1YC8A

Caban33- y37v/e44g/r45l triple mutant
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
117
structure length
116
Chain Sequence
DVQLVESGGGSVQAGGSLRLSCAVSGSTYSPCTTGWVRQAPGKGLEWVSSISSPGTIYYQDSVKGRFTISRDNAKNTVYLQMNSLQREDTGMYYCQIQCGVSIREYWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antigen Binding and Solubility Effects upon the Veneering of a Camel VHH in Framework-2 to Mimic a VH.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Immune system
molecule keywords anti-VSG immunoglobulin heavy chain variable domain cAbAn33
total genus 26
structure length 116
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yc8A00
3CZJA 3KXFE 5HI4D 2EEDA 1NANI 2K7QA 1BPVA 1D3CA 2OTUA 1MI5E 4XNXH 3TJEH 1N6VA 4PD4K 4HJGB 2WP3T 4LNVA 1I7ZA 1P6AB 3KS0J 4PJ7F 5D7LA 3EYQC 3ZE1F 1YN6A 3K4ZA 5IHZA 5JLZA 1MPAH 1H5BB 3SGJA 3VXQB 5F7NC 4DKFL 3BIKB 4HUUA 4XP4H 3WFBL 3V6FB 2B1AH 4WWKA 1X9QA 5EH1A 4D0BB 5C9JB 1R6VA 3NCMA 1RZKC 2KBGA 3MLZL 4JM2A 2O61B 5I1KL 3JTTA 3PWLA 1HEZB 4HHAB 3M8OL 4HULB 2WW8A 1IKNC 1JNNH 4MXVF 5IWLC 1OF2A 5IR1B 4M3KB 3BPNC 4H0IA 3BKCH 4YO0B 3UDWC 3ZL4L 3MUGA 1UVQA 4X99B 5SWSE 3MRBA 1OM3L 3RUGB 4XVTH 2YUZA 1AR2A 3C6LD 3QNZA 3IJHB 4FABL 5EZJA 3MFFA 3B5GA 4QHNB 1FO0H 2EDFA 5AD0A 3ISWA 5JQ6H 1WSST 4TRPL 3QEUA 3X17A 1PZ5B 2OTUB 4ODHH 2W0FA 3PWUB 3BGFC 1MH5B 3I2CH 3O2DL 3SBWA 1D5IH 5D70L 1JE6A 2WIMA 4R8WH 4P4RA 1MJJA 5SX4I 3IFPB 1BZ9A 3QDGA 1N5AB 1NGYA 1YPZB 4RAUB 5H2BA 5FV2A 1DBBL 2DQUH 3BESR 3ULUC 3VFUA 4MXQC 4CVWA 5ESQB 4JR9H 4GRMB 4P2OA 2I5YL 2BVQA 2F54E 4FQ2L 4PRHD 4YK4C 1YMMA 4R2GC 5CILL 2W65A 2YPKB 3S34L 3IKCA 2P5ED 1U8QB 5IF0A 1IQWL 1RZGB 1CICD 4RGNB 4ZYKA 4UTBL 3GBLA 4IOFD 2HFFA 2AEPL 2BJMH 5DF0A 5I1JH 1IAOA 3DVFA 2G9HB 3SDAD 2MFNA 2WWKT 3BN3B 3LOWA 3QP3A 5IIEB 4U1JB 5FDYA 4Z7WA 1MCPL 1T1WB 2JCCE 2V2WA 4YUEL 1A14L 3QXVA 2DWEB 4NCDA 3VWKC 3ZDYF 2C3WA 3ULUD 5CSBA 1PGRB 5ID0A 1JJUA 2ITDB 1T7ZA 2J8HA 5ILTH 4W4OC 4OV5A 1NCCL 4WTZG 3SHSA 1X44A 5CEZL 4FNLL 3A67H 5ENWA 2V5RA 4MZ3A 1R3HA 1IT9H 1FE8H 1RD6A 5GS1B 2DI7A 4X7SL 4YWGH 3HCVB 1T1YB 5IG7A 2WWMD 3BWAA 2AJ3B 1QSEA 4P2RD 1MCSA 1TCRB 2VDNL 5CGMA 5TDOA 1D9KC 3SE9H 3WHE0 2DTMH 1C12B 4PTUB 1RUKH 4D0DA 4G7VH 4RAVB 4QRRD 2Q6WA 4OFKA 4PV8B 2ESVE 5I15H 4ZSOE 4XH2B 3FN0H 3QH3A 1N59B 4P4KD 2X41A 1FG2B 1V7MH 4Y2DA 2YC1A 1MNUH 3IF1B 1YDPA 3MLXH 4U1KA 4B0MM 1DLHB 1IGCL 1ZLWK 1I1AD 3ILPB 2VXVH 4GRLC 4YFDB 2F58L 4MWFB 5DVLA 1IRAY 2ATPA 1HHGB 2OL3H 2FECI 5EZJB 4LVOB 2J6EA 2CGRH 3AAZA 4AJ0A 5B39G 1P2CB 1T7WA 3IDIB 5A16A 4AM0A 3WV0A 2GEEA 2B0SH 3FMGL 3FHAA 2P4AB 2E5EA 3QJHB 3L3HA 4E5XA 3LIZL 4J7RA 1TDQA 5CUSL 5I8EB 4PGBA 3K2MC 4PJ7B 4PR5B 3ARRA 4YHOH 2X9WA 1J8HD 4FP8L 4NZRL 5C09B 2DN7A 3NCJL 1MI5A 1IL1B 3TYFA 5CJOH 4XX1G 3BDYH 1YJDL 4BSVB 1CL7I 1OAUH 4NHUB 5J57B 3QISA 2UV3A 3HMXH 5C07B 5FF6A 2NY2C 3BO8B 1CFQA 1BIIA 1REIA 3LQMA 2LU7A 1U8LA 2EZ0C 4NCC1 4ZFGH 2B7DT 3AFLA 1OD9A 3ESVF 3CPLA 3VG9C 4G43A 3JSSA 2PN5A 5FKAB 2VXQH 1J5OH 1II4E 3LKQB 4PJHF 3MQIA 1ZT4B 4KHXH 3RY4A 3PDGA 4H0GA 4K8RD 3D18B 3WD5L 5B8CC 1I8KB 4OQTA 5I8CB 1DVFA 1LK2A 3BZDA 5MP6H 3HZMB 4TRPH 1E4KC 1CT8A 2DS4A 4HSQA 4K7FA 1T0MA 1U2CA 5MEQA 4FQPA 4OLUH 5HHNA 1T6VN 4I3RH 3OKLA 3TT1H 1MSPA 2P5EE 4D0DB 1BVKA 1RFDH 4DGYH 2DKUA 2NY5H 3FB8B 3PL6D 4FN0A 3DXAB 3RX7A 1GHFL 4D9QD 3PGCA 2XXCB 4HKJB 4RFOH 1AQDB 4OQTH 4QRQB 1NMBL 3RWJB 1JYNA 1JWSB 5F1NB 4Z18A 3FAWA 3PGDB 5LBSL 2HFTA 4GAYA 4X6DB 4BFIA 5T3XL 4XHQA 1KPVB 4LQFH 5J12B 3B9EA 3VG9B 4HMDA 2CDFB 1EFXB 4U2ZA 1KSRA 1MF2L 1XGYL 1CD8A 1MRDH 3GJEB 5E9DA 2ATPB 5EPMA 1P5UA 3ARGA 2XWJA 4KV5E 3CDGA 2VXVL 4ZO7A 4RQQB 1KN4L 3MLSH 5IQ7L 2FWOA 3ARGC 2DRUA 1LDSA 4QHKJ 4WCYL 3ROOB 4OCYL 1JK8A 1ZOXA 2YMXH 4TNWF 1IAII 4OF5A 2Y9RT 2VXUH 3ZYOA 3L3GB 2H6PA 3ARGD 3D39B 1NAKL 3EOAA 5F9DC 1T1ZB 1HWHB 2JB6A 2QQKL 4HUNB 3QUXD 1IC1A 3EYUH 1P1ZA 3NMEA 5D2LE 2GTWB 5DJXA 1S5HB 3FRUB 1U8MA 1MQKL 2E7MA 1CT8B 5JLZB 1R5IB 1FE8L 2X5PA 2ZUXA 5DUML 1U3HC 4LAQL 3VMPA 1K8IB 3D39D 3WIFB 2FECL 3BZEB 1BQSA 3GI9H 1OSPL 4OTXH 1YN7B 4PJAF 4LL9A 3F12B 4FTVA 2WQRA 4KKCD 3FO1A 1ZTXL 4E5XB 43CAA 4KHXL 3NABL 1P4LB 2FWOB 4LNRB 4K07A 3L5XH 2EXWC 2ZG3A 2A6IB 5J1TC 3QNYB 2I9LB 2J3SA 1MCHA 3CX5K 5HGBA 4I3RL 1G0DA 2MPAL 3MFFB 1XZ0A 1SVZA 3DUHA 4PRIE 2BOCA 3QUKA 1MFNA 4GG8A 1N0XH 4Y5XC 1S7QB 4C56D 1BWMA 3VCLB 1CE6A 3C60B 5E4EC 4YBLC 1SJXA 4ALAL 4JGMA 3DHMA 5LBSH 2ZUUA 3MLRL 3RKDD 2B0SL 3FMGH 4RMUA 2Y5TB 4WFEE 4LKXA 3IAQA 1DQDL 3IDMB 1YEJH 2KZ1B 4MJ5A 4QTIH 5I2IB 3FO2B 4XZUB 3D85A 5I1HH 1BAFL 1IBGL 5IVNA 4JFFA 1KV3A 3NH7L 4GXUM 1U8KA 2AW2A 1VA9A 1DUYB 3S37H 3L3JB 2AXFB 4N5ED 1IM9B 1KBGL 1Q9KB 4ZFZA 3S37X 4GQ9H 5EOQL 4EQ3A 4JZNB 3LPWA 3JVGA 5GGUA 5GJTL 3TT3H 2PYED 2DTSA 4L8SB 3NIDF 4QEGA 4RMWA 3EYFB 4M61A 4ZSOA 2DTML 3DJ9A 3L5IA 1SEQL 3FRUA 4U3CA 2VLRA 2VDKH 4H25B 1CFNB 4KI5D 4R3SA 1QO3A 4J6RL 3RU8L 3FJTA 3OAUH 3DI2B 3IU4L 2JJVA 4WDIA 3ARFD 4XCYB 5T1LB 1T2XA 3RAJH 1HIML 2QL1A 5DJ2A 5HGHB 4CVUA 2HFEB 3RVWD 1JK8B 4UU9B 5DHYB 4Y4FB 2M8XA 4NO3B 5INCA 3LEVL 3LH2H 1GZQB 1PFCA 3LKPB 4PLKD 3K81A 4Q6IC 3QUZB 3HAEB 3TV3H 5FO8A 3FB6B 2FGZA 4EN3C 2ILLA 1T66C 2VL5B 4FABH 3MJ9L 2YD9A 3ARXA 3STZA 3D3VA 1JBJA 2XQBL 2RR3A 1E28A 2X9XA 4DVBA 1YA5A 2VE6B 1RZ8B 4OFIA 1JTTA 2LU4A 5T3XH 1IGMH 1N0LA 1SYSA 3IRZA 4FG6D 4ODHL 2C3GA 3NZHH 1WZMA 1UM6L 1UZ6F 4Y1AA 4XCFH 2NY7L 5CIPB 5C0IA 5BS0B 4BKLB 1N0XL 1XCTA 3WLBA 3CFBB 1KCRL 5AZEH 5JW4M 3LQZA 4MJIE 3MROB 2I5YH 5FDWB 4NFBA 5GGRY 5GJSH 1NAMB 5HJ3B 2RFXA 4P2QB 3FZUC 1FO0B 5ALCH 3VXSB 1XF4B 5HY9B 4MQXD 3T3PE 2HLFD 4H1LA 5D1XD 5TH2B 5JOEA 4NYLA 4K2UL 1TITA 1YEJL 4RFEB 5LQBL 3PL6C 5CWSB 3MMEA 1ERNA 1B2WH 5AD0B 1NC4A 3NAAH 4XHJD 3EFDL 3DGGA 3WD5H 5DEGB 3CVIH 2ZSWB 3OG4B 1UADC 3LSOB 1ZHLB 4R90H 3RHWF 1IC4L 2Q20A 3MFGB 3VXPB 2NY4D 4P2QD 1E28B 1LHZA 3G5YB 5EC2B 1AO7E 1IFHL 3OTTA 3RWDB 1BIIB 1ADQA 1BFVH 3CDYA 3IDYC 3GI9L 4EI6B 1CK0L 4OFYA 4ONFH 5C0CA 4CL7A 3D5OF 3MOAL 4G43B 3MOQA 5I73C 1KELH 2NQCA 1YUHA 5E99H 1NCBH 3BO8A 1FDLL 1WWCA 4K7PY 4C56B 1B3JA 3RPIB 2R23B 1IT9L 5T5FH 1ITBB 1U8QA 2IGFH 3JWNC 4NHCL 4YEEA 1ZSDB 2HVJB 5EO9A 5TE4L 2BNRD 5TH2A 4NUJA 5JIIA 3MRFA 4LCWD 5EULV 2ZUSA 4NIKB 1YEGH 5DSCB 4M1GL 4ZXBD 1MRFL 4Z7OF 2EKJA 3PXJA 5CZXD 3GSUA 1TTGA 3MRGB 4GBXB 3RWFB 3TBYA 2OXHA 2H45A 3OXRA 1JCKA 1WQVT 4HLZH 2VLJB 1XGUA 3PNWA 4PJGE 3PGDA 4JFZL 5D7LE 2VH5L 3V4VH 3LKRA 2NY2D 5EWIH 4GRLD 1X5LA 3I6LD 3OQ3B 3LZFL 3NZHL 2P8LB 2QQNL 4ZS6D 5L9DH 4JQVC 3QHTC 3QIBB 4DTGL 3C9NA 4XPFL 1W72H 4JRYE 2LTQB 2QSTA 4GBXD 3D9AL 4HQQH 4XMKH 4GQPH 5CIPH 1CICB 1UXSB 2A6KB 1ZLVH 4LEXL 5CP3H 3GSNA 3WFEL 2ZPKH 2KUTA 2ICWI 1W0VA 1C8PA 2YD6A 5D2LF 5A2IH 2YRPA 4YHOL 2YUVA 2CRIA 5DO2D 4FP8H 5DLMH 4NO5A 2IBBA 5CJOL 4WHYH 5FK9B 2NPLX 4Y4KB 2F74A 2C7UB 4R4ND 2FJFA 2DKSA 5GPRA 1CGXA 5DDHA 5BZWB 4JDZA 4PG2C 2UYLB 3WO4C 2K1MA 1YMHB 2P24A 4ORZC 2YRLA 1NAML 3NPZB 1UXWA 5A2FA 2VLME 4X5XB 4R26H 5I16B 3HE6C 1UJ3B 3BH8B 4JY4A 2DIJA 4FTVB 5INDA 1G84A 3EO0B 1AGDA 4FQXD 1CLYH 2EEBA 4W70A 5KW9L 3ULVD 5T1MB 4YXLL 1UEYA 3BAEL 1UZ6E 2FDBP 3QULA 4PJFE 1WAAF 5JDJA 3HA0A 5EIIA 1QVOA 3NCEB 2FATH 1ONQB 2Q76B 3TESA 3STLA 3HI1A 1WFOA 1QLFA 4MDIA 3RTQD 4Q9RL 4UQ3A 1G6RH 5HYFA 3TZVC 2CK0L 3GJFK 3HC3L 3MLUL 3RWCB 3ESUF 1CIDA 1P7KA 4MA1C 1TNNA 2CDGA 1UM6H 1IBGH 3F7VB 1R3IL 1VFBB 1B88A 1LK3H 4F7CB 1DZBA 3W0WB 1JNHA 2C3HA 5IHBA 2VJXA 5L7XL 1IGYA 1Z0NA 1VACA 2PO6C 3WO4B 4UTAH 1NGPL 3VFWB 2C1PA 2XTJB 4GXVH 2VH5H 5EU5A 4U0RC 4FS0A 3ARFC 1YQVL 2FEEL 3N50A 3VGAB 2Z9TA 5CMAA 3TC9A 2I26N 1MRDL 3M45A 1MUJA 1L0QA 1I3UA 3WFHB 3VJ6A 3DYPA 1NCCH 5J6GA 5K9QG 3B83A 5IG7B 5CJQH 3ZYJA 1EO5A 4FTVD 2DLTA 3I75A 3GMMB 3Q1SL 3RWHA 1OQXA 1OF2B 4K8RC 5HHQB 1DN0B 2X4SA 4LF3B 2RIKA 3CLEH 3X11A 4U6YB 4FQHB 3TBWA 4N0UB 3QCUL 4A2LA 3VU2A 1JPSH 5CBAB 3LMJL 1MAMH 1IAMA 4R3SB 1AE6L 1EMTL 3T2OA 4CDGC 5MI0C 4GKOA 4JREC 3AAZB 2DI9A 2EE2A 5ISZD 4WHCA 3GK8H 3BEVB 1IILE 2V5TA 3O8XD 5C0RL 1OY3B 4FFVD 4JVWA 5IW1B 3RNQA 1MCDA 5JNYA 3PDOA 1RMFH 2OCFD 1GPOL 3OL2A 2R1XB 2IMMA 5BV7L 3VFGL 3C8HA 4MJIB 1AC6A 2P8LA 3PQYA 2GQHA 2APXA 5J0BA 1GGIH 5IK3A 3U9UB 5LXGL 2FX8L 3PQYE 2FR4A 2XN9A 2X4PA 2R0LH 1JVKA 4PB0H 4P59L 1BF2A 3QDME 4Z7VA 5CD3B 3RVWC 5EBLB 3QFJE 3V7MA 3TPKA 1F6FB 4WUUB 4LMQE 4OT1L 2EEAA 5C8JB 1HHJA 1WITA 2GSIB 4IRZL 1T2QH 3ZT5A 1AY1H 2BCKA 3EOAB 2ZZUT 4RIRB 5GXBB 2NYYD 1IC5H 4UZGA 2JF1A 1FL3B 3QQ3A 1LO4L 1LE5A 3NFNB 1N26A 1R3IH 3CGTA 3DV4B 3UCRA 4EIGB 4ENEC 1FJ1B 1OAKL 2WV3A 5DFVD 3G9VA 1L9MA 5IFAH 1CL7H 4L3AA 5FGCE 4HWBL 3G6AA 3QXWA 4PJEA 5ALBH 5C0EA 4OUOA 1EX0A 1CXFA 3S34H 5GGVL 4JE4B 4YDJA 1CDIA 1WEJL 1SYVB 2LE9A 2EIEA 1X4YA 3MV8A 4O2CB 4XP1L 4YXKH 3ZT7A 3GO1L 5ACZA 5DUPH 5TJWK 5J8OA 3KXFD 5HDOA 4J12A 4U7MA 1P7QB 5IMLB 1RUPL 4XXDA 5C0NC 2VZ3A 3R06A 4OF7A 5JOPD 3BPNB 4L3ED 3RWDA 1JGEB 4XVSH 3B5HA 3O6MH 5GS0H 4YZFE 1P4BH 4M1DL 1V8HA 1HOCB 4Y19E 2GAZB 3BDXA 3B6SB 3FB5B 4Z6AT 4G9DB 2YD1A 2XXMB 3CJJA 4OM0H 2X4PB 1SHMA 3JTSB 3RJQB 4WNQB 4N8VB 3VFSA 3VRIB 3U6RB 3Q2CA 3I3DA 3SDAC 4RWYL 1FVDB 2C9AA 4X0KB 2PKDA 4Q9RH 2VLKE 3HI6H 4L8CB 2AXGB 1QPXA 1CCZA 4Z9KB 1R0AH 4G6AD 1HHHA 2CKBB 3OKOB 4FXLA 4CNIA 2PYEE 1D6VH 3BMWA 3IXTA 4LLUA 1LO0L 3B43A 4LASL 3RWIB 3ROOA 4ODXA 4ZD3L 1IGJB 2E9IA 1QRKA 3X11B 3O9WB 3T8XB 2JJSA 5IQ7H 1JHTB 5EA0H 3VXOA 3E6FA 5D1ZC 4PRNB 2DWDA 3NGBC 4FQXA 3FB7B 5I1AA 43C9B 3EZJB 1EAPA 4MB5A 1AD0B 5I1GH 3G5VA 4FQXC 4G8FA 5I19H 5INCB 3LQAH 4LCCA 1RJZA 3U7YH 3FFCA 1FH5L 3IJSB 4YGVA 2RCSL 1AP2A 1OP3K 2E9WA 4FMKA 3GBMH 4S1DD 1E4XH 4RISL 4YIQB 5J13C 1YQ2A 4UU9A 5DHYA 5DUMH 2PW1B 3INUH 2PCPA 4CN6A 2AXGA 1XZ0B 1NGYB 3QIWC 5C0AA 2X4UB 1R5WA 3JXAA 4IJ3B 5D8JL 4HS6B 4PG9B 1YEEL 3DPBA 4GRWF 2R9HC 3MSPA 3QWRD 3J8F7 4HPYH 4NBYB 4L8DB 5TDNA 2AQ1A 3ZZ1A 4U4BA 1QBBA 3TA3A 2EXWD 3SKJH 3O4OC 3D85D 1J1PL 1FYTE 3CPLB 3RVTC 5AEAA 4GKSA 4L9LA 1NC2D 4ZFGL 4JFDB 3RL1B 1U8HB 4KRPD 4HGKC 4JFPA 5DD3H 5T1KD 4L9LC 5ECJE 4OZ4A 4PUBH 2V9QA 1F4HA 3OAZK 4YBLB 1GGUA 4HX1A 4YHMH 5H35A 1AP2B 4ZUTA 5HVHB 1INDH 4ALAH 3DRTB 1YECH 4PREB 1UJ3A 2VC2H 3SDXA 3U82B 3KPMB 3K8KA 4WJ5A 4ELME 4R7DB 5CEXB 3TT1L 4Q74A 1IC5L 3EW3B 3TN0A 3EDFA 4OCMC 3CSYA 4ZD3H 1X5XA 1RJZB 5D7SL 4BH7A 4LSPH 1OSZA 2CSPA 1ACYL 1W8OA 2EH7H 4EN3B 3FO9A 1JI2A 3REWB 3TPUB 3K8LA 25C8L 5JA9A 5LGKA 4QYOB 1MJJB 2AK1L 4HS8L 4AG4L 2R0KH 2GJ6D 4X8XA 5CEYB 4MA3A 4P48A 5CMAB 3KPNB 4NT6A 3VFTB 4JM2C 1S7UB 5FUZL 3KYKH 4PRHB 4XCEB 1MEXL 1AE6H 1EMTH 3GSOB 4WI8A 1ETZB 3CFDA 3S36H 4PRPE 3ARZA 5I0ZA 3GK8L 4MD0A 2BNUB 3OXRB 3MJ7A 4Y4FC 1KLGB 4LFHD 4NUJB 1FO0A 1J0KA 4NUGL 1SM3H 4MAYD 3S9DB 2YN5A 3QDMB 4XX1E 1FNHA 3WIFA 3LKRB 4OGXL 1T5XA 1KIPB 4M5YH 2IMNA 5J11C 4UT9H 3HNVH 4PJ5E 4ZOCA 4XNYH 1RJLA 2Z93A 3B8YA 1JV5A 3ZTJG 4GBXA 3RWFA 1A7BA 3ARDC 1LEKA 1DQML 2YD5A 3MRDA 1EDQA 4J8RB 3G08A 2J5LB 3LKOB 2ADGB 1MREH 4ZNEA 5J1SC 2G75A 2XN9D 3VXRB 2DQIL 3HR5B 2FCBA 3RUGF 3E0GA 5FYJL 4ODVL 2CLRA 1NDMA 3VWJA 3EOYG 2P5WD 3T2NH 1Z0MA 2P44B 1S7TB 1LO4H 2YBRB 4PJHA 5E5RB 2BMKA 1QKZH 2NR6C 4YFLF 3NABH 4W6YB 4KVCH 4Q6IA 5D6CA 1TJHH 4CBPA 3P0GB 5I66A 4LEOA 4UV4H 3BSZL 1KULA 3ZHLA 4RRPA 4MA7L 3LIZH 4WV1B 2W59A 4OLWH 3MLTB 1RJCA 4DAGL 5I19L 4AENB 3D2UD 1SY6A 1MFDL 5LCVL 3QQ9C 4ONOA 3TBSA 5HYEA 3WDHA 4L4VE 3MRIA 1BGXL 3GSWA 5E1HB 2L0DA 1YJDH 1QFOA 1ACYH 2AXFA 3D87B 5B3JF 4Y16D 3GM0A 4XWOC 3O3EA 1TJGL 1G9NL 1IARB 3EJYC 4XAKE 5I2IA 1S7UA 1YQVH 1KB9J 1NPUA 4HAGA 1SY6H 2VITB 2VXQL 3QFJB 2VN4A 5JPMB 4WUUE 3SPVA 5I1HL 4FZEH 3QDGE 1JHLH 2EIZB 4L3EB 1MLCB 3MR9B 2YPLA 1EFQA 2PTTA 5TQ2L 4Z95L 3TBYB 3WEXB 1N64L 1KBGH 1JWUA 3P77B 4KKBC 4JN2A 4CU7A 4KROC 4X99A 2YRZA 3IYLW 4KVNL 5J4MA 2VXSH 4NUGH 1U8LB 4QY8A 2Z35A 5DJ2B 5HGHA 1I3VA 3H9HA 5F89B 4YXHL 5HI4C 1BZQK 1H8OA 3PJSA 3QUZA 5E94B 5EZLA 1AXIB 3WDJA 4CU6A 1XGTA 1A4KB 1B6DA 5D7KD 2DLFL 2Y72A 3GMOA 4NP4H 1XF1A 3IDGA 4OD1L 1F58L 5L6YL 3PHQB 3FRPG 5BZWA 1FVDA 1I1AA 1RUQH 1HWGB 4Z7WB 4AMKL 5DC4B 3K74B 1MUJB 4C54A 1MJ7H 4WU7B 3ELAT 4BQ9A 1TZGH 4Y16A 3MREA 1KN2H 3S5LB 3RY6C 1NBYA 3WSQH 2H3NA 4XI5C 4IEFB 2OI9C 4ZS7L 5IIEA 1DUYA 1A6WH 1PEZA 3MA9L 2E7LA 3HZVB 1WJ3A 4YAQB 5DHVB 2FIKB 2W0PA 4JFFD 1N6UA 3JUYA 4TNWK 3KG5A 1J88A 3OKKA 3WFEH 2I24N 3O2VH 1NAKH 1QLRA 2HH0L 3CX5J 1GZPB 4XTRC 2EYRA 2HFGH 1IC7L 4PBWD 2V2TA 5GSVB 5ITBL 3EYUL 1Q72H 4KI5E 2NY3B 3UAJC 1AQKH 3QSKB 3MROA 1BD2B 1MCKA 2IH1A 2VQUA 5HDQL 1OWRM 4JFEE 2Q87A 1MQKH 5CKGA 3G5VB 2Q8AL 5I1CL 3IDNB 4J3XA 3C60C 2BHUA 1PSKH 3MRPA 3O2WL 3UTZB 4DVRL 4R26L 4V1DD 5CJXC 4LU5L 2WSKA 4PJ8A 4M02A 1CLYL 5GRVK 3H8NA 1CE6B 3C60A 3MV8E 3GFUA 3MRHB 2FYYA 5C3TA 4YK4B 2D7QA 4OIIL 4F58L 2WIIB 4M5ZL 3RPIA 2VO5A 1RK0A 3DSFH 3BT2L 2VUOA 2R69H 4U6VL 1G6RL 3WS3B 3ES6B 3V7AG 3BZEA 2IPTL 1X4XA 1CXIA 4EI5D 4LCWA 4OJFL 1YUHB 3ZTJH 4AEIL 3D6GA 4WO4C 4LHUA 4DZBA 5T3ZE 3VXUA 1XH3A 3FO1B 4ZQKA 5FYKH 1U8MB 3BIAX 4C56A 2VQ1A 5HHXH 4FQQB 1OL0A 3MXWH 1P4LA 5FUOL 2IJ0C 1OP3H 2LABA 5F7YC 1UKTA 3IJYB 3ARFB 5DK2B 1TCMA 5DRXA 1J12A 4RNRB 1D5ZA 5DO2C 3KS0H 2R1XA 2KDGA 5DZLA 1GRWA 2A38A 3UTPD 2OI9B 5HI3D 4N1CA 1A5FL 2OP4L 3AB0C 5EZIH 4AH2B 3EGSB 1A9BA 4OGZA 4F3FB 5EU3A 2ZSWA 2AEPH 2BJML 5I1JL 4YR6A 3D3VE 3SDCC 1R3LB 1UWGH 3HB3C 1D9KB 1TJGH 1G7LB 1JF5A 1DL7L 1H3UA 1NUDA 1HQ4B 4BQ6A 5E9DD 2X4NA 1J8KA 5DD0H 5C0BA 3DHJA 1OSZB 3UYOD 1FCGA 5KN5A 5D7JB 4ZNEE 1MHEB 3C87A 3AMLA 5A2KH 4DTGH 5GRXG 4HEME 5D1XC 4Z95H 2E7CA 4AEHL 3VFVA 4NRYA 4HZAA 4CMHB 3RVUD 1HEZA 4R97B 4PLOB 4HXAL 4RISH 5F1NA 3HUJB 5EBGA 1JGUH 4M6MH 4NOBA 1HIMH 1HH6A 4JO3L 1K3IA 3GHBH 3QEQE 4Y1AD 1AD0A 3MTRA 2EC9T 1ZWIB 5DJZB 1LWRA 2X70A 1CE1H 2G2RA 3TV3L 5JHDA 1DBKL 5F72S 3WE6B 3EO1A 5IQ9A 3ARPA 3ALXA 3FN0L 1FNLA 3ULVE 4NZTL 1FNSH 3QNXA 4O02L 3STLB 3EYFA 4M61B 3RA7H 1BVKB 3TN0C 1AY1L 2H32H 5GGSY 2R0ZH 1NAMH 1K8DB 3OHXA 5DC0A 5D6DA 2BXYA 4MX7B 5DMJB 4Z76A 1JYXA 4F7EA 3IDJB 3VD4A 4PUBL 4Y5YC 1A0QL 5TE6L 2AXHA 1XEDA 2SEBA 3JTSA 3VXME 1S3KH 5AWNH 5FUOH 3BPCB 1BD2D 4JQXC 4UQ3B 4UMGA 8FABA 4PGEB 4RGMB 1FVEB 1U8IA 4R96A 4FZ8H 1XCQA 5FV1L 2HVKB 1FYTD 2VDPH 1QSFA 5ALBL 4LVNB 2NXZD 2NY1B 3NPSB 4LSSL 5DJCB 4PJIF 1T5WA 3S96B 1KPRA 3QO0A 1AIFA 3BRGC 3F6IA 1QACA 3DIFB 5GSRB 3C60D 4HS3A 1QSZA 1JHKH 4NO5B 5JA8B 3SE3A 3KPSE 2ITCB 4XC3L 3QI9D 3BMVA 5IMMB 4P2YA 2ZJSL 2Z4QA 1PKOA 2Y7QA 1A47A 4FQCL 4JRWA 1F00I 1LEIA 1RIVL 4GBXC 2AK1H 1NBVL 3CVHL 2W9LA 1GGYA 5DS8B 3BH9A 3P4NA 5JPMA 2BOCB 2HFFB 1WFNA 1JGVH 3O9WA 3T8XA 2EDLA 2EIZA 5GGSA 1NCBL 5JXEC 4I8DA 2CIIB 1S7QA 4KJWC 5F7LB 3B9KA 5IOPA 1AC0A 1L0XA 2I07A 4XPBL 1HHHB 1KLUA 3BT2H 3HC4H 1U8IB 3N06B 4R96B 1A8JH 4AY0A 3LQAC 3FB8A 4TVPD 1S7XA 4JO3H 1T1YA 4KRMB 5TE4H 1S78D 1CDBA 4LLVB 4Q58C 3HS0A 1EA9C 4X4ME 4XI5D 1HSBA 5GZND 2GCYB 2WANA 4NPYB 4XVJL 4YNYB 4G6JH 5HI5D 1OP5K 4F7EB 1KPRB 3MCKB 5C08B 3GZKA 3T0WA 4AZ8A 1KPUA 4LVOC 2ID5A 3P4OB 2OTPA 5MERB 3MJ6A 4K3DH 5B39B 3FT3A 3RA7L 4Q9BA 1O7VA 4J2XA 3RGVC 1RMFL 4WGWB 1Y0LB 4ZTPL 2F8XC 4PTTA 4KZDL 1A5FH 1G9MH 4MSWA 2WAHA 2X4QA 4JKLA 5FK9A 4NJ9H 1A1NA 1KTDA 2J8UA 4OZHF 5D7JD 2P24B 2DIAA 5CS7A 1UYWH 1FPTH 2D7NA 3HPLB 1A7NH 1YNLH 2FSEB 4LHUD 2HYMA 4ZAKA 1BFOA 1Q9WA 5GZNC 3SO3C 2HMIC 4LU5H 4DK6A 1VDGA 4ODWB 3S6CA 2DD8L 3PV7A 1JPFA 2ICWA 5JHDB 3VGEA 2IANA 4OSUH 5E2JA 3VW3L 4X98A 4XPGH 1P2CA 4IOSD 3S3SA 4MA1B 4MQXC 2A6DA 2G75B 1IQDA 5ACMA 4LNRA 2H1PH 3SKJL 4OKVB 5CEZE 3OB0H 1AXSA 4JVPA 2AEQH 4M6ML 4ELMF 1CL7L 4HJGA 4G8GB 4NC2B 4V1DA 1SJEA 3AXLB 1NMCB 4KZEL 5I75C 4X6FB 1TZHA 1LMKA 1AD9B 2D4FA 3NN8A 2CO6B 2BVEA 3VI4F 3ZKMD 3CFCH 4GRMA 3F6LA 3RWGA 4XAWL 1EZVX 4Y2DC 2FO1A 4LSDA 5DJAA 3GIZL 2IAMC 1I3RB 5D5MF 4MMZC 4YEFA 1T2JA 3MJ9A 4XCNB 4BQBA 3X13B 2NCMA 1DBAH 3BGAA 3SKUD 3UO1H 4YHLL 4YO0A 3LV3A 1OAZH 5KSAA 4XVSL 1CFSA 1Z3GH 3FB5A 3SCMA 4GW5B 3VFTA 1RZJC 4ZPTB 4P3CH 5TE6H 1KTLA 2XA3A 3UPRB 4B50A 5J1AB 1ZHKB 3QDGD 1WLHA 4OM0L 4QYOA 3SDDB 4ERSH 4OD2A 1IQDB 2GJ6A 4U1GB 3SKOA 2H26B 2MJWA 1T4KA 2P5WA 3V8OA 4I77H 1I7RA 4FQXB 3BH8A 3AC0A 2DQCL 1ZVSA 2D4DA 4AMKH 1FCCA 1HHIA 1NMCC 2X4QB 5AZ2H 4PJBA 5KSUB 5CZXC 4Q9QL 4O58H 4WW2B 1CN4A 3LY6A 4WEUD 5DD0L 5F7KC 1BFOB 1Q9WB 4ZTPH 2X1WL 3FQRB 1VEPA 2Q7YA 3OGCB 4TVPH 1CG9A 4NJ9L 3GMQA 3GUTA 4M48L 2HRPH 1B4RA 3VI4E 4PY8J 1I9EA 4X6DF 3C6LA 3S37L 1EO8H 2ESVD 4DW2H 1UYWL 4TSAH 2UWEB 1VFMA 2QEJA 2F53E 1YYML 2R0WL 2Z93B 4N0YL 4O4YL 4YC2C 3GHBL 4S2SB 4KK6D 2ADJA 1G7QB 2V2XA 1CLZH 1L7IH 4DUWA 5IHUL 1T80A 4HS6A 1SEQH 3VA2C 2V7HA 2GFBB 5F7EH 4A6YH 4N8VG 1G7LA 4WWKD 1CS6A 3CFKB 3NIFE 1ZT7A 1NBZB 4XWGL 1YYLH 1C12A 5C0RH 2JIXD 3WJJA 1NC2A 4E9LA 1NDGA 4GO6B 1TZHB 1DLHA 4NQEA 5GGQL 2AEWA 2MHAA 3LB6C 3MNZB 4JAMB 2G2RB 3D3VB 4D0CA 1YEEH 3VFNA 3TBSB 1WAAA 2V5SA 4K9EC 4P59H 4XAWH 1J7VR 3GKWH 2C3XA 5C0AD 3S3PA 4HUKB 4PB9H 5HYJD 3GIZH 2XZCL 4G6ML 1H3PL 4LSQH 1EAPB 4U6VH 3JV5A 2GUOA 3U1SH 4OZHA 4TVPE 1J0JA 1F4XH 1V3LA 1Z3GL 1G7QA 4XXCA 3LN5A 4G8FB 5DI8A 1YMME 5EG6C 4NQXA 4G5ZL 5ICXB 5ACLA 4ZFFA 4G6FD 4MNQD 3RPKA 3ZKSD 1FBIH 3P0VL 4POZD 3TFKD 1OAKH 2EXYC 1D5MB 3W9EA 4LLDA 5IV2B 3IU3A 4JRXE 5T1LD 2OXGA 4M9OA 4XNQA 4CMMA 3ZE1E 2CUMA 4HBCL 4P5MB 4HKBA 1J1OH 1SBSH 4U1KB 5BJTB 3CFEB 4X8JA 1E6OH 3DVGA 4BSJA 2V9TA 1FFNB 2GI7A 4XPAH 5KVMC 3CVIL 4ORGB 3V4PL 1AGBB 2H1PL 1RK1B 3HNTH 3K8MA 2EKSA 3OKMB 1EEZA 3BKJH 1G7IA 1Q9KA 4CRPA 3X13A 4KVNH 5EOCL 5GRJH 4F9PA 5D1ZB 3ALPA 1TXKA 4NQDA 3W9DA 1NGWA 4JAMA 3RVVD 3U2SB 2ADIA 3ULSA 1W72B 2BSRB 2YPLD 4LGRB 3LB6D 3TO4C 1QQDA 2V5YA 4MB3A 4F80A 1MEXH 4FQIH 5GGSB 5GGRB 4UNUA 5T3ZH 4O00A 2VABB 1NGXB 5EO9B 2HWZL 4UIKH 1FG9C 2JK5A 5BO1L 1JWMA 1CDYA 3TIEA 2Y36H 2DDQL 1JUFA 4UOW0 4AEEA 4F9LC 2VLLB 4MMXC 3QCTH 2A83B 4X6BA 3TWCH 4K7PX 1INQA 2GITB 5HHMD 5M7QA 2FZ3A 2R2CA 1U8PA 2E8YA 3QDMD 1EFXA 1WBYB 1TQCC 5FGBC 2Q8BL 5F9WC 4X4YA 1AGCA 4LCUB 5E6IA 5K9OB 1GZQA 3QA3B 2MCPL 1UWEL 3L5WB 1B0GA 4WFFD 4JFDD 3KPTA 1CXKA 2H2PD 5IF0B 4LHJB 3V6ZB 3NIGF 2R4RL 3O6FC 3QUML 2GTWA 5DJXB 3CSPA 4G8GE 4PJGA 2PNDA 3WJLA 3MNWA 2AJYH 5ISZA 5CGYD 4J3SA 3TVMC 2XI9A 2EKSB 1A3LH 3LCYA 4TTGA 5K33A 4NSKA 3L7FB 4JFDA 3B2VL 3PUCA 4NNXB 4LKCB 2X7LB 2OQJA 4U49A 3T0EA 1EEUA 2E7LC 5C0BD 2H32A 2NTFB 3E3QC 5C08E 5E2UH 1NEUA 2BRRH 5E6YA 4GUPB 4N0CC 1I9JH 3D3VD 3KPQB 4QT5B 1RK0B 4FQLL 4ONHB 1T03L 3RWHB 4QRRE 1X6LA 3QFJD 5FO7B 4P49A 4R4FH 4IM8A 4X4YB 1CF8H 2R69L 5HHMB 1I1FB 1KFAL 4WO4B 5D2NE 1S9YA 5DA0B 5DA4A 1Q8MA 3VH8A 3A6BL 3NN8B 3X14A 3X3FL 5DVKA 1ZK9A 1MCRA 5DQDH 35C8L 1JGVL 4OLXH 1CU4L 1A4JA 3CH1A 1CTNA 1KB5B 1QZ1A 3MNVB 5F9OH 1O7SA 2B8OT 4XWOD 4QGTA 1FGNH 2NY6C 1HSAA 2Z4QB 3GMNA 3I3EA 4WI9A 1HZHH 2DDQH 4G9FB 1XF3A 4JJ5A 5E00B 3KLSA 2R2BB 2XRAH 1OTUD 1F5WA 3CXHJ 1UACL 2MNUA 2VLJD 1BEYL 4OZ4B 3RNKB 3P9WB 5SWQA 2OTWA 1NSNL 4O5LL 5C0DA 4LIQE 1XGRA 2XTJC 1GH7A 2VLJA 5D93C 2OQJB 3BEWB 4Q2ZB 5D1ZA 1UKSA 3P0YH 1B0RB 1XIWC 1MIML 2ESVB 3ECBA 2M26A 4DKAA 4P46B 3W0WE 4A6YL 3EDEA 2ZNXA 1GXEA 4Y19D 4FRWA 3LD8B 3LS4H 2CRMA 3CFJB 3EYVA 4BFGA 5MERA 1BQLL 4IS6A 3RWEA 1LEGB 2FH6A 2H2SC 5GS1A 3Q1SH 4LLVA 1SM3L 5C09D 3OGCA 3D0LB 2EDTA 4OCSL 4C57C 1G1YA 4O2EB 3L5JA 4PRBB 3KPNA 3WE6A 4H5SB 4JHAL 4ZTOH 4KPHH 4YBQD 1W0VB 4LSTL 5DEFA 5ACZB 1JYVA 1S9VB 5C2UB 3G6DH 5IJVA 1Q72L 1A6AA 4P3WA 1UXSA 2A6KA 3GKWL 1K9TA 2WLYA 1CDHA 5T3ZL 3MV8D 1RSFA 4KGLA 5KSAC 2E9JA 2J88H 1MY7A 4PJ7E 2APTA 5BO1H 4YBHA 5FYJH 5F7MC 5EUOF 4N0UE 2IBGA 4P5TC 3BQUC 3HKFA 3U0PB 2NW2A 5ESAA 3BD5A 1MHCB 12E8L 3VDAA 5K9JL 2OR8A 5GSRA 4L3CA 1UJ3C 2BY0A 1FG2A 1HXYB 1XCQB 4I4WA 2D03H 4KUCF 2EIBA 4YDKL 3RTQC 5DURB 5KG9B 4WDIB 5IMKA 5AAWA 3PL6B 5IB2B 4GW4B 3BP5A 4FQJL 3RTQA 3VGBA 1FL6B 2Z31C 1RV6X 2ESVA 4H25A 1PX4A 1F13A 3SJVB 4Z5RA 1EXUB 2X4OB 3MYJA 3EGSA 4ODSH 1F4AA 4JO1L 5FGRA 4KTYA 5L0QC 1NSNH 3BKJL 4IDJH 4CN4A 3PWUA 2OX5A 5I1IH 3IJHA 3H9YA 3F58L 4MCZA 1F3JB 5HHOB 1JYWA 4UIMA 4NN6C 5D72L 5TE7L 1MWAA 4X5LA 4XC1L 4H1LH 1ED3B 3PE9A 3K1DA 1D9KD 5HDBE 1C1EH 3C5SA 3WCYA 2A77H 4FA8A 1JHLL 4FQIL 4LPTA 1Z9OA 5D1QD 5HYSA 3UPRA 1J9CT 3UTOA 1Q94B 1QLEH 5GRWA 4B5EA 5EPMB 3BVNA 1MCWW 3Q5OA 3UTTB 5SWSA 1KCUL 5F7UA 3GRWA 1T21A 3LHPL 1YYMH 2R0WH 2FSEA 4NQDD 4JHWH 5KSUA 5B3JE 1RZGA 2R9HD 3K46A 3H0TA 3FTGB 5FA4B 3TH4T 3KAAA 4RAHA 4ZO6A 3NGBB 1CU4H 3MC0A 1C7SA 2Z0BA 3VD9A 3FT3B 4NP4L 5GGRA 1ZHNB 4M7JH 3O11B 5HHPA 2C1OB 1ZVHA 2O5XH 1P4IL 4DK3A 2HT2C 2Q1EA 4PRNA 1W2KT 5IJKC 3IAGC 1BJ1J 4P2CG 2VABA 4NQDB 5D7IE 1CVSC 3VWJD 4AT6B 4BA8A 1NUNB 1ES0A 2P5WE 3PP3H 3AU1A 4WHDA 3DGCR 1LNUB 1XAUA 1B4JL 3FT2B 3DECA 4P2RE 5J13B 3PIQA 2DBLL 3ILQC 3REWA 1HQRB 1MPAL 3EHBC 4ZPVA 4Z7VB 5CD3A 1KNOB 5IB2A 3ARSA 3PDOB 1FFOA 2W92A 4S2SA 4MYWB 2EECA 4ETYA 4U7KA 5TDOB 3ZKXB 3TN0B 3W11C 3EDDA 1P9MC 3L95A 1D5XB 1FRGH 5FYJD 3F5WA 1JRHI 2BNQA 4KJYB 4ODSL 5SV4A 1PZUB 5E6IB 3BKCL 3U7YL 4HGWB 3HMWH 3IGAA 5HYJA 4ZUVA 1EGJA 2DQGL 4RMRA 2D7TH 2D7OA 2NXZB 4XVTL 4X6DE 3S88H 2GTZB 4UDTB 5IEHA 1MWAB 4N8CH 2EDRA 1ZVSB 5C9JA 2YN3A 3BE1L 3DURB 4MAUH 4NFDA 2R1WB 1IM9D 5IKCB 3WIHL 4XBEH 2ZUWA 3SQOH 4WO4D 5IVZA 3G6JA 2DQHH 2A77L 3TH2T 4ISVA 3U4BL 4G7YL 4JKPH 4PRDB 5DRZA 4CGTA 4GMTH 1UWXH 2YA2A 3PWPA 1FGNL 1ZLUH 2DM3A 3OF6A 4Y5VA 3QJHA 1LGVA 1NH6A 4F2MA 4I9WD 1U8KB 4CDHA 3MUZ1 3FONB 1S7XB 1I8LC 2VLRB 4EUPG 3SJVA 5E0QA 5FYKL 1HSBB 1KENH 4U6HB 2XT1B 3CK0L 2RBLA 4M7KL 1MHPH 5GGUB 3O6KH 3QIUC 1DANT 2PR4L 3KHOA 2QKIB 3ARED 3N1PC 4O5LH 4WEBH 4XXDB 5FKPA 3F7YB 5IMLA 4XP9L 4TNVF 1RK1A 4YDKH 1OGAA 1U8OB 3HE7C 4LSRH 2HT4C 4J4PD 2IG2L 3WNPA 4HFWA 3LRSB 4L5FH 4JFDE 3HS0B 3AU1B 2VDQL 1UJTA 2EDXA 1BOGB 1HI6A 3C09C 4KFZC 2NR6D 3M07A 5HGGS 3NIGE 1LP9B 2VL4A 3W11D 4NN7B 1AGDB 3FO9B 1N2RA 1G9MC 4MGXA 4JO1H 3ZMRA 4LP5A 4HS3B 3SCMC 2Z92B 4YUEH 2J4WH 1A1OA 4NFCA 1RVFH 4HWBA 3GB7A 3QDJB 2Q8BH 2VL5A 2LU3A 3DX9A 3GRWL 3SQBA 1J87A 3MRBB 3RUGA 5DQ9B 3KHQA 5DMKA 2NY1C 3NPSC 2B2XH 2R1WA 3PGCB 5C0JA 4YX2L 4OV5B 3KJ6H 3VXNA 3OF6D 3VMOA 4WUKL 4JDZB 2A6JB 4W68A 5IVZB 1A4KA 1AFVL 1E27A 2Y6SD 4FFZH 2QSCH 1UXWB 1P69B 1N3NA 4JG1H 4Z0BH 5A1AA 4HWZB 4BUGA 2OMBA 3EO9L 3WUWB 4MX7A 1SVCP 1G9EA 3GKZA 3NCBB 4ZFOL 3SPVB 4M5YL 3VWJB 4OI9A 3VFUB 3TP4A 5BQ7B 4BSWA 1JL8A 4G8GD 1FVCB 1MCOL 1LO3L 3ARDB 3EOBA 3MLXL 5E70A 4L8BB 3IVKA 3RZCD 3MZTA 4PJ8C 5IEKB 2ICCA 1FNSL 2W65B 1I3RA 1E6JL 1WBZA 2XACC 3HC0A 4IIQC 5DGQA 4X5WA 3F7VA 1E4KA 3WIIL 2BHYA 1NL0L 5I8KH 4HIJA 5DURD 3QIUB 2GJJA 1RJYA 2BXZA 5DJAB 1S9WA 3ULUF 4O51B 4TNVK 4IDJL 1KCSH 3MJGX 4EUPA 1HH6B 1INEH 2F53A 3IS0X 3VMNA 4TSCH 4EDXB 1IGIH 4Q0XH 3T77B 2VIRA 3LAFA 4JRXA 4MA7H 3MRFB 2OZ4L 1OAZL 4YHNA 5C71A 5L8LB 4MCYA 1E6OL 4NQCE 5BVPL 1RI8A 3QPXH 2Y07H 3SDCA 4P3CL 1I8IB 3TZVA 5A43C 2F54A 1CG9B 2KKQA 1PLGL 4NWUH 1NCDL 5LJYH 2ZUVA 3WUZA 1WGOA 4OLYL 1BGXH 2NY5C 1AXTH 3U7WL 3QIWA 4WW2A 2MTPA 4KAQH 4S1QL 4XNUL 3W9DB 4FQCH 3MRLB 2YA0A 5LVEA 4MAUL 3NFSL 1A9EB 1B90A 4X7DC 5DEGA 3HFML 4KUZH 5IGXH 2NY0B 4P5TD 2DL2A 5E6ZA 4N8VA 5ELIA 3ZDYE 4FFWD 1HHJB 1AGEA 1FSKB 4JKPL 1A7QL 5JORA 3V4UL 1S7VB 5ETUA 5D71L 3WUWA 2W9EL 5H8DA 5JQHC 3EZ8A 5IEKA 4TSAL 3VXSE 5B38G 5ESVA 1JZ8A 3OXSB 1BREA 4JZJB 2LFGA 5H94B 1HXMB 4TQEL 5ENWB 2BHZA 1L0YA 2XPGB 4WU7A 2MCG1 5C86A 3KXFB 4I0PA 2E3VA 5D7IF 4ZDHB 5IHUH 4XVJH 3L3JA 4F9PC 5ICYA 4JGUA 5DMKB 3RBSA 2MSPA 3GGWA 5T3ZD 1NLDH 4J3WA 3IDIA 2IAND 3O0RL 5ICZA 4OD1H 3MJ7B 3RHWK 2IFFL 3WS3A 1H3WM 4HUWA 1AO7B 3BZ4A 1YYLL 4IIQB 2X6MA 2OJZL 2UWEF 1E27B 4GAFB 4UOJA 4BQCA 5GZOD 4CU8A 4KROD 3ARGB 4JLRA 3TYGH 4L1HA 4WCYH 4OZHB 4UNTA 2HJLA 6FABL 2A1WL 2VDRL 4TTDD 3O3BB 2FX9L 4NQXB 4PLJD 2AJYL 5D7JA 1OTSD 4JANA 4C56E 5B38A 4RFNB 1BD2A 1CLOL 2IH1B 4U2YA 5I71B 4OAWB 3VXUE 5FYLH 1KJ3L 3NZ8B 4QXTB 5IB3B 2XZCH 1YNLL 3RUGE 3TVMD 2IQ9L 4Q0XL 4NCC2 1H3PH 1OT2A 4U3XA 3CSGA 3G5XA 3LKPA 3MRPB 4XNMB 3AVEA 4OGAC 5HGDA 3NA9H 1FGVL 1JNNL 3H9SA 5JZ7D 1G6RB 4HT1H 2DQHL 1T03H 4Y4FA 4LLYA 2P8PB 5IWLA 1TVDA 32C2B 5D7LB 4M4PA 3U7WH 2Q8AH 2FJGB 1BMGA 1NDGB 1VFBA 1U8HA 3F58H 4XPHH 3TVMA 4JO2H 4C83B 1PSKL 1ZS8B 1R5VA 3P9LA 4PP2B 1OGAE 1M1SA 3MGAA 5GS0D 4LPXA 1F2XK 4OLXL 1WIPA 2BVPB 1M6OA 4NKDB 5AG8A 5J9PB 1PY4A 1A1MA 2VLRD 1QLEL 4OUUA 3F8UB 1EHAA 3QEGL 2VZSA 3D25B 1E6JH 2V2WB 4FFYH 5IB3A 4UV7H 1PVHA 5DD5H 3ARBD 1H15B 1CFVH 1DBJL 1B6UA 3W82A 1ADQH 1YMMD 2X42A 3JWOC 5EUOE 3DOSA 3G6JE 4HIEB 3BWUC 3O3BA 1KB5H 3WO3B 2DLHA 4RGOL 3U46A 1I4FB 1Q0YH 1M05A 3BI9X 3RGVA 2XFXB 4TSCL 3MLWL 3PABA 4OZFB 2OJZH 5DRNB 3FHQA 2ATKB 1CBVL 2RAMA 2MOVA 2Z8RA 3MV01 5KSAB 1N5AA 1WWWX 1OAYH 3OBAA 4XMLL 1JNJA 1NGZB 1BOGA 3T0EE 1DFBH 2J8UE 3CFKA 2NY0D 4P5TB 4X6CB 5KVEL 3QEHA 1HKLL 4U33A 3U4EA 4JPIA 3V9FA 5BVJB 3LS4L 4U1LA 3BD3A 2JJTA 4LPYA 4JB9L 5IBLC 3C2AH 5DJYA 3T65B 3OXSA 3PL6A 4PRHA 4XCEA 3K0WA 1AR1C 4PJDE 5KSAD 3VXMA 2MCPH 5DHVA 4AQ1B 2XN9E 3VWKA 4OCSH 4KK9C 1T89C 1WT5C 4FNLH 2B5IB 2XPGA 3FT4A 4YJZL 2R4RH 2VKXA 1HNFA 1UWXK 5J6HB 5IMOB 3EFFA 2C1OA 4PRAB 2L4OA 1EEYB 4FXGA 1G7HA 1VGKB 1RZIA 5LG1A 1UM4L 4TSBH 1MWAH 3L7FA 1DVFD 1IJ9A 1Q38A 3ILQD 1DQLL 4LMQI 1P1ZB 4MQTB 1WISA 3ZDXE 1JGUL 3RNQB 5IW1A 4N8CL 1ZLWH 4N9GB 1CDJA 5I1LA 5I17A 4JO2L 2VLKD 4IOFC 3TM6A 1XF2B 4KMTH 3C6SB 1DUZA 1V7ML 4XNMA 2J2ZA 4KXZI 3IU3B 3S35H 6CGTA 2W38A 4F8QA 1F97A 1NDMB 4M6AA 4ZUVB 1I85A 2IFFH 1JI1A 1HK6A 4PR5A 1H3VA 1ZEAL 4LHQB 1AR1D 2B4CH 1KG0B 4NKOB 3JZ7A 4G6MH 3JV4B 4WFFE 5IBLD 4PTTB 3H9ZA 2D7PA 1WV7T 4D94A 4WWKB 2AJVH 2N1KA 3A0OA 5IP4A 3S5LG 4CW1B 3FO0L 2H9GA 3WIHA 1X5HA 5HVFB 1JMZA 4MD0B 2XOTA 4GG6E 4K9EL 1RUML 1E4JA 2GSIA 3QDMA 2E27H 3IFOB 4LSRL 3BHBA 1G0YR 1JFQH 1KCKA 1OLZA 5CZKA 2B39A 1UB5B 1T83A 3NFNA 1IC4H 2IALA 3HFMH 4KUZL 2RHEA 4Z77A 2J1KA 1FGVH 5I76B 1AD9A 4KY1L 1OAQH 1I9RH 4DFIA 3VG0H 4OF8A 4P2QA 1S7WA 4XPAL 5I1EL 3MPCA 5FIEA 3B9AA 4OLZH 5DJYB 4R8WL 3VFOB 1OOAA 5CZVH 2OBGA 5MEPB 1A7RL 2VTFA 4L1DA 2P5EB 4ZAKB 2VSCA 3LHPH 3UJIH 4EI5A 4LCCB 2YR3A 5DMGD 1C5BH 3P9MB 1NBVH 5MP6L 2LVEA 4M00A 4B41A 1OARL 4RA0C 3FN3A 2ZCKH 4LCWE 2ARJQ 5CFHA 5EU4B 2DLEA 3MO1A 2AGJL 4GAGH 4NHUA 3P4MA 4CKVX 3CMGA 3RVXC 2FHBA 5DMGC 3O45B 3PF2A 4H26B 4TOYL 3PGFL 1B0GB 3OKDA 4U6TA 5I74C 4HC1A 4RBPK 5E94A 5EZLB 4I2XB 3X12A 2YPVL 3P11H 4MDJA 1S9KC 4FFWC 4GT7A 4P99A 2WBWB 4PY7B 4QHLA 3O4LB 4Z7NE 5C0BE 3MRJA 2VAJA 2R29L 3ZKMC 3TA3D 5A3ID 4JG0L 3GSNL 3SY0A 1I1AB 3G04B 3BRFA 4LRIC 1KB5L 1WFTA 3MV9B 5H35B 4G42B 4Y4KD 5GGTA 4M7LH 4HLZG 1MLCA 4CMHC 5B8CB 2IPUK 4GKSB 3WFHA 5CLWA 5F7FA 1RIHH 1OCWL 1T04B 4ELMA 2BVUA 5IMKB 4H88H 3KLHC 3U30B 4WHYG 4GW5A 1K5NB 2YXMA 2F5AH 2OMNA 2FO4B 3GBNH 3MGOA 2G5RA 4ODUA 4YWGL 4G8EA 4V1DE 3V5KB 5KG9A 3HMWL 4X7TB 5F1SA 5FCUH 3IJSA 4YGVB 2EYRB 3U79A 4KRPB 2CIKB 3C2AL 4JREB 1QBMH 3I6GB 3T04D 3IFLL 2ADJB 1A3RL 4YIQA 3LRSA 4OFVA 2OJEA 4TUJB 1F3DH 4N68A 4P2OC 5BQ7A 1CVRA 2J6EH 4BZ2L 4NC1C 4ISVB 1HE7A 5SWZD 4U6HA 4PJ5D 3QXUA 4FQLH 2FBJL 3IETA 4X6CF 3DBXA 2HT4D 4J4PC 1YJDC 3LKNB 4NN7C 5LAXB 3AREC 5HYJE 4YDVA 3JV4A 4UB0L 5E95B 2QSQA 4MNHA 1YNTA 4QOKA 1VFUA 3PJSB 1VPOH 1N4XH 5KVDH 4K55A 3T2QA 5I6XC 5DXWA 4ODTL 4TUKL 4DCQB 4HHAA 1KJVA 1FJ1A 1BIHA 1NUFA 4NQCD 3HAEG 1N8ZA 5F88B 4LSUH 3ZLQC 1ZANL 1JN6B 3T0EB 4S1DC 1J86A 4F7MA 4NKQB 2A74B 2GJ6B 3SKOB 5FO7A 3MODH 2XZAH 4X6CE 3SDYH 3ZO0A 1QFWI 2BRQA 1DBAL 1ODAA 3R0NA 2DLGA 2HJKB 4M3JA 2VDQH 4Y4HC 1R3JB 5T1DH 4Y5XA 1HZHL 3BXNB 4JR9L 4QRTA 4BFEA 4WIQA 1NEZB 4PRPB 2BNUA 4OD2B 3SDAA 4J8RA 1Q9LA 3T0XA 5HTSA 1CICA 1EZVY 1CFQB 3QHZL 2Z8VC 4PGDA 3QRGH 1J5OL 2P5EA 5E08L 1N3NB 3F65A 5CD5D 1XFPA 1DLFH 1OCWH 3CDFA 3VXSD 2IPKA 4NNYB 5K9KA 5TFSL 3DRQB 4D9RE 5DJ0B 4EUPH 3QIBA 1KCVL 4LCYA 4K94C 3EOTL 5E6IC 3PNWB 1XGUB 2DQDH 3GMPA 2R1YA 5D4QA 3RZWA 6FABH 2V7HB 2NXZC 1LP9F 1O5DT 3CXDL 3VCLA 2R2HB 1HSAB 3CIQA 2CKBL 1ETZA 3CFDB 3I75B 4N0FB 5TQ0L 4U1LB 1NCAL 3DMMC 3EHBD 2EO1A 1VEMA 2CRZA 5EN2B 3OB8A 1GGCL 2XKNA 3R1GL 1NJ9B 1CR9L 2XKUA 3UPAA 1FAKT 3ZKXC 5B4MC 4R2GB 1GOHA 4OGYL 4QHKI 5I66B 3EDJA 4YHNB 3MRHA 4KMTL 4JHAH 4ZTOL 4KPHL 1JHTA 2E8ZA 2VLLA 3ZSTA 3V0AC 1SYSB 2XQYK 4HF5H 2UZYB 4F3FA 2W0LA 4D3CL 5JR1L 1NCWH 5T5NG 3TN0D 3T1FA 4WUUD 5T33L 5KBNC 5EFIB 2D7TL 3UMTA 4PLNC 3TJHD 3FFDB 1ORQA 3P11L 4HIXL 1JV5B 1P5VA 1N4XL 2O61A 1WBXA 1EBPA 2BSRA 5E8PA 4OCYH 4I5BB 3GMRB 5C6TH 2R39A 5C2BL 3C6SA 4LIQL 4JPVH 4KH2A 4U1SB 1XF4A 5HY9A 4BJLA 5F7WC 4Z7UB 2DM2A 4RMSA 1MOEA 1Z9LA 4PJCB 1FFOB 1G0XA 2EO9A 5IK3B 5EC1A 1Z6JT 3VXUD 7FABL 1NEZA 2X4UA 2OZ4H 3U1SL 4L4VD 4JFOA 2IAMB 3QDGB 1BZ9B 2HT3C 4ZFFB 1BOYA 4HPOH 3U9PH 1H8NA 1J11A 3DVGB 3GI8H 3PWVB 4GW1A 4RWHA 2JB5H 4WTXA 1BECA 4MQSB 2K9UA 1MCCA 7CGTA 4PYHA 4RGOH 3DBXB 5GQBA 3EO1B 4GXUN 1I8MA 1A7RH 5GGVH 1WZ1L 1T89A 1WT5A 1ZTXH 5C0FA 1QSEE 5IVXA 3TBWB 1I7RB 4L5FL 3BYYA 1F6AA 1YEDB 4QNPF 4X4XA 1CBVH 1JGLH 3IDGB 1UM5H 4I48A 1Z5LB 1C5DB 1XCTB 4NGHH 3WLBB 2ITCA 4L3CB 1OAUL 4I2XE 2C1PB 1PW3A 3EYOB 4Z7UF 1OB1A 3KPPB 4EBQL 4PJHE 1R3KA 2AEIT 3I6LE 4PREA 1EBAA 4FG6C 2QV2A 1RPQA 4OI7A 1P84J 1JPTH 2XZQL 2D0GA 1NCAH 1V5JA 5MEPA 4PGJA 4R7DA 2QR0B 3MCLH 5EOCH 4UB0H 2HVKA 1GL4B 1CFTB 5BRZD 4JFOB 3QUYD 3NTCL 3HRPA 5DJCA 4NDMA 5B22A 1RHFA 3O4OB 5C92A 5JW3L 3OZ9L 3QAZC 2ARWA 1XR9B 2VLJE 1LO5B 1TENA 3DX7A 4JFXA 5DR5H 1MFBH 4K71C 5DQJB 1Q1JH 1HOCA 2ZOKA 1MQ8A 4UIKL 4RMVA 3WBDA 3QUYB 2EE6A 1FNGA 1MIEL 3BEVA 1RY7B 1YEKL 4Y7MA 1DANU 1QSFD 1KC5L 3QYCA 5TGBB 1OTSC 4F57L 2C7UA 2Y5TA 1T1XA 3S35L 3MX0A 2E6PA 2GTZA 5IEHB 5J06A 3UXFA 2GYSA 2FJGA 3AS1A 2VDKL 3D2UA 1C5CL 4ZODA 2HVJA 3EYSL 1KLUB 3PWNA 4X5XA 1F45A 2BZDA 1QSED 4GS7C 2DQDL 4HQQL 1MFEL 5D5MA 4R4BB 1J05B 2EDOA 3BP4B 4M4RA 3MRQA 1MFAL 5ANME 4JZOA 1ZAGA 3T1FB 2BERA 2QHRH 1KNOA 1LEIB 3E6HB 4JFEA 1UH3A 1Z5LA 1QBAA 2Y06H 2M1KA 3LVEA 5I15L 1UEMA 5J3HC 2GJ6E 4HIIA 4WI3A 3Q3GA 3VXPA 1QRND 3IDXH 2IQAB 5E8EA 2ZNWA 3ZDZF 4OB5L 3KJ4B 3O6FD 4BFIB 3U36A 4LAQH 1SJEB 3MRMA 3PXHA 4PJBF 4ESKA 3CC5A 5T33H 2O5ZL 4OF6A 1JPTL 5I8OL 3MODL 4JN1L 4ELKA 3GSXB 5C6PB 5HHOD 4LDOB 1KIUA 3BHBB 1KFAH 4PJXA 5KW9H 1KGCE 1YN7A 3FOMB 4IJ3C 4KTEL 1WCQA 5E6ID 3FQNB 1SEBA 3DVNA 3D48R 3D18A 1YECL 3BZFB 4I0PB 3KXFA 3L3OB 5E8OB 2BSSB 2CUIA 3R06B 5C70A 1AGBA 3VA6A 2I9TA 4WWID 3RZCA 4FQQA 1FSKC 1KEML 4JZJA 3IJYA 5I1DB 1B2WL 5DSCA 5I74B 1YC8A 1KJVB 4WENB 3L7EA 4ZS6C 2J12B 3FQRA 4ZQKB 5IUSA 3E8UL 1A1NB 1KCVH 2AERT 4PJ9D 4Y5XB 2CJUH 4BYHA 4HPOL 2GIYA 2R29H 4PRIB 4EXPX 1OT1A 3GI8L 4XNXL 4X6BB 5EU4A 4APQB 2X4SB 4LF3A 3VWJC 2XY2A 5CEXA 3NIFF 2J4WL 1BBJA 3TIEB 3AS0A 4Y16C 1UG9A 4IS6B 4NRXB 3EYSH 4XCNA 1BAFH 5C0CB 1EV2E 1XT5A 4NRZB 1FDLH 1X4ZA 4GAJL 1ZHLA 3P0YL 2ZSVA 4QO1A 2BDNL 3CDGB 4N5EC 1U8PB 3M8OH 5EC2A 2SEBB 4HXBL 1A6TB 5FYJE 3ROLB 4BQ8A 4WUKH 1F90H 5C8JA 1ACZA 3BN9C 3SGDI 5EU5B 4POYA 1A1OB 1BVLA 4DGYL 4NJAH 1BX2A 5E2WL 4PJXF 2YC1B 1ZLSL 5J3HD 1UB6A 1DDHB 1QBML 4KV5F 5EBWB 2FR4B 2GKIA 3FKUS 4MA8L 4AK1A 4L4JA 4U1NB 1I1RA 4XH2A 1UCTA 5TDNB 3B9VA 3DYOA 4QRPB 4YDLC 2VYRE 4XGZB 4PS4H 4OCWL 1UQSB 3DSNA 4TTDC 3HZVA 4WI7A 4X4MA 4NN5B 2X7LA 4XCCL 4A6YA 1J05A 4Y16B 1U8NA 3CD4A 4OCXH 1M7IA 2DQTH 4U31A 3EO0A 5BCAA 3GHEH 5F1IA 1HHKA 2ZUQB 3BJ91 5KANG 1J8HB 4XHJC 1FFQA 1WCBB 3DIFA 4WTZA 3QUZC 4GKNA 3WIIH 4W6WB 2R4SL 4DOHB 5DGRA 5BRZE 1NFDA 4A2MA 4KQ4H 4PG2A 2R2EB 2APBA 3X14B 5FHAL 3EJYD 4EZMA 3KLHD 5F97E 2FJHA 2A6IA 2HFEA 1P7HL 1BJMA 1I1FA 3BKML 4WO4A 2XIDA 4D9LL 4NM8H 3BN9D 3TBTA 3H6JA 2XZZA 3ZKQD 1CD9B 5T1KA 3HZKA 5GGTH 3QDHA 3MV9D 5CJ5A 1D7FA 2JIXA 1D5MA 3OAYH 4GRLA 1RZJL 2IAMA 1CFVL 1CXLA 3KPSD 1X6NA 4M1CD 4MNGB 4P46C 3OJMB 4QF1B 1MCPH 1QRNB 2Y07L 4LLMA 3AROA 5BS0E 5ALCL 5FXCH 4X9FA 1PLGH 4RDQF 1UQSA 3RDTB 1MAJA 5ESVB 2QHRL 3OMZA 1Q0YL 4R0LB 1H9VA 1IKFH 4YDLB 1X3DA 1X7QA 5E08H 2GAZA 1CI5A 4WV1C 3FQUA 4E42A 2BVQB 4Y19B 3CLFL 5DMYA 2R8SH 1ZS8A 4WNQA 1W72A 1C16B 5JW3H 2I27N 3ARVA 3GSQB 3HMXL 3MRNB 1QNZL 4BELD 4KDWA 3QZWB 4GKZB 1R3KB 2APFA 2DQFB 5DJDB 3LDBB 3O6ML 5GS0L 1G7MB 2XY1A 3D85B 5C9KA 2NX5D 1U8OA 3LKSB 1M4KA 3DX8B 3GDBA 5T1MA 4S1SH 1CLCA 4OCNC 1BQHG 3REVA 1MIEH 4J3VA 4QRSA 5E4EB 2Q76A 3O2DA 1NGPH 4D9RD 4AEFA 4DKEH 1TVBA 1XGPA 1TTUA 4ZO9A 2DICA 4G3YL 1CGYA 4Y4FD 5CJ8A 5KOVC 1RHHB 1OTTC 5CLTA 5ID0B 4N0FA 3ALWA 1LO2L 5E9DB 1IQWH 3WLWC 2A73B 1DQLH 4JY6A 2X4NB 1A2YA 1XF2A 4YR6B 2F5AL 2YBRA 1S7TA 4PJHB 4BZ1H 5CGYC 1AI1L 4NQEE 2FJHB 4KGJA 1KTLB 2GHWB 1DBML 4HFUL 2DQEH 4KQ4L 5DTFA 5IHLB 2YD3A 3IGAB 5FGSA 5F7DA 3KNBA 5BS0D 2F8VA 1ZA6A 4G80B 3UJJH 2JB6B 1T20A 2X4RB 4PJGB 1KOAA 4XPFH 3F12A 1MY5A 4KXZH 1YC7A 4KTDH 1S5HA 5E2TL 2ZCHH 3BXNA 5L2KD 2DJ4A 3CVHB 3OAUL 3NA9L 4D8PA 1BP3B 2IBZY 3GMRA 1XGQA 4NNPH 3HNSL 3LQZB 2HRLA 3WHE1 2W91A 5BV7H 2VDNH 5KOMC 4R2GD 3FFDA 2DYPA 2OS7A 5JW4R 2GK0B 5C0IB 4GW4A 3PQYD 2A73A 3JWDL 5F96H 5K59E 4FQ1L 1MI5B 4KJQC 1EXUA 1JGLL 2DOCA 2PO6A 3QG6B 2GFBA 4JCMA 4BSVA 3Q3GB 2RFXB 9CGTA 4LSVH 1XGPB 4OAWA 4RX4D 4RGNE 5CSGA 2RB8A 5D1QC 3SQOL 4OCWH 1LE9B 2HKHL 3ZSSA 2D0FA 4OV6F 3MZGB 4GOSA 1AGCB 4LCUA 5LGHH 1MHHA 3KYMA 5D1QA 5CZVL 2NY7H 2Z35B 5BOZG 4QNPE 4DN3H 1EGJL 3SGDH 3DRQA 1KTRL 3BAEH 2Y4SA 4HJJL 4OQTL 1S8DA 1IZKA 1PG7X 2CJUL 2E7HA 3L5XL 3FQWA 2R1YB 1XR8B 4DKEL 5MHSD 4CVXB 2JLLA 1HHGA 3QI9B 5C0CE 1YPZF 4Y2DB 2PTVA 1C16A 1MJUL 3MLYL 2F53B 3WXVL 4WY7H 3WLWD 5C0FB 2IPKB 4NNYA 3TZVD 1T21B 3QRGL 1WBZB 3B3IA 2EC8A 1X7QB 4RNRA 4ODXB 1KLFA 4PV8A 4K7FB 3DV6B 5C0AE 1H3TA 5D2NA 2CDGB 3UTSB 1JIBA 3L6FA 3QUXB 5D2NC 4HX1B 3HI1B 4ZUSA 5E2VL 5SX4H 2VXUL 3BGMB 5DD1L 1YPZE 3K4AA 4HS8H 5TQ0H 4NWTH 3ECBB 4LARL 3DUSA 5JPNB 2KH2B 2NX5E 3MREB 4U0RB 2EYTA 3O3AB 1BFTA 1CGSL 4XP4L 1A9EA 4HWZA 3VGAC 1RIHL 5GS0C 4MA8H 2O5YH 2NLJB 2OR7A 4H88L 4OBRA 5BW7A 3MLZH 1Y18B 1RURL 4HGMA 5C07A 3DX7B 4JFXB 2QADC 2HKFH 3WKML 4XCCH 5BRZB 2AI0H 4YHPB 3ARBC 5C0DB 3KPSA 3QCUH 4M1GH 4JG1L 5SWZB 4Y2DD 2LAGB 5JZ7C 1QHPA 2YHGA 1NKRA 1A6AB 1X5ZA 2Q7NA 2AV7A 5IT2L 3WUWG 1KB5A 2VB5A 4BZ2H 1FC1A 5AAMA 3T0EC 4AL8H 1MHHB 3KYMB 4R4BA 1EAJA 3JVGC 3UTSD 2MPAH 3JUZA 3O3EB 3WMSA 1MVUA 2Y6SC 1VKXB 2B4CL 4GSDH 1M7IB 5LXGH 1IM3A 2Z31B 3LEYL 2HJLB 2ZKHH 1DBBH 3D9AH 1S3KL 3K4DA 5AWNL 3SE4C 3B9KC 1K8IA 2DWDB 1NL0H 1ZE3C 2GY7B 3MGOB 3BSZH 1W0WA 3T3PF 1ZGLB 3KLAB 5TF1L 3DVIA 1IGML 5GRUH 4WUUA 1PEWA 5JIPA 5F9AC 2AJ3A 1QLFB 4LSSH 4QCIB 1IKFL 4X80H 3UJJL 2ENSA 5C07D 2ZOKB 1OW0C 3HZKB 3IDJA 3B9DA 5D96B 2EDNA 5JO5B 3QULB 1PYWA 3MJ8A 1KCRH 3BPCA 2Y23A 2BMKB 3DO7A 1FAIL 2FGWL 4GQ9L 4HK0B 1OP9A 5JW5A 5GJSL 5ISZB 1FC2D 1LDPL 2VZOA 2P8PA 3O45A 1CD1B 5TDPA 4LLDB 3S4SA 5IV2A 3SGKC 4JDVA 1XR8A 4QXTA 1J8HE 4OLYH 4PGCB 1ZVYA 3V0VA 2AJSH 5DJ8B 2P49B 4JFQB 1A7OL 4MJ6B 2PXYC 1MVUB 5GZOC 1VKXA 3BIBX 4E0RB 4PJEB 4OCLC 5C0EB 1QEWB 1P6FA 1QTYT 1BM3H 3IT8D 1YY9C 3A67L 3EAKA 3HG1A 5TQ2H 5DUPL 3OSKA 1OARH 1FNEA 3Q5TA 5B3NA 3T4AB 1F4YH 5E56A 3ULUL 2VXSL 4OD3L 4DGIH 3CU7A 4IRSC 4MXWL 4JPWL 5AYQA 1MFBL 3SGJC 4NO2B 3E3QE 1RUKL 2GT9A 2W9DL 5FM5O 1QRNE 2BFVL 4HKZA 3REVB 1MCQA 1U9KA 3R1GH 3VFVB 4M8VA 5C0GA 4Z8FH 1K4CB 4RFNC 4HIHB 4HUMB 3E1F1 1QD0A 2P47B 3OPZL 4FQ2H 4XP5L 4RWYH 1D5BA 2APVA 3TGXA 1R0AL 4HUXA 4F7TB 1JTPA 3V6OC 1UZ8B 4PGDB 1OGTA 4RX4A 4GUPA 3BWAB 4LASH 2AS5M 3S35X 5CEYA 3GNML 2V2XB 3T65A 1MRFH 4K8RH 2VLKB 4ZS7H 2ICWJ 2BNRA 3U9UA 1FIGL 4X5WB 1FPTL 2BP3A 3TPUA 4EQ2A 1HDMA 4OZGA 1B0WA 5C2BH 5IFJB 4OI8A 1KXQE 3UTTA 3TT3L 2XFXA 3ZL4H 2A9MH 2YS4A 4UT7H 4LCIH 5DJ8A 3LS5H 1KJ3H 2NZIA 5IBUG 4D9LH 1JZ7A 5HD8C 4EJ1C 4OSUL 1F4WL 2FEDC 3SY0B 4XPGL 1FO0L 4APQD 4N9GA 3LRHA 4JM2B 4KUCD 1S7SB 5JQ6L 4JFED 3GBML 3N1GC 5I1CH 4Y4HB 3T2PA 5E9DE 4AYFA 1YMHA 5KVFH 3WNLA 5CP3A 4LPWA 1MI5D 2CLVB 3LKOA 5JOPE 4POUB 4EDXA 5E03A 4CNIB 5A16B 3AM8C 3OJ2C 4JKMA 2EDWA 3CCHB 4Y8AA 1EGJH 4PJFF 3ORJA 4F15C 3MBED 5E99L 4WW2F 4HJJH 1OAXH 1TJHL 2BNRB 3IXAA 1SJHB 4DKDC 2G5BA 4F58H 3RWJA 1G6VK 3BUTA 4EI5C 4IRSB 4PJ9C 4NYLB 2HAZA 3BEWA 2YUWA 4LLQB 1RZ7H 2VKWA 1XR9A 1GSMA 4HUXB 3V5DA 5BXFA 2OK0H 1DQJA 4MVBC 1QA9B 1RFDL 4PG9A 4WFGD 3ULVL 4WFED 3U0PA 1URLA 3FFCB 1RULL 2JELH 2QKIA 3WXWH 4LRIA 5DFTA 4U1GC 4NQED 4XRCA 2FATL 4JJ5B 1VACB 5E00A 4I0KA 3RDTA 2NX5A 3QI9A 4HFWB 4I77L 3OPZH 4X9GA 4CVXA 4GG6F 2DQCH 4J1UA 1EHXA 4JPIB 4WGVB 3GSVA 4HH9A 5EORH 3S8WA 3DETD 4RRPG 5EWIL 3NAAL 1IE5A 5EZIL 1K4DB 1YNKL 3GNMH 2NW2B 5CEZH 3FONA 1EO8L 2VWEC 3BDYL 3G6JB 1F3RB 1KACB 2EH8H 3EOTH 1ZLUK 2G5BB 1AI1H 2OM5A 3EYOA 1LDPH 1AO7A 3BZ4B 5FHBH 4UDUB 3L1OL 4WI6A 1CK0H 1PG7L 4IDLA 3RL1A 4YXHH 2UY7A 1CLZL 4NM4L 4LCIL 1QFPA 4H8WC 2Y5EA 3OV6A 2QJDA 5T1KB 2OYPA 4G9FE 5L2JA 1FV1B 4RA3A 3WFZA 4KTDL 3P73A 4K7PH 4NC0B 4P4KA 4U1SA 3VFPB 2F5BH 4LPUA 3D0VB 1A6UL 1N5YH 2QQLL 5SV3A 3ULUH 4QRUB 1MNUL 4JFYA 4PP1D 1IGCH 4MJIA 1JF6A 3L3IA 1LO0H 4GKNB 4MJ5B 1IEBA 3UZEA 3UBXG 1CZ8L 1MAML 3O6FB 3P9MA 4L4VA 4RCAA 4RAVA 5GRYA 1T5XB 5F96L 1CDGA 3BX7C 4JO4H 4RFOL 3UYRH 4YBQC 3P40A 3JV6B 1DTUA 5BZDA 5FKPB 3IDXL 2NX5B 32C2A 3V4VL 3NCFB 5C08D 4RMQA 1MCIA 5DK3A 3O2DH 4YAQA 1VGEH 2XKNB 3MGTA 2P43B 1DSFH 4NT6B 1K5NA 1ZEAH 4JN1H 3BW9A 5KZCB 3FTGA 4W4OA 2IFGA 5EIIB 2DAVA 2GK2A 5HSFA 5F8QC 4Y4HA 5IMMA 5FECB 3T77A 4QXGH 4P3DA 4X9BA 1RUMH 4UT7L 3SE8L 1SBSL 4KHTL 1I4FA 3Q5YA 4J3OC 4MLIA 1S9YB 1WZ1H 3DX8A 5IB1A 5LCVH 4HPYL 4HWEL 1NANH 1GCFA 1YNKH 3GIVB 1DE4B 1OQOA 1GGTA 2JJSC 3QT2A 5T5NF 3TEUA 5FEBA 4GLRH 2LV4A 5D1XB 2JTDA 3MRDB 4PRPD 3GMQB 1F02I 4ZFOB 4G9DA 2FLBT 1ED3A 2ZJSH 5EOQH 4XCYA 1S7VA 5ETUB 1RJYB 4OGAD 1G9NH 1CD1A 5TDPB 4KDTA 3S4SB 3VXRD 3NFPA 4NWTL 1SY6L 2YK1L 4WI4A 3LMJH 4Z7WF 1U8JB 1CGSH 3TF7C 2C4XA 4S1SL 4YXLH 4FZEL 2ZCLL 4HMEA 4P2QE 1ZT1B 1R3JA 2JE8A 3A6CH 5F88A 3GSOA 1U2HA 3OZ9H 4Z7VE 5GS1C 3QJFB 3TH3T 4YHYB 3ES6A 5FYKE 5KZCD 3CH8A 2RQ8A 1RZIB 1NLBH 2DYPD 2PTUA 4URTB 2R2BA 2OP4H 5CWSA 1Q1JL 3T1WA 4BFBD 3TNNA 3BJLA 1A3QA 1JUFB 3QQNA 3Q6GL 5ICXA 4XB7A 5D1XA 1V7NL 4UTAL 1JWSA 1QSVA 3NIDE 4H0HB 1KXVC 4U6YA 3B9KD 5IR1A 2V5MA 2QSVA 1HYSC 3CXHK 5BS0A 1MCEA 1MJ7L 5HVGB 3O3DB 4U1IA 1J8HA 1DEEA 3BOVA 3MRCA 3V6BR 4MVBD 4OCXL 1CXHA 3F7RA 1MLBA 4PJAB 4ZOAA 5C0BB 1WTGT 3FL7A 4QOKD 4Z7WE 3I02B 4KKAD 3MR9A 5FO8B 4CJ0A 3HZYB 5I1KH 5EBLA 1PAMA 4FTVE 5I73B 5DT1L 3X3GL 4E41B 1S9VA 4YHYC 1L4IA 4NNPL 1O0VA 1T6WA 5FHAH 3QO1A 1EFXD 1JZ2A 5BZDB 3BP7B 4MD4B 3C08L 5I30H 5FCUL 2YWYA 4XNYL 5AYUL 1FNGB 2ZUTA 5DJ6A 1UB6B 3ZE0E 2NTFA 5ITBH 3PWNB 2EXYD 3CFEA 4X8JB 5F70A 3W0WA 2XV6B 1DQMH 3FQXA 4LCCC 5IFJA 2R15A 1GIGH 4MNGA 4QF1A 5FYKU 3TA3B 4K7PL 4R90L 3RU8H 3MRRA 2NY3C 1A6UH 2AEQL 3NFPB 4XBPB 2X4TA 3LEXB 1N8ZB 3BGMA 2FIKA 2EDDA 3TVMB 1RZ7L 3I2CL 2P8MB 3W39A 3W2DL 3MV11 5LGHL 3VFGH 2E6QA 5I8OH 3A6BH 3ULVH 4ZNCD 3RTQB 1LP9E 3LN4B 2HN7B 5F3BA 1WUNT 2CIIA 1FZOB 2FL5A 4KVCL 1RZFL 4M7ZC 5DZOA 4OT1H 3SO3B 4EOWL 4OFPA 4J3TA 1GAFL 1CWVA 2XWBB 3WXVH 3RVTD 2JJUA 5DQ9A 3BUYB 4OLWL 4P57B 3O4LD 1NLBL 2N56A 3BQUB 4QTIL 4DEPB 3ZHDA 3QUKB 5I18L 3GMNB 1DSFL 1X5KA 1T22A 2ATKA 1UACH 1WVZA 4MQ7A 5GS2D 1QR1A 2JCCB 4U1JA 5IVXB 1PD6A 3QUXC 2I9LA 3TA3C 3MNVA 1IAKB 4DFHA 3KDMA 3Q6GH 2EH8L 3MO1B 4Q9CA 3QH3B 3HG1B 1N7MH 5DEZA 4AIXA 5E8OA 4YH6A 3U0WH 2FEEI 5AZ2L 5J12C 4Q9QH 3MA7A 4M03A 3VGHA 4QGYA 5K93A 4K3HA 2CKBA 2NLJA 2RJMA 2YD7A 1OTTD 1KLGA 3VGFA 4IRJD 4QRRA 1NFKA 3T0VA 4FXKA 1TZIB 1HI6B 4LCYB 3S98A 4HIJB 4JKKA 5ADOL 4ONGL 3KPQA 2F5BL 3HR6A 2BVPA 3MRRB 4PLJC 5GIRA 4G42A 1OLLA 3QJFA 25C8H 5KVGH 1N6QH 2DL9A 3INUL 1P4BL 4M1DH 2CKBH 4L8SA 2A9ML 3FFCE 2PYFA 3HI5L 2NW3A 3L5HA 2DYPB 4NJAL 2H3NB 2YSSA 5D93B 5FFLA 4XBGA 4YQXH 3CX2A 4PFEA 3MJ9H 2B1AL 1JNLL 1G1CA 5B21A 3UYRL 1MJ8H 4PJIE 4M6OL 5CJBA 4F33A 1XGQB 3QXAA 5IT2H 4JQXA 2GJZB 1FYHB 4JRXD 4OGYH 5GRVL 3SKMA 5F9JB 2C26A 5BV7B 4PBVC 5KS9E 4OZIE 1FLRL 3OGOE 3VXRA 2PCPB 5I17B 1I7UA 1VGEL 1U3ZA 3S4SG 4W4NA 3EYQD 4N5UA 1AHWA 3HUJA 3QDJD 4UT9L 2HT2D 3ETBF 4K3GA 1YEGL 4MZ2A 1FFPB 3OKYA 3GHEL 4WWKC 1YEHL 3D2UB 1TPXC 4NQCB 3RDTC 3I02A 1YNTB 4QOKB 3QQ9D 4PYGA 2BNQB 2D03L 4GRWE 1S7SA 1V7NH 2VR9A 3LN9A 4KJYA 3RZCC 5KANI 4HK0A 1IKNA 4NZTH 4EOWH 2EZ0D 3LKNA 2JKXA 4N9OB 5D1QB 3R4DA 4PJIA 3WFDH 1UKQA 2YD2A 4KK6C 2VZVA 1D5XA 4X80L 5EIQA 2BSTB 1NCUA 3OJVC 2BVOB 3NCJH 5LWYL 4XVUD 4XNZB 4DJMA 1AGFA 2UY6A 2NY2B 5L2KE 1T0MB 2WLZA 3GGWB 3MACL 4HEPG 2L7UA 5IBTH 5HHNB 3MLRH 1C7TA 3C08H 3LKQA 4KZEH 3LKSA 1J1OL 1FL6A 3VXMB 5DRXB 5EOTA 5I8CA 5IB4B 3SCMD 3ULSB 1NMAL 1MFDH 4ODBD 1P7KB 3OR7B 2WWKO 4D2NA 5D5MB 2X1OA 1NBQA 3DSFL 3FZUD 4F2MB 5T5FL 1JZ6A 4EBQH 4NHCH 4NO2A 3OAYK 4U0QB 4M93B 4NKOA 4Y1AE 5IFHH 2Z91B 1A2YB 1UFUA 3CLEL 2ITDA 1Y6MR 4NZUL 2LQRA 2NY5L 3KPSB 1OVZA 2JIXB 1EHNA 4J3UA 1FFPA 4UBDD 2GJZA 3MCLL 1FNFA 1PDKA 4PJ8D 4RGMC 3SDDC 4U1MB 2O5YL 1QRNA 4M6OH 4Z8FL 1INDL 2PXYA 2XWTA 5D7LD 1WTLA 3L3DA 4PJAE 3IU4H 3SDDA 1MREL 1WC7B 1A1MB 2ADFL 3OR6A 4ODVH 1I9IH 1MAKA 4NO0A 2BVYA 2C3VB 1MF2H 1XGYH 4UAOB 5I18H 1LP9A 4HUVA 3QCTL 5DD6A 1RQ5A 1YEHH 4Q7DA 4L8DA 4K94H 1SEBB 1T7VA 1IZJA 3VWKD 4LLYB 1CFNA 3CSBA 2DJSA 2ADIB 5L7XH 2XG5A 4JDTH 1YEKH 3JBG7 3QDJA 2V2TB 5L6YH 1SMOA 1SQ2N 3PP3K 3MCKA 1K6QH 4L9LB 1W0WB 1UWEH 1FN4A 1I8LA 4AG4H 1T0NB 3C5JA 5D96C 4AIZA 4QXWA 3WFDL 5AYUH 4PJ5A 5DK0B 3L3IB 4PJDF 5HD8D 3NZ8A 3KYKL 2IALB 5K59F 3RY5A 1A64A 4MA3B 4WFHD 5LWYH 4N1HB 5EBWA 3KJ4C 4UBDC 3S36L 3WHXB 3MA9H 4NQSA 5AZEL 3HZYA 4P9MH 4RBPH 1BHGA 1FVCA 4U1HB 3U46B 4NBZB 3RGVD 1F6LL 2ENYA 2HTLD 3KVQA 4JFFE 3AREB 4ZUUB 1CQYA 3PABB 4OZFA 2EYSA 5E8NA 2HT3D 3MLTA 3QEQA 2DMCA 1JRHL 4ZOBA 4HUVB 3TNMA 4WW1A 2E9BA 5EUOB 3W81A 3QUZD 3VW3H 3TLRA 5CSZA 3V0WL 1RZFH 1LVEA 1A6TA 1T3FA 4YXKL 3GO1H 15C8L 4IRJA 1VADB 4JFHE 1FAIH 2FGWH 2XWTB 4WTWA 4WV1A 3EBAA 4OB5H 1HKFA 4PJBE 2UUDH 5DRZB 2N7BA 2OR9H 5HDBF 4LDLB 3H3BC 3VGGA 2AJXL 3HG1E 4DVRH 1YZZA 2GK0A 5F6HI 1AIFB 2FX8H 3C5SB 4C4KO 2AK4E 2PXYB 1PQZB 3AMKA 2UYLA 2DQUL 1NFDB 2R0LL 3U83A