1YC8A

Caban33- y37v/e44g/r45l triple mutant
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
117
structure length
116
Chain Sequence
DVQLVESGGGSVQAGGSLRLSCAVSGSTYSPCTTGWVRQAPGKGLEWVSSISSPGTIYYQDSVKGRFTISRDNAKNTVYLQMNSLQREDTGMYYCQIQCGVSIREYWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-VSG immunoglobulin heavy chain variable domain cAbAn33
publication title Antigen Binding and Solubility Effects upon the Veneering of a Camel VHH in Framework-2 to Mimic a VH.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Immune system
total genus 26
structure length 116
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yc8A00
5DJZA 1K5NB 4EEEA 5C6WH 3MLXL 4WO4C 1RFDH 3L5JA 1VSCA 1VEPA 1EGJA 5E2TL 4JM2D 5DRWA 4HD9A 35C8L 2UZIL 3VFTB 3MRBA 1UWEH 3K4AA 5IB4A 3U82B 4PRDB 1K8IA 2VH5H 4M1DL 1UXWA 3BPLB 5FGRA 1RI8A 1YMHA 1YEEH 5CJQH 2VRAA 3C6SB 3LEXA 1ZVSA 2CLRA 3LKNB 4EOWL 1FGNH 4XBEH 1L7IL 1NMCB 4JDZA 4P99A 5FA4A 5DJ8B 4WEBH 1CGVA 2JJSC 5BVPH 3OKLB 4JY6B 4TULH 3V0VB 3MCLL 3RKDC 3W81A 1A7QH 1N3NB 2F5BH 3ZO0A 1A3QA 1AH1A 2BSRB 3P77A 5FHBH 3NCYP 5JW5B 4LNRA 4PR5B 4YBQC 1CDIA 3VXQA 4F2MB 3UTQA 5JORB 3G08A 4NQCA 5C6PB 3QDHA 4YPJA 1M7IB 1HXYB 3QXWA 2EIZA 1MVUA 1MEXL 1ZE3C 1D5BB 3W39B 1CDJA 5D6CB 2IBZX 5DJCA 1PSKL 4LPXA 4LQFH 1GGBH 2C3XA 1EK3A 2VWEC 2W0KA 3QIWA 5EDXA 4PP2A 4LIQL 4NC2B 1N6VA 2DKSA 4FNLL 1T66D 1IEHA 2IPUK 5K9OB 4MD4A 5F1KC 4NRXB 5BOPA 3RY4A 1RZFL 2C3GA 4WI3A 5DHXB 1WEJL 5CZXD 5T3XD 4K7FB 4LHUG 5GGVY 3DX7A 5KANI 3BEWA 3M1BA 3L3IA 4UTBH 1IAOB 5KW9H 4P3DB 1YEHL 4G8IB 5CZKA 1CD9B 4HFUL 4G3YH 2EDEA 2DM7A 4XPFL 4YFLI 2Q6WA 3DMMA 4XC3L 2RCSL 2F19H 4LQ1A 3VDAA 1T04B 4OZGF 3AMLA 1BZQK 1IAII 4XAWL 3RVTD 4NQTA 3CJJA 2HN7A 4PB0H 5I1HH 2HLAA 4EN3C 5I9QB 1J0HA 4HC1L 1I3GL 4FXLA 1T20B 3HC0A 2VKXA 4KZDH 5TF1L 2FX7H 1MRDL 2IBBA 3QEQE 2OMBA 2PYEA 1C08B 2GFBA 3NBNA 3V6ZB 5FUZH 4UT7L 4F7EA 5TDOB 1KIRB 4MDIB 4OZGA 5C6TH 2HT3D 4JVWA 4OLZL 4HX1A 1Q9LB 2FLBT 3NCBB 2AEPH 3ZMRA 2DL9A 4OCLC 2Z92B 1J1XH 5FGCB 4NM8L 5KSAD 2OZ4H 3X14B 3DGCR 4CL7A 2ARJA 4ONFL 4WFFE 4M1CC 1JRHH 1JGUL 1WAAA 1OTUC 2A73B 5C92A 4G43A 3TN0D 4QCIA 3MRHB 5KVDH 1DDHB 2ZUYA 2ADFL 1PQZB 3MRJB 1QSZA 4OD1H 3SO3C 1V3MA 1HHIB 3KJ4C 2R8SL 2ZSVB 2Y5TA 3KHQA 3O2WH 1U92A 4HUKB 1R24B 1N5AA 4GMSH 2EIDA 2AJUL 2ESVA 2HT4C 1CD8A 3LIZH 1A1OA 1NSNH 4K71B 3SE8L 5D7SH 5DZLA 2E6PA 1YEIL 2WK2A 3BP7B 3AROA 1RIVL 1HQRB 4I77H 3VXMB 1WISA 3BN9D 1OAKL 3VJ6B 4U6HA 3QA3B 4JRXA 4OD2B 2NZ9D 3JWOL 5BVJA 4NQCE 1FFOB 4H0GA 4WHTB 2NY3C 3U79A 4R0LB 4KROC 1RJLA 1A6WH 5IVXE 5DS8B 4XVTH 3QUYC 4WHYH 4G9DA 3WS3B 1IBGH 3MLVL 4APQA 3MLSH 5BS0A 2VLRD 3KDMA 3S37H 3KPPA 2NYYD 5EOQH 2X4SA 5EN2B 4QHNA 3BZ4A 1XR9A 2GKIA 1C12B 3MCKA 3IKCB 1EMTH 4Y4FA 5T3XH 4GMTL 4DFIA 3QR2A 4NP4L 5D93C 4RNRA 3BRGC 1FZJB 3T65A 2ZSWB 4XB8A 2I25N 5JHLL 1NKOA 2EXWC 1QEWA 3GIZH 5EU5B 1FAKT 2CUIA 1W0VA 2VNCA 3IT8D 1ZHBB 5KOMC 4V2CB 4AT6B 1KB5B 5FUOH 4NKIL 2A0LC 1SEQL 4TRPL 3WFDH 1WSST 1D9KA 2QHRH 5ETUA 3GSOA 4JPWH 5DQJA 4IMLB 4WFHE 2QADD 3FB7B 1KFAH 5H2BA 5HPMB 3RA7H 5ESQA 3X3FL 4GAGL 4NZUL 1MI5B 4PTTA 1WIUA 3VFUA 4Q6YA 5T1DH 2B7DT 1DE4A 1DQQB 1G7HA 1KUMA 4WFGD 1MLBA 2YD8A 5C2UB 4PRPB 4OLEA 5JW3L 2V2XB 5DO2D 3VG9C 1Y6KR 1XGTA 1AQDB 3AC0A 1JGVH 3PL6D 2VUOA 4DKFH 3MRRA 4N90D 4PRBA 2YK1H 4TVPH 3WD5H 3ARRA 1NL0H 5IV2A 3T2PA 1T7WA 4LVEA 3MUJA 4ZS6C 2YUVA 3MNWB 4KK8C 4KAQL 3DUUA 3QPQD 5GGSB 2XZAH 3TO4C 4IRJB 1PX3A 2F8OA 1R3LA 4J6RH 5GGQL 4JQIL 3VFVB 2FJFA 2ESVE 3RWDA 4X7CC 4JFDA 4M7LH 3T8XB 1SM3L 4K94C 4LARH 4J3UA 4BZ2L 2LTQB 4N0FA 3ZTJH 3P4NB 5D1ZD 3SO5A 2F8XC 4YHIB 2F58H 3B8YA 1NJ9B 2ADJA 2W9EH 3QQ3B 3BPNB 3LKRB 1HCFX 1QR1B 5CKAA 1NLDL 4HV8A 2ICES 3FFDB 3C5SB 3ARDD 2NY1B 3L3KA 1GOHA 4JG1H 4UZGA 4LLUB 3AREA 2OR7A 5ADPL 1A5FH 1MCKA 1MQ8A 3N1FC 4M5YL 4P5KB 4G8EA 1K4DB 1I1YB 4NO3A 1P4IL 4GS7C 4OIIL 5C08A 2DJ4A 2EYTB 4D0BA 4ZUVA 1KGCE 3PG2A 4BFEA 3HRZA 4KQ4L 5ITFA 3QG7L 1CXIA 1Q8MA 4TUKH 2ZKHH 2BNQD 4AIOA 4O2CA 1GOGA 3MRCA 4HW6A 1J05B 3STZA 2EDTA 1T03H 1FDLL 4X83A 3TA3D 1CGYA 2CIIA 5E9DE 5TE4H 3ET9F 5TDNB 1F3DJ 1IGTA 4LPCA 2NXYB 5GJSH 1WK0A 3DO7A 3X3GL 4LK4A 4Z7UF 3PWJA 2P5WD 2OI9C 4JREB 2RHEA 2EDHA 1KEGL 4GQPH 3BUYA 1ZEAL 3IDJB 3GI9H 2ATKB 2P48B 1VGKB 3DRQA 3FT4A 1ZGLM 4PTUB 5I18L 3HPLB 3A0OA 2CO7B 3DYPA 3OX8B 3D2UD 2GI7A 1WZMA 1CICD 5HYJA 1T4KA 4OF3A 5HHOA 4WEMB 4N9OB 3GSXB 3TIEA 3HE6B 5JQHC 4HUVA 1SJVA 3ULVD 3IDMA 3DROA 3NA9H 3WLWC 5F7LB 4UAOC 1GGYA 1LD9B 5I8CA 3LS4L 2C4XA 3SKOA 4YXLH 3REVA 5HYSG 4JO2H 4PB9H 1F58H 2DN7A 4E9LA 3EJYD 3LV3B 2Z31C 3EIFA 15C8L 4KK6C 4LLVA 1JUFB 4FXGA 4GRLD 1HHKB 4MAYB 3JVGC 3AMKA 4YLQT 3VFSA 3G6JB 5D2NB 3OGOE 5C0AD 3RIAK 3CAFA 5E0QA 1JIBA 3OZ9H 3FO1B 4NQUA 4XWGH 4JFDE 4K23L 4M9PA 3ULUF 3RNKB 4BUGA 5I16B 4Y2DA 3KJ6H 1MFNA 3GBNL 2QLVB 1AR2A 32C2B 4UU9A 1W72B 1AGBB 2GQHA 5D1QC 3NIFF 2E6QA 2YD6A 4DEPB 3UTTA 1U3HD 1B3JA 1XGPA 1OTTD 2X1XR 5FAAA 1D5ZB 4G9FA 3KYAA 2D7OA 3RPIB 2D2OA 2ZG1A 3E6HA 4NKOA 3O3AB 3PABA 3VU2A 3QFJA 4FP8L 4AYFA 5JPNA 5L88H 2MCPL 4G7VL 4FTVD 3DIFA 1B0RB 1A4KA 1IEAA 2WNGA 2R2BB 3GI8H 1YEJH 3UJJH 3MXVL 4NO2B 3NN8B 4YHPA 1VACB 4RFOH 1YY9C 5TDPA 2IPKA 3BKJH 4Z77A 1HQ4A 1X5ZA 3CMOL 4EI5A 2FEEL 1KPRA 1JPFB 4HPOH 4G5ZH 5L9DL 4RGNE 3RHWF 1W8NA 4XCYA 4ZQKA 4X4XA 2IAMC 4QGTA 4KI5F 3QDMD 5CP7A 1JFQH 1KACB 4NYLA 4Q9BA 4Y4KC 1Q94B 3B2VH 4MDJA 2O5ZL 3MMEA 4AY0A 2VLJE 4M61A 3SDDD 3VXSA 1AO7D 2EH8L 1K8DB 3ES6B 3QDJB 4CADB 5E6IA 5E5MB 5M95B 2FSEA 1I8IA 3HPJA 5D7IF 3AGVA 4I0PC 4XPGL 3PP4L 5C07B 4JO1L 4M3JA 2FHBA 4NC1E 3IU3A 4DVRH 3MJ9A 4DW2H 5BRZD 1ONQB 4L8DA 1OP5H 3KLSA 3LPGA 2AK1H 3TBYB 4XWOD 3MV9E 4GAJL 4HWUA 3QYCA 3R1GL 1E27B 1G84A 4OLWL 5J57B 5FUCC 3ZKNC 2RQ8A 5HY9B 2O5XL 1XF4B 3HNTH 5D7IA 2ZCKH 4GXUN 5HYJE 4ZAKA 3BIBX 4U0QB 5EULV 3G5ZA 3SE4A 4Z7UE 5HHOE 2JF1A 3ZDXF 3O6FC 2RJMA 4FQ1H 4DKEH 4PGBB 1KN2H 2LU4A 1AKJB 5LGHL 5C0CB 2IC2A 2X4NB 3HZYA 2XWJB 1F11B 3TYGL 3HMWH 3KHOA 2V9QA 4WFEE 3ZHDA 3RZCD 3OR6B 3BW9A 3MRFA 1ZWIA 1CLZL 3SKUD 2FIKA 1R3HA 1IAIL 1OP9A 4ZXBD 4OCYL 3CPLB 5F7DB 4NWTL 2H32A 4QNPF 2MHAA 4FQXD 2H3NB 4C56D 1LNUA 2PCPB 1GIGL 3LEYH 3RJQB 1QBBA 3CLFH 1DVFD 1FG2B 3ARXA 4HUXA 3CVIH 3BQUA 1MH5A 1ODAA 3P9LA 4ZFFB 1UADC 3BXNA 3M45A 2GJ6D 4HZAA 5I15L 3JWDC 5KSUB 1RZGB 3IF1A 5C0ND 4J8RB 1YDPA 1ETZA 4TQEH 3F7VB 5IBLD 4PP1D 4LHUB 1CVRA 3MJ7B 4OLYL 2AI0L 5DMYA 2BCKB 2KZ1B 4PRHB 5DDHB 5DRXA 4ONHB 4P2RE 4XCNB 1I9RH 3BD3A 3BEVB 3TVMA 4NN6B 1XGUA 5DJ6A 5EUOF 4NM4L 1A7BA 3ULUE 1AC0A 4S0TD 3QFJE 3V5KA 4NZTH 5F7EL 1QFWL 4Z9KB 4D8PA 1E0OB 3VFWA 1NAKH 5IMKA 1ADQH 3BPOC 5HGBA 3NIFE 5C8JA 5HJ3B 1CFNA 4G6FD 4XBGB 3MACH 3I50H 5KVFH 1DLHA 1JGLL 4LMQE 3D3VB 3MRKB 3H9SE 2HJKB 1QBAA 5EUOA 3TNNB 4JFFA 4F9PC 4XPBH 5GIRA 1XAUA 4FG6D 4DQOL 3KS0J 3B9KB 1MFDL 4U1IB 3WUWG 3QQ9D 4BQBA 3T0EC 3E8UL 3SJVB 3G6AB 4XRCB 2V5SA 2VDMH 4JM4H 3NFSH 4DKAA 2FCBA 5FA3A 2D0GA 3FT3A 3MRQB 4NRYA 2B4CC 4F8TA 4MSWA 3TJEH 1SY6A 3KYNA 1P6AB 1HEZB 4ENEC 2ICWJ 3EO1B 3IRPX 4DFHA 4K94L 4KI5E 5GGUA 3OKOA 5CP3A 5HI4D 1EBPA 5CIPB 5FO8A 2GSIA 3BE1L 1PEZA 3LDBB 1AFVH 3HZVB 2W9DL 1MLCA 5IROA 1XCQB 1KJVB 3ARFA 5D7IE 4TUJB 4HFWA 1Z5LB 1MPAH 2R29L 3QUMH 1S7WB 4Y16D 5I1DB 1XIWD 3GKWL 3V7AG 3WYRA 4H1LB 5EO9B 2D4DA 1INDL 2R1WA 4BFIB 1S7UB 1RURH 4HBCH 3VXRA 2D9CA 1I7TA 2GY7B 2J8UF 4XP6L 3RNQA 4IS6A 4ZPVB 4EDXA 1Z9MA 3E3QC 4Y5YC 1H5BB 3T1FA 3BP5A 4PLJD 1YECH 3BT2L 4H0IA 1NEUA 2CKBA 3FMGH 3MR9B 1TJHL 1BZ9B 3I75A 3QG6A 1RUQH 5BW7C 3O2DH 3DBXB 3L3DB 4KRPB 1J5OL 5SWZD 3VGFA 3CFBB 4ZUUB 2VDOH 3AY4C 1IAIM 3P4MA 1D5MB 1AE6L 3MOAL 2CD0A 4G6MH 4CNIB 1TENA 5IW1A 5C0BB 3F7QA 1K5NA 4P2QE 3NZ8A 1MWAB 2APVA 3KXFE 4NKMB 3C60A 3WSQL 4QNPE 1FL6A 3FQRB 2ARJQ 3JV4B 1G7MB 3FTGB 4K3JL 4QRRB 4CJ1A 5I8EA 4KUCD 3VXPA 2X1PA 3OPZL 4KHXL 2AXHA 3VXUD 4K7PH 5ICYA 3L3HB 4GKZB 1KF9B 3C6SA 3HNSL 3RAJL 2ARWA 1E6JH 3ZKMD 3LKNA 2E7LA 3O8XD 1FLRL 3NZHL 7CGTA 2XWBA 4DAGL 2QR0A 4I48B 2DQUH 5DJ8A 5JA8B 1VESA 2DWEB 5CHNB 5A1AA 3TT1L 4UIKH 1JVKA 3PE9A 4MXVF 3N1QC 3MZTA 4JY6A 3STLB 5EUOE 4JFFE 1N3NA 3O11B 2Z8WC 3LKSB 4U05A 4R2GD 2C3VA 5JW5A 4JLRB 3DRTB 3D25B 5JORA 1HCVA 1F13A 4XC1H 4Y4HD 5CD5D 1KCSH 1FH5H 1B4JL 5D7JC 1WUNT 5GS1B 1HK6A 2IH3B 1RMFL 5IJVB 1HXYA 4PBVC 1D5BA 4NFCA 1LILA 3W39A 1PKQB 4IJ3C 5D6CA 1KCVH 1MHCA 1WBZB 1NMAL 2DAVA 3QDGD 1MCNA 5I6XB 5D70H 1CFVH 3BKCH 5K9OA 4NRXA 4X7FC 5EZLB 1NEZG 1YMMD 2R0KL 1U2CA 4K7FA 1BM3H 1E4JA 2EZ0C 3FAWA 4GJTB 4P3DA 1PG7X 1XF1A 4G8IA 3TJHC 3AXLB 4HWBH 4G7YL 5ADOL 2K1MA 1KENL 4O51B 1TJGL 4GOSA 4P46D 5HGDB 3MSPA 4RMVA 5HDLA 1MJ8L 1T04A 4NUGL 3ALXA 4QHUB 4Z7OF 3LEVL 1IQWL 1KC5L 2BVQB 2HMID 4XZUB 1T20A 1CGTA 4GW5B 1LO2L 5AAWA 5GRJH 3UYPA 1LMKA 2XG4A 2IQ9H 3HC4H 4O02L 5IP4A 1C08A 1A0QL 3V6ZA 4PJBF 1TZGL 5GRUL 3V5HB 5TDOA 1VEMA 1KIRA 1V7NH 2J8UE 4MDIA 2J88H 4L3ED 4WWKC 1Q9LA 1JHTB 1MAKA 3DURB 3BPCB 4TN9A 2ORBH 35C8H 4AMKL 2Z92A 1IZKA 1KN4L 3TBVA 3Q0HA 1PY9A 1NBVL 3RP1A 4LGRB 1K6QH 2ZCHL 1FLTX 4DZ8B 3BP6B 3KGRA 2AERT 4KPHL 1WICA 4PFEA 4HCRA 2A73A 3EFFB 4IRSD 1KCLA 5D96C 4FA8A 1IGYB 3MRHA 4PJBA 1DDHA 5F9OL 3MRJA 4X0KB 3QHTC 4OGXL 4NUJA 1KBGL 2ZSVA 4RQQB 4V2BA 4JG0L 3FT2B 2X4RB 4YXKL 1FJ1B 1IGJB 4R97B 4OBRA 1DQML 3HCVB 5HI5C 3IDYC 3BP7A 4L1DA 1EUUA 4OGYL 1HQRA 5DSCB 3VJ6A 4HS8L 1NBZB 3QA3A 3IS1X 2R69L 1T0PB 4N0YH 5FYJE 4OD2A 2A9MH 2YOCA 1MCDA 3K8LA 1MAML 5DS8A 3ZTJG 2X4PB 5E24E 2QEJA 3WS3A 5JZ7D 2NY2D 3RWCA 2Y06L 2PO6D 3JWDL 4XHJD 5EN2A 4YXHL 3T3MF 1QQDB 3PWPE 3V7AE 3IKCA 5DD0H 3OWEA 4Q2ZA 4JZNB 5A2FA 2CLVB 3L5XL 2NTFB 5SWSD 1FZJA 2WUCL 2ZSWA 3EJZC 4XPFH 2XZCH 1P9MA 4TTDD 1X4ZA 2Y6SD 5FM5M 1QLEL 1TZIB 4AT6A 1B88A 2I60L 1ZLUH 4P4KD 2A77H 4XAWH 4NT6B 1KEMH 1PG7L 3QPXH 2BDNL 4Q6IB 1T2QH 1JNNH 5L7XH 2DM4A 4OZIB 1IQDB 4MWFA 3OJDB 4IMLA 1I3GH 3FB7A 3THMH 5HPMA 4TSBH 1IGMH 4MNQE 4UB0L 1E4KA 2MPAH 1MI5A 1A3RH 3FB5B 1W8OA 3VGEA 5FOBB 2VABB 3U4AA 3MV7B 1DQQA 3CK0L 4M5ZL 4LEXH 1UACH 2AV1A 4PRPA 3VGGA 2NNAB 4G42A 2HFGH 2QKIB 3DMMC 5I1KH 2YD3A 1CFSB 4LPTA 3V6OA 1AQDA 4LPUA 1AQKL 1ZA3B 4AENB 5IJKC 4Z7OE 3F12A 3P11L 1MRCH 5T1KD 5FHAH 1JGUH 5DD3L 3GSVA 4V1DB 4R4FH 3AFLA 2ZUQC 5E8PB 4OLXH 3OKMB 3DWTA 4L4VD 3MNWA 5F8RC 3L9RB 1FSKC 5GRXG 4PJBE 5GGSA 4LBEB 1MFCH 4PV9A 5FB8B 4IRJA 3MBED 3C6LD 1VCAA 1QSED 3O2VL 3DI3B 3NGBB 3C5ZB 2I5YH 4HJJH 3T8XA 4JFQB 4JFED 3F6IA 3MUZ1 3V4UH 5T3ZD 2XRAH 3P4NA 3MYJB 3WXVH 4YHIA 1Q0XL 2ICWB 1NJ9A 1NMBL 3QQ3A 4I5BB 3LKRA 4GLRH 1QR1A 2E5EA 2MNUA 3FFDA 4X4MA 4KKLC 2AJZB 4P9HC 1UKQA 4A6YB 4YJZL 4XNYH 5KSBB 4FZ8H 4LLUA 1CR9H 2GTZB 1NGYB 1U2HA 2PR4L 2OK0H 4P5KA 3UJIL 3U4BH 4K3EH 2JELL 5A16A 4EVNA 5IVZB 3VMNA 1XCTB 4UINL 4GMTH 2EYTA 4LCCC 3R4DA 5DMGC 4JZJB 2YPVH 3FRPA 4MD5A 2D3VA 2Q1EA 4H25B 4MJID 4IRZL 3VE0B 4PJEB 2H26B 4E42B 3FHQA 3G9AB 1K3IA 3OKEA 4MXQC 1J05A 1RUKL 3IDXH 4KVNL 5TH2B 3U4EB 4HULB 5TDNA 3MLUL 3T3ME 3GM0A 1QSFE 4APQC 2ZUSA 3SY0B 5EBLB 3S9DB 4DGVH 2QSCH 3L7EB 3GSNH 1B2WL 4Z78B 1SBBA 3QO0A 1MI5E 3CD4A 4B41A 3IDJA 1KTLB 2ATKA 1BWMA 1KTRL 4FQCH 3UROR 1MCPL 3VWJB 5IT2L 3G6DL 3PP3H 3HPLA 1MCRA 3OX8A 1RZIB 2DF3A 3V6OE 3S34L 2WUBH 3CDYA 3L3GB 3SE3A 4JRYD 4U1LB 1EEUA 1S9WB 2CGRL 4LASH 3OAYK 4XMLH 1RZJC 1D9KC 5EPMB 3CSYB 5DZNA 5IHUH 1LD9A 5EU6B 3BDBA 2IPTH 4XP4H 4LU5L 1S5IL 1BD2B 3U1SL 3FQWB 3DX9B 5FECB 3LV3A 4NCC2 1A7RH 1EO5A 2N1KA 4HXAH 3UC0L 5KVEH 3QIBC 5K59F 2C3WA 4GBXB 1JUFA 1HHKA 4MAYA 3D39D 2WLZA 4K3DH 4S1SL 5D2NA 4PJCF 2VMFA 5DUPL 1NCCL 5T3ZH 2Y9RT 3FO1A 1I85A 2AP2A 3GUTB 3QZWG 1MCCA 4KHTH 3NCMA 4QHMB 4S1RH 5I16A 1JPGB 1QBLH 1AXSA 1OF2B 2I07B 1X44A 3JTTA 3L95B 1W72A 1MIML 5F7NC 1AGBA 2HVJB 5CKGA 3HMXA 4M48L 4PG2C 4M8QB 1ZTXL 5BZWB 5B8CB 4FFVC 1D5ZA 1OGAD 5EO1B 3WHE1 1R5IB 2J1KA 3NTCH 4JPVL 4LAQH 3RPIA 3O3AA 3RVWC 1DP0A 1DEDA 1I9EA 1QG3A 1LO4H 4RGOL 2W07A 3VG0H 3O45A 5AZ2L 1WFTA 3NABL 4RBPK 1KIQB 4HIXH 4OAWB 4NO2A 4WO4B 1VACA 5IW6B 5MEND 3QI9D 2I9LB 3ZYOA 5JXED 1DTUA 1JPFA 3V0AC 1TFHA 4IDJL 2BSTB 2IG2H 4LSRH 2DM3A 3K7UA 1OSPL 2P5EB 1RK0B 2O61B 1DBJL 1OTUD 3QDJA 1K8DA 3ES6A 4CADA 4CMMA 5E5MA 2LQRA 4H20L 2VQTA 4Y1AE 5C07A 3QULB 5JHDD 1MFEL 3WN5B 2IADA 3PHOB 5I2IB 1ONQA 5FXCH 1JPST 3BO8B 3GM8A 4JKPH 1EGJL 4JM2B 3TBYA 2X89A 3MNZB 4WFGE 3SDYH 4D0DB 5FO7A 1E27A 1T1XA 1YNTB 4LVHB 5HY9A 4M7ZC 5E2WH 4O2FA 1VKXB 1XF4A 4RGMB 3KYOB 1RUML 1UWGH 2NY3D 1NC4D 2OX5A 2DTML 1VHPA 3DNKA 4XNMB 1AKJA 3D69A 2WAHA 2ED8A 3QJFA 3PXJA 5C0CA 1YUHA 2X4NA 1GJIA 1X7QB 2XWJA 3SCMB 2FZ3B 1BQHG 1HIML 1WLHA 3BH9B 3OR6A 1TIUA 2R0WH 4J4PA 1U8QA 2M1KA 5F7DA 2H3NA 2PCPA 1CFTB 5D2NE 5KS9B 1FG2A 3WNKA 1N0XL 2GK0B 1NANI 1JK8A 4OCRH 1AXTL 1CDCA 2HWZH 1RU9H 4U31A 3TNMB 5KSUA 1RZGA 4ODVL 1H3GA 4J8RA 4KXZH 1FPTL 3B8SA 5HGAA 4PGCB 4OD3L 1B0GB 4ZTOH 3F7VA 5ELIA 3MRMB 3DV6B 1NEZB 3PJSB 5E2VH 5K59E 1OLLA 1IAMA 3UPAA 4PRHA 2J4WL 5DDHA 4HMDA 4ONHA 4PJCE 4XCNA 3BEVA 3DLQR 3MXWL 3I9GH 4HHAB 2BVTA 5CD3B 2VXSH 4UTAL 1AD0B 3CXHJ 3KNBB 4RFNB 5CEXB 2JCCB 5CLTA 4EZMA 1MUJB 3MXVH 1JPSH 5DGQA 3EZ8A 1TPXC 2NXZC 4R26L 2B8OT 1OTSC 5F3HB 2ERJC 4Y2DC 5HJ3A 1TETH 3C08H 5EZIL 1UM4H 2XZQH 4HJGB 3D3VA 3MRKA 3WIIL 4JFPB 4U1MA 2HJKA 2O5ZH 2H6PB 3KPRD 3TNNA 4PUBL 3DYMA 4ZS6D 3B9KA 1UC6A 3IJHB 2DI9A 3SJVA 2CUMA 3CH1B 3G6AA 4JO1H 1WT5A 5F7MC 2FGZA 4JPIB 5CLWA 3MRQA 4D9QD 4QRPD 5CEYB 2NCMA 5EORL 3ZTNH 5C3TA 2LE9A 4B5EA 1HEZA 2XY1A 2ZUVA 3EO1A 4KK5C 3C8HA 4EI5C 2HP4A 4GAYB 2Q8AH 5CIPA 1HNGA 5DJXB 3HZVA 3QT2A 1KLUA 1XCQA 5TF0A 1KJVA 4Z0BL 4YDVB 1A6UH 1Z5LA 2YUXA 4P9HL 4YO0B 5DHYB 3ULVE 3BZDA 5E6IC 1FAIL 3GMNA 1S7WA 4NO0A 5I1DA 3MRIB 5F71A 4RFEB 1MCOL 1V7MH 1AGFA 4BQ9A 4H1LA 1I8MA 3CH8A 5EO9A 4U2YA 1CLZH 1WF5A 4P2OA 3UDWA 4BFIA 3CSBA 1S7UA 3DUHA 4UNTA 4OM1H 4KI5C 4OQ1A 4ZPVA 2ZG3A 4X7DC 2ZOLB 1H5BA 2XWTB 3OTTA 3KAAA 2JK5B 1YNLH 1YEFL 3K1DA 2V7HB 5F7KC 1WVZA 1O7VA 1EO8L 2MCG1 5L8LB 3IFLL 3MR9A 5H94B 5I15H 1BZ9A 3SE4C 4JFOB 2FL5B 1FBIH 3MBXL 1NGPL 3MOBL 3DBXA 3L3DA 3K4DA 3X13B 2NY4C 3C9NB 3CFBA 3J7HA 1D5MA 4WI2A 2BSSB 3U9PL 4CNIA 3EDEA 1OGTA 3QXDB 4OLYH 2AI0H 3GNML 5ENWB 1MWAA 2EKJA 4NKMA 3SGDH 4LCWA 4OIBA 3CU1A 2WBJB 2ZJSL 3FQRA 3U48A 1G7MA 3FTGA 4WJ5B 2PTTA 4QRRA 3HE7D 5CBAB 2VR4A 5IWLC 4OFKA 4JB9H 4NNYB 1QFWH 2W65A 3ALPA 4OKDA 3L3HA 3O0RH 2X4TB 1MY5A 3HAEA 2XT1B 5AG9A 5DXWA 5D5ME 3Q6GL 2VKWA 4I48A 2EO1A 1ZT1B 4NNXB 1P7KB 1UKTA 2DWEA 1JGLH 3QDME 1RZJL 3QEUA 3D3VE 1RZ7H 4DQOH 1MFDH 3BIKA 1YNKL 3DXAB 3E8UH 1OL0A 3LKSA 2EDRA 3TVMC 1VENA 4DCQB 3DRTA 2VIRA 3D25A 3L3JB 4YC2B 3F5WB 4RMRA 5GS1A 2VISB 2IH3A 4H5SB 3TV3L 3PL6B 5IJVA 4LGPB 1IC7L 5EIVA 1BGXH 4RWHA 2R2HB 4C83B 1BQUA 3UZQA 3WIHH 3P4LA 4HKBB 4EBQL 4JO3H 2FATH 3QXAB 4LLWB 2O93L 2OBGA 2GY5A 4R90H 3MUGB 5AYUH 3RWEA 4G6AD 3FOLB 4QHKI 2R29H 4KMTL 3OR7A 1DFBH 4X7SL 3GKWH 5EOCL 1N5YL 2GSGB 5D7KD 2AXJA 4IDLA 2IANB 4M7JL 1S7RB 4BYHA 2JIXD 4LSQL 1RVFL 1J88A 3K2MC 2B1HL 3AXLA 1UH3A 4K7PY 2XG5A 2BNRD 1KLFA 5HGDA 4EUPH 1REIA 4IOFC 4OZFA 4C56E 1MFBH 5D1ZB 1YY9D 5BO1H 4QHUA 5E4EC 4XNXH 3KPNB 2Y7QB 4H8WC 4PPTA 3U2SB 1SEBA 1X5LA 2BVQA 5IROC 4ZSOB 4ZTPL 1FE8L 4XZUA 3ARFC 3FQNB 5HHXH 4GW5A 5T33L 4BM7A 4Y4KD 3MOAH 4C4KT 3BZEB 1BPVA 3VFRB 3H42H 5I1AA 4RA3A 3GIVB 1M05B 3EOTH 1MF2L 3GRWL 1X5FA 2PETA 2G75B 3BFOA 1YEKL 2W9LA 4ODSL 4I0PD 3TFKC 1BFVH 3WDJA 1JHTA 5I19L 2C9AA 3DURA 4L4TA 4LCWE 2HRPL 1CS6A 1DQJB 3MLZH 4OQTH 3V79C 4LSTH 1A7PL 4KTEL 2ED7A 2BNQB 5INCA 5CSGA 4DZ8A 2DQIL 1DQLL 5LCVL 3DOSA 1VFMA 3TA3B 1IGYA 4JFXB 1NC2D 3EOBB 4ISVB 3AS0A 5I74B 1UENA 2VDRL 2Y36H 4X0KA 5I30H 3AVEA 2DLEA 3FN0H 3UYRH 5BZDB 3O6FD 1DBKH 2P5WB 2CMRL 5E2UH 3FT2A 1AR1C 2I24N 2G60H 2X4RA 5F9WB 3MQIA 1IGJA 4S1DC 4DN3H 3LD8B 2EDYA 3ME0A 3HCVA 2V17L 2PXYD 4OM0H 1A3LH 4G8GD 1N64H 2N7AA 4QYOA 3S4SA 4O4YL 1NBZA 4W81A 5IESH 4MJ6B 5IBUG 3BPLC 3VD3A 1JJUA 1Q72L 1HZHL 3UAJC 2E7LC 4I2XE 1CICB 5F96H 2B5IB 4M7KL 2X4PA 4BSJA 1NMCC 1YYLL 4O9HH 4E41D 1ORSB 3RWFB 1Q9KA 3FCTA 3X11B 4XNUH 1W0YT 2HVKB 2G9HB 5CGMA 1ED3B 4JZNA 4OZIF 1JWSB 2CLVA 4N0CC 2BC4A 4RISH 3CU7A 2NTFA 2FGWH 1VB9A 3IAGC 3QCUL 4GRLB 5ADOH 1NBQA 4D3CH 5C0AB 4K2UL 2C26A 3SDAD 1TZIA 1FL5B 4NUGH 4NT6A 4DK3A 2AAVA 4Z95L 4Q6IA 2AK4D 2C4FT 4OZIA 1IQDA 3OJDA 2HT2D 5J7CC 4HC1A 1XFPA 1BP3B 5CJXA 1U3HB 4O02H 2CR3A 5ANMA 3LMJL 2VLKB 3FB5A 5DD5H 5E99H 2V2TB 5FOBA 2VABA 3O41A 5TE6H 3MV7A 5FKPB 5CCKL 2YSSB 5KAQF 4OFYD 3T0ED 3WFBH 4C57C 5DR5L 5T1MB 2QKIA 4FTVB 5ERWB 3IYLW 1CFSA 1KN4H 4L4TE 1ZA3A 4AENA 4JHAH 5FDWB 3EYFB 4HWZB 3VA2C 1MAJA 3RVUC 3LS5L 4D0CB 1UYWL 2BERA 5C0IB 4ZFOB 4ENED 1FO0H 3Q48A 4CKVX 1QZ1A 5E8PA 4BSWB 5I9QC 3IRZA 1IKFL 3L9RA 2AW2A 1FFPB 6FABL 2VXVL 3FFCB 1RJYB 4LBEA 1XT5A 5GGTH 3SDXF 2B39A 1YJDC 4WI9A 3NCCB 4OGAD 4ZUSB 3SDDB 1AO7B 5DGRA 2HFTA 1OAYL 4MA8L 1Q1JH 1OP5K 3L7FB 1FYHB 2XY2A 4JG0H 3L6FB 1UB5A 1ORQB 3C5ZA 4FXKB 1OY3B 1T89A 4HS3B 5IG7B 1NFIA 2NX5D 1QVOB 4Y5VB 5BRZB 3MJ9L 5I8OH 1FVCB 2M2DA 3MYJA 4RAUB 4K55A 4XAKE 4BH8B 3PGDB 1NLBH 4H26B 4G8FB 4I5BA 3DSFH 5HHME 2VLME 4PJAB 3SDXA 1A7OH 4QF1B 3CMGA 1Z9OA 3TZVD 2AJZA 4Q9RL 4A6YA 5E56A 1AIFB 3O4LD 4TPRL 1NGYA 5TGBB 1UB6B 1CI5A 4NZRH 1BQHB 1X5KA 2EE6A 1GRWA 3ARGD 3M8OL 2XA3A 3QISA 2XNAB 2R1YA 1JNLH 4X6EB 5HDBE 4LIQE 5IVZA 3QUMB 1N8ZB 1XCTA 5IOPA 4K71C 3L5XH 3A6CH 3TO2B 3VE0A 4E42A 2APFA 4OCXH 4ZXBB 5IB1A 3RVXD 3CVHH 4FQXB 3FO9B 2R56L 4HXBH 1DVFB 5BOZG 4WW2B 4CVUA 1G6RB 5TH2A 4R0LC 3S5LA 3U4EA 1PG7H 2VQ1A 3WJJA 2GJ6B 2VXUL 3RWIB 3JV6A 4HQQH 5EBLA 3SY0A 3U30B 3WJLA 4MA3A 4OZIE 2A6DB 3L7EA 2WBKA 1L0XA 3U46B 5DMJB 1QRNA 1X6NA 5JW4Q 5J12B 5ANME 1UVQB 4EDWL 3UTSE 1UM6H 1H3TA 3VWJA 2CRMA 3MV7E 3O3DA 4WTWA 2YD1A 4L3EE 4J1UB 5SX4H 5FFLA 4WI8A 3STBA 1F3RB 2UZXB 4KGJA 3L3OB 2B4CH 1S7SA 3L3GA 3LQAC 4U1LA 5D7JD 5IFHH 3F62A 1S9WA 4KUZL 1F4WL 2FJHB 1A7NL 4G6FB 1JPTL 3CSYA 2A83B 4P59H 1QA9A 4PJXB 4YDKH 1BD2A 1J1OL 1W2KT 3FQWA 4WUUB 1PZ5B 4NHCL 3MV8E 1N4XL 3P3YA 1E4KC 3UTZB 3BX7C 4X6CB 2IBGA 3S7GA 3O2VH 1LK3H 1ACYH 5ALBH 1U93B 4GBXA 5B39G 3A67L 1JNHB 5CUSH 4JEGB 4N5EC 5IB3B 3UO1H 2FD6L 4DGIH 1KV3A 2DMKA 5BJTB 4F57H 4JZOA 5DWUL 2EZ0D 4CJ0A 1P5UA 3MGTB 3HG1E 5FYKL 1E4WH 1QFPA 2YPLB 4PRID 3V6OC 3GUTA 3BSZL 4LLQB 1X4XA 2R4SH 1JPGA 1SY6L 12E8H 4YHLL 4AEHL 1OF2A 2I07A 2VZUA 4HUWB 3L95A 2K7PA 2HVJA 3SDXE 3KYKH 1EJ6A 4GRWB 1DJSA 3MV01 4M8QA 4H8WL 3JUYA 5B8CA 3NACH 4JJHA 3TWCH 5EO1A 4IRJC 1R5IA 3IJSB 4WIQA 3HTLX 3FJTA 2H1PH 3W0WB 5F97E 1ZANL 4O58L 1TNNA 5KN5A 3LH2L 1GGIL 3H0TB 3QUKA 1JCKA 4KGLA 2IFFH 5E1HB 1FRGL 2AJYL 1AY1L 1KIQA 4WO4A 4XPHH 5IW6A 2LTQC 4MAUH 4WWKD 3EJJX 2I9LA 1MY7A 4R9HA 5DZOA 1QNZL 4JGUA 3BPNC 4LFHD 4F15B 2BSTA 4UT6L 2MQ3A 4AK1A 2XKSA 2P5EA 1RK0A 5I76B 2NY1C 2X70A 4X99B 1RAMA 1N59B 2CKBL 5IB2A 2V5MA 1I3RB 3ZE0F 1BREA 2B1AH 5SWZB 3P0YL 1IC4L 3QEQD 1IM9A 5DRZB 3QULA 2AJSL 1KCRH 1QRNE 1QOKA 3WN5A 3F7PC 3LSOB 5I2IA 2ADIB 2DLFH 1YYMH 3NFPB 4GKOA 2NY7H 5IT2H 3BO8A 1T5WB 3MRDB 4AEIL 2VDQL 3H7LA 4D0DA 3FRUB 1NCAL 5I1IH 3LCYA 4HH8A 2OZ4A 3G9VA 1YNTA 4EXKA 2CRYA 4WFFD 4UNVA 4YUEH 1T1ZB 5J1AB 4RWYH 1VKXA 7FABH 2JB6B 2DBJA 2E9BA 2OQJA 3WLBB 3O8XB 5EC2B 5KS9F 3BYTA 4JFYB 5HDOA 3VFGL 4XPTL 2MKWA 2NXYC 4AH2B 5I1LA 1VADB 3SGJC 4LLYA 1SBSH 2QV2A 3U0PB 2VDNH 2DMCA 4Z7WB 4ZS7H 1X7QA 1KG0B 1UFUA 4NIKB 3SCMA 3VRLF 2FZ3A 4JREC 5GISH 5KANG 2GAZB 5DEFB 3BH9A 5ESVB 5FM5O 1FIGL 8FABB 2FWOB 4D94A 4R2GB 4S1SH 1IGIH 1CE1L 3CFCH 1CFTA 4OCNC 3AS3A 1BAFL 5KS9A 2DQJL 1OWWA 3OKKB 3EJZD 3RWHB 2GK0A 1JMXA 3GMPA 4Y4HB 3FB6B 2QQKH 4UV7L 3TP4A 5DJ2B 4H0HB 1ITCA 2YUZA 4NQCD 2XA8H 2OTWB 2VN7A 3QCVL 3RBGA 3TNMA 1J86A 3HE6C 2BRRL 4HMCA 4GUPB 3G5VB 4PGCA 4W6YB 5DK2B 1B0GA 3RGVC 2CKNA 3DV6A 4ZOBA 1NEZA 3QDGB 3RL2B 5C0GB 1BFTA 4EN3A 2VXQH 5EZOH 1U8HA 1WITA 3QIWD 2X44D 4JPVH 4KJWD 4MGXA 4Q97A 4NO5B 1UH4A 2Y72A 1YMMB 1FORL 5CD3A 2OCFD 1KJ3L 1OWRM 2OJZL 4MAYC 1Y0LB 1T2JA 2DYPD 3KNBA 5AZ2H 2JCCA 4MMZC 5GHWL 4YHOH 4XB7A 1MUJA 1N6QH 4PGDB 4LLAA 3HFMH 1KELL 5C2BL 1SMAA 3KLAB 4FQ2H 5AYQA 2HA1A 5I0ZA 4RMUA 2DQGL 5L2KB 1GXEA 4JY4B 3F6LA 2JTDA 4HJGA 4KTDL 1NGZB 4U1KB 1OSPH 1A4JB 4DEPC 3WV0A 3ZDYE 1OD7A 4JFPA 2JB5H 4WFHD 2P5EE 1PFCA 4YFDB 1S3KL 4KJPC 1CF8L 4ODTL 4AL8L 4KY1H 3GK8H 3IJHA 4NKDB 1HKLL 4N8CL 1DQDL 1S7VB 3CH1A 2BZDA 1YJDL 4HJ0D 5LJYH 1LDPL 1KJ2H 1MFEH 4JAMB 4JPIA 1OAQH 2WP3T 4P9ML 5CEYA 4YFLF 3ZZ1A 4PBWD 3C5JB 3P30H 4P2YA 2VTFA 1CZ8H 3CX5J 4Y89A 2UYLB 3QUXB 2PF6A 4GAYA 4MX7A 3K80A 5DJXA 4UT9H 2W0LA 4YDVA 4J12A 4YO0A 5DHYA 1WIOA 5K9QG 1QYGH 4Q9CA 5LBSL 2GTWB 1T6VN 5E2JA 2AQ1A 2I9TB 1G9NC 3MRIA 1PAMA 2NPLX 4GG6F 4RFEA 4JANB 1H3PL 2VWEE 1JF1B 3QXUA 2ESVD 1JGDB 4F3FB 4U6VL 2ZOLA 2XWTA 2X9XA 4I3GA 2JK5A 1N0XH 2PNDA 2V7HA 3QWOB 1MOEA 2GW5A 1QFUH 4XBPA 3RVVC 4YHZL 4GG6A 2AJ3B 5H94A 4EUPG 3SPVB 2X1WL 5C9JB 4JFOA 2FL5A 1O7SA 3IDNB 4ZYKB 3O9WD 5F89B 1U36A 4QOKB 2YA2A 4GKNB 3C9NA 3VRLE 3B5HA 2NY2B 2FB4L 4ODXA 5ICZB 1NCBL 1PLGH 2BSSA 2PO6B 4NRZA 3QXDA 5ENWA 4CDHA 1BZ7B 5DVLA 1U8KB 4KVCL 1OGAE 5IGXH 3IAPA 1I75A 2WBJA 4J4PC 5DJ0B 4I3RH 2E27H 3TT3L 4BFGA 1J18A 1BEYL 1KGCD 4WJ5A 4Y4FD 3TBWB 1CL7I 5HXMA 4JQVA 5CBAA 1CQKA 4LDLB 1T6WA 4X6DE 4NNYA 3T4AB 1FNSL 1P1ZB 2X4TA 4NZJA 4ORGB 1UWXK 3MV11 5E6YA 1JZ7A 3EDDA 4P4KB 5EZIH 1KB5L 3GJEB 2CRIA 5DJDB 2RAMA 2MSPA 5E9DD 3LQAL 4M93B 1DBBH 2FIRT 1ZT1A 3N85H 4NNXA 1P7KA 2Y4SA 1JZ4A 1XF2B 1HILB 2D03H 2DD8L 5CZVH 1IE5A 3WIIH 3MNVB 3DXAA 2SEBA 3GSNB 4MYWB 1IRAY 4QWWC 3TO4A 4NN6C 4MXWL 3DARA 3V6FA 1JHLL 4ZMAT 4DCQA 2J6EH 2GJJA 3AUVA 2NMSA 3B83A 3VD9A 5GRYA 3F5WA 2FX9L 2EYSB 2VISA 5HYFA 3PL6A 4JCMA 3MJGX 4PJHB 3WFHB 4F7TB 4JFZH 2R2HA 4C83A 4OV5B 5T1KB 3T77B 4MQ7A 5K9JL 5T5NG 1ROWA 2AXFA 4NQEB 1JHKL 1KXQE 1MFAH 1UA6L 5F44A 4ZFZB 1NPUA 3QEHB 3QXAA 4LLWA 4U0RB 2OL3H 4S10A 4L4VB 3FOLA 3B9KC 3QQNA 5MHSE 3EYOB 3VFOB 2GSGA 1A1MB 1CGSH 2Q3AA 3CZFA 3MBEB 3ZT7A 2IANA 2VSDA 1S7RA 5IHZB 3C6LB 5JOEA 3T4YB 1QSEB 1BIHA 2EO9A 5E08H 3SKJL 4JFEB 2QQLL 1HI6B 4JFDD 3G5YB 4CBPA 5F1IA 3HNVH 1OSZB 3KPNA 2H41A 2Y7QA 3LDBC 3U2SA 4F58L 1R3IL 1ES0A 1M1SA 3QFDB 2ZUXA 5C3LD 4GG6E 3MOBH 3IFOB 4GSDH 1J8HE 2B2XL 3RUGB 5C1MB 2C1PA 1CU4L 3VCLB 3BZEA 2X1QA 3MJ6A 3VFRA 4URTB 1MCWM 5DI8A 3ARED 4M02A 5C0JB 1M05A 2G75A 5D8JH 1P7QB 4XCCL 2ZNWA 3CLEL 3UDWC 4LL9A 5J9PB 2E7HA 1UM5H 4HS6A 4MJIB 5C08D 1KPUB 1LHZA 4X9GA 3V0WH 2R0ZL 4MA7H 1R6VA 1H5BC 2YKLL 3NMEA 4IMKA 1U8JB 2UWEF 4PS4L 5GJTL 5FM8A 2FDBP 2P44B 4JFXA 3EOBA 3EW3B 4ISVA 3D9AH 1VGEL 4KRPC 5JW4R 1C1EH 3V4VH 2VLJD 5SV4A 2EH7H 3VI3F 2HLFD 4NQDA 4JDTH 2VAAB 4LDEB 3ARPA 2DDQH 1KULA 5TPWH 1QFHA 2UWEA 4HMEA 2Z31A 5DEZA 1KYOJ 1M4KA 1XF5B 1X4YA 1ZLWK 1OAZH 1YC8A 3TH3T 3JVGA 5CINH 4MJ6A 4QTHA 2Z93B 3MV9D 3NAAL 1ZHNB 1T7YA 5E8OB 5GGVL 5C09B 5I1EH 4LPYA 4L5FL 4P48A 1I7RB 3LRSA 4EBQH 5C0DB 1ORSA 5HYJD 4PGEA 5HHOD 3RWFA 1N26A 3X11A 3CFEB 5D1QA 1EXUA 5FV1L 4M4PA 2HVKA 5TQ2H 2G9HA 4OGZA 4YE4H 1EEYB 2V5TA 4D9LH 1JWSA 1U8OA 5JR1L 2X5PA 3EOAB 3KPLB 4WFED 4WUKL 4MNGB 2IANE 3UPRB 4GRLA 2C7UB 3D39B 4ZUTB 5MEQB 1FZMB 5C0AA 1QLFB 5HYQB 3I6GB 5GS1C 1FL5A 1UXSB 2MTPA 5DHVH 3UEZA 1MREH 4GXVL 2OR9H 1A6AA 3BUTA 3ULSB 1ZS8B 1EJOH 4Y2DD 2GITB 1GH7A 3EOYG 5I6XC 1ZT4B 5E7BA 1U3HA 4PJFB 4UDUA 4N8VG 1VFAA 2VLKA 2V2TA 1OAUL 5DD1L 4G9FD 4P2RD 2YSSA 2DQCH 3CIQA 5D9SA 3QHZH 4QRTA 3C2AL 1G7PA 5T1MA 5JO5A 3C09B 3ULUD 3QFJD 5ERWA 4LSUL 5HTSA 3DUSB 5FDWA 4KTEH 4F80A 3AB0B 3EYFA 5MENB 3QI9B 4HT1H 5AZEL 1FNHA 1ZVYA 4D0CA 1SYVB 2DQIH 1WQVT 2D7TL 5C0IA 3KPSA 4ZFOA 4OLVL 2PW1B 2QJDA 2R4RH 4EI5D 2EXYC 4BSWA 3TYFA 1HOCB 1FFPA 4ZD3L 2XN9A 3FFCA 3H9SD 2Q8BL 3NPSC 5JXAH 4PJAF 1URLA 2XKUA 1UT9A 1C5CH 3SDDA 2CO6B 1MQKH 1P84J 4XVSH 3L7FA 3VXSD 1NDGB 2CK0H 1RSFA 3L6FA 5E6ID 4NQDE 2AKRB 1G9NL 3SQOL 1S9VA 3WFCH 1P7HL 2E3VA 3KWWB 1ORQA 4FXKA 5JHDB 2F54B 3PGCB 2DQHL 2D31A 5IG7A 1BQLL 3V2AR 1QVOA 2MJWA 4Y5VA 5BRZA 1DCLA 4HGWB 2UWEE 3F58H 2P42B 4CRPA 4RAUA 3DTXB 3L5HA 4NGHH 3VFPB 3SGEI 4KI5D 3PGDA 4H26A 4G8FA 4PJAA 2FRGP 3IFNH 3DSNA 4QF1A 4OTXH 5F21B 2DOCA 1AIFA 5ISZE 5EBMB 1ZLVK 3VI3E 1UG9A 1B90A 1UB6A 4OLUH 5CS7A 1LWRA 4WW2F 4LCIH 1NC4B 5DJAB 4ZAKD 1CDGA 1P4BL 4X6EA 1XR8B 2NY4D 3GJFK 3QUMA 1N8ZA 3HUJF 2XTLA 4X8JB 1S9XB 5B21A 3TO2A 1Z0MA 4R97C 3JWNC 3EFDH 2OMNA 4ZXBA 3T2NL 1TJIH 5TQ0H 5ALCL 5DFTA 5DJYB 3R0MA 4FQXA 3FO9A 4M03A 3QH3B 1Y6NR 2VDKH 2WWMD 5F8QC 3D1MC 4QRQB 1BBDH 1DVFA 4WW2A 1G6RA 4ZFGH 4KQ3H 3V9FA 5HYEA 3CFDB 4HIIB 4OT1L 2GJ6A 3BQUD 3K81A 1WBXB 3HUJA 1EO7A 3RWIA 5LWYH 3ARWA 1EHAA 1IJ9A 1TVHB 4PJ7B 3U46A 5IEKB 1T7ZA 4YEEA 4F8QA 1VPOH 2BJML 1HHHB 5ID0B 2ICWI 2BHYA 2E9WA 5T1LA 3W9DB 3KXFD 2YR3A 3EYSH 4KKAC 4FQIL 2P7TB 1R3KB 1UVQA 3P73B 3U0TB 3VGAB 3ZE1F 4J3OC 3T08A 3ULUH 5MI0C 3OJMB 1CGWA 3UBXG 4TVSa 3TEUA 4UBDD 3NFNB 1L7TL 4J1UA 5E8DH 5C71A 3I2CL 2AJVL 3L3OA 3UMTA 2JJTC 4Q9QH 3CGTA 3WKMH 5F7WC 3WMSA 4Q6IC 4QTIL 4WW1A 4ZO9A 3SQBA 2CDFA 4LVOB 2A83A 2J2ZA 3KPSE 4PJXA 3LKQA 5DYOB 1JN6B 1AI1L 1IARB 2N4IA 2OR8A 1WWBX 4WUUA 6FABH 5FUCE 4WGWB 3KVQA 3UTZA 3KPRB 2XN9E 4ZG1A 3OJVC 1GGCL 2MQ0A 4MA8H 3LRGA 1WZ1L 2OP4L 3LB6C 4GRWF 4JFFD 1A1NB 3GGWB 1JNHA 3CX5K 4QKXB 4Z76B 1FC1A 5IB3A 1NFDE 1XF3A 5BJTA 3PV7A 4JGJA 3RBSA 3KPOB 1AHWB 2VSCA 2YPLA 4QRPB 4LLQA 3PV6B 3ILQD 1NCWH 4G8GE 3V52H 1ZOXA 5ACLA 4HUWA 4IOFD 1OOAA 4U1HB 5I17B 1GC1H 4Z7VF 1GCFA 2YA1A 4I4WB 1GYAA 2VDPH 3ARSA 4POZD 5EFIB 1F4HA 3KLHD 1FN4B 5FYLL 1NUFA 1CL7L 1NGQH 3IJSA 3SBWA 4XTRC 3W0WA 1CLOL 2VO5A 3AY4A 3QCTL 5ILTH 3SE9L 4OI7A 3NGBC 3EDKA 3H0TA 4WU5B 5JW4M 3C5ZC 4R8WH 2F53B 3PWNB 4CVXB 3GSQB 3S98A 4YDJB 4YHML 1R3JA 5DUBB 4AG4L 5IB5B 3EYQD 4EUPB 2VE6B 4MCYB 1FL3A 3ARBD 5JQ6L 1HYSC 4MQXC 4H88H 2G5RA 1T80A 5LXGL 2YBRB 4QXGL 5I76A 2AJXL 2VXUH 4X99A 3NCJL 3OAUH 1N59A 4U1JA 1MHPH 1KCUH 4LFHG 1RUAH 1I3RA 4MLIA 1PZUB 3HUJE 2IMNA 2Y07H 4JPKH 3P40A 4K9EC 3B2UD 5SWZA 3HB3C 4WHDA 4HWNA 3AS2A 3V95A 5A3IC 4FABL 4JZJC 1IL1B 3LSOA 4HF5L 2BOCB 1MWAL 2ADIA 1BECA 1H15B 1ZV5A 3NFPA 4P3CH 4EDWH 1WWAX 3C60D 1T5WA 3MRDA 4S1DD 2KKQA 4TOYH 3MROB 3HE7B 5DFWH 3ZYIA 2A6IB 2EDJA 2DIAA 1IFHL 1T1ZA 1DL7H 5J1AA 1HDMA 2JB6A 1EH9A 1S9YB 4F37K 3QWRD 4PJ5A 2CDGB 3WLBA 3WJJC 1IEBA 1RUPH 1A7NH 1GPOL 1JPTH 4JFYA 4AH2A 4Y8AA 1A14L 1VADA 3OXSB 4PRAB 3U0PA 1FYTA 4Z7WA 4NJ9H 1KG0A 1EHXA 4YK4B 1MJUL 4LSPH 3ZE1E 1RZKC 3N9GL 3P0VL 4XVJH 3OAYH 3I3BA 5ESVA 3KS0H 5MEOB 2FWOA 2GT9A 1ZXQA 2KL6A 3BAEL 4HKXB 4X80H 4M6OL 4EQ3A 3VWJC 5DWUH 1NAMH 2NW3B 5JUEH 4OF8A 1OAXL 3OKKA 3RWHA 4YWGL 3FB6A 5FYJD 5CEZL 2YPLE 5DJ2A 3BZFB 1JF5A 4TSCH 2OTWA 3OAZH 2CJUL 5JIKA 2X4OB 2CLZB 3NPZB 2XIDA 3G5VA 4GUPA 4LSSL 3HR5B 4XXDB 3E3QE 3MODH 1HSBA 1I9IL 3QDGA 4OI9A 3RL2A 4ELMF 3OHXB 4KK9D 3RGHA 4GRWE 2V2WB 2HJLA 2I26N 1G7LB 4R3SB 3T3PE 5KVGL 1YMMA 3VXTB 4GBXC 1JRHI 1Y0LA 2JIXB 5DMIL 3T1WA 2KQNA 5TE7L 4PGDA 4KJYB 1QHOA 1INEL 2UVEA 1S5HB 3EYUH 2BNRB 2OXGA 4HWEL 4I3SL 4Z7VE 4ELMA 2Z35B 3INUL 5T5FH 2Z0BA 3VD5A 4UT6H 1UCBL 5L2KA 1JYNA 4JY4A 4RBPH 4U1KA 4X6FB 1A4JA 3C2SA 4FFZH 3GHBH 4KI1A 5IMMB 5HI3C 4YGVB 4JDVA 5B8CC 1EV2E 3D0VB 1CDBA 4YHYB 5FV2A 4MNQD 5KG9B 4NKDA 1S7VA 2NR6C 4AZ8A 3PGFL 2DQDL 3PQYE 4JAMA 25C8L 1XH3B 1MHEB 1C5BL 4LLDA 5EOTB 2N56A 1JZ6A 4YR6B 5GSRB 2R0LL 3C5JA 2F9BT 5GZNC 3EYVB 1UJ3B 3ALWA 3QUXA 2GJZB 1CD1B 3BKML 4GW1B 3QNYA 2HTKD 3ZHKA 3T09A 5B38A 1DR9A 3CXDH 3RTQD 1L6XA 5EZJB 4WWID 1FO0B 3QQ4A 4NQXB 1LE5B 3KPMB 4O5LL 4PJ5E 5CJOH 4XPTH 4Y88A 1SJEB 5JLZA 1OM3L 3RWJA 2GTWA 2AGJH 4GG8B 5E5UB 3UX9B 5L6YH 1ITBB 3Q6FB 4X5LA 1KYOK 2DLGA 2ENSA 1FYTE 5IK3A 1L0YA 1ND0B 4JANA 5EG6C 2FJGB 1NKRA 2RGSA 1JF1A 3WN5C 5I71C 1NQBA 1RIHH 1DBAH 1EA9C 4PJDB 2COQA 2IALA 1CE1H 1JGDA 4JM2C 4F3FA 1BAFH 4PJIB 4KRLB 1QKZH 3GSRA 2DQJH 2VZ3A 1YEGH 4AIZB 5FYJH 3QWOA 1H0DB 4UV7H 4LVHC 4PRIE 1A2YB 2YMXH 1Q0YH 2AJ3A 4RGMC 3KYMA 3LHPH 5C9JA 3HI5L 3IDNA 4ZYKA 3WL9B 3C8KB 2BRRH 2VITB 4QOKA 5EWIH 4GKNA 3BHBB 4FQJL 3GHEL 2NY0D 4QRUB 5D71H 1WZKA 2PO6A 3OMZA 1CLYL 2KZWA 2WSKA 3SCMC 1UCTA 1BZ7A 1R0AL 2QQNL 2IJ0C 2OTUA 4BKLB 2LAGB 3NCEB 1NH6A 4JVPA 3G04A 5L8JB 4W70A 1QBMH 2MKLC 4KJQD 1D5XA 2G2RB 3T4AA 4UV4L 1KELH 4B53A 3CVHB 3SDAB 5HVWA 4XP5L 1MCJA 3WDHA 4L9DA 4P4KA 4YAQB 1II4E 3RY5A 3GJEA 5DJDA 5IJKA 1H8SA 4UIMB 4ELME 3WFEH 2AK4B 4ETQB 1XF2A 3AS1A 1A9BB 4FQLL 1HILA 1QSFD 5L2KE 1D5IH 2UV3A 2YD5A 4X5XB 4XP1H 3MNVA 5JIPA 4ODWA 1T66C 1IKNA 2MOVA 5IBTH 1FZKB 5DK3A 2FYYB 3KR3H 1WAAF 1MI5D 5CZXC 3TM6A 1W0WB 4RFNC 4ETYA 3RU8L 4WI4A 1RIUH 4KMLB 1O0VA 2EYSA 3QNZB 4J2XA 4ELKB 1XGRA 3WFHA 4F7TA 2WZPD 4TNWK 4JR9L 3ZL4H 5I8KL 5GS0C 3MZGB 4NQEA 3P9MB 4HK3N 4YBHA 3O4OB 1P84K 2HKHL 1Y18A 4HCRH 3FO2B 4MB3A 1BOGB 4ALAL 4GRMA 1GAFH 5DQ9B 4NC0B 3EYOA 3PHSA 3VFOA 2GIYA 1A6TB 3MBEA 4JY5L 5IHZA 3QHFL 1AJ7L 1ULVA 3IDGB 3T4YA 1QSEA 3MRNB 3VRJB 4IRJD 2NY5H 2BNUA 2WIMA 3X17A 4YHKH 1H3XA 5BMFH 2UY6A 3S96B 2HT3C 4WTXA 4LCCA 1TNMA 5F9AC 1IT9L 4WU7B 2NX5B 2VC2L 1ZLSH 4JFEA 1G7JB 2B0SH 1HI6A 3F7YB 5ACMA 4WI5A 3G5YA 1D6VH 5HVFB 1OSZA 1G0YR 1OB1B 3HI6H 4WCYH 4YHZH 2HH0L 2XXCB 3TZVB 3U7WL 2EEAA 3VW3H 3RUGA 2BRQA 5ID1B 4A6YL 3O4LB 3L5WA 3VCLA 4NWUH 2F5AL 4QOKE 4D2NA 1NCBH 2D7PA 4HG4J 3ILPA 1AD9A 3A6BL 4BH7B 4X4YB 3ARGB 5C0JA 4XMKL 4K9EL 3I02A 1VEOA 4RRPA 3MLRL 1P7QA 1BOYA 4NHUB 5IF0B 5DVNA 5J9PA 3D18B 3C87A 1KPUA 4Z8FL 5IVOA 4NN5B 3C8DA 4M7LT 3WNLA 4UILL 3CFIC 4GQ9L 1A6ZB 5HD8D 3BN9C 3ZHLA 3P9WB 5IM7A 4N0UB 3OB0H 5AWNL 1FFNB 1HINL 1MIEL 1JZ3A 1AGCB 1FGVL 5FF6A 3LQAH 5E5RB 1DLFH 3BD5A 3BDYH 4KC3B 2NYYC 1BVKB 5J89A 1CLCA 3MGOA 4L29A 2VAAA 5HHQA 2AABL 4XXCA 4Y1AD 5KVMC 3QP3A 3MRPB 2WBJC 5EUKA 3UBXB 1M6OB 2CSPA 2DQTH 4LSVL 3MYZA 3SOBL 1RZKL 1XF5A 4JQVC 2PYEE 1V3KA 3QIBA 4P4RB 1RFDL 1YQVH 2L7JA 3JSSA 4F33B 3H9HB 1TCRA 4NSKA 4WY7H 4YIQB 2CIKB 1FNEB 4U1NB 3KG5A 1ZHNA 2HKFH 3HC3H 4OZGE 5E8OA 5EU3B 5C09A 1UWEL 5FYJU 2FH6A 1YN6B 4XGZA 5CILH 5C0DA 5F9JB 2VH5L 4IIQB 5CJQL 1YEEL 3X12B 5CJ5A 1YZZA 2FO4B 3DO3A 1FGNL 4XBEL 1WAAE 3MTRA 4WEBL 2ZNXA 4PG2A 1BBJB 5BVPL 5EOCJ 3EOAA 3KPLA 3UJTH 4CW1B 5DVKA 4RZCB 1LEIB 1B6UA 4KKCC 5EA0H 2C7UA 3D39A 4ZUTA 2VDLH 4YC2C 5MEQA 1F90H 1CGXA 1A7QL 2F5BL 2ZZUT 3ROOB 1QLFA 5DO2C 1M71B 3I6GA 5HYQA 4GT7A 1UXSA 3ARUA 4FQQB 3BP4B 3PL6C 4I0CC 4LSDA 4C4KO 4M8VA 4TNVK 3ZSTA 2P8MA 3N50A 3QXVA 4J7RA 3S37X 2YWYA 1LO3H 1I1AB 2QHLA 4F58H 3ULSA 1ZS8A 1BMGA 3NCYS 4A2LA 2DQEH 1GHFH 4JRXE 1ZT4A 5DUML 4PJFA 1A9EB 4P5MA 3QPQC 4LQFL 1GGBL 4OFVA 4OB5H 4F9LA 3MLYH 5BS0E 3NA4A 3CUPB 3CCHB 3GRWA 3DECA 1U8IA 5CAYB 3T0VA 1EFXD 5ICXA 3DUSA 2FR4B 4UTBL 3WXWH 5KW9L 2A1WL 2EDFA 5MENA 3QI9A 4G3YL 4QY8B 2UY7A 4HEPG 5D1ZC 4W4OC 5KJRH 2AEQH 4JRWA 2PW1A 4G6KH 1SYSB 1HOCA 1VGEH 2L7UA 2VXTH 3ARYA 4PB0L 1VDGA 3FKUS 3QIUB 4NN7B 3FO0H 5I1HL 2DS4A 1M7DA 3U0WH 3QEQB 4KZDL 2FX7L 3KWWA 5JHDA 2F54A 5MP6H 5C07D 1KJ2B 5H35B 5B4MD 2GEEA 5FUZL 3FQTB 3DTXA 5C6TL 2BY3A 4RMTA 4R7DA 1TVBB 4IMKC 3VFPA 1NCTA 3WFZA 1RD6A 2AEPL 1J1XL 5J3HC 1IC1A 2OZ4L 3VGDA 5D72L 3TA3C 5C09E 4LHQB 5I74C 2Z91B 1JRHL 1YMHB 5DJAA 2AV7B 1IGCH 4CGTA 2ITDB 3EZJB 5KVDL 1XR8A 3F8UB 2ZPKH 3RGVB 1PBYA 3I85A 4X8JA 5F9WC 1A6PA 4OD1L 1IZJA 1S9XA 1Z2KA 3LD8C 4PIRF 4OBSA 1A47A 3O2WL 3ZLQC 2O5YH 1D7FA 5DJYA 4L8BB 1NSNL 3QH3A 4ODUA 4QRQA 1F42A 3DHJA 5F1OB 3FZUC 3VXQB 2V5RA 4I77L 4U6TA 1CICC 4TYUA 5IW3A 3CFDA 1A21A 2B5IC 4HIIA 4NQCB 1LDSA 1WBXA 1GZQA 4MVBC 5IVXB 4U6XB 1VFBB 1TVHA 1W72H 4PJ7A 5IEKA 2DWDB 5E95B 1A6WL 4XVTL 4DTGH 2VZOA 4ONOA 3HMXH 1HHHA 2IGFH 4XH2B 5ID0A 1IBGL 3MLSL 3S37L 4YDIH 3EJYC 5EOQL 1OAUH 3QIWB 2P7TA 4PP2B 4QEGA 3P73A 5F6HJ 2APXA 4GRLC 3C2AH 1EMTL 4YFEA 2DYPB 5T3XL 5FGBA 4OJFH 3D6GA 3R8BB 3NFNA 3BEWB 5C08E 2AS5M 3ARZA 4LOUD 2XACC 3OF6D 4Y19A 5H37G 2D7TH 3BRFA 1CXFA 1IC5L 2ITCA 5DYOA 3UCRA 1JN6A 5GS0L 1U8MB 5FUOL 1NFKA 3W9EB 4DOHB 1U3HC 5GZOD 2QHRL 3KPRA 5E6ZA 3D3VD 4JPWL 3B5TA 4LF3B 1KFAL 5C0FB 2LU7A 1G9NH 4Z76A 3RA7L 4W4NA 3HLAA 2ZG2A 5DURD 1CTOA 1K4CA 3KPOA 1AHWA 2F54E 5T1DL 1J1PH 1N6UA 4BA8A 4QRPA 2QTEA 3D85D 5HHNB 4M62H 4M6NH 4XX1G 5C7XH 2XZZA 3GSUB 2H8PA 3FOMB 4Z6AT 4U1HA 4JHWH 5I17A 1JGVL 4I4WA 2DB8A 2ARJB 5IFAH 4RMQA 4DKFL 2BMKB 1FN4A 2YK1L 4M6MH 4TVPL 3WD5L 1XGYH 4K3GA 1NL0L 3ULVH 2OL3B 3SDDC 2XYCA 3GDBA 1F4YH 3OKDB 1F5WA 4NO0D 2XZAL 1UJTA 2F53A 1C16A 3PWNA 4CVXA 1KPVB 2Y5TB 1EZVX 4J6RL 4WTZA 4Y5VC 2A9NL 3T2NH 3ZDZF 1ZSDB 1A1OB 2JLLA 4P2OD 5DUBA 4XWOC 1F4XL 5IB5A 1QHPA 4U6YB 2VE6A 4M7LL 4MCYA 4XPAH 5IWLA 3D48R 4I9WE 2YBRA 4TSAH 3PWUB 2F58L 1VERA 2W91A 2W9EL 2PUQT 1FZOB 3O9WB 2KQMA 5D7LB 4ACPA 3VGBA 1DUZB 4HGMA 4JG1L 1G7QB 1U8LB 2Q7YA 2P47B 4N9GB 3UTTE 1IL1A 1A5FL 2BOCA 3LN4A 4XNQB 3BZ4B 1A8JH 2DLTA 4UDTA 4G9FE 3ROLA 4ZXBC 4LCWD 4Y4FB 3MROA 4PY7B 4FQXC 3HE7A 2A6IA 4RNRB 5GRZA 1DSFH 2ATPB 1DVFC 4WW2C 1U95B 4XCFH 2P49B 1S9YA 4QTIH 2CDGA 3B3IB 9CGTA 4Y19E 4WI6A 1S78D 2FHFA 3L1OH 4U33A 5C0NC 4PLOB 3U30C 1T03L 1LP9B 3OXSA 5E9DB 1EHLH 4JQXA 4PRAA 4HPYH 2PTUA 4W68A 5TE4L 3GSOB 4PP1C 4P23D 5GJSL 5J12C 3TIDA 4GAFB 1UZ8B 1I8LA 5H2BB 1JYWA 2X9WA 3GMRB 4HKXA 3VXSE 1JZ5A 2JJVA 3DGGB 1AC6A 4XI5D 5IMLB 1CDUA 1F2XK 4NFDA 1NGWB 2NW3A 1AP2B 4XNZB 2FEDC 1QUNA 3GI9L 1DE4B 4QXUH 1G7HB 2ED9A 4UNUA 6CGTA 4DJMA 3BZFA 1LEKA 3UPCA 1MCQA 2G5BA 3MCG1 5HDQH 1OP3K 2K9UA 5DLML 2X4OA 1XGTB 4OSUH 1U6AH 2CLZA 4XXDA 3HR5A 5DVOA 3IXTB 4L9LB 4LLMA 4R4BB 2OM5A 3S88H 2V2WA 3PDDA 5IQ9B 5IV2B 4WVRA 4FG6C 4R3SA 1TXKA 2BP3A 3I6KB 3GB7B 4YXLL 4YHNB 3IVKB 3QRGH 4LKXB 2JIXA 4PB9L 1F58L 3GO1H 2J7LA 4MQSB 4KJYA 1S5HA 3MOQA 2BNRA 4RDQF 1TTGA 1BQSA 4JE4B 3RWDB 4AG4H 2Z35A 3IFPA 4JFDB 1H3WM 4KKBC 2DIBA 5F9DC 5HI4C 5DHVB 4XWGL 4HG4K 4C54A 2EC9U 5LXGH 3PNWA 5IMMA 2BOBB 3ZDXE 4YGVA 5EU4A 3ARVA 2ZCLH 3FB8B 4EJ1C 5I1GL 1E4XH 4HV8B 2X6MA 5KG9A 3SBWC 3S36H 1MCWW 3AREB 4PRNB 5DMKB 3VWKB 2DI8A 1XH3A 3ZDZE 1MHEA 2VUYA 3BWUC 5EOTA 3JBG7 4G8EB 4YR6A 2ZWLT 3DETC 1UJ3A 2LFGA 4D0BB 5L88L 2GJZA 1MSPA 4L4TD 4ZUVB 4GW1A 3LOWA 3VFTA 5ITBH 2BY1A 2OJEB 5DQDH 3GI8L 5ITFB 1T3FB 1YEJL 2WWKO 4F15C 5I75B 4QHKJ 4PRDA 4RFOL 1IGFH 4PLJC 3VFMB 5E8NB 1GZPB 5EZJA 3BKJL 4RGNB 3MRCB 4PJIF 4NQXA 1GPOH 1LE5A 3HAEH 3GBMH 3KPMA 4HPOL 1G9MC 4G5ZL 4QHLB 1A14H 3STZB 1SJEA 4MB5A 5DA4A 3HA0A 3TBSB 3WIFB 5D1XD 2VLJB 3B2VL 2WW8A 2B20A 2FJGA 3OKLA 3V0VA 3BAEH 4G6JL 4Z5RB 3I3EA 4PJDA 4M43H 5KTEH 3O6MH 4XX1E 2BSRA 4S1QH 4PJIA 4PR5A 3WNPA 2ZUWA 4AIZA 4DW2L 4F2MA 1H0DA 4XAKD 5E00B 1A2YA 1NCDH 5FYKE 3FT4B 3MV9B 2AK1L 5HHMD 1CDYA 2CJUH 2VLMD 2XQBH 1CK0H 1JYXA 3ZKMC 4BQCA 3O8XC 1M7IA 1OQXA 3WL9A 1OPGH 3C8KA 4P2CG 3BHBA 5HYJB 1Z3GH 3M17B 1EEZB 4QRUA 4Z7UB 3HNTL 4P49A 1MNUH 2ZCKL 4M1GH 2Z8RA 4YDLB 5HHVH 4HUVB 4DKEL 2BVEA 3BGAA 1KN2L 4BKLA 3RKPA 4CU8A 3UTOA 3KPQB 4E0RB 4R2GC 4M6AA 4DGYH 3HMWL 1IAOA 4ONGH 2EIEA 4LLVB 4Y4HC 5CD5C 5BV7H 3EGSB 2P8PB 4Y7MA 3NH7H 3SDAA 3H3PH 4NNPH 2XQYG 2BVOB 4JHBA 4YAQA 3LEYL 3VXRE 4OZFH 2CUHA 3CLFL 4UIMA 1EHNA 3VH8G 4YX2H 4ETQA 3CVIL 1A9BA 1EBAA 3K1KC 2WLYA 5IQ7H 4UU9B 1CXHA 3ECBB 3O6KH 1FZKA 1SMOA 2W38A 4JO4H 3V6BR 3UZVB 1AGEB 1J7VR 3QUZD 1UZ6F 4TQEL 3NPSB 2DQDH 4GLRI 1W0WA 4JVUA 4P2RB 3UTSD 4K7PX 3MLXH 3MV7D 1I9RL 3PABB 3QNZA 3QFJB 5E2TH 4ELKA 3K4ZA 3DIFB 2UZIH 1UH2A 3X14A 2FH8A 2Y5EA 2OSLB 3P9MA 4M1DH 5JW4N 4Z77B 4ZFOL 2XTJB 1ADQL 1KPRB 3FO2A 1YEDB 1R5WB 1BOGA 2X1OA 3MO1B 4EOWH 1L7IH 1Z9SA 4YNYB 4ZQKB 4X4XB 3MACL 3MV8D 3H9SB 5DQ9A 3I50L 5CP7B 5KVFL 1P69B 1PQZA 1A6TA 2XICA 3IDGA 1HHIA 4P0DA 3CFJB 3MRNA 2Q20A 1EUTA 5J11B 4XPBL 1JF6A 1R24A 3MCLH 3S96A 5GRVL 2FSEB 4WU7A 2NX5A 1G7JA 4L8CB 1BJ1J 2VDML 3F7YA 3HG1D 4JM4L 4KH2A 1FC2D 3NFSL 3QUXC 4L8DB 3VXMA 3JV5A 4MJ5B 1OB1A 3TJEL 4XVUD 2C1OB 1FFOA 4WHTA 3TZVA 2ICCA 4R0LA 1MEXH 5ID1A 3O4LA 4R4ND 4MXVE 1AFVL 3RY6A 5JMRA 5HYSB 1PSKH 5CGYD 4ZAKB 4BH7A 3ARGA 3IXAB 5EBWB 4LIQH 4FNLH 4LP5A 1C12A 2QQNH 5GS2D 5IHBA 1WIPA 4NHUA 1MPAL 1WFUA 1RZFH 3QUML 1CWVA 3U36B 3D18A 3HZYB 1WEJH 3IKKA 1JWMB 2JE8A 1YEHH 3MRFB 4NOBA 4EKXA 4HFUH 1RURL 4HBCL 4OUUB 5MI0B 3BYYA 3ESVF 4XC3H 5AAMA 3FRPG 4XP5H 5EU5A 4LRNL 1LNUB 2RCSH 1AGCA 1OCWL 1ZHBA 3BJ91 1KB5A 1J9CT 1G6RL 1ZK9A 3UYOD 1MJJB 2P4AB 3BQUB 1DANU 1MH5B 1IILE 1VA9A 3RL1B 1CN4A 2NY2C 5J13B 1YECL 5JZ7C 1BVKA 2PO6C 3FMGL 4DN4L 3I3DA 5D4QA 1UWXH 1RUQL 4HC1H 3O2DL 4PJ9D 1MCIA 5TF1H 1MRDH 2VDOL 1QRND 1M6OA 4P2QB 4G6ML 3KXFB 5DRNB 2ADGB 3T0AA 1WBYB 4UT7H 4P4RA 3V5DB 5DRXB 5EO0B 4F33A 3H9HA 2NY6D 4YIQA 4P5TD 4OLZH 3VWJD 1FNEA 4TTDC 4U1NA 1OT2A 2V2XA 5EU3A 1C7SA 2BVYA 4NM8H 1EFQA 1F2QA 1YN6A 4P4KC 4F7MB 5FGCE 5F9JA 4M93C 3MRLB 3RDTD 4K7PL 1GOFA 4ONFH 5CFHA 2HKHH 5IMKB 3S6CA 3MFFB 3VMPA 1E6JL 1HE7A 1UZ6E 2R9HC 1IKNC 1U3ZA 2DQUL 2ADFH 1BD2D 1DLHB 4FFWC 1Z9LA 4CW1A 2R8SH 4RZCA 4JFFB 3RHWK 1LEIA 3PF2A 1T0MB 2AJUH 3FQUB 2DJUA 3VFVA 3SE8H 3ROOA 1FHGA 1M71A 1YEIH 1J12A 4FQQA 1NAMB 1EAPB 3BP4A 4W6XB 5A43C 4YPGB 1RIVH 5FA3B 2ID5A 2WQRA 3B43A 1OAKH 4XC1L 1KCSL 3CNKA 4PGJA 1I1AA 3VXME 3WEXB 3JWOH 3OXRB 3S8WA 3KPTA 4U0RC 3S3JA 1U3YA 3D0LB 1KCVL 3C5SA 2F5AH 2BY0A 1RHFA 1CTNA 2YRZA 3MLVH 1MLCB 4OCSL 3MBEC 5JPMB 1T1WB 3C6LC 2ZOKB 2CXKA 3EHBC 4K9EH 5D70L 1CFVL 4BELD 5FEBA 2X2YA 3CCHA 1K4DA 1I1YA 3H9ZA 3GZKA 3CDGB 1TITA 1BM3L 1JZ2A 3LN9A 4NP4H 1WWWX 2FR4A 2Y25A 2BFVL 4ZOEA 4GQ9H 4QY8A 4WO4D 5I73B 4HWBL 5JHLH 5J0BA 1TTUA 3ARBB 3WNNA 3U6RB 3F7RA 1HN1A 4NKIH 1SEQH 4TRPH 1SVZA 3QIUA 2P5ED 1G9ML 1I7UB 5GRWA 1MCSA 3SGJA 3QEQA 5F6IB 1RHHB 5E7FA 2IQ9L 3HC4L 3X3FH 4GAGH 4NZUH 1IM9D 5IUSA 3BOVA 1KJ2A 5H35A 2AVGA 1TZHB 2J8UB 4KXZI 3NZ8B 3FQTA 2X4UB 1I1FB 1V7NL 3C60B 5BXFB 3RKDD 1FL6B 2J88L 1VGKA 4YH6A 3OKNB 1TVBA 5JW3H 2CR6A 4PTUA 3M07A 2ORBL 3BD4A 4PRPE 4YBQD 5I8EB 1KIPB 5LGKA 3JTSB 3PUCA 3VXPB 4LHJB 1K6QL 2D0FA 1LO0L 1PDKA 1ZLWH 5ICYB 2Z91A 3G6JF 3GSXA 5DFVC 3BKYL 4OZHB 2AV7A 1RJZB 3HE6A 4OUOA 1BHGA 2ITDA 4LNVA 2XWBB 5A2JH 2QR0B 3RGVA 2IF7A 4XXCC 3WUWB 4KAQH 4PGZA 5IVXF 2FEEI 1WFNA 3SCMD 3SGKA 1JGEB 2J5LB 5GGQH 2LVCA 4JQIH 4L8BA 3OAZK 1QLRB 3G6JA 2C3VB 1CG9B 1DBML 1SM3H 4MMXC 4X9IA 4BZ2H 2EE9A 4PJ8B 3RNKA 2F8VA 3BN3B 4N0YL 3SDCB 2A9ML 5IVXA 4U6XA 1P5VA 1VFBA 32C2A 4PV8B 1NLDH 2DWDA 2CDEB 5DUMH 4DKDC 4IHOB 1MHCB 4XH2A 4X4ME 3PWPB 2BHZA 3BVNB 4EN3D 5ADPH 5AD0B 2MFNA 4M5YH 1P4IH 5DD0L 2DYPA 4OIIH 3T0WA 1V5JA 1B0RA 2A1WH 2VZTA 3DVNB 4KQ4H 5LVEA 2R2BA 1G6VK 3QG7H 4WEUD 3NN8A 2XZCL 1SJHB 3FONB 2EE3A 1YA5A 4KWUA 3O3UN 1U8MA 2A77L 5GS0D 1FDLH 3W9EA 1KEML 3QPXL 4M1CD 1T2QL 1Q94A 1JNNL 4EIGB 5L7XL 1CBVL 4MNQB 4LF3A 3VDCA 5IFJB 3IU4L 3THML 3X3GH 4F9LC 5C0FA 3U7AA 1HKFA 1IGML 2DICA 4TSBL 3WNOA 1F3JB 4L8SC 2MPAL 1A3RL 3C09C 5DT1L 4CVZB 1KEGH 2J6EA 1ZEAH 4I8DA 4WDIB 5HHNA 1RK1B 5I71B 1U8NB 3K0WA 2HT4D 3AB0C 3GSUA 4LEXL 1UACL 3QI9C 4IBLT 1CFQB 3RI5F 5JXEC 3FOMA 2ZP0T 2HFGL 5I18H 1HHJB 5I1KL 3TBVB 2K7QA 3SGDI 5JMOC 5D72H 1MRCL 1TQBB 3RTQB 2BMKA 5FHAL 2UUDK 5C0RL 1JI2A 4TVPD 5HBBA 3AU1B 2OL3A 4R4FL 4OLXL 4PGBA 4U3HA 5DTFB 4KROD 4PJBB 1JI1A 5MHSD 4X7EC 1QFWI 3I6LD 1V3LA 4DUXA 3LS4H 3QUYD 3OKDA 1K2DB 1MFCL 4NUJB 3QDAA 1ZLVH 4LGSB 1F11A 1KPVA 4HIEB 2P43B 1X5JA 1ZSDA 15C8H 1S7XB 3CPLA 2I5YL 3GJFH 1DEEB 4HJJL 4U6YA 1S8DB 1TCMA 1CDHA 4H1LG 3QO1B 3T2OA 2HFFB 3V4UL 3N06B 3G6JE 5A40E 1IAKB 2XRAL 4K23H 1ZHKB 1LO5B 5JTWA 2Z8SA 2EXWD 3WXVL 3PWUA 4ZFFA 1FZOA 3O9WA 3WUZA 3GBNH 1J8HD 5D7LA 2NY0B 1DUZA 1JV5B 1JL8A 2A0LD 4XNYL 4FZ8L 1CR9L 1G7QA 1U8LA 5CJBA 3EDJA 3RWCB 2YZ8A 4N9GA 4LHUA 1LP9F 3MJ7A 4XNQA 2APTA 1PKOA 2OK0L 5K9QI 2BCKA 4Y8DC 3U4BL 3GMQB 4K3EL 4XP9L 3S3PA 1NUGA 1D6EB 2WBJD 4Q2ZB 4PY7A 4FP8H 2YPVL 2MCPH 3TGXA 5A2LH 4G7VH 2YHGA 2ATPA 1U95A 4JKKA 4X6BB 3VH8B 4UI2A 3B3IA 1F45A 3PHQB 1QRKA 5DC4B 3CMOH 1IC5H 5L9DH 2EDQA 1LP9A 3IDXL 5E9DA 5GS0H 3HRPA 4S2SB 5ESAB 4XBGA 4C58B 1QSFB 2H2SC 4DOHE 4F7CB 3HAEG 2VR5A 4MWFB 4DGVL 4KV5F 5F88B 2WINB 1UZ8A 2EH8H 2QSCL 4U1IA 3GMRA 3GSNL 4DVBB 3DXAD 4KK8D 3VGAC 3QDJE 4XPGH 3DGGA 1RPQA 3PP4H 5IMLA 2K3TA 1NGWA 5FGBC 3TO4D 4XRCA 1AP2A 1FFQA 4HAGA 4JJ5B 5C07E 4UOJA 4KKCD 2HAZA 3B9AA 4MS8C 2PTVA 4FQCL 2AV1B 4QXTB 2BVUA 4G42B 1V05A 5KSAB 4GAJH 4LVOC 3R1GH 8CGTA 4OLWH 5J8OA 3F12B 2WUBL 3IXTA 4L9LA 4R4BA 2JJWA 2O5XH 1UQSB 3GSVB 4LASL 4XMLL 3T2QA 5IQ9A 4TUJA 3TN0B 1IMHC 5IHUL 2IPTL 4XP4L 2E9IA 3I6KA 4KKNA 5LGHH 3GB7A 4YHNA 3IVKA 4LKXA 4PV9B 2IAND 5C0CE 4DUWA 3WS6A 1A7RL 3TYGH 3DPBA 1AHWC 4HXAL 2A9NH 5KVEL 4QGYA 1IAIH 4OCYH 4K3DL 4NWTH 1F4XH 2R2CA 2BK8A 1GIGH 5T3ZL 5DHVA 2CH8A 4CMHB 4KHTL 1BLNB 4O00A 2BOBA 4S1RL 5GGRY 1QBLL 4R6UA 1A6VL 3FB8A 3GBLA 4OZFG 3W2DL 1Y6MR 3VD7A 1S7QB 1G1CA 5D7LE 2XQYK 5F93C 4ZUUA 2VLRB 4PRNA 5DMKA 3VWKA 1EEQA 5C0BA 3NTCL 4LAQL 5E8EB 5A16B 4NCC1 4EVNB 3OB0K 4MZ2A 3JV4A 4PRHE 3TLRA 1IM3B 1LO4L 4MD5B 3VG0L 4NM4H 4A2MA 2PW2B 3NOIA 2OJEA 1ACZA 2KPNA 1T3FA 2YN5A 4HIXL 5F7EH 1FCCA 5LG1A 3VFMA 5E8NA 1GZPA 4GKZA 4AQOA 1CFBA 3OKEB 2WMPA 4QHLA 5J3HD 1GVIA 2WM0A 3FAXA 3VRIB 1WC7B 2IG2L 4LSRL 3TBSA 1LP9E 3WIFA 2VLJA 3LN5B 2EICA 5CHNA 5K9KB 5INDB 1T83C 2QADB 2X09A 4Y1AB 3WLWD 1BJ8A 4NQDD 3STLA 1C5DB 1SJXA 4Z5RA 3O11A 3QO0B 4JLRA 2Z31D 3SJVE 3HE7C 4G80B 4LCYB 5E00A 4KK6D 3MV9A 4JKPL 4PJGB 3FQXB 3SDYL 5HVHB 5DLMH 4K94H 3FZUD 5ISZD 5CSBA 5I66B 1PKQA 3M17A 1EEZA 3S4SG 3LAFA 5E2WL 4Z7UA 4JQXC 1WBZA 3BE1H 4KV5E 2W9DH 4MVBD 1UWGL 4S0SD 2IEPA 4FZEL 4JFHD 4YK4C 4FN0A 2DRUA 2P24B 2OXHA 5FYLE 3BJLA 5D1QD 1C7TA 1I8LC 1FQ9C 5EZLA 3KPQA 4E0RA 2VOTA 4HBQA 2R0WL 1INDH 2YPKB 3MJ8B 3NVQA 43C9B 3OQ3B 3EGSA 2P8PA 4O51A 4NQVB 4XP6H 2BVOA 2L4OA 2A74B 1KXVC 3V8CA 1E6OL 3RRQA 4OIAA 3ZKXB 4OCRL 2HWZL 1ZA6B 3BT2H 1RU9L 1AXSB 2N7BA 3JTTB 1TJHH 3ECBA 5I1GH 2H9GB 5E94B 5KZCD 4G6AC 1AGEA 3ARDB 2IAMD 1J5OH 5JIHA 2PN5A 4ZTOL 1AE6H 2BHUA 3S3SA 5E2VL 2VLKD