANH 1C5PA 1W2KH 4BTTB 2Y80A 2QXHA 1MD7A 2ZPSA 1DM4B 2OBOA 2OC1A 3NCLA 2D8WA 1TWXB 3STJA 4X8VH 4YZUA 1O3EA 1O3PB 3A84A 3SO3A 2ANKH 2XBWA 4R0IA 3E1XB 1E37B 2D2DA 2THFB 2P3FH 5JB8S 4DVAU 3H7OA 1DUAA 4UFEH 3U8OH 2F83A 5TCCA 3SZNA 1VGCB 2AMDA 1HAPH 1DT2A 2Q1JA 2O8MA 4K69A 4UFFH 1LTOA 3RMOH 1XMNB 4AFQA 3V12A 1FONA 1NU7B 1Y3WA 5JBAS 2BDGA 5DP6A 4X2WA 5J4SA 2VIVA 1O5FH 1TA6A 1ZJDA 3RXSA 5LPRA 4FUCA 1XX9A 1RGQA 2BD9A 2SGAA 4JYVH 1ACBE 1ELGA 3UWJH 4Q7YA 2AMQA 2BXTH 2C8YB 1VCWA 1PPCE 3RDZA 3SNDA 2G8TA 4WF8A 3SJOA 5LPEA 4AORA 2ZTZA 1W7XH 1O35A 2VGCB 4BTUB 1ZRBA 1O31A 1C2HA 4GCHF 2OD3B 3GYMA 2A4OA 1ANCA 1FMGA 4YTAA 1CHOG 5EQSA 1YBWA 2PR3A 4ABFA 4CBNA 2FO9A 5ESBA 3A89A 4X1SU 3SU4A 4X6PA 1C2EA 1LDTT 3D23A 3UNSA 1SGPE 5A8YA 1BTZA 3OY5U 1HPGA 1PQ8A 3QO6A 4UEHH 2NU0E 3A7ZA 1P01A 4A1VA 1BBRE 1EAUA 1ZTKA 3RXJA 1GCTB 3C27B 4A7IB 1O2VA 3F9HA 1DLEA 2JKHA 1SBWA 3T2NA 1T31A 2H1UA 2SGQE 3SUDA 3DFLA 3EA9A 1A7SA 1S81A 1THPB 1JBUH 1K1IA 2G52A 1YCPH 3TH4H 1S0QA 3D65E 3S7HB 1SGCA 4AYYB 2A5KA 4U01A 1XXFA 2BVXH 2Y5FA 3D62A 4ZROA 1AVXA 2J92A 2HPPH 3B23B 1P05A 1F7ZA 2BDBA 2J94A 1PYTC 5EU8A 3ZZDA 1AFEH 1EB2A 5FX6A 1S84A 4JZEH 1MMJN 5DP5A 4HTCH 2P93A 4CRBA 3A8AA 1GDNA 1LVMA 1SSXA 1GJ6A 4IS5A 3L3TA 2ZFTA 3SU6A 1SOZA 1YPEH 4ISNA 2ZHQH 3W94A 2SGPE 3SV9A 1GBLA 1QQ4A 1AU8A 4NSVA 4KTSA 3ENSB 1TNLA 4NFFA 4CRGA 2G51A 1LKBA 1GBJA 3RXQA 2BHGA 2FX4A 5FBEA 1ARBA 5GIBA 1LQEA 3AAUA 1T8LA 4M7GA 1ESBA 3UOPA 5LH8A 4BAKB 2FX6A 1G30B 1ZSJA 4JK6A 4MNYA 4MNWA 3K6ZA 1VJ9U 2C8XB 2FTMA 1AKSA 1W11U 2BDYA 2OP9A 4CHAC 3M7QA 1ORFA 4CRDA 1O2XA 3RXBA 1DX5M 1CHOF 5DKMA 2SNVA 2BVRH 2VH0A 2AYWA 2CHAC 4KKDA 1K22H 2AEIH 2Z9KA 2C4FH 2Y6TA 1P02A 1EUFA 4U32A 3K6YA 1MQ6A 1SGIB 4DCDA 1O3JA 1A5HA 1W0YH 4FVBA 4AYVB 3O8RA 4X1QU 1EAWA 3HK3B 5BPEA 2BD7A 3BTHE 1OWIA 1ZPZA 1HCGA 1YGCH 2O8LA 2GZ8A 1AUJA 1GDQA 2M5TA 4FUGA 4WWYA 2A7HA 2TGTA 2TGDA 3HPTB 4SGAE 3BG4C 1AIXH 1IQKA 5F6MA 3QDZB 1AGJA 1MTNB 2J2UA 4NZQA 1V2QT 1TA2A 2KAIB 1MH0A 1GHAG 2PUXB 4CRCA 1ABJH 2ZQ1A 1O39A 1L4ZA 3KGPA 4E06H 2FZZA 3QLPH 1FV9A 1XUKA 1O3MA 1LVBA 2TPIZ 2BY6X 4Y8XA 2XXLA 3PM3A 3RXPA 3SI3H 3VXEH 5GXPA 2BLVA 3SN8A 3F6UH 4X2YA 1O2HA 1GL0E 3BV9B 1SGDE 2A4QA 1TE0A 3T62A 1C2KA 1P8VC 1OWDA 4KTUA 4UD9H 4WMEA 2GDDA 2BQ6B 1OWJA 3F9FA 1O2QA 2TIOA 3Q3YA 1LHEH 3EGKH 1DSTA 2YOLA 3A8BA 2JH5D 2JH0D 3I77A 1C5RA 3TK5A 4MTBA 4NIVA 4NSYA 1THRH 4Y11E 1MTWA 5EXNA 1AFQC 1JRTA 3GY6A 2JETB 1QNJA 5EOKA 4X2VA 2FPZA 4IGDA 3B9FH 3BG4B 3PMAB 3RXOA 5HGGA 3S9BA 3P70B 3PLKA 1ANEA 2ZTYA 1YPJH 3M5MA 3UQOA 3BTQE 3BIVH 3MO3A 2J34A 2F3CE 1CBWB 1MZAA 1SGRE 4ZH8A 1ANDA 1FPCH 4AN7A 2ALPA 2PSXA 4CH8B 1YM0A 2AFQB 4DT7B 3SUEA 5DO4H 1VCQA 1LQDB 5L30H 1V2LT 4YM9A 1JIMA 3TGJE 3U98H 2ZEBA 3MNXA 1VITG 2I6QA 3UR9A 4ABJA 2SFAA 1SQTA 2W7SA 4TWYA 1KIGH 1FY8E 2ILNA 4NA8A 5EG4A 1YLDA 3DFJA 1ZSKA 1GBAA 1G36A 2ZDAH 2ZZUH 1Q3XA 3K2UA 3TJVA 1P09A 1B5GH 1BBRH 2Q6GA 1BCUH 1PPFE 4XOJA 2V0BA 3KF2A 3RLYH 2G81E 2W5EA 1V2WT 2SGFE 3RU4D 4CR9A 2DE8A 1QL9A 1SR5C 1AVWA 4WMDA 4X2XA 2GGVB 4B2CA 3BTME 2B8OH 2FDAA 2ZDNA 3ZZBA 5DP4A 1HIAB 1SQAA 1NRQH 1O5GH 1C1WH 4Y8ZA 2R3UA 1PJPA 4JMYA 1OX1A 2ANMH 4BXWA 1O5DH 3IWMA 1S6FA 1C2JA 2GT7A 1BJUA 1RD3B 2OINA 3RXFA 1C2GA 6CHAB 1C5MD 2WPIS 3RXKA 3SBKA 2P8OB 2R3YA 2NU1E 3SNEA 1CU1A 5GCHG 5T6GA 1KLIH 2XW9A 3OTJE 3EA7A 4I8GA 5A2MH 1G3CA 1KDQA 4J1YA 1YPGH 1L2EA 1F0RA 4O3TA 3SGAE 1Z71A 1F0UA 3KQBA 3BTTE 2CXVA 1C2IA 5F8ZA 4CH2B 3TH2H 1C1OA 3SUFA 4TY7A 3KIDU 2BLQA 2RA0A 5AFYH 2F9UA 4TYDA 3TGIE 1Y3VA 3AVZA 1RTLA 3IG6B 2C90B 1V6DA 1GMDG 3Q77A 1ZHRA 1TYNA 2ZGXH 1SQOA 1EX3A 1AB9B 3MU5A 1GGDC 1ELFA 1GI9B 1BMAA 1H8DH 3SV6A 3LH3A 2O8WA 4XBDA 1O0DH 4K1EA 3QZRA 1GHXH 1P03A 3TNSA 1K1LA 3VB4A 5SGAE 2ZA5A 4PROA 1TIOA 1XXDA 1P2NA 2QAAA 4MPXA 1O3KA 3FP6E 3BEFB 2BY7X 2ESTE 2P8OC 1ELAA 2F9VA 7KMEH 2P94A 1TRYA 1QBVH 1ZPCA 8KME2 4RSPA 3PTNA 1A46H 1LCYA 1SOTA 3KQCA 5AF9H 3SU3A 1FJSA 5EXMA 1EZQA 1Z1IA 1XVMA 1C1PA 1MD8A 1OXGA 5EQQA 4CHAB 2PGBB 1JWTA 4YOIA 4B74A 1Z8GA 1ELBA 1VCPA 1KXFA 1E36B 4FUHA 4ZAEA 2QXGA 1BB0B 1YF4A 3MTYA 1DWEH 2BLWA 1GI1A 3E91A 3M5LA 1HAVB 1GHZA 4ASHA 5JPMH 1EPTB 3IITA 4MNVA 4TPIZ 1TLDA 4BAOB 2YNAA 4ZMAH 1IQHA 4FUBA 3SHCH 3U1IB 2OXSA 4BAQB 1ZHPA 3QGNB 4CRAA 2VVVA 2STAE 4AOQA 4RKJB 3LDXH 4K8BA 4CREA 1O2OA 3LOXA 1KTSB 3RMNH 2GCHG 4R8TB 3P92A 1SGEE 1UK3A