1YC8A

Caban33- y37v/e44g/r45l triple mutant
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
117
structure length
116
Chain Sequence
b'DVQLVESGGGSVQAGGSLRLSCAVSGSTYSPCTTGWVRQAPGKGLEWVSSISSPGTIYYQDSVKGRFTISRDNAKNTVYLQMNSLQREDTGMYYCQIQCGVSIREYWGQGTQVTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-VSG immunoglobulin heavy chain variable domain cAbAn33
publication title Antigen Binding and Solubility Effects upon the Veneering of a Camel VHH in Framework-2 to Mimic a VH.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Immune system
total genus 26
structure length 116
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yc8A00
2OMBA 1AQDB 5EU6D 2CUMA 2ENYA 4JQIH 4LOUD 2OJEB 3N9GH 4NO0A 5D9SA 1WT5A 1MFEH 5EZOH 5B3NA 2I5YH 2A9NH 1G1CA 1B9ZA 2EDFA 4UTBL 4KKCD 4JDVB 4P2QA 4YDJB 3QPQD 4CN4A 1NMAH 2CLZB 5JMRA 3QUMA 2C3VB 3EDDA 4X7TA 1KEGH 1RUAH 4JG1L 1IILE 2DBLL 4GQ9H 4M7JL 3TA3B 2QHRH 3DGGA 3PIQB 5IW3A 4P2OA 2D03L 3CJJA 1S9XB 2F53B 3EYSH 2R23A 2EH8L 1UVQB 1IEAB 5B39G 1OTUC 5KSAD 3LAFA 5AZ2H 4JDTH 4U0RC 5FOBA 3EZ8A 4R97C 1J1XL 5IGXH 2APFA 3LPFA 3H3PL 4HBQA 4NP4L 5C8JA 4P2YA 2XZCH 3LB6D 1JPFB 3ARZA 3KVQA 1JGVL 1UEMA 5IB5B 1WEJL 5D1ZA 1NBVL 5HYSB 3TN0C 1K4DB 4R26L 5JPMA 4DZ8B 1XEDA 4K7PL 1KPVA 4FQHA 3WO3B 1A02N 5CEYA 3SBWC 3HE7B 5IFHH 1DEEA 4ZPTB 5E1AA 5HDBE 4M00A 2NY4D 5J6HA 3BO8A 2OQJB 1X5ZA 2B5IC 3TFKC 9CGTA 4HIHA 1GGIH 3ZE2F 2E3VA 2JKXA 2DQHL 2B1HH 3LKOA 2FL5B 2EC9U 1MI5A 3VJ6B 5CEZE 4JZNA 4MCYA 1NFKA 4KUCF 5FHBH 1KULA 4Z5RA 2VQ1A 4PJHE 3H9SA 2PR4L 3MLSH 2Y06L 4EOWH 1L6ZA 1CFTB 4XHQA 2YWZA 3NCYP 5SX5H 3PWUA 2VLKB 5DUPH 1KTLB 1F6FB 3ULSB 3K81A 1VEMA 1RMFH 3HE6C 3Q1SL 1OTTC 3DURA 5IKCB 1D5MA 3WDJA 5CEZL 3CUPB 4KHTH 5ESAA 4Y4KB 4F33A 2W65B 1A1NA 5GRJH 2BFVH 3B9KD 1MWAL 3G5XA 1UJ3B 4DEPC 1BREA 2BNQD 2E6QA 2C3WA 4MSWB 5DS8B 2GITB 4B53A 3U4AA 3G08B 5TFSH 3EO0A 2WINA 2X4RA 4Y7MA 3KWWA 3CPLB 3A6CL 3L3GB 3LRSA 43C9B 1S9KC 3IDYC 3T65A 3GNML 4P4KD 4Y4FD 3QIWD 4LDLB 3DETD 5C0CE 1JPTL 1QLEH 1JNHA 1BZQK 2HLFD 3I2CH 4LPXA 5GJTH 3T3MF 3LCYA 2WANA 4OZHE 4LGPB 1I1AA 3OKNB 1X3DA 3IAPA 4DKEH 4KKBC 3U0WL 1S5IL 5INDA 1MAMH 4APQC 1FZKA 4JKWA 1FYTD 3EO9L 4OGXH 3ARGC 4NN6B 1Q9WB 2BNUA 1RULL 1GC1L 4LARL 2HTKC 1EBPA 3MRLB 3FN3A 1WFOA 4R4FH 1KBGH 4WV1B 4QRRD 2VLJA 3MRRB 4F9PC 3SDYH 1I7UA 1MVUA 2ZUXA 3DRTB 1CLZL 2B0SH 3G04A 1UKSA 4XTRC 4AIXA 3HMXH 4QHMB 5IW1B 1XR9A 4M5YH 5GGTH 3CC5B 2Q8BL 1S9WB 2B4CH 2ZG2A 1PDKA 4EI5B 4DFIA 2IGFL 5I75B 1IL1A 5IMOB 1RUQL 2P7TA 1UB5A 1Z0MA 4MQXD 4BK5A 1KN4H 2X4QB 3FCTB 3GB7B 1FGVH 1UM6H 5IB1A 5DRWA 1TZGL 4LHUB 4HUWB 4L5FL 5T3XH 5J3HD 5EORH 2FX9L 3MR9A 1QD0A 2E7HA 1N5AB 2H6PB 2X4NA 4XPBL 3SQBA 3AREA 2BOBA 2A77H 3HUJF 3FT4B 4RMVA 4W81A 4QXWA 1PQZA 3JUZA 3HPLA 3D48R 3CFBB 4JZJC 4ZUUA 3CK0L 3FQTA 4XPTH 5INCB 3MLXL 2IFFL 1LHZA 4ZUVA 2X70A 1EO5A 3PUCA 3L7EA 3TCXA 3TNMA 1KIUA 4R90L 4MQ7A 1OF2B 1K6QH 2NLJA 4LSQL 1IKFH 1WFUA 2DLFH 4PPTA 3BKYH 4P9HH 3QDME 5IB2A 1A6UL 1QFUH 3BDXA 4JM2C 4YIQA 3VFUB 3MLZH 1NCCH 1AQDA 5JZ7D 3CXHK 4MA8L 4RQQB 3MUZ1 4TVPD 1YEIL 4YDKH 2OJEA 1NMCC 4H0IA 5CSGA 2FATL 5EOCH 4QRTB 4JDVA 3HKFA 3MLRH 4Z7WF 4G6ML 2CLZA 2FJHB 3AS0A 3ZTNH 5T3ZE 2MHAB 2C3VA 1JVKA 1EHXA 4JPWL 5GGRY 5J12C 3TA3A 4LQFL 1JGUL 3PIQA 1S9XA 2F53A 1UVQA 2J88L 4O02H 1ONQB 5GGSY 1IEAA 1A6PA 1FGNH 1E4WH 3ROLB 1MRDL 4I3GA 1BIIB 2HKHL 1JPFA 4NZUL 4X6DB 5T3ZL 5HYSA 1DVFD 1K4DA 4DZ8A 5JXAH 3MV8E 1FORH 1MIMH 5CP7B 1UZ6F 3SGDI 3H3KA 5F89B 2NXYC 3HE7A 1JGLH 4OD1H 2QADC 4ZPTA 2R9HD 3PJSB 2OQJA 3VI3E 4OLUH 2UZXB 3VH8B 1YPZF 1YJDC 1H3PH 1P7QD 4NNXB 5CD3A 4RMRA 3T0XA 1GGCL 3LZFL 3QUZB 2XIDA 5FYKL 2FL5A 1IAIM 2NY1C 15C8H 1IC7H 3WNNA 1IGTB 3V0WH 3VJ6A 5EWIL 5FGBA 3O6LL 3SKJH 2Y1VA 2OS7A 4WDIB 5JIKA 1BAFL 4HJ0D 1CFTA 2BC4B 5HVFB 1I8IB 3RVTC 2VLKA 4KK8C 1KTLA 1KELH 1VACB 4S10A 2V7NB 3ULSA 5E56A 3LD8C 4ONFL 4XCFL 1FNFA 1LEGB 5DURD 5IKCA 5JTWA 4XNXH 5BZWB 4Y4KA 3MGOB 3C09C 2W65A 4NO0D 1UJ3A 4IDLA 1REIA 3VGDA 1G0DA 4MSWA 5DS8A 2GITA 2N7BA 5J11C 3G08A 2XG5A 2FEEL 4JHAH 3B9EA 1BPVA 4P2QD 4GBXB 2AXGB 3CPLA 1WLHA 2NXZD 3L3GA 43C9A 1EVTC 5IW6B 5JDJA 4BQ9A 3CDYA 5E2VL 4GXUN 5HY9B 1LQSR 3DI3B 2NZ9D 3BQUC 2KL6A 3BGAA 4P2OD 4WI9A 3K4DA 5DI8B 3ILQD 2DS4A 4RBPH 1S7UB 1LVEA 4XMKH 5CILH 3SE3C 2WZPD 1BVZA 2OXGA 3NCFB 4KJQD 4JFFB 3B8SA 1ITCA 2WBWB 4QGYA 4KZDH 4RGNC 4F58L 1Q9WA 5D7IF 1JHKH 1E4XL 3Q6GH 4HEPG 4UV7H 5D2LF 1Z9OA 3C5ZC 3MRLA 5D1ZD 3N1FC 4P2RE 3CXHJ 4PJXB 4WV1A 3MRRA 3W0WB 3K8LA 1UZ8B 5C0BB 3DRTA 1IEBB 4H1LA 4NJ9L 4QHMA 2O61B 1DQDH 2VSDA 3QG7L 5IW1A 3CC5A 2DD8L 1S9WA 2OTPA 4XAWL 1IQWH 4X99B 4EI5A 4IBLT 4H26B 1G9NH 1NLBL 3HZMB 5IMOA 5MENE 1Q9LB 3WLWC 2X4QA 1MI5D 3FCTA 3GB7A 3JWNC 3NGBC 3B3IB 1ERNA 4LHUA 1JP5A 4HUWA 4LSRH 3OGOE 4HIIA 5BQ7B 3INUL 1C7SA 4M7KL 1N5AA 1YJDL 2H6PA 5LVEA 4V2CB 3H9SD 1AGFB 4DUWA 4BFBD 4WI6A 4XB8A 4X9HA 4FQJH 3FT4A 5DJXB 1DUYB 3LKQB 1CE1H 3CFBA 5FK9B 1JI2A 5ID0B 2E7CA 4Z7UF 5INCA 3VXSE 3HNSL 1KNOB 4OTXH 1HCFX 1CLYH 4XMLH 3D39E 2AVGA 2P48B 4FQLL 2B8OT 3B5HA 1OF2A 2H2SD 4JVWA 5TF1H 1UCBH 2B1AL 2NY0D 3ZT5A 3KPQB 4WO4C 3VFUA 1JV5B 4S0SD 5I8CA 4RQQA 1T66D 3MBXH 5L6YL 4H88H 4YHPB 4I2XB 5IM7B 3LMJL 4YHML 3O4LE 3CZFB 3PF2A 3SDCB 4QRTA 1KF9B 1I1AD 5SV4A 5EC2B 1RZ8B 1P4IL 4RGNE 3ORJA 4TYUA 5TE7L 2FJHA 1MIEL 4HS8L 5T1DL 2MHAA 1CD9B 2NR6D 3Q6FB 3NIFE 1KCSH 1LO2L 3D1MC 3I50H 4M1CC 1Z3GL 4TTDC 3EYQC 4XNMB 4HQQH 2VLJD 3QHFH 2AK4E 1ONQA 1A3LH 2YPKB 4F57H 3RTQB 5FCSH 4R4NC 4KDVA 2ADIB 4ZQKB 4B7LA 4X9BA 4X4MA 1HSAA 3ARTA 3ROLA 1MCOL 4IOIB 1BIIA 4ZTPH 5JUEH 4UILL 1T03H 1CGXA 4MNQB 5IIEB 4FZ8H 3V5DB 4X6DA 3B4NA 5HI3D 5HHMB 2GK2A 1CN4A 3T1FB 5CP7A 4P9HC 5F89A 4JO1H 3BPLC 1DR9A 4G6KL 2H45A 5B39B 5DMKB 3U2SB 1HINL 4RGMB 2CJUH 3PJSA 1LEIB 1SJVA 2DM7A 3R06B 3VH8A 3O11B 4R0LB 3HG1B 4NNXA 3BDBA 5AYUL 3QUZA 3ULVD 3CDFA 4G3YH 2P1YA 3GBNH 3VXMB 1S7WB 4C83B 5E00B 1IGTA 4ZODA 2Y07H 2UVEA 4KDTA 3MA9H 4AEIL 4I0PD 4U1HB 4PJGF 5L8KB 3TGXA 1FIGH 2B20A 4WDIA 4P3CH 3QFDB 4YK4C 3X3GH 5JW3H 5ADOL 2BC4A 1JZ4A 4YXLL 4L9DA 5AD0B 3RWGA 2MCG1 1I8IA 4OLXH 2ADFH 5IHUH 4YX2L 1VACA 5C0GB 2V7NA 1LEGA 3NFSL 1R3IH 4ZAKC 3TVMB 5E2TL 2V2TB 5BZWA 2JB5H 3MGOA 3KR3L 4NWUH 1MJJB 4PG2A 1QBML 1JNNH 2ZOLB 1CF8H 3BUTA 4KROB 1MJUH 5ALCH 1YNTB 1Q94B 1YEEH 3LIZL 4IRZH 4GBXA 4X7EC 2AXGA 5MP6L 2ZUWA 1HYSC 1HNFA 5IW6A 2MQ3A 4N5EC 1PSKL 4CVZB 4YE4L 5I8KL 2CKNA 5FV2A 5HY9A 2OZ4H 3RVXC 3DECA 3DV4B 5KSVA 4LK4A 3D0VB 2YEZB 4JPIB 2F53D 5DI8A 5DJCB 1S7UA 3SE4A 3BUYB 4U6VL 4JFFA 3NZHH 3EYOB 3I6KB 2YBRB 1T5WB 2XTJD 2DQEH 4PJXA 5CINL 3OB0K 4KVCL 3W0WA 3IFOB 1M7DB 1UZ8A 5C0BA 1FO0B 3MODL 1IEBA 1DN0A 3CVHL 3HE7D 1YEDB 3KG5A 4MGXA 4LHQB 5C08E 4RZCB 1NFDB 4OD3L 3SQOH 1J88A 2VWEC 2V5YA 1RI8A 4JFDE 4X99A 5I1HL 5TJWK 3QDGB 4H26A 3HZMA 4ODSL 1Q9LA 2AEQH 3MUGB 5GRUL 5E6IB 4HMEA 4CRPA 3GHEL 5ID1B 2V9RA 3B3IA 3D3VB 1RAMA 5F3BB 3T0AA 5BQ7A 2C1PB 3JWDL 1Q0XL 1J9CT 4ZS7L 1AGFA 1J12A 3V52H 4M4RA 3ES6B 1KENL 5IESL 4YH6A 4XP6L 4ELME 2IAMC 3NCJL 3ZT6A 5DJXA 4OZ4B 1DUYA 3BXNA 3FHQA 3LKQA 2J8UE 3NA9L 2H1PL 3A67L 4LRIC 5FK9A 2W60B 5ID0A 2G5RA 4GS7C 5TGBB 2YMXH 3CLEH 1KNOA 3CMGA 5CJ5A 2FR4B 1KCRL 4Y4KD 4NGHH 2A2QT 4PR5B 1WTGT 1BLNB 4FOMA 1WV7T 2CUHA 5IHLB 1XIWC 3G6JE 5DF0A 4K3GA 2I9TB 3F62A 3CMOL 1QPPA 5BW7C 3KPQA 1JV5A 3PHOB 5D71H 4D3CL 4ODWB 1M05B 4QWWC 3IJHB 4YHPA 4I2XA 1MJ8H 5IM7A 2X4SB 5DJ6B 3KAAA 4KZEH 3CZFA 3G5YB 3SDCA 5GSVB 2MOVA 5EC2A 4POZC 4FFYH 1RZ8A 1RZKH 2UZYB 1RZJH 3MMEB 2AJXH 4XNZC 5IB4B 5E70A 4LQ1A 3Q6FA 4ONOA 3RGVC 4HWUA 4PJ7E 2J4WL 5F1IB 7FABL 4XNMA 5D7JB 3LPGA 4P23C 1K85A 1ZLUK 2P49B 4GAGL 5SWSE 2YPKA 2YXFA 5JQ6H 3RTQA 2VWEE 2ADIA 4NM4H 4ZQKA 3SKOB 1NAKH 3OKLB 1H3WM 4IOIA 1DQQB 5A2IH 4MNQA 5IIEA 3S3PA 4HC1L 3VGGA 2X44D 3V5DA 2NY6B 4ESKA 1F4XH 4ZNEE 4EI5D 3MV11 3C5JB 5I1DB 4P5MA 5HHNB 2BVUA 2MPAH 3T1FA 4PJ5E 5H2BB 5B39A 1EFXB 4LHUD 5DMKA 3U2SA 1VFBB 4YUEL 3I3BA 3B2VL 1RY7B 1LEIA 4ODTL 1QKZL 3R06A 3O11A 4R0LA 2AEPL 3HG1A 2OL3L 3N06B 3FMGH 3O41B 3VXMA 3HZVB 1S7WA 5E00A 3DXAB 4MZ3A 4YBQC 5CD5C 2A6KB 3QCUH 5C71A 4UINL 4U1HA 1R5WB 1CLOH 1NDGB 3T0EB 2J5LC 3Q2CA 1L7TL 4FMKA 3P0GB 3QFDA 3P11L 4NUGH 3O2DA 1RURH 1YEHL 1OP3H 2WWKT 4G5ZH 3ET9F 5BVJB 1ADQA 1CDBA 2WM0A 4BK4A 2NY2B 5C0GA 4D9LH 3SDAC 3WNOA 2DIJA 3L9RB 4I1NB 1LO0H 1TJGL 3TVMA 4PJDB 4PS4H 2V2TA 3EJYC 2AGJL 4P46B 2WBJC 1K8DB 5TF0A 1MJJA 4LVOC 2ZOLA 1I9JL 1YQVH 4KRNA 1YNTA 1Q94A 4KDWA 1RIUH 1B0WA 4MJ6B 3BZDA 5F7EL 1U8PB 5F70A 3OWEA 1HWGB 4LDOB 4MAYC 3WHE1 4O4YH 4CVZA 4CN1A 3GKWL 2VN4A 3FB8B 5I1IH 3DV4A 1TVBB 4O00A 3D0VA 4QHLB 2YEZA 4H5SB 4JPIA 4R2GB 4GAFB 5DJCA 3MRDB 3BUYA 1T2JA 1BFVH 3QAZB 4RWYL 3VFGL 1U41A 3S36L 3QO0B 3EYOA 4HW6A 3I6KA 2YBRA 1T5WA 1KJVB 5D7SH 1AHWC 1QRNE 2VR5A 4I9WE 5D7KE 4ZO6A 3W11C 4WHYG 1AIFB 3MLWH 2LE9A 3KXFB 3IFOA 1M7DA 1FO0A 4HFUH 1NGPL 3V7AG 4KRLB 1NAMH 1YEDA 1YNKL 4YNYB 4RZCA 1NFDA 5D5MF 4WCYH 5DD3L 1H15B 4X6BB 1D9KB 1QHOA 2R1WB 4XC3H 4EDXB 4AMKL 3QDGA 2CD0A 1EAPB 4RWHA 1HHJB 3QUZD 1OT2A 3MUGA 5E6IA 3ELAT 4M6OL 3WSQL 4FG6D 5ID1A 3VGHA 4PRHE 3D3VA 4U6HB 1NH6A 3T3PE 3WIHL 5F3BA 4YBHA 2C1PA 1IGML 2OR9H 4RFOH 2EDKA 1CICD 1D5BB 4OM1L 3ES6A 1A7PL 3O0RL 1CVRA 5GS1C 3B9AA 4OZ4A 5DJAB 2XZZA 1WIOA 5I71C 2W60A 3ZL4H 5TGBA 1QYGH 2FR4A 5I73C 5C09B 4PR5A 2Z31B 5HYFA 1A4KB 1BLNA 4GAJL 1IGIL 3I02B 4NQSB 5KANG 3TZVD 1U0QA 4GBXD 4WFHE 5E8NB 2I9TA 4W4OC 3C6LB 1ZLWH 3PHOA 3VWJC 1CBVL 4ODWA 1M05A 4LFHG 3IJHA 2LAGB 2VLME 2X4SA 5DJ6A 1RJCA 4QXGH 3SO3C 1IARB 1D6EB 5CKGA 3G5YA 4XP9H 3HI6L 5GSVA 5CZVH 1WGOA 3MOAL 3V6ZB 5LCVH 1HWHB 1WWAX 3MMEA 4JFFD 5IB4A 4FFZL 4FQ1L 4Y1AE 1CU4H 1VFMA 2YZ8A 5F1IA 5D7JA 2Z92B 3O3AB 3W0WD 5E2JA 1FZOB 2QQLH 3ARFD 1GRWA 3SKOA 1W72H 3FONB 3CSGA 1IZKA 3OKLA 1U3YA 1HH6B 2P44B 1IFHL 1DQQA 2VXQL 3ARBC 4JO4L 2YS4A 1PLGL 4OGAD 5DEZA 1VADB 4YBLC 1F58L 4IIQC 3C5JA 5I1DA 5HHNA 3LN9A 1OW0C 5H2BA 4PGBB 2VERN 1J1PL 1EFXA 5KVMC 1VFBA 2DL9A 3NH7H 3P4LA 3V4PL 4QCIB 3MFGB 4U6XB 4LCIL 3NTCH 1T0MA 3QUYC 2OX5A 2V2WB 5DDHB 1P1ZB 3O41A 3HZVA 1RZJC 3MV9B 1BM3H 4KXZH 3DXAA 1BD2E 2A6KA 5JHDE 4PUBH 2ZP0T 4M43L 4OCSL 1FVEB 4PJIF 2IF7A 1N4XH 5E7FA 3VG9B 5B8CB 1E4XI 1DQLL 4A2LA 1R5WA 4Z7VE 5IEHA 1NDGA 3B2UD 3T0EA 5F8QC 2R0ZH 1QBLH 3X17A 3NACL 2OYPA 1MRFL 1J87A 1I7RA 4RX4A 3ULUD 1U42A 1I8KB 4XMPL 4IOFD 5BVJA 1H9VA 3FQWB 2Y4SA 2IMMA 3NCYS 3BD3A 1WBZB 4YEFA 4Z7NF 5FDWB 3L9RA 3V8CA 32C2B 2RQ8A 4QNPF 4GG8B 4PJDA 3KS0J 4I0KA 4P46A 1K8DA 3GMRB 2VISB 1X5LA 3ZTJH 5C0AB 5IB3B 4FN0A 3T2NH 2AV1B 1R3JA 3SDCD 2E6JA 3FB7B 1TQBB 2RB8A 3VRLF 4HXBH 4MJ6A 4BYHA 4HJJH 3GSWB 1U8PA 2EEAA 1C1EL 1MRCH 4JE4B 2IPTH 1OCWH 4PRIB 3UPRB 4L3AA 3FB8A 4ZO9A 2Y5EA 1NGZB 4JRXE 1TVBA 4HPOL 4H5SA 5JNYB 4V2BA 3CVIL 2ZKHH 3PHSA 3RTQD 2HH0H 5I15L 1I85A 1VEPA 3MRDA 1IEHA 3MNWB 1RHHB 3QO0A 3HUJB 4MNHB 4YHZH 4KAQL 3VD3A 1JF6A 1H3XA 1KJVA 4MNQD 5LWYH 4K3HA 1OP5H 4F37F 4QTIL 1AIFA 4JFZL 2NY7H 3KXFA 4K8RH 3U4BL 3OPZL 3IS1X 4YNYA 2YRZA 1YEFH 4KGLA 3ZHLA 5ISZB 4LSDA 2ADGB 1H15A 4X6BA 1D9KA 2R1WA 1CG9B 4EDXA 3HG1D 3D2UA 1VENA 1EAPA 1HHJA 2M2DA 2CGRL 1JNJA 2APBA 3J8F7 3VXMD 1QBBA 5TDNB 1FH5H 3R1GL 3UPCA 1BJMA 4NJAH 2GSGB 4P9ML 5D8JH 4JB9L 2DF3A 4U6HA 5E95B 1SBSL 4YQXL 2J2ZA 1NCDL 1JWUB 2A6JB 4NRZB 2WSKA 1D5BA 4NCC1 5DXWA 4FZEH 4Z7WB 2EC8A 2BJML 1CGYA 5DJAA 5DGQA 3GSUB 1IBGH 3C08H 5DQDH 3F7YB 1TETH 3D85B 5HGAB 3TVMD 4R7DB 3ARDB 4XPFH 3JXAA 1U36A 2R29H 5C09A 1CXHA 3S35H 2Z31A 1FL3B 2AJUL 4RDQG 1A4KA 1BGXL 4KJWD 5EOQL 1OY3B 4KROD 4LCCC 1LEKB 3I02A 4NQSA 2BDNH 4XPGL 4ZG1A 1JYVA 5DR5L 3VFNB 5E8NA 1MF2L 4JCLA 3C6LA 1ZLVK 5F44A 2JJWA 2CR6A 4HZAA 4LVEA 5CJQH 1D6EA 1FDLL 1N6QH 3GJFH 4WFFE 3OR6B 3FO1B 3V6ZA 4NNPH 3SDDC 4HUXA 1YPZB 4F9LC 1IVLA 4LF3B 5T5FL 5ECJE 4UNTA 1T1YB 4DTGL 2JB6B 3MLUL 1RZFH 5HGGS 2JCCE 1WIUA 2DLIA 5KANI 2KUTA 3DGCR 4BQCA 1JK8B 2XG4A 3PP4L 2Z92A 3O3AA 1SM3L 1FZOA 1DL7H 3QXAB 3WS6C 3FRUB 4L8DB 5ITFB 4PY8J 3TV3L 3KPMB 3GSRB 4M93B 3FONA 4OFYD 1HH6A 3MUY1 4M5ZL 4OSUL 1X5HA 1VADA 4QEGA 2X89A 3IDJB 4FFVD 3QDGD 5EU5B 1FP5A 2VKXA 3UJJL 2F19L 2LU3A 4MYWB 5E6ID 4PGBA 3W81A 3BEVB 5EU6E 3TWCH 3D3VD 3ME0A 2H9GB 4JPKH 4JFPB 3NPSC 3AM8C 3ZYJA 3QXDB 5E08L 4KV5E 4QCIA 1NEZG 4U6XA 3U83A 3GSNH 3RKDC 5CIPB 4GRWH 4YDLB 2XY1A 4Y5VB 2OTWA 5FDYA 5D70L 2V2WA 5DDHA 2XRAL 1P1ZA 4OCYL 4Q58C 3MV9A 1TPXC 2AJVL 2JELL 1FVEA 3VMNA 5B8CA 1A8JH 1DBBL 2G5BB 2J6EL 2XYCA 3U36B 2JJSC 1VERA 2QQNL 3N0PB 4Y4FC 2UUDH 5K9JH 2YA1A 2HKFL 2OXHA 4Y16B 3X14B 4XRCB 3DETC 3S8WA 3C2AL 2E27H 5I1LB 1FV1B 4HGMA 3ZKNC 1I8KA 2VABB 4AL8L 4BM7A 1WFTA 3FQWA 1MFDL 5HPMB 5J89A 5D2LB 1O0VA 5DHVB 1L6XA 3RIAF 3DWTA 4UQ2B 4OUOA 5FDWA 32C2A 4GG8A 2HWZL 1V7ML 1KLGB 3GMRA 3QCTH 2VISA 4KKAD 5C0AA 1QQDB 2DYPB 3VE0B 5IB3A 1DTUA 2AV1A 1H3TA 4KTEL 5F9JB 1LDPL 3UYRH 3QFJE 1PG7L 3FB7A 3TIEB 2ZUQC 4YHYC 3GSWA 3JWOH 4PJAF 4JY5H 3ZE1E 3F7VB 2X1QA 2P47B 4PRIA 3UPRA 3KPLB 1QFWL 4L8SB 1NGZA 3KJ4C 5D7JD 1AGBB 5JNYA 3PL6C 1CDYA 3RWJB 5FM8A 1CVSC 2QSVA 3MNWA 4MQXC 1RHHA 2AABH 1RJZB 2E7MA 3HUJA 4MNHA 5J3HC 1UACL 2NY6D 5EZIH 2F8XC 2FX7H 2A73B 5C92A 2XY2A 1F4WL 2PF6A 1DSFL 1WWCA 1JFQH 1IKNA 4MVBD 5JIIA 4K9EH 1G7LB 4UT7H 1EFXD 3SE8L 2BSTB 8FABB 1MFCH 5ISZA 2R4RL 3KPRB 2ADGA 4L3EE 5K9KB 2JJVA 1KIPB 3KS0H 1CG9A 4J12A 5E2UL 1FRGL 2A74B 5FGRA 2GSIB 5EBLB 3HS0B 3MZTA 5TDNA 4M48L 4DGYH 2W9DH 2GSGA 4KI5D 1IT9H 2PNDA 5HVHB 1ETZB 3NCMA 4ZFGH 3KLHC 3WKML 3T0ED 1JWUA 4LEOB 2A6JA 4NRZA 5JZ7C 4Z7WA 4O58L 4RX4D 3MSPA 3MACL 4LLQB 5HD8D 5DJYB 2R1YB 1J7VR 2WUBL 4WI8A 1U92B 1G9ML 2NY2D 2X40A 1Y6MR 2A9ML 3GSUA 1ZAGA 5I16B 5DVKA 4Q74A 3F7YA 3D85A 5HGAA 4XBEL 4R7DA 3U7AA 3ARDA 4P46D 3W2DL 1CR9L 4K8RC 1ZK9A 3UDWA 1FL3A 2VUOA 3QYCA 4JRYB 1LEKA 1Q8MA 5GGQL 2XN9B 4NQCE 3E6HB 1I9RH 5DA0B 3VFNA 1ZSDB 3LN4B 5I1KH 2NYYC 3QEGH 1NEUA 4JY6B 2Q1EA 4WW2F 4H8WL 2LV4A 4B41A 2VXSL 3IAQA 2X41A 5AWNL 4ACPA 4OCXL 1DVFC 1EZVY 4OCMC 2AW2A 3OR6A 1I1YB 3FO1A 3RUGE 4Z95L 1YPZA 4LF3A 4GMSL 1T1YA 2JB6A 1GPOH 4G6FB 1P9MC 4Q9CA 2R9HC 1FG2B 4PJFB 3UPAA 4PGDB 3FB6B 2BY0A 1JK8A 2V6HA 3S7GA 4HIEB 3KXFD 4PJGB 3S35X 4NO5B 4O2CB 2KQNA 3QXAA 4RFNC 3FRUA 4L8DA 2C3GA 3LRGA 4Z0BL 5ITFA 5HJ3B 3KPMA 3GSRA 2X6MA 4KVNH 2UWEB 4NO3B 4KHXL 5FO7B 3ISWA 1KFAL 1D9KD 1T83C 2Q8AH 5KVEL 3FL7A 3D2UD 3IDJA 2R56H 2VYRE 1ZA3B 3BZ4B 3I3DA 5EU5A 3V6OA 3WIIL 1A14L 4ZOBA 3QDJE 5CGMA 4X7FC 4YC2C 3UMTA 4IRSD 4CVUA 5DD5L 1OLZA 3BEVA 3IKKA 1XGTB 4TVPE 2H9GA 4LASH 3QSKB 4D0BB 4JFPA 3H7LA 3QXDA 4DKFH 1NL0H 3R4DA 5CIPA 3UZEA 1OOAA 4KMTL 3QCVH 4Y5VA 1JPSH 1DZBA 2IBZY 8CGTA 5BVPL 3ZDZF 1QFHA 3TEUA 2D7TH 4N0YH 3S9DB 3EKCA 3NAAH 4ZXBB 3ALPA 5EZOL 2G5BA 2Y5TB 3U36A 5FYJD 5HBBA 4XHJD 1JL8A 3VU2A 2XI9A 5GHWL 4Y16A 5ENWB 3X14A 4XRCA 1EMTL 5C09D 5I1LA 1FV1A 1ZHBB 3P4OB 3H3BC 2VABA 3NIGE 1KEGL 3QXVA 4F7PB 5HPMA 4UQ3B 2AJ3B 5LBSH 1IAMA 2RBLA 2IPUK 3L1OH 5D2LA 4EN3B 5DHVA 4JEGB 1QNZL 3DPBA 3C6LD 4UQ2A 4KJQC 4PLKD 1OP9A 4MB5A 1KLGA 5HTSA 4EUPG 5EG6C 2CKBB 2DYPA 4GH7B 3VE0A 5L0QB 5F9JA 3BT2L 3BZFB 5I0ZA 2DMBA 3TIEA 2XZCL 2YA0A 3BD4A 3DUHA 1ZTXL 1UWEL 4YXKL 4L4TB 3DVIA 4OLVH 2AV7B 2DQFB 3CFKB 4YHLH 4ZSOE 3HC3H 3DNKA 4G7VH 5M95B 3F7VA 1A3RH 3KPLA 1C5BH 3STLB 4QGTA 1CD1B 3AB0C 3LEYL 5SWZB 3HC4H 2CH8A 3PNWB 1AGBA 4HXAH 1GH7A 1V3LA 4NZJA 4KUCD 4X6CE 3RWJA 1F3DJ 2VQUA 1KT2B 4WHDA 4J8RB 3DV6B 3DSNA 1RJZA 2AERT 3DX6B 2ICWB 4LLDB 3HR5B 1AGEB 2X89D 2A73A 2DL2A 1FCGA 4HSQA 2AXFB 2WWMC 4DAGL 1G7LA 4KC3B 4ODVL 1D5IH 1MELA 2BSTA 1Y0LB 2GEEA 4V1DB 5BMFL 5DRZB 8FABA 3KPRA 4YHOH 5K9KA 1KIPA 5F1NB 3EYVB 2YA2A 1YYMH 1UGNA 4OCWL 1BEYL 2LQRA 4P2QE 2JTDA 2A74A 2GSIA 3UTSB 5EBLA 2BCKB 3HS0A 3MV9D 2ICCA 3JWOC 2E6PA 1W8NA 1A7QL 1U3ZA 1XGYL 1ETZA 5F71A 1FLTX 4MX7B 4JHWL 4LEOA 2K7QA 1T66C 3GFUA 4PJ8D 35C8H 4MA7H 1IGJB 2CMRH 4LLQA 3GIZH 5DJYA 4KRPC 1WBXB 4NYLB 2R1YA 1MOEA 4AT6B 1U92A 5FM5O 1QLEL 3NFNB 3TT1L 5I16A 3QUML 3FQUB 5D93C 4U1JB 3X13B 3SN6N 2EICA 2NR6C 2JE8A 3PV6B 2Y6SD 1T89C 2X2YA 4XNUL 1TJIL 5C0AD 1WSST 3O4OC 3O3UN 3PP3H 4PGCB 2D9QB 4GRWE 4A2MA 4Q9RH 2XN9A 4KMQA 4S1SH 1T0PB 3E6HA 1TQCC 5DWUL 1ZSDA 3LN4A 5J4MA 1FN4B 1HOCA 4IDJH 4JY6A 1JGDB 3SDYL 3E8UH 2NCMA 3CGTA 2Q3AA 3VFMB 2IH1B 3MNZB 5HI3C 1AO7B 2YK1L 2LTQC 5IROA 1YA5A 5I1GH 1I1YA 2OI9B 4LCYB 5I1JH 3RDTB 5GRVK 5ACZB 4UU9B 2DBJA 1NSNH 1EEUA 3FFDB 1EH9A 3O8XB 1T7WA 4UTAL 1DBKH 3ARPA 1FG2A 1B4JH 2OJZL 4PJFA 4PGDA 3FB6A 2EXYC 1UM6L 1CTOA 5FKAB 4HIEA 5T3XL 1UM5H 4GG6B 2BSSB 4PJGA 2YPVH 4O2CA 5FM5M 5T5NF 3QHZH 1PZ5B 2UWEA 2DOCA 3L3JB 4JN1L 4NO3A 1IAIL 2OSLB 3LKSB 4I0PC 3L3KB 5FO7A 5ISZD 1ZS8B 3C2SA 3DYMA 5IJKA 3FZUD 4U2YA 3MJ9H 2VDQH 1ZA3A 3BZ4A 4BSWB 5ICZB 3CXDH 5FA3B 1M6OB 1RZIB 3O6KH 2HYMA 4HWEL 3L7FB 5IMMB 5GRWA 1XGTA 1ACYH 4D0BA 3S6CA 3SOBL 3M07A 4P3DB 4OI7A 3T8XB 3IDGB 4F15B 1C8PA 2R2CA 4X9IA 4AG4H 1CXIA 4M7LT 3BDYL 2V5TA 3N85H 2C9AA 3WXVL 4ZOEA 4FMFA 3QRFM 4ZXBA 2KPNA 1D5ZB 5HGDB 2Y5TA 3D85D 4LSSL 5JIHA 2VLJE 4KK9C 3ARDD 5ENWA 5J1SC 1NEZB 4JPVL 1ZHBA 4LGRB 3P4OA 3GDBA 2R4SH 4YHIB 1P2CB 4F7PA 2EH7H 4UQ3A 2AJ3A 3MRJB 1ZV5A 4HWBH 3VGAB 4BH8B 4EN3A 1SY6H 3QIBB 3KHQA 4ZPVB 4JFOB 3QI9B 2GY7B 4OZGE 5J6GB 5I8OL 1FGNL 1KLFA 2XTJC 2CKBA 1W2KT 3IDIB 4TNWF 5L8LB 4Z8FL 3BZFA 3TT3H 4HKZB 5JMOC 1CZ8H 3CSYB 1F4HA 4L4TA 2AV7A 2K1MA 3HE7C 3L5IA 2DQFA 3CFKA 3OZ9L 1R5IB 2GAZB 3D9AH 4LSTH 12E8H 2EKSB 1NCWH 2EDLA 3STLA 5KVDH 1CD1A 5JW4N 5LJYH 3P9LB 1ZHKB 1V8HA 2EDYA 3BKML 3CFIC 3PNWA 4D9RE 4LL9A 3ULVF 3LHPH 3OHXB 4PTTB 5KVFL 1KT2A 1G0YR 3IFNH 4J8RA 4QRQB 3DV6A 4KPHH 3DX6A 2ICWA 4LLDA 4I18B 5DHXB 1UKQA 3S88H 3HR5A 3UO1H 3RWEB 15C8L 3BISA 5FGSA 1AGEA 5BOZG 1NC2B 2BRRL 3SKJL 3WFDH 4PJBB 2D7PA 2AXFA 4BELD 3ULVL 3TBWB 4FP8L 2YKLH 2A0LD 4X7SH 3MLPA 1Y0LA 4V1DA 3RY6A 1TJHH 4RISH 5DRZA 3MV7B 3H8NA 5F1NA 1UWGL 2XNAB 3EYVA 4TUJA 4ZOAA 2NX5E 4OCRH 3LEVL 2Z8VC 3UTSA 2BCKA 2EIBA 1M7XA 4YDIL 4L9LC 4ODUB 3MJ7B 4X4YB 1T7XA 3GO1H 1YZZA 4MX7A 3EJZD 3X3FH 3QO1B 5KVGH 2BRQA 4Y16D 3SGKA 1A6VL 5F9DC 4HAFA 3WJLA 1EIBA 1WBXA 4NYLA 1F3DH 4AT6A 1MLCB 3NFNA 2XTJE 3ARYA 1QUNA 3FQUA 4U1JA 3X13A 1KB9K 4U3XA 4W6YB 2HTLD 3MRHB 3PV6A 4QTHB 3WD5H 3BAEL 3BP4B 5CILL 3I84A 5FHAL 3GI9H 5HDLA 3NVQA 2DYPD 2XQBH 3DUSB 4RSVA 4KKLD 4IMKC 2FX8L 1INEL 3AS3A 3M8OL 4FQIH 4WV1C 4PGCA 4C56E 3Q6GL 3VXQB 5CLWA 2W59A 5FCUL 1N64H 4TQEH 1FN4A 5J13C 2ARJQ 1JGDA 4HD9A 3BMWA 5D1QC 5CJOL 2A6IB 3VFMA 2QSCH 2IH1A 5JW5B 4EI5C 1AO7A 3U7YH 2AEIT 1NCBH 1DQDL 4ZNCD 1VFAB 4LCYA 1O7VA 5ACZA 1QBAA 4UU9A 1IQWL 5IVZB 1P84J 5L7XH 3FFDA 3O8XA 2B2XL 3F6IA 5HI4D 2UV3A 2F5AH 2VDOH 5FKAA 5ITBH 4MHHG 2EO1A 4GG6A 2BSSA 1JZ6A 4JGUA 3SCMC 3ARSA 5ABDE 1NLDH 4M1DH 1RU9L 1PZ5A 3SDXB 3L3JA 2OSLA 3LKSA 3L3KA 1XT5A 2VDPL 4MXWL 1VGKB 5BV7B 1KGCD 5TQ2H 3MX0A 3WFCH 1PVHA 2D9CA 3TJEL 3V4VH 1WCBB 3CDGB 4BSWA 5ICZA 4H20L 5I19H 5FA3A 1M6OA 5EBWB 1RZIA 4D0DB 4OTXL 5GISL 1XGPB 3L7FA 5IMMA 4GRLD 4L8BB 5JDSB 5C7XH 1INDH 5GGUB 4Y2DD 1K8IB 5D72L 1JZ8A 3V0VB 3U9PL 1J11A 4P3DA 1JN6B 3EYFB 3T8XA 3IDGA 1ZANL 3OR7B 3PXJA 1KC5H 2Y7QB 2E9WA 2FECL 2VOTA 4Q6YA 1AE6H 3RWFB 5M7QA 1D5ZA 5HGDA 2X1PA 4PBVC 4W6WB 4YFLF 4ONGL 3QUXC 3BRDA 1UCTA 1S78C 1EV2E 5DMGC 1IM3B 3UC0H 1NEZA 3DARA 4K3JH 4P57A 5ETUB 4EBQL 2VAJA 3KLAB 4NBYB 3WFEH 1IM9B 2BNRD 1EHLH 1OAQH 1P2CA 1DQML 4YHIA 5C9JB 3MRJA 4GKNB 2XN9D 3FAWA 1EGJA 4BH8A 4P2CG 3QIBA 4G6JL 3FQRB 3GK8H 3RWDB 4JFOA 2ED8A 3QI9A 3WIFA 5J6GA 5I74B 4LIQE 4FTVD 1G6RH 3L5WB 1VGEH 4KQ3L 3IDIA 1JZ5A 1J0HA 1T03L 1Q9OB 1MJ7H 1QFOA 3BJLA 3CSYA 1EEYB 4HZLB 5DVMA 2VKWA 1Y18B 3TIDB 4HBCL 1R5IA 2GAZA 4G6FD 3MRBB 4K3DH 1CWVA 3GM0A 3P9LA 1ZOXA 1ZHKA 4UB0H 5H35B 4LFHD 1KB9J 4EUPB 3OHXA 3T04D 4DN4H 2W9EH 4YWGH 4LIQL 3QUZC 4PTTA 2RR3A 5JPNB 5LXGH 3REWB 4QRQA 4OF7A 3EBAA 4KDTC 4M4PA 4Q2ZB 3RZCB 3T2OA 4LLUB 2BHYA 2NY5H 4I18A 4NWTH 3RWEA 2R0KH 1CICC 3K46A 1NC2A 4JREC 1X5JA 4PJBA 1FG9C 3KJ6L 3TBWA 1CGSH 3L3DB 4PJHB 1BBDL 3GSVB 3TO4B 2W0PA 2YPLB 3WDIA 3MV7A 4NKIL 2ADFL 1I1RA 4JM4L 3QNXB 1KCUH 4IJ3B 4NRYB 4GJTB 1Z9LA 1HXMB 2XNAA 5EO1A 3NCEB 1MHPH 3V5KB 3VD5A 3AAZB 2XXCB 3LKRB 4PYGA 4XNYH 4PGZA 2DQDL 4KK6D 4NIKB 4ODUA 4X4YA 3TZVC 4NWUL 4ZXBD 4GBXC 5CP3H 3EFDL 1CF8L 3MZGB 3SGEI 4J3OC 4LLAA 1S7VB 1BIHA 5DRXB 3QO1A 3UJTH 5SX4I 1D5XB 4X4ME 2IFGA 1K2DA 3DVNB 1MLCA 5C0CB 3V4UH 1W0YT 3LKPB 4X6DE 4R97B 4Z7VF 4XXCC 1HXYB 3E6FB 1AKJB 3MRHA 4QTHA 2JJTC 3BP4A 5HDQH 5EDXA 4JFQB 3DUSA 1MHHA 2EYTB 5HSFA 5T33H 3GI8L 1BQLL 1NGYA 3VXQA 3ARFC 4L4TD 3HNTL 5FYJU 1UC6A 1MCEA 5DRNB 1OM3H 1FLRL 4LEXH 1RIVH 5BS0E 2DQCL 3WHE0 2B5IB 2A6IA 5B22A 5JW5A 4CUCA 4FFWD 1VFAA 3CLFH 5IVZA 1F2QA 1H3VA 1MCLA 4LVNC 3BW9B 5E8EB 5B4MD 1U6AH 1RIHL 1NGWB 2VDNL 4NN7C 1OWRM 3IU4H 1PX4A 2QHLA 3FO0L 4WI4A 4MA3B 5E9DE 4UOJA 2XA3A 4ZO7A 3QWOB 3SDXA 1EK3A 2DQGL 3HE6B 2ATPB 1VGKA 3B2UC 5IP4A 3A6BH 5CJXC 2EECA 5FF6B 2OM5A 1WCBA 3CDGA 4H0GA 4RAVB 2O5ZH 1NUNB 5EBWA 2FGWH 2VDLH 3UTSD 4WWKB 3ZKSD 4D0DA 2ICEB 4IOFC 2Z35B 4HUNB 1XGPA 4NGHL 5FUOL 4L8BA 5CGYD 1OLLA 3PV7A 1KV3A 5JDSA 2B39A 2W0FB 5GGUA 1CDCA 1K8IA 1YC7A 4D94A 5FUZL 3V0VA 3EOBB 1I3GH 1JN6A 2AJSH 4KY1H 3EYFA 1J0ZA 1T3FB 4PJCE 3OR7A 4ORGB 4OM0L 4NM8L 4JG0L 5IWLC 1EJOH 1YYLL 2HN7B 4JFFE 4PP1D 2Y7QA 1A2YB 3R0MA 3RWFA 4YXHL 1CL7H 2VSCA 4XBGB 4WFGE 3W0WE 4F8QA 1IM3A 1AXTH 5ETUA 3L3OB 3KLAA 1IM9A 1J8HE 5EPMB 2M1KA 4N8CH 3FQNB 5GRXG 1FPTL 5C9JA 3HLAB 4GKNA 1Z6JT 5HXMA 3IVKB 3HAEH 3NOIA 1H8NA 3LH2L 3FQRA 5K59E 3RWDA 3VFSB 4HFWB 2IQ9H 3ZE0F 3L5WA 5I6XC 3P3YA 5F1OB 4QY8B 1AO7D 4TSCH 1KCVH 1FJ1B 2I26N 1Q9OA 4AY0A 2DJ4A 1EEYA 3QUKB 4HZLA 1F4XL 1PGRB 5HI5C 2X42A 4WEBL 1UA6L 1Y18A 3O8XD 3TIDA 3OAYK 3K80A 1VB9A 4RGMC 1XCQB 3MRBA 3MV8B 3MLYH 5FYLD 1T2QL 5H35A 3P73B 3VA6A 1HKLL 2YN3A 5DQJB 4EUPA 3V5HB 3AMKA 1CTNA 5JPNA 3REWA 1N2RB 3RNKB 3F7PC 4XPAH 4YPGB 1F4AA 3THML 4DN3L 1LK3L 1WZKA 1HIMH 3TYGL 1HZHH 4Q2ZA 3RZCA 4LLUA 2IC2A 3ULUF 3C6SB 2WLZA 4A6YH 2VQTA 4FA8A 5I1EH 1CLOL 2D3VA 3VD7A 2Z91B 3L3DA 1GHFL 4PJHA 3TJHC 2VH5L 2VN7A 3WNPA 3TO4A 1I8LA 2KZ1B 5HGHB 2YPLA 4I2XE 4PRDB 2ZZUT 3AGVA 2GY5A 3QNXA 3C87A 4NRYA 1HXMA 1Y6KR 4NQUA 2D7QA 4UTBH 2CSPA 4D9LL 3ULUL 3V5KA 2VE6B 4KJWC 1LO0L 3AAZA 3LKRA 3NIDF 4KROC 3D69B 3PABB 4JG1H 2DBLH 1CI5A 4DJMA 1S7VA 2D03H 4NZRL 3BN9D 5DRXA 2HRPL 2ZG1A 2EH8H 5J12B 3CNKA 4F8TA 2BOCB 1D5XA 1J1XH 2YUZA 3GGWA 1KXQE 1VEOA 2IMNA 1CD0A 3W5NA 3H3PH 4NP4H 3DVNA 5C0CA 2F58L 5JW4Q 5EFIB 3LKPA 2WV3A 4JO3L 2NY5C 1WEJH 1NBVH 1HXYA 4OV6F 5D1XA 1UWXK 1PG7W 3E6FA 4ZTOH 1AKJA 5AG8A 1PFCA 4K7PH 1RZ7L 4JFQA 5LAXB 1WAAF 4XCCL 1JHTB 5KJRL 2EYTA 3ESUF 1AGCB 1GIGL 1QSFB 3FHAA 4MZ2A 1QG3A 1M4KA 3C60B 4XVSL 4OT1L 5CHNB 5DRNA 2OP4L 3VXRE 1F4YL 2QADB 5EU7C 2YRLA 4HJGB 1Z2KA 3WJJC 4OV5B 5DGRA 2PTTB 5CEXB 4JJ5B 1G9EA 3KYMB 4YHKL 2RAMA 3WE6B 2NY1B 1YY9D 4Q9QL 2PR4H 2Y06H 5MENB 4JDZB 3OJDB 3BW9A 5A3ID 1CIDA 5CZKA 2FLRT 1NGWA 1AI1L 2WAHA 1NC2D 1MCDA 3HA0A 2QSQA 5E94B 3PQYE 3Q1SH 4MA3A 2OR9L 4RFOL 3TBSB 2E7LC 5CEZH 4U1MB 3QWOA 1L7IL 2D0GA 1MWAH 3HE6A 2APXA 3MV7D 2ATPA 2HT4D 4U4BA 1ZEAL 5FF6A 3O2DL 3C09B 2BXZA 4RAVA 4HS6B 5TDPB 3A6CH 3CH8A 2HT3C 4WWKA 3AY4C 2JIXB 1ADQL 2ICEA 3GNMH 2PW1B 1OWWA 2VDRL 2Z35A 3HPJB 4JFXB 2I27N 4ONHB 4PLNC 4GKOA 1JPTH 4F7MB 1G0XA 2W0FA 4J3SA 3DVGB 3GRWA 4PBWD 1HHGB 5ICXB 3EOBA 2UY7A 3MROB 3V6FB 3VI4F 1T3FA 4P48A 1SQ2N 3HB3D 4ORGA 3BQUB 4LLMB 3U0WH 2HN7A 5D96B 1S5IH 3DMMB 3EO9H 3RZWA 1A2YA 1RULH 2DQIL 4LARH 5F7WC 3O4LB 4XBGA 5L8JB 4XP9L 5EUOF 3RVWD 4RGNB 3MFFB 2ZCLL 2RFXB 3EYUL 3L3OA 1CLZH 3C5ZB 1IC5L 3UTOA 4HUVB 5EPMA 2Q20A 3FQNA 5DMJB 1CDGA 1QLRB 1NFDE 1T1ZB 5EU7E 1RFDL 4F9PA 3HLAA 2H32H 3UROR 5C07E 1BF2A 3IVKA 1WF5A 3WYRA 4LKXB 4LLWB 3WS3B 2FD6L 3UXFA 3QDGE 4MS8D 3GBML 4K07A 1TIUA 2IGFH 5JOEA 1RUQH 2QQLL 4LSPL 3VFSA 3WXWL 4HFWA 3S3JA 4G6AD 3QA3B 3HRZA 4QY8A 3T0DA 1TZGH 1JIBA 2K9UA 1FJ1A 4L5FH 4FQPA 2FX9H 1FO0L 3MYJB 1GSMA 1OAZL 4MVBC 3QUKA 4FS0A 4PREB 3CFCL 4XPBH 3NGBB 2X1XR 3RVUD 4XBPB 2WUCL 4U1GB 3K3QA 1XCQA 1MSPA 3MV8A 4MCZB 1WQVT 2VXVL 3MRPB 2EDOA 4WGVB 3OV6A 3P73A 3UEZA 5FO9A 4HKBB 2ZWLT 1DBJL 1NGXB 3LY6A 4HCRA 1ZVHA 3VGEA 5DQJA 2W1NA 3CK0H 3V5HA 4QO1A 3MLXH 2IFFH 1N2RA 3RNKA 1ACZA 4YPGA 2N56A 3AUVA 1UQSB 1OAKL 3W9EB 1QSVA 2N4IA 4P59L 2XA8H 4S1DD 2N7AA 2IANB 4LSQH 3C6SA 5C3LD 4PUBL 5DK2B 2PUQT 4DCQB 2HFGL 3LQZB 1T4KB 2BY2A 5DVLA 1A6UH 3S97C 4RFEA 2ZJSL 2Y36L 2Z91A 3RGHA 1W0VB 4C59B 4MA8H 5E6YA 2NY2C 1L4IA 5HGHA 4PRDA 4XC1L 4P3WA 1GJIA 1H5BC 2FATH 3EOTL 3H9ZA 5EULV 4P46C 3WNKA 4G6MH 4PRPB 4WGWB 3GRWH 4DK3A 2VE6A 5D6DC 3D69A 3PABA 3VDCA 5GRVL 3D0LB 4PB0L 5BO1L 1S8DB 4JAMB 1JGUH 3VXPB 3RIFK 3T0WA 1J86A 2J88H 4LCWE 4EI6B 4JN2B 2BOCA 2COQA 3G5ZB 4HULB 4S2SB 3O3EB 3BIKB 4HIXL 1INQB 1MRDH 3T1WA 3AS1A 5C6TL 2HKHH 4JQXC 5I17B 5EFIA 3E0GA 4NZUH 5FV1L 5T3ZH 1KJ2B 3C5SB 1NJ9B 4TOYL 4PLJC 5LAXA 1JHTA 1SJXA 1WZMA 1AGCA 3ARWA 4M1GL 3TNNB 1QSFA 5DD1L 3L3IB 3R8BB 2GIYA 4ELKB 1B0GB 4KUZL 3C60A 2XWBB 5CHNA 5BOPA 3D5OF 4PIRF 3HNVL 1MHEB 3WHXB 5E8DL 1GGCH 3LZFH 5TQ0L 5FYKH 4OV5A 3I3EA 1D9KC 1BFOB 5C1MB 2PTTA 5CEXA 5C08B 1TNNA 1YEFL 4JJ5A 3KYMA 1WITA 4JJHA 1PKOA 3O6LH 1F45A 4IRSC 2XICA 3WE6A 5I76B 4JFDB 1SYSB 1BAFH 2IG2L 5MENA 2PXYA 3ROOB 3RZCD 4JDZA 3OJDA 4EIGB 4XP4L 3U4EB 1FH5L 2DIAA 1K5NB 4QXUL 1A7OL 1T22B 4YK4B 4K7PX 3V7MA 1URLA 1CFQB 2VXTL 4ONFH 4XCFH 5E94A 1HSBB 5ALBL 3TBSA 2HJFB 4PJDE 3TO4D 4U1MA 5GRZA 2G9HB 4YFLI 2YPLD 3MGAA 4ELMB 4XVUC 4ZAKB 3I6LE 2J8UB 3HC0B 4F7EB 5GS0D 4N0UE 4I48B 4FQXC 4AH2B 4L8CB 4HS6A 3OKDB 5TDPA 4IS6B 4OLWL 2JIXA 2D4FA 2PW1A 1OAYL 5MHSE 3HPJA 2LFGA 4ONHA 5D2NB 3VWKD 1OSPL 5FGCB 4PRBB 4F7MA 1Y6NR 3C8DA 3DVGA 1YEGL 1HHGA 5ICXA 5DT1L 4PLKC 4C4KT 2BDNL 3MROA 3V6FA 5I1CL 5AEAA 3G6JB 1QP1A 2EZ0D 3W5MA 2EEBA 4J6RL 3BQUA 4LLMA 1KYOK 1W8OA 1FQ9C 2E8ZA 4ZDHA 1G7IB 4U0QB 4OZFH 1ZA6B 3DMMA 5C0CD 4Y5YB 4F58H 3SE3A 4U49A 1E4XH 3O4LA 5D1XD 1N6QL 5JW4R 4E5XB 1AKJD 3MFFA 4Y89A 2RFXA 3QXWA 4J3TA 3C5ZA 1KN2L 4HUVA 1UB6B 3TF7C 4NJ9H 1RUKH 3TC9A 1QLRA 1T1ZA 4UUJB 3QG7H 4PJ7B 2DD8H 4WI7A 4LKXA 4XX1E 4LLWA 1FHGA 4XAWH 3WS3A 4X4ZA 4NZTL 5D7LB 4DK6A 5SWSB 4J3WA 4PJEE 2LVCA 1UM4H 2O5YL 4QOKD 3QA3A 3TFKD 4NHCL 1JUFB 4FABL 5DSCB 4HHAB 2ICES 3HI1B 5IR1B 3S98A 1V3KA 4XB7A 3MYJA 4GRWF 3INUH 4G7YL 4M7KH 2DLEA 1YJDH 4G8GE 4PREA 4B5EA 4LKCB 5CUSL 4XBPA 3T77B 3GBLA 4ZS6D 2OBGA 1A3QA 2AQ1A 1C5DB 4PJ5B 3MRPA 4WW1B 4M62L 4LNRB 4HKBA 5GZNC 1NGXA 3H6JA 4Y5XC 2IAMB 3SEPA 4BFEA 3HNSH 5FYJE 4ODHL 1GC1C 2M8XA 3VG9C 1UQSA 3W9EA 5C09E 3HE6D 4MNGE 1MCQA 4UBDC 1DLHB 2BVQA 4FQLH 3ZDYF 2IANA 1FFOB 5DK2A 4PJ8C 4DCQA 1T4KA 4WU5B 1XR8B 4WUKL 1VFOA 2ATKB 4WWKD 1U3HC 1W0VA 1XIWB 1RUMH 5L6YH 3F7RA 3HMXA 4GT7A 3LMJH 1M71B 5FYJL 5IFAL 5GGTA 1I9EA 4YHMH 4I5BB 2Y6SC 4GXVL 4PRPA 1MIEH 2X9WA 5E5RB 5T1DH 1Q72L 3ZE2E 3RKPA 3P30L 3O6FC 5DK0B 4MDJB 1LO2H 4OGZA 3D0LA 4H25B 3UTTE 1F8TL 1Z3GH 4KKBD 1S8DA 4JAMA 1RSFA 2XQYG 3UYRL 4XNZB 4NCDA 3VXPA 3U0PB 3RGVB 3FAXA 5C70A 1LD9A 4ETQB 4EI6A 1OVZA 4JN2A 3G5ZA 4FNLL 3FKUS 4S2SA 3O3EA 3BIKA 4M9OA 4M7LL 1INQA 5DO2D 3BSZH 1MCOH 2H2PC 4OBSA 1LK2B 4UILH 1N7ML 2RCSL 3SGJA 2VB5A 1KJ2A 3T4YB 3C5SA 1NJ9A 1U8QB 3FO2B 3NN8B 3T2QA 4OI8A 4ZFFB 2DRUA 1AJ7L 4G6KH 1BQUA 1HINH 1Q38A 3TNNA 5KSBE 4ELKA 1IKNC 1A64A 3L3IA 2ERJC 1B0GA 3OSKA 1MCFA 3SHSA 2XWBA 2FX7L 1KYOJ 5KW9L 2DDQL 1MHEA 3WHXA 1JFQL 5AYUH 2MNUA 3MV8D 3RAJL 1B2WH 3JV6B 4K9EL 2ZNWA 3HRPA 1BFOA 3MV9E 1J0IA 4JKKA 5C08A 5TE6L 3FZUC 3DRQB 1MFCL 3ALWA 4AEIH 3REVB 3T3ME 4DZBB 4XP1L 5I76A 4JFDA 1SYSA 5IVXE 1X44A 5GS2H 5ADOH 3HI5L 3ROOA 4YXLH 3U4EA 5ADPL 4CU6A 5IQ7H 2J5LB 4LRNL 1K5NA 4YX2H 4MLIA 5ILTH 1T22A 1MEXL 4NKMB 4YFDB 3UP1A 1XF5B 2NW2B 4Q6IB 2ESVE 4K3EL 3VFRB 1CFQA 3DX7B 3H42L 4ZFGL 5DA4A 3ZKMD 3NFSH 5LQBL 1HSBA 2HJFA 5E2TH 5KZCB 2G9HA 2W38A 3KR3H 5ESQB 3SDAB 4ELMA 1QBMH 1IGFL 1G7MB 4ZAKA 2PKDA 4QRSB 2J8UA 3HC0A 4F7EA 3ARDC 5EIQA 3TBVB 2WBJB 2OLDA 3LIZH 4I48A 4LVOB 4AH2A 1E6OL 4L8CA 5MP6H 3OKDA 1N3NB 4IS6A 3B9VA 5C6PB 4PV8B 1PSKH 5C86A 5D2NA 4ERSH 5I8KH 1F5WA 2XZQL 4PRBA 4PGEB 1DUZB 3ZMRA 4MAYB 4GRMB 5MEQB 1JZ2A 3G6JA 1DBAL 4KKNA 4U6VH 1LP9F 5FEBA 1C7TA 1G7IA 3HUJE 3DLQR 3OAZH 1ZA6A 5GIRB 4OFPA 4Y5YA 4J1UB 1MFAL 4X0KB 2VDML 5LGHL 4PRAB 4NQXB 3A6OA 3ZTJG 2BVEA 4E5XA 3G6DH 4KVCH 4PG9B 1AHWB 4NC0B 3MODH 4EZMA 3RWIB 5E4EB 1FZMB 3CVHH 1KJ2H 1UB6A 1GPOL 2YD1A 1UH4A 4RRPG 1QSFD 4OD3H 5BRZE 4UUJA 1YEKL 4PJ7A 3C60D 2NW3B 4FQ2L 5I1HH 4UMGA 4M93C 5D7LA 2OR8A 3P40A 3WO4C 2QADD 3EFFB 5SWSA 4ODSH 5GJSL 4NDMB 5GRUH 3DX9B 4OF6A 3BGFC 3HR6A 3GHEH 1JUFA 4LGSB 3ZDXF 5DSCA 4HHAA 2DQTL 3V6OC 3HI1A 3P9MB 5IR1A 1FNAA 5A1AA 2NY1D 1PZUB 3K2UL 4F37K 1A7RH 3BIBX 4Y19B 4UAOB 1Q0XH 4LKCA 2R56L 4ZS7H 25C8L 5MEND 3T77A 2PXYD 4O2EB 5IESH 1KENH 1QFPA 3KYOB 1K9TA 4XP6H 4YDJA 1C5DA 3NCJH 1WVZA 4PJ5A 4WW1A 4LNRA 1MVFA 2ID5A 3IJSB 3NA9H 2H1PH 3A67H 3RY5A 1R5VB 7CGTA 2PYED 2IAMA 3SJVB 1MCKA 2DLGA 4KK5D 4WI2A 4DKFL 1IZJA 1IAKB 3MUJA 1KCRH 1NANH 4LRIA 4L4JA 5I71B 4D9QE 4S1QL 4LPYA 1BOYA 1DLHA 2P4AB 5BCAA 1FFOA 5I73B 5TPWL 4Y16C 2EYRB 1IGCL 3CSBA 4WU5A 4Z7VB 1XR8A 2ATKA 2JIXD 3CMOH 5FYKE 5IB5A 1XIWA 2GJ6B 3IDXL 1ZXQA 4D3CH 1UZ6E 3QDHA 4L29B 1M71A 4CNIB 3O3BB 5BW7A 1CK0H 5MI0B 3KYNB 4I5BA 2ORBH 1MCNA 2HTLC 4U1IB 5F7HA 3L1OL 1F02I 1YPZE 3GMPB 1I1FB 3BQUD 3DROB 3M45A 3SO3B 2FBJL 4KKLC 5L2KD 5DFVC 5C2BH 4BFIB 3DMMD 2BVYA 5DK0A 3LKNB 4MDJA 1MPAH 3WUZA 3BPCB 4H25A 2J4WH 7FABH 3O4LD 4EDWL 3U0PA 4CJ1A 4OJFH 4RGND 3RGVA 1E6JL 1MCWM 2WMPA 4ETQA 4QF1B 3C5ZD 4LDEB 4OLVL 2R2EB 3LPWA 4KTDL 1F3RB 4P5TC 4OIIL 1C5BL 3ARRA 1LK2A 4PD4K 3WNMA 4JRXB 4HC1H 1J0KA 1JWMB 2WW8A 3MC0A 2R15A 4NKQB 1FNSL 3T4YA 1FCCA 3V6OE 3O9WC 1U8QA 3FO2A 3NN8A 4ZFFA 1OPGH 3P0VL 5E99L 5EUKB 4EKXA 3CUPA 4YUEH 4IIQB 3B2VH 1UADC 4ODTH 1E4KA 2VLRE 1UEYA 3WLWD 1QKZH 2R0WH 2AEPH 5IBTL 4HPYL 2OL3H 1VFUA 4F7CB 3JV6A 4HH9B 3PWPE 5EZJB 2VZVA 4N0RA 4ODXB 3QUYB 2YD6A 4OQTA 3DRQA 4X8JB 2PN5A 4UINH 4EXKA 4M6ML 4DZBA 4YGAB 1HQ4B 1OAUL 1MQKL 1L7TH 4GRLC 1YQ2A 5HVHC 3OKNA 1YEHH 4Y2DC 3LS4L 4HAGA 3MUHL 2GW5A 2IAND 2NY3C 4NKMA 1XF5A 2NW2A 4Q6IA 5D7IE 2FRGP 5D2LE 4QT5B 3DX7A 3G6AB 2WIMA 1IQDB 1TJGH 3RHWF 5HHOE 2AGJH 5ESQA 5F96L 3SDAA 1B6UA 2HA1A 5C0EB 3GIZL 1RVFL 1G7MA 1HH9B 1LE5B 1I9JH 4QRSA 2F54B 2FGZA 3MXVL 4JGJA 4QRUB 3TBVA 2WBJA 4TSAL 1GL4B 4PRPD 1N3NA 4UV4L 4OFKA 4PV8A 5D6CB 2FDBP 5BJTB 5CZXD 5KBNC 5T3XD 1OB1B 2ZPKL 3GKWH 1OSZB 4JFHE 4PGEA 4TULL 1DUZA 5DD0L 4MAYA 3U1SL 4GRMA 5C0FB 3P2TA 3ZYZA 5MEQA 4Q9RL 4S1SL 3RX7A 4M1CD 3RIAK 4TTDD 2ZCHL 1AQKL 3EYQD 4OFIA 2EDNA 3MREB 1LMKA 4RWYH 4JFYB 3MNVB 3S36H 3VFGH 1JRHL 1CGWA 1GGUA 3BD5A 3ESVF 5IROC 5GIRA 4R4ND 2DAVA 1NCAL 4KXZI 4J1UA 4GKZB 4X0KA 2XWTB 3QQ9C 3MCLL 4X9GA 4PRAA 4Z7UE 4NQXA 4PG9A 4U33A 3QNZB 2QTEA 1AHWA 2ITDB 4MXVF 4I3RL 3RWIA 1FZMA 3GSQB 1YNKH 1QEWB 1DBML 4HIJB 5FB8B 2JCCB 1B4JL 5DD3H 1KGCE 2NW3A 1CD8A 4AMKH 1UM5L 3EFFA 3K1DA 4BKLB 1FAIL 3B5GA 5HHXH 3Q5YA 4NDMA 1UENA 3DX9A 4M6OH 3WSQH 5C08D 3DX8B 4JFEE 3V7AE 3P9MA 2HFFB 2UZIL 3WIHH 5IG7B 1IGMH 4C54A 2GKIA 4JFDD 4Y19A 1PEZA 4OQTH 1F90H 3CXDL 4NQVB 4OM1H 1A7PH 1TENA 3KYKL 3KYOA 3O0RH 2OZ4A 4GQPH 4UT6L 4NFCA 3B6SB 3IJSA 1R5VA 3SJVA 3MRKB 1OGAB 3EUUA 1MCPL 1IAKA 1KB5B 2CK2A 1PAMA 2C3HA 1HI6B 2BNRE 4ZAKD 3N85L 4GAJH 3HFML 3DO7B 1PKQE 2XN9E 2EYRA 4Z7VA 3F65A 1T1XB 4G8FB 4LCCB 1NAMB 3UJIL 2GJ6A 3ARQA 4YZFF 1FSKB 1CBVH 1R0AL 3QEHB 4FTVE 5A2FA 2MCPL 4L29A 4BUGA 2QBWA 4JQVA 4W4OA 4CNIA 1HYSD 3O3BA 1CE6B 4POYA 3KYNA 4OZIE 4O5LL 3HI6H 4U1IA 5T1KB 3MOAH 4Z9KB 3GMPA 1JMXA 1I1FA 3DROA 5L0QC 3LRHA 4BFIA 3JWDC 1RQ5A 2F15A 3ARED 3RWCB 1M7IB 3LKNA 4FQ1H 3KPSE 3SDDB 3BPCA 3STBA 2FNBA 1EHNA 4PJFF 3QFJB 3TT3L 2RIKA 3EGSB 1F13A 4QF1A 2R2EA 4DVBB 1HNGA 3I9GH 5E8OB 3D9AL 1IFHH 1NCWL 2A1WL 4NCC2 2VXQH 4JO4H 3TP4A 2UWEF 4JRXA 1PLGH 4UT9H 1N5YL 1JWMA 1SEQL 5D7LD 3WFBH 5TDOB 2HT2C 2ARWA 3IFLL 4TRPL 1JZ3A 2AXHA 3QEQE 1TCMA 1W0WB 3AS2A 5EUKA 4G8EB 3VFPB 4HLJA 4IIQA 3V4PH 2AQ2A 2CK0L 4LCIH 5FUCC 2ZUUA 4XPHH 3WFDL 1X4YA 3NPSB 1RHFA 3RY6C 4F7CA 1YNLH 4HH9A 4PJ5D 3ZT7A 2AI0L 2H26B 4KFZC 5BZDB 3PWLB 5H37H 4ODXA 1PEWA 4M43H 4OCSH 3ARUA 4X8JA 5T1MB 2IAMD 1DQLH 1QVOB 4L3EB 1HQ4A 1TPXB 3TA3D 2VZ3A 2VMFA 2V17L 3PGDB 4XI5D 5E5MB 2Y23A 3NACH 1MRFH 3O2VL 3VXUE 2NPLX 2BX5A 4OGYL 4CN6A 4XH2B 1BFSA 4QT5A 3G6AA 5DMIL 2NMSA 1IQDA 1TVDA 2R2BB 1ORSB 1RUPL 1XIWD 3CDCA 5EUOB 4PP1C 5KVGL 4GSDL 1W72B 2X4OB 1F97A 4N0FB 5C0EA 1RV6X 1JTTA 2CUIA 4NOBA 1HH9A 1LE5A 2VTFA 2F54A 2EKJA 4QRUA 4QWWD 2EIDA 1GGTA 1RK0B 3GMLB 2O61A 4HMCA 3ZHKA 3S4SG 2DKMA 1C1EH 5EU3B 5D6CA 2ZUQB 4YHYB 4HKXB 1OB1A 1NUDA 1OSZA 4NQDB 1P4LB 1U93B 2H8PB 2IQAB 3L3HB 4HPOH 4FQIL 3BWUC 4OBRA 5C0FA 3RGVD 3CVIH 4NQCB 2O5XL 2DTML 2CKBL 2Z8RA 4K71C 5I15H 3V95A 5TH2B 3KJ4B 1FC2D 3MREA 4JFYA 3MNVA 2Z4QB 3PL6B 2OMNA 2GI7A 3L5XL 1SVCP 5EB9A 1EO8L 3IDUA 4G9FB 2XWTA 4QTIH 3O8XC 2VO5A 4JFZH 2VLKD 3U4BH 3RUGB 3QNZA 3LS5L 3OPZH 2ITDA 3BP5B 3OKEB 4MJIB 3GSQA 2A38A 5FUCE 3BRGC 1QEWA 4HIJA 5FB8A 2JCCA 4UIKL 2FO1A 2FJGB 5D7KD 1R24B 2FLBT 2VDOL 1SVZA 3H2WA 3BPOC 4GMTL 3OAUH 1SBBA 1LO3H 4BKLA 2CGRH 3WFHB 4RAHA 2OK0L 2CXGA 3RIFF 3UTSE 3ECBB 3BKJL 5IFJB 3R1GH 3J7HA 5SX5K 3KPTA 3TBTB 3DX8A 4P9MH 4JB9H 1OARL 1BVKB 2HFFA 3PDOB 1SBSH 4OFDA 5IG7A 4YQXH 3S36X 1NCDH 1SMOA 5TQ2L 3WFCL 3BP6B 1PY4A 4NQVA 3QDJB 3NABH 5B38G 2BJMH 3D18B 2O26U 3QQ3B 1NBZB 3P77B 4ZD3L 3ARVA 3B6SA 2W91A 4JLRB 4ZMAT 1XCTB 2GT9B 2P24B 1N8ZB 3MRKA 1OGAA 4WTXA 1H3GA 2V7HB 1AR1D 4RGOL 5KZCD 1KB5A 2AJZB 1SEBB 4I3SL 1KC5L 3SDAD 4L3CB 3VDBA 1HI6A 5EOQH 3KNBB 3OX8B 1C5CL 3DO7A 5IT2L 3P4MB 1JPGB 2WBJD 5F3HB 4XPGH 4F2MB 5DR5H 1MF2H 1T1XA 4G8FA 4LCCA 1NAMA 1A9EB 1GGBH 2Y9RT 3QEHA 5DLML 1WAAA 2VXUL 4OD2B 1EHLL 1AO7E 1CE6A 4X4XB 3MRGB 1FDLH 4MAYD 1BMGA 5EOTB 3TM6A 5T1KA 4PFEA 4M7ZC 1T5XB 4RDQF 5T5FH 1HEZB 1DVFB 4DTGH 3MLUH 2DM2A 3RWCA 1M7IA 3SDDA 4F9LA 2FEDD 2VLMD 2V5SA 5KTEL 2EE3A 5F93C 2DQJH 1QHPA 4C83A 3QFJA 3MGTB 1N6VA 3N1MC 3EGSA 3GM8A 1SM3H 4GG6F 1N59B 2EXWC 4G42B 4DVBA 3TV3H 5GZOC 5E8OA 4ALAL 1V7NL 3MRIB 4K2UL 4LSVL 4OSUH 3WS6A 3V8OA 2KQMA 5FXCH 5AD0A 4JR9L 1YY9C 1NFIB 1T0NB 3MRCB 1BP3B 5DFWH 3RA7L 4DN4L 5TDOA 1JNLL 2DWEB 4K23L 2F8VA 5LXGL 5FYLL 2UY6A 3UJJH 1FBIL 2P5EE 2F19H 2QQKL 5F6HI 1W0WA 1E0OB 4G8EA 4U1KB 3VFPA 1PY9A 4YC2B 3QRGL 1K3ZA 5E08H 1P4BH 5I2IB 4Y19D 4QRPE 5EBGA 2CXKA 1BBJB 3P0YL 5D70H 4UOW1 3AM8A 2HT4C 2XRAH 4TPRL 4OCYH 1JMZA 2H26A 3K7UA 5BZDA 3PWLA 2AJVH 6FABL 1JYXA 2JELH 5IMKB 3GJFB 5T1MA 3SJVD 1DBBH 1OAXL 4K94L 1P6FA 1QVOA 2J6EH 4L3EA 4CMMB 1EEQA 3PGDA 5E5MA 3UYOD 2HKFH 4X98B 4OLYL 3U9UB 2HVJB 2JJSA 4TUKL 4AL8H 1L0XA 1J5OL 1MFDH 1KB5H 4MWFB 4XH2A 1Q0YL 3HB3C 2AJYH 5J1AB 2R2BA 2XWJB 5EUOA 2GJ6D 2HWZH 1W72A 2X4OA 1V7MH 1MFBL 4N0FA 5SV3A 4P5KB 2I07B 5D5ME 4KTEH 1JTPA 1LDPH 1OL0A 3VFVB 4MAUL 1PG7H 4BSJA 3GSOB 1RK0A 3GMLA 2CO6B 3BN3B 3V4UL 2CDGB 1NCNA 1RK1B 1QACA 2KDGA 5B3JF 4FXGB 5EU3A 3VRIB 4R4BB 3BRFA 1EGJL 2YD5A 5HDQL 4HKXA 1FFPB 1QFWH 4NQDA 5MERB 2R8SL 1P4LA 1U93A 3L3HA 2H8PA 2IQAA 4NQEE 4TSBL 5DEFB 5T33L 3FJTA 1BWMA 3GSNB 4GRWB 1MLBB 2WK2A 4NQCA 3AB0B 4WY7L 2XV6B 5TH2A 4G6AC 1LILA 1OM3L 4YAQB 1SHMA 5DJ0B 3BYYA 4TNVF 2Z4QA 3PL6A 1FVCB 4J23A 4I77L 4XWOC 4JRXD 4TNWK 1XFPA 1UACH 4G9FA 4K7FB 4MXQD 4OKVB 3RVUC 1F4WH 5F9OL 1ULVA 5L88L 1DSFH 1S3KL 3RUGA 4D8PB 3BP5A 2VQ1B 3OKEA 4MJIA 4PJBF 5HGBB 1HYRC 1U3JA 3SE8H 4R8WL 1FNGB 4HLZH 2R4RH 2CLRB 5EZLB 2J1KA 2FJGA 5F9AC 4BUHA 5J8OA 1R24A 2R1XB 4MJ5B 2H3NB 5E2UH 2F5BL 4NT6B 5DUMH 1YECL 1FRGH 3WFHA 4S1DC 4R6UA 3ECBA 3CFJB 5FKPB 5IFJA 4WI3A 2D7OA 3MXWL 2NTSP 4KTYA 4M48H 2VUYA 3TBTA 1U8NB 1XMWA 3PDOA 3EHBC 3M1BB 3WKMH 5TE4L 4RRPA 3BP6A 1MCSA 3I6GB 3PWVB 4WIQA 3QDJA 4O58H 1F3JB 3MACH 3D18A 1MCBA 4NBXB 2ZCKL 3QQ3A 1NBZA 4WENB 1T7YA 4JLRA 2WUBH 5A2JH 4FHBD 1XCTA 1ND0B 2A9MH 2GT9A 2P24A 4HT1L 1Q1JL 1N8ZA 3MOBL 4M61B 4KRPB 2V7HA 1B4RA 4NSKB 4M6NL 2AJZA 1SEBA 3W2DH 3PHQB 1CR9H 4L3CA 5C0BD 3AXLB 4CU8A 2QR0B 5INDB 3KNBA 2F54D 4M03A 3OX8A 1XF1A 3P4MA 1JPGA 5GGQH 3GKZA 5F3HA 3O4OB 4RBPK 4F2MA 3R8QA 4BZ2L 3F5WB 1FE8L 1SJEB 1T6WA 1A9EA 5AZEL 2VXSH 3IKCB 4Z7OF 2X5PA 5AWNH 2QSTA 2DICA 4OD2A 4OCXH 4R96B 4X4XA 3MRGA 1X5IA 5I30L 5EOTA 5HHVL 4Z95H 3VCLB 2G60L 1T5XA 5DD6B 1AH1A 4GMSH 1BJ1J 1HEZA 1DVFA 4OZGB 1D6VL 2J7LA 3AU1B 2IQ9L 4J4PC 1AFVL 1X4ZA 3MLVH 3SGEH 2WIIB 4TSCL 5IB1B 4PJIE 3H9HB 2W92A 3MGTA 4WFFD 4WHTB 3MTRA 3OBAA 4BZ1L 4BH7B 1GAFL 3U0TB 4G42A 3JV5A 4DUVA 4PGJA 2BOBB 3JVGA 3MRIA 3JSSA 5LGJB 1KFAH 3SDXF 4XWGL 2YOCA 1U8HB 4NQTA 5KVEH 1NFIA 1TTUA 4XAKE 3LDBC 3FN0L 4BZYA 2A83B 5HHPB 3WIIH 4I0PB 1A14H 3OB8A 4Z7NE 2DWEA 2AKRB 4QNPE 5DD5H 4XPAL 1HIML 3DSFL 4U1KA 2BVOB 3U30B 4LPCA 4N8PA 3LQAC 5I2IA 3TO4C 3VRLE 3V2AR 3VDAA 4U7KA 2YR3A 5BV7L 5BVPH 4HF5L 4IJ3C 4DUXA 1JRHI 5GS0C 3DI2B 5IMKA 3RU8L 1F42A 4MD4B 3GJFA 3S34L 2VC2L 1T7VA 3CFEB 1OGAD 4XP5L 4CMMA 2P5WE 4QHLA 4TVPH 3O2WH 5GHWH 3VWKC 2C4XA 2NX5B 2K3TA 1EMTH 4X98A 3U9UA 2HVJA 1MAKA 1KJ3L 1LP9B 5ANME 4WEMB 1UYWL 3OB0H 5L9DH 3L5HA 4MWFA 4IRJC 2EZ0C 3EOAB 4PB9L 2Q86B 5J1AA 1QNZH 1XF2B 4X80L 2XWJA 2FWOB 1R6VA 5HHMD 1ZLSH 4KJPD 4LAQH 2AEWA 2L4OA 5JHLH 1BX2B 4JKPL 3QB7C 4P5KA 1QA9B 3OXSB 4I13B 5D1XC 2I07A 3BT2H 4N1HB 2VJXA 3VFVA 5I18L 2OTUB 5T1KD 3GSOA 1ZTXH 2XFXB 1QTYT 1UWEH 4YXKH 3P4NB 2XTJB 5K9QG 2CDGA 1C08B 1RK1A 4FXGA 4PP2B 4Y4HC 4ZTOL 1AR2A 4OB5H 3VRIA 4R4BA 2FO4B 3SDDD 1WZ1L 1DQTA 1FFPA 2IPUG 5T1LB 5MERA 3LEYH 1XGQB 2AK1L 5DEFA 3QFJD 3GSNA 4C56B 2VL4A 3BX7C 1MLBA 1DN2A 1OHQA 4O9HL 5HDBF 4YAQA 4JO2L 5DJ0A 5CD3B 5DYOB 1FVCA 3S4SB 1J1OL 3TH3T 4LSUL 4LOUC 4L4VB 4S1RL 1GVIA 4K7FA 4OKVA 4ZO8A 5GGVY 1KCLA 3MRMB 5E2WL 4ZS6C 4NZDA 4KKCC 4D8PA 3QPQC 1PG7X 4DAGH 2CIKB 5HGBA 4ODVH 1DLFH 2YPLE 4PJHF 5BMFH 1FNGA 2CLRA 5EZLA 4XVJH 4D0CB 2R1XA 4MJ5A 2H3NA 3VXTB 5A40E 1WICA 4NT6A 1BEYH 4OCWH 5IJVB 5KSAC 3RKDD 3CFJA 5FKPA 1RJYB 2VDKL 2GQHA 4YLQT 3H7BB 4U7MA 1U8NA 5CSBA 1A7QH 1A0QL 1XGYH 3VD9A 2J8HA 5DJ2B 4H1LH 3M1BA 3LQAL 5KSBF 4L3ED 4XVTH 4WWKC 3LB6C 4JHWH 4DKAA 2C5DC 4L9LB 3I6GA 3PWVA 5CFHA 1F3JA 1TZIB 1KXTB 3WN5C 3IU3B 1HCVA 5GS0L 1ZLUH 1ND0A 3TT1H 2NY4C 2ZUYA 4M61A 3QUMH 3ZKND 4G80B 2FYYB 1GCFA 4Q0XL 3K1KC 3JTSB 2FIKB 4NSKA 5IVXF 2DN7A 2ENSA 3PHQA 4OZHF 1TXKA 4XNUH 1TJIH 3O3DB 3AXLA 2EDXA 2QR0A 2P8LB 3HMWH 5B38B 1FFRA 1JBJA 1T89A 4HGWB 5F1SA 4UDTB 5DWUH 5GQBA 2CIIB 3F5WA 5DO2C 1SJEA 3O6ML 1KEML 4YHNB 5DQ9B 3IKCA 4QOKE 4NQDD 3AVEA 1DFBL 1DE4B 3DIFB 5J13B 4R96A 3ZKXC 2YK1H 4NQCD 5D1QB 1BQSA 1S9YB 4Q7DA 4IHOB 3VCLA 4XXDB 3VFOB 5DD6A 4HGKC 4PJ9B 4DKDC 1MREL 3PL6D 2A6DB 3VA2C 4UTAH 4OZGA 1UH3A 3AU1A 5I1AB 2OJZH 3RPIB 3B9KC 4G9FD 2WIIA 3H9HA 4HIIB 4WHTA 1G9MC 1XAUA 4BH7A 5KG9B 4MJID 3U0TA 3OJMB 4P4KC 2EYSB 4JN1H 3K4ZA 2HJKB 3QIWC 3SCMB 1IAIH 1IC1A 4W68A 5LGJA 2HLFC 3MYZA 1U8HA 2C7UB 4KGJA 2A83A 4C57C 5HHPA 4I0PA 2AKRA 4Q97A 3WBDA 5GGVL 1MH5B 3QJHB 4HWEH 1WBZA 4QHKJ 3QWRA 3B5TA 3MRQB 3B83A 2BVOA 2GTWB 2H41A 5I66B 2XA8L 4H8WC 4YEEA 3ZKMC 4WHCA 3SOBH 1NGQL 1T04B 3QDJD 3KLHD 4PJAE 2F74B 3ZYIA 5JR1L 2DQUL 3FT3B 1EFQA 1CFVL 5GS3A 1MNUL 3BDYH 5I8CB 4CU7A 3WNLA 3WXVH 3F7QA 1BJ1H 4MD4A 1R3HB 3CFEA 4WW2C 1U91B 2YD2A 4LSSH 5ACMA 3TCLB 1BZ9B 1CS6A 2NX5A 1MCIA 4JPVH 1LP9A 3GRWL 3HHRB 3SE9L 5C0JB 4OCNC 3QUXB 4AZ8A 3VW3L 4LMQE 4K8RD 3EOAA 2Q86A 4RMWA 1XF2A 4LCUB 5ICYB 5GRYA 1YMMB 2ICWI 3AC0A 2FWOA 3ILPB 3S37X 4NFBA 1FNEB 1E27B 1BX2A 3C9NB 3QXTA 5I8OH 4LU5L 1QA9A 1A6WL 3OXSA 2NYYD 1HSAB 1I7ZB 4QXTB 4Z8FH 4DVRL 2OTUA 5I9QC 1KUMA 2XFXA 2HG5B 3P4NA 4FQCH 1I3RB 1C08A 1LO4L 2BNQE 5DVOA 3KPPB 4PP2A 3OZ9H 4OLZL 3MRNB 5EA0L 2FO4A 1U8LB 1JZ7A 1G6VK 5T1LA 3C60C 3RQ3A 4KQ4L 5JA9A 1XGQA 3BKMH 4HH8A 5EN2B 3NBNA 3BKCH 3DXAD 4C56A 2P42B 3BPNC 1AY1L 5KVFH 3RL1B 3TBYB 4NHUB 3VI3F 4FQQB 2BVPB 5DYOA 5BS0B 4MQTB 3HAEG 5C0RL 3S4SA 4U1LB 1T6VN 1YEJL 1N0LA 4L4VA 5K9QI 2EDBA 5CAYB 1N0XL 4DGVL 3CX5K 4RMUA 1GGYA 3MRMA 2PXYC 1FYTE 2BRRH 2OR7A 3ULVH 4FP8H 1CICB 2CIKA 4JREB 4HCRL 4DQOL 4QRRE 3RWGB 4M02A 1QSZA 3RBGA 3G9VA 5I8EB 4KK5C 5CJ8A 4D0CA 1UWGH 4JM2F 3VXTA 3LOWA 1KIRB 3HN3A 4PV9B 3LEVH 3F58L 5IJVA 4NPYB 5E9DB 1OP3K 4YDIH 1RJYA 3H7BA 1EZVX 5DJ2A 3UYPA 1U8JB 4R3SB 2XPGB 3EDFA 4L9LA 4R2GD 4KRMB 3TZVB 2Y25A 1A6VH 2K7PA 1TZIA 3UBXG 1NMBL 3IU3A 3EIFA 3T09A 5F1KC 2XZAL 5HYJB 5KSVB 1IC4L 4G80A 2FYYA 5D96C 5JOPD 2MTPA 3JTSA 3NMEA 2FIKA 3DMMC 4PJCB 1DQJB 3BAEH 4NKDB 5FHAH 3O3DA 1ZHNB 2P8LA 2FX8H 1INEH 1F11B 1TCRB 3M8OH 4XX1G 4Q9BA 5B38A 1QSFE 4CDGC 4HGWA 4DGIL 5IF0B 4UDTA 5FCUH 3PG2A 4IMKA 1H0DB 3RRQA 4OCLC 2CIIA 4HJ0C 4YHNA 5DQ9A 3VG0L 3ARFB 5CJOH 3D87B 1DN0B 2FB4L 1DE4A 1J8HB 1A5FL 3DIFA 4N0CD 1RUKL 2WBKA 4GLRH 1IE5A 1OQOA 4AEEA 4MD5B 5D1QA 3U6RB 1S9YA 4IHOA 3S5LG 3QPXH 4XXDA 3S37L 3VFOA 4ZFOB 4PJ9A 2IBZX 4OAWB 2A6DA 2B2XH 1UM4L 3ZDZE 5I1AA 3RPIA 2FJFB 2R69L 4OI9A 1WT5C 1IMHC 4J2XA 4U1GC 4Z77B 4LVNB 5CSZB 4JQIL 2PYEE 2DJSA 4KH2A 2YC1B 3N9GL 5DZOA 5J06A 1MFEL 2NXZC 2WWKO 5KG9A 2I5YL 2A9NL 1RU9H 1CDUA 4NN7B 1II4E 5DUBB 2EYSA 2HJKA 3SCMA 2D0FA 2VDPH 2WWMD 1NMAL 4MXWH 1LO5B 2Z31D 2R2HB 3BXNB 2NZ9C 2C7UA 5KOMC 4AEHH 4P2OC 1RUAL 1QPXA 2XOTA 3TJEH 4H20H 3ILQC 4GQ9L 1YMHB 1MH5A 3QJHA 1EA9C 2XKUA 2QHRL 1K3IA 3PDGA 5GISH 3MRQA 3EYSL 3QEUB 2GTWA 1LGVA 5I66A 5AZ2L 4JDTL 5D72H 1S7RB 3U9PH 1U8KB 5IMLB 1QQDA 4BSVB 5D1ZC 5IGXL 1FYHB 1T04A 1ZANH 2XQYK 2F74A 3JBG7 5DTFB 3FT3A 5L2KE 1NBQA 1RUML 2B4CC 3CX5J 3TH2T 1RJLB 1TVHB 4XNQB 4QYOB 1R3HA 5KN5B 4KRPD 4L8SA 1U91A 1R3KB 3TCLA 4BA8A 5IFHL 1O5DT 4ONGH 1ZLWK 1BZ9A 2VAAB 5CZXC 4I0CC 4EBQH