1YCCA

High-resolution refinement of yeast iso-1-cytochrome c and comparisons with other eukaryotic cytochromes c
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
107
Chain Sequence
TEFKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWDENNMSEYLTNPKYIPGTKMAFGGLKKEKDRNDLITYLKKACE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C
publication title High-resolution refinement of yeast iso-1-cytochrome c and comparisons with other eukaryotic cytochromes c.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Electron transport (cytochrome)
total genus 32
structure length 107
sequence length 108
ec nomenclature
pdb deposition date 1990-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00034 Cytochrom_C Cytochrome c
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1yccA00
3ZOWA 1RZ6A 5KKZB 5CIDB 1CRGA 2JQRA 3NBTA 4EIFA 1JDLA 3BCCD 1CHIA 2MHMA 1I54A 3ZOYA 4WQ7A 2B10B 1HRCA 1KYOD 2D0SA 3RMZA 1H9XA 4Y5RA 1YEBA 1KYOW 5KAFV 3SLEA 1N15A 3CU4A 5H2FV 3ORVA 1CRCA 5AURA 4Q5PA 2IBZD 1EB7A 5KAIV 1N50A 1DW2A 2BCNB 3L74D 4AALA 1A8CA 1DVHA 5B5EV 2EXVA 4JCGA 4WQ9A 1CORA 1HH7A 2DVHA 1H32A 1C52A 5C0ZA 2FWLA 3ZIYA 1YTCA 3PXWA 1DW1A 4UB8V 351CA 2MTAC 4GYDA 1KX7A 1W2LA 1DT1A 3L4MA 4O1WA 1B7VA 3DP5A 3HQ6A 1HJ3A 4H0KA 2YQBA 2B12B 155CA 2PACA 3VYMA 1LC1A 5DJQC 5DJQB 1CRJA 3WFEC 2AXTV 4FA1A 1C7MA 1C2RA 4FB1A 1CIHA 1NTKD 1MZ4A 1ZZHA 1QL3A 1I8OA 2GC7D 1EZVD 1LC2A 3PXTA 1GKSA 1E29A 4P4QB 5IY51 1H9YA 1E2RA 2DGEA 1NIRA 1A2SA 4WQ8A 1OAEA 3H1HD 3WU2V 1HROA 1HZUA 2I8FA 1CC5A 4PD4D 3OCDA 2CA4B 2PCCB 2ZXYA 1M60A 4EIDA 1CSXA 3NWVA 4V2KA 2N9JA 4L3GA 4MU8A 1I6EA 4FA4A 1C6OA 1FI9A 3JBTB 3CYTI 2B0ZB 1DIQC 1BL9A 1N90A 1CRYA 4AAMA 1HJ5A 1IRVA 3DR0A 2QJPB 3O5CA 1KB0A 2B11B 3SVWA 2CXBA 2CA3B 1CO6A 1CSWA 1GIWA 2BLFB 4D6TD 1AOFA 4WQDA 3H1LD 3WC8A 4FA9A 1H31B 2GIWA 1PPJD 1LS9A 1QYZA 1H33A 5KLVD 1CTYA 4UB6V 2HV4A 1L9JC 1RAQA 4H0JA 1QL4A 4WQEA 4U3FD 1J3SA 1K3GA 3TYIA 1H1OA 2YCCA 1L0ND 1BGYD 1DW0A 2AI5A 2FRCA 1RZ5A 1CXCA 1FJ0A 2QJKB 1NTZD 1SQBD 2JTIB 3A9FA 2N18C 2C1UA 2N18B 3DMIA 3OA8A 5CIEB 2BCCD 1FOCA 1S6VB 1KX2A 3H1JD 1IRWA 1R0QA 1YNRA 1CIEA 3WFCC 5CIFB 2V07A 3NBSA 3L73D 1FCDC 2C2CA 4AANA 1KIBA 1DIIC 3CXHW 3H1KD 1BCCD 1CCHA 1FI3A 3ZCFA 1CHHA 1F1FA 1HCMA 3CX5W 2VHDA 1WEJF 1CTJA 1CYCA 3CWBD 5DF5A 3A0HV 4IL6V 1H32B 5E79V 4WQBA 1U75B 4RSZA 2CE0A 1FHBA 2YK3A 2BPBB 4PW9B 1SQQD 4EIEA 2C1DA 3O1YA 2OZ1A 2QJYB 4AAOA 451CA 5C9MA 2LIRA 3SXTA 3M97X 3HQ9A 1M6ZA 5KLIB 1IQCA 1YCCA 2A06D 2C1VA 3ZOXA 1F1CA 3RN0A 1E8EA 1BE3D 1N9CA 1AOQA 1I8PA 2YIUB 1HZVA 1NU1D 1C6RA 2BH4X 1IO3A 3O0RC 1IZL0 4EICA 3H1ID 1CXAA 2ORLA 4FA5A 1CYJA 1NMIA 3WUIA 1RAPA 1W5CT 3ZBMA 3OCDB 5CIBB 1LFMA 1C2NA 1KB9D 2PCBB 5DFSA 5CIHB 1SQXD 1CSVA 1SQVD 1AKKA 1SQPD 2BH5X 5CIGB 1ETPA 3VNWA 1M70A 1P84D 1K3HA 3CP5A 4AX3A 1YEAA 4PJ0V 5B66V 4GEDB 4L3HA 1NMLA 1LMSA 2ZOOA 4N0KA 2ZBOA 1MG2D 1L0LD 5EXQA 2ZZS1 1CRIA 5GTIV 3PH2B 1CCRA 4J20A 1NTMD 3A0BV 3KZIV 5TISV 1GQ1A 3WFDC 4PWAA 3RLMA 2LITA 1H33B 4DY9A 1CTZA 2D0WA 1S5LV 5GTHV 1GDVA 3HQ8A 1OCDA 1KV9A 3CXHD 4YE1A 2AIUA 3PXSA 1MG3D 2FYUD 3CX5D 2C9XB 1HJ4A 1GJQA 1CSUA 2N3YA 1DVVA 1PP9D 2B4ZA 3RN1A 1VYDA 4L1QA 1QKSA 2GB8B 4FANA 3L75D 1CIGA 1DW3A 1I5TA 3OA8B 3HQ7A 2C8SA 1WVEC 1CEDA 2GC4D 2CE1A 1COTA 2BGVX 4QAOA 2ZONG 1CYIA 1FI7A 5B6QA 1I55A 1CIFA 1CRHA 1C6SA 2L4DA 3L72D 3SJLA 1ZRTD 3SWSA 1AYGA 4XXLA 4WQCA 1I6DA 2V08A 1GU2A 1QN2A 3L70D 5CYTR 2C1DB 3MK7B 3MK7C 3O20A 4FAVA 5CICB 1YFCA 2OZ1B 3L4OA 4KMGA 3C2CA 1NNOA 4LJIA 3X39A 3ZOOA 1A56A 1C75A 1L9BC 1U74B 1YICA 1CHJA 1CNOA 3VRDA 3L71D 4WQAA 4XYDB 1YIQA 4K3IA 2N9IA 2N3BA 1H31A 2FYNB 3TGUD 4NFGB 2XTSB 4O1QA 3WFBC
chains in the Genus database with same CATH superfamily
3ZOWA 1RZ6A 5KKZB 5CIDB 1CRGA 2JQRA 3NBTA 4EIFA 1JDLA 3BCCD 1CHIA 2MHMA 1I54A 3ZOYA 4WQ7A 2B10B 1HRCA 1KYOD 2D0SA 3RMZA 1H9XA 4Y5RA 1YEBA 1KYOW 5KAFV 3SLEA 1N15A 3CU4A 5H2FV 3ORVA 3D0WA 1CRCA 5AURA 4Q5PA 2IBZD 1EB7A 5KAIV 1N50A 1DW2A 2BCNB 3L74D 4AALA 1A8CA 1DVHA 5B5EV 2EXVA 4JCGA 4WQ9A 1CORA 1HH7A 2DVHA 1H32A 1C52A 5C0ZA 2FWLA 3ZIYA 1YTCA 3PXWA 1DW1A 4UB8V 351CA 2MTAC 4GYDA 1KX7A 1W2LA 1DT1A 3L4MA 4O1WA 1B7VA 3DP5A 3HQ6A 1HJ3A 4H0KA 2YQBA 2B12B 155CA 2PACA 3VYMA 1LC1A 5DJQC 5DJQB 1CRJA 3WFEC 2AXTV 4FA1A 1C7MA 1C2RA 4FB1A 1CIHA 1NTKD 1MZ4A 1ZZHA 1QL3A 1I8OA 2GC7D 1EZVD 1LC2A 3PXTA 1GKSA 1E29A 4P4QB 5IY51 1H9YA 1E2RA 2DGEA 1NIRA 1A2SA 4WQ8A 1OAEA 3H1HD 3WU2V 1HROA 1HZUA 2I8FA 1CC5A 4PD4D 3OCDA 2CA4B 2PCCB 2ZXYA 1M60A 4EIDA 1CSXA 3NWVA 4V2KA 2N9JA 4L3GA 4MU8A 1I6EA 4FA4A 1C6OA 1FI9A 3JBTB 3CYTI 2B0ZB 1DIQC 1BL9A 1N90A 1CRYA 4AAMA 1HJ5A 1IRVA 3DR0A 2QJPB 3O5CA 1KB0A 2B11B 3SVWA 2CXBA 2CA3B 1CO6A 1CSWA 1GIWA 2BLFB 4D6TD 1AOFA 4WQDA 3H1LD 3WC8A 4FA9A 1H31B 2GIWA 1PPJD 1LS9A 1QYZA 1H33A 5KLVD 1CTYA 4UB6V 2HV4A 1L9JC 1RAQA 4H0JA 1QL4A 4WQEA 4U3FD 1J3SA 1K3GA 3TYIA 1H1OA 2YCCA 1L0ND 1BGYD 1DW0A 2AI5A 2FRCA 1RZ5A 1CXCA 1FJ0A 2QJKB 1NTZD 1SQBD 2JTIB 3A9FA 2N18C 2C1UA 2N18B 3DMIA 3OA8A 5CIEB 2BCCD 1FOCA 1S6VB 1KX2A 3H1JD 1IRWA 1R0QA 1YNRA 1CIEA 3WFCC 5CIFB 2V07A 3NBSA 3L73D 1FCDC 2C2CA 4AANA 1KIBA 1DIIC 3CXHW 3H1KD 1BCCD 1CCHA 1FI3A 3ZCFA 1CHHA 1F1FA 1HCMA 3CX5W 2VHDA 1WEJF 1CTJA 1CYCA 3CWBD 5DF5A 3A0HV 4IL6V 1H32B 5E79V 4WQBA 1U75B 4RSZA 2CE0A 1FHBA 2YK3A 2BPBB 4PW9B 1SQQD 4EIEA 2C1DA 3O1YA 2OZ1A 2QJYB 4AAOA 451CA 5C9MA 2LIRA 3SXTA 3M97X 3HQ9A 1M6ZA 5KLIB 1IQCA 1YCCA 2A06D 2C1VA 3ZOXA 1F1CA 3RN0A 1E8EA 1BE3D 1N9CA 1AOQA 1I8PA 2YIUB 1HZVA 1NU1D 1C6RA 2BH4X 1IO3A 3O0RC 1IZL0 4EICA 3H1ID 1CXAA 2ORLA 4FA5A 1CYJA 1NMIA 3WUIA 1RAPA 1W5CT 3ZBMA 3OCDB 5CIBB 1LFMA 1C2NA 1KB9D 2PCBB 5DFSA 5CIHB 1SQXD 1CSVA 1SQVD 1AKKA 1SQPD 2BH5X 5CIGB 1ETPA 3VNWA 1M70A 1P84D 1K3HA 3CP5A 4AX3A 1YEAA 4PJ0V 5B66V 4GEDB 4L3HA 1NMLA 1LMSA 2ZOOA 4N0KA 2ZBOA 1MG2D 1L0LD 5EXQA 2ZZS1 1CRIA 5GTIV 3PH2B 1CCRA 4J20A 1NTMD 3A0BV 3KZIV 5TISV 1GQ1A 3WFDC 4PWAA 3RLMA 2LITA 1H33B 4DY9A 1CTZA 2D0WA 1S5LV 5GTHV 1GDVA 3HQ8A 1OCDA 1KV9A 3CXHD 4YE1A 2AIUA 3PXSA 1MG3D 2FYUD 3CX5D 2C9XB 1HJ4A 1GJQA 1CSUA 2N3YA 1DVVA 1PP9D 2B4ZA 3RN1A 1VYDA 4L1QA 1QKSA 2GB8B 4FANA 3L75D 1CIGA 1DW3A 1I5TA 3OA8B 3HQ7A 2C8SA 1WVEC 1CEDA 2GC4D 2CE1A 1COTA 2BGVX 4QAOA 2ZONG 1CYIA 1FI7A 5B6QA 1I55A 1CIFA 1CRHA 1C6SA 2L4DA 3L72D 3SJLA 1ZRTD 3SWSA 1AYGA 4XXLA 4WQCA 1I6DA 2V08A 1GU2A 1QN2A 3L70D 5CYTR 2C1DB 3MK7B 3MK7C 3O20A 4FAVA 5CICB 1YFCA 2OZ1B 3L4OA 4KMGA 3C2CA 1NNOA 4LJIA 3X39A 3ZOOA 1A56A 1C75A 1L9BC 1U74B 1YICA 1CHJA 1CNOA 3VRDA 3L71D 4WQAA 4XYDB 1YIQA 4K3IA 2N9IA 2N3BA 1H31A 2FYNB 3TGUD 4NFGB 2XTSB 4O1QA 3WFBC
chains in the Genus database with same CATH topology
3ZOWA 1RZ6A 5KKZB 5CIDB 1CRGA 2JQRA 3NBTA 4EIFA 1JDLA 3BCCD 1CHIA 2MHMA 1I54A 3ZOYA 4WQ7A 2B10B 1HRCA 1KYOD 2D0SA 3RMZA 1H9XA 4Y5RA 1YEBA 1KYOW 5KAFV 3SLEA 1N15A 3CU4A 5H2FV 3ORVA 1CRCA 5AURA 4Q5PA 2IBZD 1EB7A 5KAIV 1N50A 1DW2A 2BCNB 3L74D 4AALA 1A8CA 1DVHA 5B5EV 2EXVA 4JCGA 4WQ9A 1CORA 1HH7A 2DVHA 1H32A 1C52A 5C0ZA 2FWLA 3ZIYA 1YTCA 3PXWA 1DW1A 4UB8V 351CA 2MTAC 4GYDA 1KX7A 1W2LA 1DT1A 3L4MA 4O1WA 1B7VA 3DP5A 3HQ6A 1HJ3A 4H0KA 2YQBA 2B12B 155CA 2PACA 3VYMA 1LC1A 5DJQC 5DJQB 1CRJA 3WFEC 2AXTV 4FA1A 1C7MA 1C2RA 4FB1A 1CIHA 1NTKD 1MZ4A 1ZZHA 1QL3A 1I8OA 2GC7D 1EZVD 1LC2A 3PXTA 1GKSA 1E29A 4P4QB 5IY51 1H9YA 1E2RA 2DGEA 1NIRA 1A2SA 4WQ8A 1OAEA 3H1HD 3WU2V 1HROA 1HZUA 2I8FA 1CC5A 4PD4D 3OCDA 2CA4B 2PCCB 2ZXYA 1M60A 4EIDA 1CSXA 3NWVA 4V2KA 2N9JA 4L3GA 4MU8A 1I6EA 4FA4A 1C6OA 1FI9A 3JBTB 3CYTI 2B0ZB 1DIQC 1BL9A 1N90A 1CRYA 4AAMA 1HJ5A 1IRVA 3DR0A 2QJPB 3O5CA 1KB0A 2B11B 3SVWA 2CXBA 2CA3B 1CO6A 1CSWA 1GIWA 2BLFB 4D6TD 1AOFA 4WQDA 3H1LD 3WC8A 4FA9A 1H31B 2GIWA 1PPJD 1LS9A 1QYZA 1H33A 5KLVD 1CTYA 4UB6V 2HV4A 1L9JC 1RAQA 4H0JA 1QL4A 4WQEA 4U3FD 1J3SA 1K3GA 3TYIA 1H1OA 2YCCA 1L0ND 1BGYD 1DW0A 2AI5A 2FRCA 1RZ5A 1CXCA 1FJ0A 2QJKB 1NTZD 1SQBD 2JTIB 3A9FA 2N18C 2C1UA 2N18B 3DMIA 3OA8A 5CIEB 2BCCD 1FOCA 1S6VB 1KX2A 3H1JD 1IRWA 1R0QA 1YNRA 1CIEA 3WFCC 5CIFB 2V07A 3NBSA 3L73D 1FCDC 2C2CA 4AANA 1KIBA 1DIIC 3CXHW 3H1KD 1BCCD 1CCHA 1FI3A 3ZCFA 1CHHA 1F1FA 1HCMA 3CX5W 2VHDA 1WEJF 1CTJA 1CYCA 3CWBD 5DF5A 3A0HV 4IL6V 1H32B 5E79V 4WQBA 1U75B 4RSZA 2CE0A 1FHBA 2YK3A 2BPBB 4PW9B 1SQQD 4EIEA 2C1DA 3O1YA 2OZ1A 2QJYB 4AAOA 451CA 5C9MA 2LIRA 3SXTA 3M97X 3HQ9A 1M6ZA 5KLIB 1IQCA 1YCCA 2A06D 2C1VA 3ZOXA 1F1CA 3RN0A 1E8EA 1BE3D 1N9CA 1AOQA 1I8PA 2YIUB 1HZVA 1NU1D 1C6RA 2BH4X 1IO3A 3O0RC 1IZL0 4EICA 3H1ID 1CXAA 2ORLA 4FA5A 1CYJA 1NMIA 3WUIA 1RAPA 1W5CT 3ZBMA 3OCDB 5CIBB 1LFMA 1C2NA 1KB9D 2PCBB 5DFSA 5CIHB 1SQXD 1CSVA 1SQVD 1AKKA 1SQPD 2BH5X 5CIGB 1ETPA 3VNWA 1M70A 1P84D 1K3HA 3CP5A 4AX3A 1YEAA 4PJ0V 5B66V 4GEDB 4L3HA 1NMLA 1LMSA 2ZOOA 4N0KA 2ZBOA 1MG2D 1L0LD 5EXQA 2ZZS1 1CRIA 5GTIV 3PH2B 1CCRA 4J20A 1NTMD 3A0BV 3KZIV 5TISV 1GQ1A 3WFDC 4PWAA 3RLMA 2LITA 1H33B 4DY9A 1CTZA 2D0WA 1S5LV 5GTHV 1GDVA 3HQ8A 1OCDA 1KV9A 3CXHD 4YE1A 2AIUA 3PXSA 1MG3D 2FYUD 3CX5D 2C9XB 1HJ4A 1GJQA 1CSUA 2N3YA 1DVVA 1PP9D 2B4ZA 3RN1A 1VYDA 4L1QA 1QKSA 2GB8B 4FANA 3L75D 1CIGA 1DW3A 1I5TA 3OA8B 3HQ7A 2C8SA 1WVEC 1CEDA 2GC4D 2CE1A 1COTA 2BGVX 4QAOA 2ZONG 1CYIA 1FI7A 5B6QA 1I55A 1CIFA 1CRHA 1C6SA 2L4DA 3L72D 3SJLA 1ZRTD 3SWSA 1AYGA 4XXLA 4WQCA 1I6DA 2V08A 1GU2A 1QN2A 3L70D 5CYTR 2C1DB 3MK7B 3MK7C 3O20A 4FAVA 5CICB 1YFCA 2OZ1B 3L4OA 4KMGA 3C2CA 1NNOA 4LJIA 3X39A 3ZOOA 1A56A 1C75A 1L9BC 1U74B 1YICA 1CHJA 1CNOA 3VRDA 3L71D 4WQAA 4XYDB 1YIQA 4K3IA 2N9IA 2N3BA 1H31A 2FYNB 3TGUD 4NFGB 2XTSB 4O1QA 3WFBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZOW A;  1RZ6 A;  5KKZ B;  5CID B;  1CRG A;  2JQR A;  3NBT A;  4EIF A;  1JDL A;  3BCC D;  1CHI A;  2MHM A;  1I54 A;  3ZOY A;  4WQ7 A;  2B10 B;  1HRC A;  1KYO D;  2D0S A;  3RMZ A;  1H9X A;  4Y5R A;  1YEB A;  1KYO W;  5KAF V;  3SLE A;  1N15 A;  3CU4 A;  5H2F V;  3ORV A;  1CRC A;  5AUR A;  4Q5P A;  2IBZ D;  1EB7 A;  5KAI V;  1N50 A;  1DW2 A;  2BCN B;  3L74 D;  4AAL A;  1A8C A;  1DVH A;  5B5E V;  2EXV A;  4JCG A;  4WQ9 A;  1COR A;  1HH7 A;  2DVH A;  1H32 A;  1C52 A;  5C0Z A;  2FWL A;  3ZIY A;  1YTC A;  3PXW A;  1DW1 A;  4UB8 V;  351C A;  2MTA C;  4GYD A;  1KX7 A;  1W2L A;  1DT1 A;  3L4M A;  4O1W A;  1B7V A;  3DP5 A;  3HQ6 A;  1HJ3 A;  4H0K A;  2YQB A;  2B12 B;  155C A;  2PAC A;  3VYM A;  1LC1 A;  5DJQ C;  5DJQ B;  1CRJ A;  3WFE C;  2AXT V;  4FA1 A;  1C7M A;  1C2R A;  4FB1 A;  1CIH A;  1NTK D;  1MZ4 A;  1ZZH A;  1QL3 A;  1I8O A;  2GC7 D;  1EZV D;  1LC2 A;  3PXT A;  1GKS A;  1E29 A;  4P4Q B;  5IY5 1;  1H9Y A;  1E2R A;  2DGE A;  1NIR A;  1A2S A;  4WQ8 A;  1OAE A;  3H1H D;  3WU2 V;  1HRO A;  1HZU A;  2I8F A;  1CC5 A;  4PD4 D;  3OCD A;  2CA4 B;  2PCC B;  2ZXY A;  1M60 A;  4EID A;  1CSX A;  3NWV A;  4V2K A;  2N9J A;  4L3G A;  4MU8 A;  1I6E A;  4FA4 A;  1C6O A;  1FI9 A;  3JBT B;  3CYT I;  2B0Z B;  1DIQ C;  1BL9 A;  1N90 A;  1CRY A;  4AAM A;  1HJ5 A;  1IRV A;  3DR0 A;  2QJP B;  3O5C A;  1KB0 A;  2B11 B;  3SVW A;  2CXB A;  2CA3 B;  1CO6 A;  1CSW A;  1GIW A;  2BLF B;  4D6T D;  1AOF A;  4WQD A;  3H1L D;  3WC8 A;  4FA9 A;  1H31 B;  2GIW A;  1PPJ D;  1LS9 A;  1QYZ A;  1H33 A;  5KLV D;  1CTY A;  4UB6 V;  2HV4 A;  1L9J C;  1RAQ A;  4H0J A;  1QL4 A;  4WQE A;  4U3F D;  1J3S A;  1K3G A;  3TYI A;  1H1O A;  2YCC A;  1L0N D;  1BGY D;  1DW0 A;  2AI5 A;  2FRC A;  1RZ5 A;  1CXC A;  1FJ0 A;  2QJK B;  1NTZ D;  1SQB D;  2JTI B;  3A9F A;  2N18 C;  2C1U A;  2N18 B;  3DMI A;  3OA8 A;  5CIE B;  2BCC D;  1FOC A;  1S6V B;  1KX2 A;  3H1J D;  1IRW A;  1R0Q A;  1YNR A;  1CIE A;  3WFC C;  5CIF B;  2V07 A;  3NBS A;  3L73 D;  1FCD C;  2C2C A;  4AAN A;  1KIB A;  1DII C;  3CXH W;  3H1K D;  1BCC D;  1CCH A;  1FI3 A;  3ZCF A;  1CHH A;  1F1F A;  1HCM A;  3CX5 W;  2VHD A;  1WEJ F;  1CTJ A;  1CYC A;  3CWB D;  5DF5 A;  3A0H V;  4IL6 V;  1H32 B;  5E79 V;  4WQB A;  1U75 B;  4RSZ A;  2CE0 A;  1FHB A;  2YK3 A;  2BPB B;  4PW9 B;  1SQQ D;  4EIE A;  2C1D A;  3O1Y A;  2OZ1 A;  2QJY B;  4AAO A;  451C A;  5C9M A;  2LIR A;  3SXT A;  3M97 X;  3HQ9 A;  1M6Z A;  5KLI B;  1IQC A;  1YCC A;  2A06 D;  2C1V A;  3ZOX A;  1F1C A;  3RN0 A;  1E8E A;  1BE3 D;  1N9C A;  1AOQ A;  1I8P A;  2YIU B;  1HZV A;  1NU1 D;  1C6R A;  2BH4 X;  1IO3 A;  3O0R C;  1IZL 0;  4EIC A;  3H1I D;  1CXA A;  2ORL A;  4FA5 A;  1CYJ A;  1NMI A;  3WUI A;  1RAP A;  1W5C T;  3ZBM A;  3OCD B;  5CIB B;  1LFM A;  1C2N A;  1KB9 D;  2PCB B;  5DFS A;  5CIH B;  1SQX D;  1CSV A;  1SQV D;  1AKK A;  1SQP D;  2BH5 X;  5CIG B;  1ETP A;  3VNW A;  1M70 A;  1P84 D;  1K3H A;  3CP5 A;  4AX3 A;  1YEA A;  4PJ0 V;  5B66 V;  4GED B;  4L3H A;  1NML A;  1LMS A;  2ZOO A;  4N0K A;  2ZBO A;  1MG2 D;  1L0L D;  5EXQ A;  2ZZS 1;  1CRI A;  5GTI V;  3PH2 B;  1CCR A;  4J20 A;  1NTM D;  3A0B V;  3KZI V;  5TIS V;  1GQ1 A;  3WFD C;  4PWA A;  3RLM A;  2LIT A;  1H33 B;  4DY9 A;  1CTZ A;  2D0W A;  1S5L V;  5GTH V;  1GDV A;  3HQ8 A;  1OCD A;  1KV9 A;  3CXH D;  4YE1 A;  2AIU A;  3PXS A;  1MG3 D;  2FYU D;  3CX5 D;  2C9X B;  1HJ4 A;  1GJQ A;  1CSU A;  2N3Y A;  1DVV A;  1PP9 D;  2B4Z A;  3RN1 A;  1VYD A;  4L1Q A;  1QKS A;  2GB8 B;  4FAN A;  3L75 D;  1CIG A;  1DW3 A;  1I5T A;  3OA8 B;  3HQ7 A;  2C8S A;  1WVE C;  1CED A;  2GC4 D;  2CE1 A;  1COT A;  2BGV X;  4QAO A;  2ZON G;  1CYI A;  1FI7 A;  5B6Q A;  1I55 A;  1CIF A;  1CRH A;  1C6S A;  2L4D A;  3L72 D;  3SJL A;  1ZRT D;  3SWS A;  1AYG A;  4XXL A;  4WQC A;  1I6D A;  2V08 A;  1GU2 A;  1QN2 A;  3L70 D;  5CYT R;  2C1D B;  3MK7 B;  3MK7 C;  3O20 A;  4FAV A;  5CIC B;  1YFC A;  2OZ1 B;  3L4O A;  4KMG A;  3C2C A;  1NNO A;  4LJI A;  3X39 A;  3ZOO A;  1A56 A;  1C75 A;  1L9B C;  1U74 B;  1YIC A;  1CHJ A;  1CNO A;  3VRD A;  3L71 D;  4WQA A;  4XYD B;  1YIQ A;  4K3I A;  2N9I A;  2N3B A;  1H31 A;  2FYN B;  3TGU D;  4NFG B;  2XTS B;  4O1Q A;  3WFB C; 
#chains in the Genus database with same CATH topology
 3ZOW A;  1RZ6 A;  5KKZ B;  5CID B;  1CRG A;  2JQR A;  3NBT A;  4EIF A;  1JDL A;  3BCC D;  1CHI A;  2MHM A;  1I54 A;  3ZOY A;  4WQ7 A;  2B10 B;  1HRC A;  1KYO D;  2D0S A;  3RMZ A;  1H9X A;  4Y5R A;  1YEB A;  1KYO W;  5KAF V;  3SLE A;  1N15 A;  3CU4 A;  5H2F V;  3ORV A;  3D0W A;  1CRC A;  5AUR A;  4Q5P A;  2IBZ D;  1EB7 A;  5KAI V;  1N50 A;  1DW2 A;  2BCN B;  3L74 D;  4AAL A;  1A8C A;  1DVH A;  5B5E V;  2EXV A;  4JCG A;  4WQ9 A;  1COR A;  1HH7 A;  2DVH A;  1H32 A;  1C52 A;  5C0Z A;  2FWL A;  3ZIY A;  1YTC A;  3PXW A;  1DW1 A;  4UB8 V;  351C A;  2MTA C;  4GYD A;  1KX7 A;  1W2L A;  1DT1 A;  3L4M A;  4O1W A;  1B7V A;  3DP5 A;  3HQ6 A;  1HJ3 A;  4H0K A;  2YQB A;  2B12 B;  155C A;  2PAC A;  3VYM A;  1LC1 A;  5DJQ C;  5DJQ B;  1CRJ A;  3WFE C;  2AXT V;  4FA1 A;  1C7M A;  1C2R A;  4FB1 A;  1CIH A;  1NTK D;  1MZ4 A;  1ZZH A;  1QL3 A;  1I8O A;  2GC7 D;  1EZV D;  1LC2 A;  3PXT A;  1GKS A;  1E29 A;  4P4Q B;  5IY5 1;  1H9Y A;  1E2R A;  2DGE A;  1NIR A;  1A2S A;  4WQ8 A;  1OAE A;  3H1H D;  3WU2 V;  1HRO A;  1HZU A;  2I8F A;  1CC5 A;  4PD4 D;  3OCD A;  2CA4 B;  2PCC B;  2ZXY A;  1M60 A;  4EID A;  1CSX A;  3NWV A;  4V2K A;  2N9J A;  4L3G A;  4MU8 A;  1I6E A;  4FA4 A;  1C6O A;  1FI9 A;  3JBT B;  3CYT I;  2B0Z B;  1DIQ C;  1BL9 A;  1N90 A;  1CRY A;  4AAM A;  1HJ5 A;  1IRV A;  3DR0 A;  2QJP B;  3O5C A;  1KB0 A;  2B11 B;  3SVW A;  2CXB A;  2CA3 B;  1CO6 A;  1CSW A;  1GIW A;  2BLF B;  4D6T D;  1AOF A;  4WQD A;  3H1L D;  3WC8 A;  4FA9 A;  1H31 B;  2GIW A;  1PPJ D;  1LS9 A;  1QYZ A;  1H33 A;  5KLV D;  1CTY A;  4UB6 V;  2HV4 A;  1L9J C;  1RAQ A;  4H0J A;  1QL4 A;  4WQE A;  4U3F D;  1J3S A;  1K3G A;  3TYI A;  1H1O A;  2YCC A;  1L0N D;  1BGY D;  1DW0 A;  2AI5 A;  2FRC A;  1RZ5 A;  1CXC A;  1FJ0 A;  2QJK B;  1NTZ D;  1SQB D;  2JTI B;  3A9F A;  2N18 C;  2C1U A;  2N18 B;  3DMI A;  3OA8 A;  5CIE B;  2BCC D;  1FOC A;  1S6V B;  1KX2 A;  3H1J D;  1IRW A;  1R0Q A;  1YNR A;  1CIE A;  3WFC C;  5CIF B;  2V07 A;  3NBS A;  3L73 D;  1FCD C;  2C2C A;  4AAN A;  1KIB A;  1DII C;  3CXH W;  3H1K D;  1BCC D;  1CCH A;  1FI3 A;  3ZCF A;  1CHH A;  1F1F A;  1HCM A;  3CX5 W;  2VHD A;  1WEJ F;  1CTJ A;  1CYC A;  3CWB D;  5DF5 A;  3A0H V;  4IL6 V;  1H32 B;  5E79 V;  4WQB A;  1U75 B;  4RSZ A;  2CE0 A;  1FHB A;  2YK3 A;  2BPB B;  4PW9 B;  1SQQ D;  4EIE A;  2C1D A;  3O1Y A;  2OZ1 A;  2QJY B;  4AAO A;  451C A;  5C9M A;  2LIR A;  3SXT A;  3M97 X;  3HQ9 A;  1M6Z A;  5KLI B;  1IQC A;  1YCC A;  2A06 D;  2C1V A;  3ZOX A;  1F1C A;  3RN0 A;  1E8E A;  1BE3 D;  1N9C A;  1AOQ A;  1I8P A;  2YIU B;  1HZV A;  1NU1 D;  1C6R A;  2BH4 X;  1IO3 A;  3O0R C;  1IZL 0;  4EIC A;  3H1I D;  1CXA A;  2ORL A;  4FA5 A;  1CYJ A;  1NMI A;  3WUI A;  1RAP A;  1W5C T;  3ZBM A;  3OCD B;  5CIB B;  1LFM A;  1C2N A;  1KB9 D;  2PCB B;  5DFS A;  5CIH B;  1SQX D;  1CSV A;  1SQV D;  1AKK A;  1SQP D;  2BH5 X;  5CIG B;  1ETP A;  3VNW A;  1M70 A;  1P84 D;  1K3H A;  3CP5 A;  4AX3 A;  1YEA A;  4PJ0 V;  5B66 V;  4GED B;  4L3H A;  1NML A;  1LMS A;  2ZOO A;  4N0K A;  2ZBO A;  1MG2 D;  1L0L D;  5EXQ A;  2ZZS 1;  1CRI A;  5GTI V;  3PH2 B;  1CCR A;  4J20 A;  1NTM D;  3A0B V;  3KZI V;  5TIS V;  1GQ1 A;  3WFD C;  4PWA A;  3RLM A;  2LIT A;  1H33 B;  4DY9 A;  1CTZ A;  2D0W A;  1S5L V;  5GTH V;  1GDV A;  3HQ8 A;  1OCD A;  1KV9 A;  3CXH D;  4YE1 A;  2AIU A;  3PXS A;  1MG3 D;  2FYU D;  3CX5 D;  2C9X B;  1HJ4 A;  1GJQ A;  1CSU A;  2N3Y A;  1DVV A;  1PP9 D;  2B4Z A;  3RN1 A;  1VYD A;  4L1Q A;  1QKS A;  2GB8 B;  4FAN A;  3L75 D;  1CIG A;  1DW3 A;  1I5T A;  3OA8 B;  3HQ7 A;  2C8S A;  1WVE C;  1CED A;  2GC4 D;  2CE1 A;  1COT A;  2BGV X;  4QAO A;  2ZON G;  1CYI A;  1FI7 A;  5B6Q A;  1I55 A;  1CIF A;  1CRH A;  1C6S A;  2L4D A;  3L72 D;  3SJL A;  1ZRT D;  3SWS A;  1AYG A;  4XXL A;  4WQC A;  1I6D A;  2V08 A;  1GU2 A;  1QN2 A;  3L70 D;  5CYT R;  2C1D B;  3MK7 B;  3MK7 C;  3O20 A;  4FAV A;  5CIC B;  1YFC A;  2OZ1 B;  3L4O A;  4KMG A;  3C2C A;  1NNO A;  4LJI A;  3X39 A;  3ZOO A;  1A56 A;  1C75 A;  1L9B C;  1U74 B;  1YIC A;  1CHJ A;  1CNO A;  3VRD A;  3L71 D;  4WQA A;  4XYD B;  1YIQ A;  4K3I A;  2N9I A;  2N3B A;  1H31 A;  2FYN B;  3TGU D;  4NFG B;  2XTS B;  4O1Q A;  3WFB C; 
#chains in the Genus database with same CATH homology
 3ZOW A;  1RZ6 A;  5KKZ B;  5CID B;  1CRG A;  2JQR A;  3NBT A;  4EIF A;  1JDL A;  3BCC D;  1CHI A;  2MHM A;  1I54 A;  3ZOY A;  4WQ7 A;  2B10 B;  1HRC A;  1KYO D;  2D0S A;  3RMZ A;  1H9X A;  4Y5R A;  1YEB A;  1KYO W;  5KAF V;  3SLE A;  1N15 A;  3CU4 A;  5H2F V;  3ORV A;  1CRC A;  5AUR A;  4Q5P A;  2IBZ D;  1EB7 A;  5KAI V;  1N50 A;  1DW2 A;  2BCN B;  3L74 D;  4AAL A;  1A8C A;  1DVH A;  5B5E V;  2EXV A;  4JCG A;  4WQ9 A;  1COR A;  1HH7 A;  2DVH A;  1H32 A;  1C52 A;  5C0Z A;  2FWL A;  3ZIY A;  1YTC A;  3PXW A;  1DW1 A;  4UB8 V;  351C A;  2MTA C;  4GYD A;  1KX7 A;  1W2L A;  1DT1 A;  3L4M A;  4O1W A;  1B7V A;  3DP5 A;  3HQ6 A;  1HJ3 A;  4H0K A;  2YQB A;  2B12 B;  155C A;  2PAC A;  3VYM A;  1LC1 A;  5DJQ C;  5DJQ B;  1CRJ A;  3WFE C;  2AXT V;  4FA1 A;  1C7M A;  1C2R A;  4FB1 A;  1CIH A;  1NTK D;  1MZ4 A;  1ZZH A;  1QL3 A;  1I8O A;  2GC7 D;  1EZV D;  1LC2 A;  3PXT A;  1GKS A;  1E29 A;  4P4Q B;  5IY5 1;  1H9Y A;  1E2R A;  2DGE A;  1NIR A;  1A2S A;  4WQ8 A;  1OAE A;  3H1H D;  3WU2 V;  1HRO A;  1HZU A;  2I8F A;  1CC5 A;  4PD4 D;  3OCD A;  2CA4 B;  2PCC B;  2ZXY A;  1M60 A;  4EID A;  1CSX A;  3NWV A;  4V2K A;  2N9J A;  4L3G A;  4MU8 A;  1I6E A;  4FA4 A;  1C6O A;  1FI9 A;  3JBT B;  3CYT I;  2B0Z B;  1DIQ C;  1BL9 A;  1N90 A;  1CRY A;  4AAM A;  1HJ5 A;  1IRV A;  3DR0 A;  2QJP B;  3O5C A;  1KB0 A;  2B11 B;  3SVW A;  2CXB A;  2CA3 B;  1CO6 A;  1CSW A;  1GIW A;  2BLF B;  4D6T D;  1AOF A;  4WQD A;  3H1L D;  3WC8 A;  4FA9 A;  1H31 B;  2GIW A;  1PPJ D;  1LS9 A;  1QYZ A;  1H33 A;  5KLV D;  1CTY A;  4UB6 V;  2HV4 A;  1L9J C;  1RAQ A;  4H0J A;  1QL4 A;  4WQE A;  4U3F D;  1J3S A;  1K3G A;  3TYI A;  1H1O A;  2YCC A;  1L0N D;  1BGY D;  1DW0 A;  2AI5 A;  2FRC A;  1RZ5 A;  1CXC A;  1FJ0 A;  2QJK B;  1NTZ D;  1SQB D;  2JTI B;  3A9F A;  2N18 C;  2C1U A;  2N18 B;  3DMI A;  3OA8 A;  5CIE B;  2BCC D;  1FOC A;  1S6V B;  1KX2 A;  3H1J D;  1IRW A;  1R0Q A;  1YNR A;  1CIE A;  3WFC C;  5CIF B;  2V07 A;  3NBS A;  3L73 D;  1FCD C;  2C2C A;  4AAN A;  1KIB A;  1DII C;  3CXH W;  3H1K D;  1BCC D;  1CCH A;  1FI3 A;  3ZCF A;  1CHH A;  1F1F A;  1HCM A;  3CX5 W;  2VHD A;  1WEJ F;  1CTJ A;  1CYC A;  3CWB D;  5DF5 A;  3A0H V;  4IL6 V;  1H32 B;  5E79 V;  4WQB A;  1U75 B;  4RSZ A;  2CE0 A;  1FHB A;  2YK3 A;  2BPB B;  4PW9 B;  1SQQ D;  4EIE A;  2C1D A;  3O1Y A;  2OZ1 A;  2QJY B;  4AAO A;  451C A;  5C9M A;  2LIR A;  3SXT A;  3M97 X;  3HQ9 A;  1M6Z A;  5KLI B;  1IQC A;  1YCC A;  2A06 D;  2C1V A;  3ZOX A;  1F1C A;  3RN0 A;  1E8E A;  1BE3 D;  1N9C A;  1AOQ A;  1I8P A;  2YIU B;  1HZV A;  1NU1 D;  1C6R A;  2BH4 X;  1IO3 A;  3O0R C;  1IZL 0;  4EIC A;  3H1I D;  1CXA A;  2ORL A;  4FA5 A;  1CYJ A;  1NMI A;  3WUI A;  1RAP A;  1W5C T;  3ZBM A;  3OCD B;  5CIB B;  1LFM A;  1C2N A;  1KB9 D;  2PCB B;  5DFS A;  5CIH B;  1SQX D;  1CSV A;  1SQV D;  1AKK A;  1SQP D;  2BH5 X;  5CIG B;  1ETP A;  3VNW A;  1M70 A;  1P84 D;  1K3H A;  3CP5 A;  4AX3 A;  1YEA A;  4PJ0 V;  5B66 V;  4GED B;  4L3H A;  1NML A;  1LMS A;  2ZOO A;  4N0K A;  2ZBO A;  1MG2 D;  1L0L D;  5EXQ A;  2ZZS 1;  1CRI A;  5GTI V;  3PH2 B;  1CCR A;  4J20 A;  1NTM D;  3A0B V;  3KZI V;  5TIS V;  1GQ1 A;  3WFD C;  4PWA A;  3RLM A;  2LIT A;  1H33 B;  4DY9 A;  1CTZ A;  2D0W A;  1S5L V;  5GTH V;  1GDV A;  3HQ8 A;  1OCD A;  1KV9 A;  3CXH D;  4YE1 A;  2AIU A;  3PXS A;  1MG3 D;  2FYU D;  3CX5 D;  2C9X B;  1HJ4 A;  1GJQ A;  1CSU A;  2N3Y A;  1DVV A;  1PP9 D;  2B4Z A;  3RN1 A;  1VYD A;  4L1Q A;  1QKS A;  2GB8 B;  4FAN A;  3L75 D;  1CIG A;  1DW3 A;  1I5T A;  3OA8 B;  3HQ7 A;  2C8S A;  1WVE C;  1CED A;  2GC4 D;  2CE1 A;  1COT A;  2BGV X;  4QAO A;  2ZON G;  1CYI A;  1FI7 A;  5B6Q A;  1I55 A;  1CIF A;  1CRH A;  1C6S A;  2L4D A;  3L72 D;  3SJL A;  1ZRT D;  3SWS A;  1AYG A;  4XXL A;  4WQC A;  1I6D A;  2V08 A;  1GU2 A;  1QN2 A;  3L70 D;  5CYT R;  2C1D B;  3MK7 B;  3MK7 C;  3O20 A;  4FAV A;  5CIC B;  1YFC A;  2OZ1 B;  3L4O A;  4KMG A;  3C2C A;  1NNO A;  4LJI A;  3X39 A;  3ZOO A;  1A56 A;  1C75 A;  1L9B C;  1U74 B;  1YIC A;  1CHJ A;  1CNO A;  3VRD A;  3L71 D;  4WQA A;  4XYD B;  1YIQ A;  4K3I A;  2N9I A;  2N3B A;  1H31 A;  2FYN B;  3TGU D;  4NFG B;  2XTS B;  4O1Q A;  3WFB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...