1YCFA

Oxidized (di-ferric) fpra from moorella thermoacetica
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
398
structure length
398
Chain Sequence
b'SQPVAITDGIYWVGAVDWNIRYFHGPAFSTHRGTTYNAYLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDSLKAHYSHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMDEAAKYYANILMPFSNLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKAKAVIAYDTMWLSTEKMAHALMDGLVAGGCEVKLFKLSVSDRNDVIKEILDARAVLVGSPTINNDILPVVSPLLDDLVGLRPKNKVGLAFGAYGWGGGAQKILEERLKAAKIELIAEPGPTVQWVPRGEDLQRCYELGRKIAARIAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nitric oxide reductase
publication title X-ray crystal structures of Moorella thermoacetica FprA. Novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase.
pubmed doi rcsb
source organism Moorella thermoacetica
molecule tags Oxidoreductase
total genus 132
structure length 398
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec 1.-.-.-:
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ycfA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1ycfA01
5K4KA 3I0VA 4GYUA 3ZR9A 3IE0A 3X2YA 2BR6A 5LVAA 5HIOA 4C09A 1YCGA 2I7TA 3K20A 1BU5A 4GQIA 1JJEA 1WUOA 4C14A 5LCFA 1C7EA 4BP0A 3TEMA 3ADRA 1SQSA 3NHLA 2YCBA 3NHYA 2OHJA 2P18A 4LA4A 1QRDA 3SPUA 4YAFA 2YNTB 5K0WA 2A7MA 3X30A 4Y9RA 4WD6A 3B6JA 4YAUA 1KR3A 3IE1A 2FLVA 1FUEA 2FM6A 2R2DA 4YALA 5FQCA 1B1CA 5EV8A 1KBOA 3F6SA 1BVTA 2AIOA 4NQ2A 1WSWA 3BK1A 5A0VA 2Q0JA 4Z5ZA 2RG1A 2BG8A 2OHHA 3JSXA 1D03A 2X2OA 4EY2A 1V4BA 3O2NA 1QBGA 2V9CA 4TYTA 4RAMA 1CZRA 4TYFA 3FJOA 4H0DA 2VW8A 2WRSA 3U7IA 3ESXA 2BZSA 2M6RA 3I15A 4O98A 1CZOA 4H2DA 2BFKA 3ZNBA 2W5UA 2Y87A 3OJWA 3KAPA 2V5UA 4Y7CA 2FOXA 2QMYA 5LE1A 3ZWFA 1QR2A 4UAMA 3LT5A 1P9EA 5B15A 4LAFA 3Q6VA 4QOJA 1AHNA 3IOFA 1BVYF 3D7NA 4ZVNA 1XI2A 3IOGA 4EYBA 2BMVA 3AF5A 2Z9DA 1C7FA 1I1OA 1QHEA 2BMIA 2YNTA 3GFSA 4HEQA 1AG9A 5K4MA 4ICIA 3NLLA 1ZKPA 4ZO2A 4QOFA 3NHWA 4HL2A 4UWSB 4ZEJA 2Q62A 3P2UA 3RPCA 1DXKA 5FA6A 1A7TA 5EAIA 1XYVA 1WW1A 2F1OA 1FLNA 2ZWRA 5HH5A 2DKFA 3ESHA 2YNWA 3R2UA 3FVWA 2XF4A 4AX0B 5EVDA 2V5VA 3ESYA 1WRAA 1KO3A 2UYXA 4RL0A 4AWZA 4ZVLA 2XR1A 3N3BC 5A4KA 4LTDA 2P97A 3FAIA 4OXXA 4N9QA 1J9GA 1FLDA 5AEBA 3FNIA 1JT1A 4D1UA 2Q9UA 2I7VA 2QDTA 3DHCA 2GFKA 4FX2A 1QH5A 4F6HA 5HISA 2FZ5A 3NHPA 2QWXA 1AKWA 2P4ZA 3QH8A 1XM8A 4EFZA 2QX4A 3X2XA 1J9EA 1CZHA 2KQUA 4PTZA 4CETA 5AHOA 1H69A 3KNRA 3IELA 1CZLA 1L9YA 1X8HA 2FHXB 2AZ4A 1YDGA 4FGKA 3I14A 3A4YA 3KNSA 5B3KA 3IDZA 4LTMA 1DDKA 4D1WA 4FGJA 2H6AA 1GG5A 4C1CA 4QODA 5FQAA 4AD9A 4AX1B 3LCMA 4FEKA 3HR4A 4BMPB 5AXOA 2BGAA 1AKVA 1BC2A 5LBUA 5FQBA 1QH3A 2GSWA 5A87A 2N1MA 5B1UA 3S0ZA 2QJSA 3JXPA 4FSBA 2NYPA 1TIKA 2DOOA 4PU0A 4PVOA 4RAWA 4YSLA 2FVXA 3U7RA 3WXCA 4AWYB 4HKYA 3FX2A 2M5CA 4ZNBA 5HH4A 1CZUA 3SW3A 3F6RA 4U7GA 1XTOA 2WYMA 3SBLA 4Z67A 5AXRA 2Z98A 3T9MA 1BMCA 1ZTCA 2FDXA 4NULA 3W7AA 3OVMA 4QOGA 3NHRA 4Z6XA 2HPVA 5KIKA 3AJ3A 3DH8A 3TE7A 5ACVA 3EYWA 2BIBA 3NHFA 2ZZIA 2R96A 5EVKA 3NFRA 4TZFA 3ZHOA 5ACXA 4NLLA 2QX8A 4KEQA 5LSCA 3DHBA 2FHXA 4FR7A 2X2PA 4YQEA 2FCRA 2GMNA 1E5DA 5HH6A 4C1DA 5B3RA 4P62A 4U7HA 3IEMA 3QFRA 3ES9A 4TZ9A 1A8TA 2QDSA 2WC1A 1YCFA 5JROA 2BG6A 4QOEA 1VGNA 1J9ZA 4C1HA 3KAQA 5EMNA 5ACPA 1HLKA 4Z60A 1DD6A 1YRHA 4FGLA 2Q0IA 3T3NA 4HS4A 2BTNA 2BC2A 1SMLA 2I7XA 4YAOA 2A5LA 1YOBA 2Z9BA 3HLYA 4N82A 3B6MA 3SRXA 1T0IA 2WHGA 4D02A 3L9WA 1CZKA 2FZVA 4UWRB 1JA0A 5ACQA 3DHAA 2NXAA 2BPOA 4S24A 1DXQA 4B87A 5TGZA 3NHSA 2BG7A 5NULA 4PTYA 4D1TA 5EHTA 3GFRA 4F6ZA 2CBNA 4UWOB 5K4NA 5LCAA 1VMEA 1WUPA 2D5IA 3I13A 4NQ6A 2AMJA 1T5BA 1ZWLA 2WYMC 3RKKA 1TLLA 3F9OA 4BMOB 3K1YA 4C1FA 1AKRA 2FX2A 4PVTA 3ESZA 2NZEA 5F12A 1M2XA 5AHRA 2E7YA 5LMCA 5KILA 2XODA 4GYQA 1AKTA 1FLVA 3L9XA 1AKUA 1OFVA 2QR2A 2BFZB 4XWWA 2YZ3A 3P0RA 2HB9A 1ZWKA 2HNBA 1MQOA 3OX1A 3SFPA 3RPEA 4CHLA 2MOKA 1H66A 3QE2A 4C76A 1Y44A 3F2VA 2YNVB 4C0XA 4DY4A 1JA1A 2MTBA 4GCWA 5ACWA 2ZNBA 2FK6A 1X8GA 1KBQA 4M0CA 1NNI1 3AF6A 3MD7A 4Z5YA 3ZQ4A 3UXEA 2MWMA 3B6KA 4ZVMA 2WYLA 2YNUA 3B6IA 3W79A 2OYSA 2QX6A 5EW0A 4H6PA 1RLIA 4LE6A 5AYAA 4C1GA 4U7FA 4V0HA 1D04A 5LS3A 2FU9A 1X77A 1AMOA 4Z7RA 4ZO3A 2MT9A 3BK2A 4GI5A 2P1EA 3VPEA 3G1PA 3S2YA 1VJNA 4ZVKA 2QINA 4NQ5A 3FCZA 4KEPA 3OX3A 2BG2A 2FU6A 3KL7A 5HIPA 1WSBA 5A5ZA 5BUCA 3NHJA 1SG0A 2QEDA 2Y8BA 2ZKIA 3VQZA 3F90A 2BN4A 4NQ4A 2GFJA 3G5MA 5LJIA 2BFZA 4RL2A 5LBTA 4EXYA 2B3DA 3R6WA 5A0TA 5LM6A 5LCHA 3BC2A 1JJTA 1K07A 3OX2A 2FAXA 4XDHA 4RM5A 4YSBA 2YNVA 3NHKA 4TZBA 4GR9A 3QFCA 2FU7A 3I11A 3N3AC 3KLBA 1FX1A 1FTGA 4DILA 3FW1A 4DIKA 2OHIA 4BZ3A 4J5HA 5ACUA 1J8QA 2HNAA 3O73A 2Q42A 3HA2A 1FVXA 4C0WA 2GCUA 5EA2A 5FUQA 5ACRA 4D1VA 4UBQA 3IE2A 4TZEA 3GAMA 1DX9A 4R81A 4YAWA 1F4PA 3W77A 5FX2A 1RTTA 4EYFA 5DPXA 4QOIA 2QX9A 1OBOA 2R97A 5NLLA 1DXOA 4RBSA 2BF4A 2XOEA 1CZNA 3RKJA 1RCFA 4XUKA 3BV6A 5IQKA 1ZX1A 1KO2A 3N39C 3TZBA 5ACTA 4J5FA 4EXSA 4UA4A 2BFLA 2FU8A 3L6NA 3OWHA 3OJXA 3TP9A 5EWAA 2NZFA 4F8YA 4C1EA 3OWXA 4ESEA 1YKGA 3W78A 4HL1A 3PY6A 3KEGA 3NHUA 4J8PA 2KLBA 2M5DA 4EYLA 3SD9A 4JO0A 5LLDA 1RLJA 1XYYA 5LJLA 1ZNBA 4CF6A 6NULA 5F51A 2ZO4A 5HIQA 4XDGA 5EV6A 1AZLA 4U4LA 3T3OA 2Y8AA 5F4BA 3IEKA 1D4AA 4QOHA 5B3LA 2BG8B 2Z9CA 4XWTA 1YCHA 2QMZA 3EDOA 2GKLA 4LTNA 1XT6A 3X2ZA 1AKQA 3LVZA 3SVLA 1OBVA 4N65A 5ULLA 5EH9A 1X8IA 2M6SA 3PG4A 4YSKA 1FLAA 5ACSA 3UXHA 3H3EA 5EVBA 4UWPB 3GFQA 3PY5A 2ARKA 4Y9UA
chains in the Genus database with same CATH superfamily
4JQYA 5KINB 2P2ZA 2C4UA 3G1TA 3GMIA 1FEZA 3DAYA 3WJ7A 2IZ6A 3G3EA 3R7WB 2QE7D 4ENWA 1C8VB 1VIDA 2BEJA 3VHQA 5KB3A 1RYHA 1ZNXA 1YDFA 1CNMA 4L51A 4L4XA 4PF1A 5KTPA 1S2LA 2QLNA 2VUSA 5CT5A 2P77A 4M9ZA 4FEGA 2FFQA 2HMYB 3PFBA 4TX1A 4C6SA 1O89A 3O3NB 1TEVA 2HDWA 1X42A 4QUHA 2Q3HA 2FEWB 3TBFA 1USWA 2C0QA 3FWPA 1RJ9A 2E2WA 3WKDA 1XMVA 3U6BA 3CLSC 3G2IA 3IAUA 4I1YA 2A5FA 2YNTB 1ACLA 3ASZA 3DMRA 2VSYA 3IOCA 1YR8A 3UMFA 1D2CA 3B1XA 3H65A 3RYFB 1CY6A 4V2IA 4MZXA 4P54A 3WL5A 5BXYA 3B1JA 4X90A 1ESMA 2B8JA 2RBGA 1KK3A 4L4ZA 2XMQA 4QUBA 4AAYA 2D0DA 3BH6A 1CQJB 4BQRA 3F6SA 4G37A 3AM3A 1HK7A 2BEKA 2EX4A 2HBYA 3CINA 3GZNA 3K1JA 4RKFA 3SS7X 4HV4A 1H3EA 4EELA 4R8VA 3W05A 4KFUA 1DEXA 1PJ3A 3JSXA 1ISPA 2PLNA 2ZRPA 4OK6A 1G3QA 1IWBB 2I6TA 2HWXA 2PGNA 2QE6A 2QT1A 3DQQA 4FDMA 3MJVA 4ENVA 3T1NA 1SCQA 3RS2A 3PFIA 2PE5A 2ID9A 1JG6A 2Q6IA 3VTFA 2A5JA 1CUEA 4S1VA 2OB2A 2RAUA 2E55A 1P1BA 5G0SA 1O5OA 3HVUA 5LLSA 3LQKA 3U7IA 3IUBA 2I62A 1PWEA 3JX9A 1ISMA 4YRZA 5IPFA 4WZAE 3QNUA 3REGA 5ENVA 4G5QA 5JSQA 2ZRCA 2JARA 5E3HA 1AV7A 1DAHA 1P17A 4KBYA 3RU9A 3R0JA 2D1TA 4GWLA 2W5UA 4CLRB 4DCJA 3PFWO 4IWYA 3IT1A 3R5TA 5A0TA 4AUKA 3OD1A 2GXQA 4MCIA 4KR2A 2R5WA 2JFYA 1X7ZA 3DB2A 1KSFX 1PX2A 1GRVA 3HVJA 1M2GA 4LDPA 4JJ8A 4E88A 1W96A 4F92B 1DRWA 4ER7A 3OP1A 1L5YA 1N5KA 2ZJ3A 2J4CA 4P4SB 4A26A 4CJXA 5CXUA 1XPRA 3D7NA 3K5HA 3MZ0A 3P97A 2DBRA 2GJKA 2WIDA 3D6HA 4O4LA 4YMIA 1ZBQA 3HI6A 4FYYA 2FLKA 3SZGA 1LCIA 2NV2B 4BZQA 4DJ5X 4R8MA 4A8TA 4C0QC 4ZMBA 5FUWA 5I4CA 4C9BA 3LNTA 4NMLA 3VR5H 5AI9A 4QLAA 5IM4F 4E11A 3CBQA 4BDTA 3NLLA 1Y5MA 4OFWA 4QG3A 2K7ZA 4MI6A 3CX6A 5CLQA 2SKDA 3MT0A 2CWWA 1K2VN 3PQFA 1IOZA 1DXKA 1XZHA 1NA5A 1WHTB 1V1JA 1XALA 5KYXA 1BS9A 2F1OA 4NR0A 3DZGA 4I6JA 4HRYA 4U2EA 4Y2RA 6YASA 3PRHA 4R1TA 5LB2A 2RMKA 4P7GA 5ALQA 2NYVA 3KQWA 3L04A 4LJ8A 3SBEA 1WRAA 3QMWA 3ZQUA 3V1LA 1AGPA 4P5PA 4J75A 1UAYA 3WB1A 2WU0A 1F5NA 3NI2A 5AOAA 4RLSA 3MTEA 3O5AA 3ET4A 3KOOA 1W49A 1XEXB 1GYPA 2ZM6B 2P97A 4HZUA 5DP2A 1U6KA 4QU9A 5G0VA 4E46A 3CR3C 1HQYE 3GROA 1JIUA 2PFKA 3GW8A 3NO4A 4CKCB 2Q2WA 3IB3A 2Q0SA 4D1UA 2L19A 2FZWA 3F71A 1V9CA 2ODAA 3LA6A 1JKJA 2Y0EA 4A5OA 4YS6A 2P9EA 3URMA 2C2MA 1QH5A 4U1RA 1UBHS 5AJYA 1L2TA 3GQBA 1BMTA 3H18A 5EZYB 3QMPA 2HH9A 4QULA 1HT2E 3QK7A 4FHZA 5IBRA 3W5BA 4AZTA 3MILA 2JGEA 4XM2A 2Q3LA 2ZREA 3IELA 4X7RA 3T5BA 1JYEA 4HQOA 1BDBA 2QE7A 4A7PA 4DIEA 2C5FA 1TMKA 1X3SA 5GGYA 5L51A 1A9QA 1EK0A 1FFSA 2FHXB 3W8NA 1XMQB 1YDGA 4FGKA 1Y3CE 4LZOA 3OLCX 1FDSA 3WFZA 3IPXA 4GGOA 5F35A 2CD9A 1P60A 1X7WB 4OHBA 1SK8A 1XVVA 2FR8C 2OECA 2H6AA 4G8DA 4QODA 2C4KA 2PJZA 1VZ3A 5G4LA 5FXMA 3NT4A 5KC9A 2WYVA 3GBSA 1DFGA 2ZWPA 4DCSA 4YRIA 4JUDX 3HXOA 1IJBA 1SU8A 2DWUA 1OAOC 5L3ZA 2VOEA 1IZ8A 1GT91 5TEVA 1GXSA 5F9FA 1E2UA 1GDDA 1P2SA 3FLMA 4E5DA 1JYFA 2V4ZA 3IQGX 2Q49A 4HYQA 4QU5A 1I80A 1P91A 4MUIA 4AZ3B 3AO0B 3GB9A 4L6AA 1SC3A 5DRTA 3HO6A 1QGED 2XQFA 5E8JA 4R54A 1RJWA 1RRFA 4M1TA 4R98A 3UHJA 1R6AA 1HORA 3VHXB 3D1VA 4LC9A 2HMTA 3WHIA 1Z25A 4BMDA 2GM4A 5HH4A 1X9HA 1RYEA 1TO6A 2X8BA 1WEHA 2WOOA 3PJFA 1QO7A 3DT9A 4WLNA 3OZVA 1PJLA 5FT9A 4BFTA 2H4FA 1GAQA 2FMFA 3A26A 3WGQA 2Z98A 1QHGA 1RIIA 2R85A 2G36A 1XJCA 3GT4A 1CDOA 1NW5A 1ZD8A 3NG1A 3RRYA 3WLQA 3ZKWB 4B71A 3TF5A 2REOA 3WGJA 3GPLA 3PKJA 4RZXA 1JQKA 5FFMA 4QWWA 1BHO1 3FAKA 2R8PA 3R5HA 4DLSA 1EVLA 1NMZA 1ZCAA 3NZEA 4JN6B 1L5NA 3WIVA 4JBWA 4FBMA 2F59A 4CM6A 4UQOA 1CULC 4L8GA 3VSAA 4BVJA 4RL4A 2VBGA 4ZOAA 2ZR7A 4X97A 2FPGB 1R4NA 3WISA 4Z54A 3OCCA 3EQZA 3M6WA 2RKWA 1SUCA 2CG3A 1EH5A 2QN9A 2X4LA 3DEYX 4X64B 1N25A 2X2PA 3GGSA 4D4GA 2ADMA 4ESOA 1P8JA 1KJ9A 4INJA 1Y4SA 1HT3A 3KE9A 3DOCA 1SQFA 3CURA 1B1AA 2VQ3A 1OU0A 3A3PA 1HLFA 4US2R 3FXAA 3CRW1 4UNQA 3TKYA 3GVIA 4ZVSA 4KN6A 2B82A 5T4EA 4DQDA 5F7OA 5KOJA 4MDEA 3EA5A 1K6IA 2JEOA 3NBQA 3V48A 1FMCA 3WXBA 2VT3A 4BMNA 4UHEA 2YUTA 5DTIA 1CKEA 2IDJA 5AJVB 2BG6A 2W11A 1TW2A 1G0OA 1OOEA 3NWBA 1J1ZA 2GF2A 2DUJA 5C7LO 4M9CA 3JRWA 5KTYA 2WSSA 4DDWA 3SWWA 2Q3EA 1HLKA 4I5FA 4F93B 2H8KA 2NZUG 1QVRA 5TX7A 3FROA 2H2GA 3WIBA 1SVSA 2SBTA 4QJIA 2RIRA 3ELUA 3EF3A 1QNFA 1UXKA 2GRJA 2H07A 4EJFA 4QVIA 3EXHA 2OCIA 3FDFA 4FZRA 2X1MA 4J0IA 1KJNA 1KHHA 1Z6PA 3BIXA 4RH3A 3SIXA 1GZ5A 1Y8CA 3RVSA 2XIJA 4P84A 3ZH9B 2FRDC 3WRYC 4LF8B 4JP3A 3VYWA 4YXFA 2NU9B 3D6AA 2Q3JA 3V4VB 3L4SO 1UBUS 4CN9A 1ZOOA 3NASA 3KJNA 4BFWA 5PGMA 1O08A 1OB2A 2JLBA 2B4QA 3R4VA 1JDSA 3DDNA 4JIGA 4JYCA 4QLOA 3LUFA 3D31A 1D0SA 2FUG6 3PEEA 5BSRA 4WTOA 4TWAA 3OPYB 4RU1A 1V41E 4X8MA 2MSCB 5EXPA 3UHOA 3ZHZA 4CFSA 1XKTA 3ANMA 1O6FA 5K0FA 1JHVA 4RVUA 2DAPA 4BVLA 4KHZA 4TLAA 2ECQA 4KNYA 1NUHA 2LW7A 3WVNA 2IYEA 3ORQA 3DHNA 4MW9A 5EPUA 4AMYA 2I9KA 1I3CA 2B4TO 4M1ZA 3GGDA 4ZJYA 2WHRA 3JWPA 2G17A 2YNMD 3HSKA 3NJRA 3JQCA 1MRSA 5B1IA 1MIOB 3KBBA 3GUZA 4BASA 4DLLA 4ARUA 1NX6A 3G2NA 3K1YA 2HK8A 2A0XA 2QV0A 1XKLA 2CK3D 2FJPA 5TIIA 1P9RA 1FUIA 1E6KA 2QL5A 4PVTA 1ULBA 4LKOA 4M7PA 1L5WA 2YN4A 4FT2A 4PCLA 2BAGA 2HN9A 2IV2X 3ZTWA 4PLFA 2XODA 4CYMA 3FG9A 3PNYA 2VSOA 4BMVA 3CEJA 3WWCA 1DG1G 2D5CA 1OFVA 1EEHA 1LB1B 4ZAYA 4UOZA 1GV1A 3F3MA 4UQLA 2IH2A 3L7OA 2VJCA 5DGHA 1GZSA 1YULA 3K31A 2C2XA 2ZDHA 3SVZA 2UVQA 1DNPA 2GZSA 4NOLA 1OWLA 5ALVA 1MJGA 2GTIA 3ZDCA 3HA7A 2ZRFA 4PCAA 1NYRA 5HF8A 5CXQA 3RVRA 4LBZA 4ZI7F 2R66A 2V7WA 4XIIA 5LSAA 3NTVA 1V1MB 2AOWA 3VU8A 4X3PA 5GJBA 2PH7A 1YQ9A 3GLUA 1PR1A 1NNI1 1R6VA 1UBSB 4YQYA 2QSYA 5F1KA 4RVHA 2FGJA 4V1CB 3ROPA 3DTVA 2CLSA 3AVTA 2D06A 3C85A 4RADA 1PGOA 5IH7A 1PVDA 4YH1A 3A6EA 3AGPA 1TX4B 5MDHA 1Y1TA 4AUEA 4V0NA 1Q7CA 1QGAA 2DWQA 1G20E 1NGSA 1VKNA 3R6TA 4WUVA 1Z74A 4DRXA 1TXGA 4JMPA 5JAZA 1ODCA 3KT8A 3QYAA 4M7OA 4HEJA 2X0RA 1XGKA 4FX5A 1HT1E 3OCZA 1LDMA 1K4YA 2ISSD 3FTCA 1RLIA 1UKYA 4N3GA 3U26A 3L8CA 3DBIA 3QVKA 1K4KA 1FDVA 3NIGB 4HLQB 5ALKA 4DDTA 3X43A 1Z33A 4OLJA 2EKDA 4PO9A 1W4BA 4I9NA 3EIXA 1UDRA 1NJ2A 1UPXA 4GE0A 4DB2A 1FRFS 2ZIXB 3UHFA 3VAAA 4A6PA 3HY4A 3ZCSA 5FBQB 2Y0DA 4DUGD 3TJZA 3RQIA 3VPCA 1NVKA 2EYQA 5JRZA 1I1NA 2NN3C 1NVTA 5TMPA 2R8BA 3HHEA 4FFBA 5GOTA 5A3VA 2V65A 3CLUC 4OQNA 4ZDJA 3TLGB 2DJ5A 4CUKA 1T0PA 4WCDA 4FZ5A 4CEJA 2XXAB 4FFMA 2HYDA 4DE5A 2GFJA 1DBSA 4RD0A 2WFAA 4S3MA 3RUAA 2ZJYA 2CHVA 4WZAB 5FCDA 4RTSA 3CVWA 3ADDA 1JQEA 2O14A 1DRKA 3KTAB 3BXHA 3U9SA 3ZEAA 4ZI3A 2CSXA 1BWRA 5TQ0B 5KX5A 2WU3A 3AL2A 2J5QA 3PNKA 1P2FA 2J5KA 5IH3A 1TT5A 2JF0A 1N1EA 3M1LA 4AXHA 3GFFA 2DHRA 2WIGA 1NQTA 4KTTE 1ZVVA 2H1LA 1G21B 3EAQA 4N8DA 2VF4X 3KLBA 2M32A 3TAHA 4FFNA 1QTIA 3IDOA 3CN9A 3TD6A 4PYMA 1DC8A 3VR4D 4JEMA 2BMJA 4L5YA 2WDPA 4C0WA 2HZ7A 4N8SA 1Y3IA 3KYCB 1QKKA 1QB8A 5A2GA 3IE2A 2RGXA 3CVYA 2BM1A 4JC8A 1OYVA 1QF7A 2ODNA 4OK5A 2QVLA 1ZEMA 4IYJA 3HO8A 3PX2A 4OLHA 4WY5A 2P2GA 1Z37A 2DE0X 2BZGA 2HMSA 3BMQA 1Q1NA 1J2EA 3OU7A 2C20A 5DPXA 4ZJUA 1G5IA 3A05A 3RUCA 1PNOA 4LCJA 4B8ZA 3DE4X 4AJOA 2PUFA 4LFAB 2QROA 1O94D 4QG7A 1L4UA 4PYIA 3ZVNA 5AKYA 3JAKA 4L9RA 4BJ1A 1DZIA 3MTAA 2KLHA 2C5EA 1QX4A 4F5WA 2W8BB 4TVSA 1XELA 4P7JA 2HWWA 3P32A 1BGXT 3E9QA 4HZGA 1P9WA 3TLEA 4ASUD 1IK6A 4RPIA 2XRFA 3OWXA 4Q6WA 2NU8A 1XWFA 5DTMA 1KY3A 4F2PA 2PGXA 3V8BA 1ANKA 2YNMA 4J16A 4EPYA 4QL3A 3JQ8A 1ZD2P 5T4HA 3IJRA 2Z2YA 3LWNA 3WGNA 4ABYA 2A1UB 3I45A 3TGPA 1TTQB 1NRWA 2I78A 2QK4A 2XBLA 4MS4A 4P22A 3DLBA 1RKVA 2QLTA 2ZTHA 4RVOA 1D9ZA 3P9PA 4HL6A 3W6UA 4BNYA 4EI9A 3OBIA 4C4XA 2BMAA 2AHOA 4R84A 1PCXA 2EERA 2G80A 3C8MA 1FU7A 2QRLA 1ZW6A 4R4JA 1S3GA 2GKLA 1CETA 4KIJA 4MVWA 4P6VF 1RBQA 4R51A 3BD6A 2O2IA 3WLRA 1KGSA 4ZP1A 3PG4A 1S8OA 3K70B 3R09A 3JQBA 5ECYA 4RYDA 3TLZA 5IW8A 3U44B 4PZLA 2NO6A 3TE6A 4DCGA 4YRQA 1OQAA 2YXDA 1D2RA 3IC5A 5IVIA 3JQEA 3IR7A 3ZZNA 1H1LA 4G2NA 5B7QA 1OLSA 4NV1A 3W2HA 1OH7A 5BRAA 3I0VA 3WLSA 5LN1A 3RIEA 3N58A 3WKEA 3VPHA 1FFBA 2RONA 3RWOA 2NSDA 3QWIA 4JB2A 5K8LA 3U5TA 3SP1A 1HNZB 3O9VA 1DAMA 1AQYA 4GFDA 4P9NA 4R1UA 2CJWA 5HS6A 1GPYA 2GAIA 1JLKA 5CDFA 4V0RA 1LV8A 3K20A 4OHCA 5J2UB 1E18A 4GICA 4BCCA 5ALWA 5I7OA 2PIAA 2X9NA 1H2BA 4QGHA 5DLPA 5H83A 3AL3A 2CHUA 3FETA 4K40A 3ENZA 4ZHSA 5EKSA 5D1HA 3W3AH 3IAXA 1QORA 2CD7A 1QM5A 4L22A 2GA8A 1XP8A 1C1DA 1HFEL 2HRCA 3UT5A 3W5HA 1WAMA 4TTVA 3SPUA 4YAFA 4DUGA 1NAHA 2ZOSA 821PA 4JJGA 4MGHA 1W0KD 2PKXA 2RB5A 4R83A 1SBHA 4HMQA 4ZPJA 4B9AA 5E6UA 2QTBA 1L4BA 1YFJA 4NMMA 5JJCA 1IBLB 2W6IA 3IA2A 4A9AA 1YB4A 1NI4B 3ILYA 4YRCA 4DAOA 3EGOA 2QXTA 3HVHA 4AIRA 4ZICA 2CWDA 1XXHE 4EI7A 2P3QA 2QMQA 4TTTS 2ZBFA 1F12A 4LGYA 3KYDB 4UNNA 4D9BA 3UY4A 1J1IA 3NC0C 2HF7A 5C34B 2IZ7A 2LV8A 1Z5GA 2PMCA 5IK2A 5G53C 5T6MA 3DZKA 1ORTA 4I1VA 4NOJA 4B6OA 4MRMA 3RYCB 1SC9A 2X1VA 3LBYA 1QQAA 5BYAA 3KD3A 3ET5A 2IE0A 3MTJA 4KLAA 2JEZA 2HDOA 4PNZA 2DQKA 4KDRA 1U7WA 2JS7A 2O3RA 3FCOA 3JQAD 1LTKA 4MR7B 4XVHA 3C1TA 3CA8A 2QL7A 4J0DA 3VR4A 3OZWA 4XVUA 4FKMA 5EWLA 1EFPA 1Q95A 2P9HA 1TVEA 3K6KA 4GBGA 4ADSG 2PEZA 4NBVA 4LV5B 2X1HA 1QS0A 3JQ7A 5CLJA 3S4YA 1YS7A 2PQMA 3E27A 4PTLA 1SXPA 1ILEA 2BFKA 1MH9A 3IYLW 4BNUA 1UDCA 1T5SA 1WMEA 3OJWA 2IRWA 4FMCB 3V4RA 1KF0A 2FOXA 1TK9A 2QMYA 1VPWA 3GUHA 5H8WA 1KSGA 5U4QA 2DFTA 2NVWA 3F8TA 4D9GA 4H7DA 5B30A 2ZUWA 3CNBA 3GI1A 3LT5A 7ABPA 4MUGA 3ESRA 3OCJA 5ALSA 3N2GA 4F3YA 2NP7A 2CYCA 4LECA 3R7DA 3ZJYA 3C4JA 3PI6A 1KQ3A 2V7XA 5BN3B 3DAFA 4ZHQA 4KXXA 1PFQA 4PLTA 1PQPA 4V02A 5JEEA 1N3YA 1UC9A 4FDUA 5EJEA 4I55B 2OXIA 1NL3A 4HEQA 2BGMA 4OQZA 3G02A 1NFRA 4UJ3A 1C0KA 2PPVA 5DHSA 1MV8A 5EJGA 3EFBA 4D56A 5EJ8A 1EMDA 2AN3A 4DKXA 4KQHA 2FKNA 4ALJA 2UYGA 4QSMA 4LYAA 5E0OA 4IQFA 4DM7A 1QOQB 1UP6A 5AKJA 4KITB 1U1FA 1UADA 2AKAB 4AJ2A 3BSWA 4M22A 2QT9A 4BN0A 4C01A 4C7JA 3TIVA 4PG6A 4HGQA 2EZ4A 4KBFA 3WHPA 1GPLA 3FNGA 3ESHA 1OWPA 1H0SA 5AKXA 3TL3A 4DMCA 4H1UA 1Z56C 3IBTA 3IRUA 2UYXA 3PZBA 5KPDA 4AKHA 4MW7A 3OD5A 4NI5A 5IEBA 1E1QD 2F43B 3CQ9A 3ZC3A 4YAIA 3MJFA 3FJYA 1R5JA 2XCUA 1OUMA 5GM1A 4UM9B 1ZMTA 1RXEA 2X13A 1ZM2A 3I5UA 4B32A 2ZPAA 1TI7A 4N9QA 1V71A 3GNTA 1QGOA 4FFPA 1LQUA 1F2TB 2REXB 4LX8A 4RDHA 3HPQA 4RHEA 3RAJA 3FNIA 5LR6A 2IS4A 4BLOA 3MJ4A 1Y98A 1U28A 2AJLI 2B3TA 4GX1A 4EA8A 1VCOA 3D0OA 4C0LA 1C9NA 2QTAA 3H9QA 3MVEA 4F6HA 3P4YA 4B47A 3NHPA 4H9GA 3WI7A 3CSSA 1GTRA 3DHYA 3IR6A 1FOEB 3UYLA 1Q19A 2QNRA 3O8BA 4CETA 3W2FA 4YWHA 5UKDA 4YUXA 2ZIZA 4Z9BA 3N87A 4MUYA 3ZVKA 3JVIA 3KJHA 3CG4A 4ZYZA 4Y1FA 1C4OA 2CF6A 3WDMA 4C4PA 5JZ9A 1JKMA 2XQKA 1BZYA 2GKOA 4PM4A 1DIRA 2FN9A 2REBA 5B12A 5JI2E 4EY3A 2CDRA 4OHRA 4KIGA 1GLNA 1QV7A 3INYA 3KWMA 4GGMX 1RS0A 1SVLA 1FTSA 4MSUA 4OXRA 1JP7A 4G07A 2ZRIA 4JI8B 4R1SA 5DWQA 2H16A 4R2MA 1G20B 1YZHA 4KJXA 4HLNA 5IMBA 3T3DA 3NWPA 2QGNA 1QH3A 2GSWA 1W0KA 2JFHA 3HE3A 1T2NA 3Q2KA 4FR7A 3UICA 5AFSA 4C4SA 1TIKA 1YZYA 3AP1A 3I58A 3INRA 3TCKA 1UP7A 4G5YA 3N59A 4Q1VA 4RAWA 1J0CA 5JAOA 3CM0A 1ABFA 2PRSA 4MVJG 2O8NA 1EHIA 3IP6A 4OHPA 1L9KA 3E35A 4Y6LA 4G5OA 2OCPA 3U7RA 4ETMA 5KOHA 1Z4JA 4QOSA 1H42A 4E7OA 1P4JA 4Q03A 2IYZA 3GIWA 2GM3A 2ODTX 4URUR 3V34A 4MKZA 4YCNA 2QY9A 2NUPB 3D7MA 4BGDA 2P30A 3PQ2A 1KVTA 4WESA 1REQB 2D4AA 2A84A 3N8KA 3IVCA 5IDVA 4BQNA 1X80B 2AUTA 4Q3CA 4MIYA 3NPAA 1TE2A 1A1VA 1X1SA 4ARZB 2MIIA 1TA9A 5AXRA 4O4HF 4WKBA 2D3WA 3GRRA 1RI2A 4U9UA 1EI9A 4OJYA 3R6GA 1BMCA 1QG4A 2F55A 4DA0A 1NVGA 3JQAA 3QVOA 3Q6MA 3KKNA 4REMA 2QLLA 4BO1A 2BOVA 2EBHX 3HMQA 2WA2A 1IJEA 3P9NA 4TGLA 1XMSA 1G98A 1CX9B 1JAXA 2BGJA 1J25A 1M7GA 3LO5A 4IDQA 2P41A 1Q1QA 3TE7A 3L6DA 5MFZA 1CUSA 1RMYA 1NUUA 2GPAA 3NFRA 3OPXA 3C6BA 4LHEA 1S9HA 4FXOA 2YTZA 1IY8A 2ANBA 1OB5A 1NBMD 1UZMA 1LBSA 1RLOA 2DWPA 2I1QA 4GLFA 4WMLA 2Y1FA 5CURA 1JGTA 4BYMA 4WCFC 1HUQA 3H0EA 1TZ2A 1ISSA 1P4HA 5FPTA 3RSSA 5B55A 1M1NB 1NATA 3EPKA 2FUEA 4L76A 1XDGA 2IEDA 1Z5ZA 4GOOD 1U0BB 1XE3A 4QUIA 4OHMA 3VU3A 1E9CA 1TUIA 5BOSA 1AH2A 2BMWA 3UV6A 4GRDA 2EKZA 4JBGA 3WTCA 1E1YA 1T0BA 1DJMA 3UJ6A 1C81A 3HYSA 2VPYA 4G41A 4PZPA 3TO5A 4J03A 4MUFA 5THXA 2ZJ8A 2N75A 2WTXA 5BW5A 4I1IA 4RH1A 3W4IA 1E2IA 3C24A 1A8HA 4ZO8A 1JVNA 2DSNA 3BS4A 2GEUA 1UR5A 2UZ0A 3RFTA 3BGIA 5E1MA 1CVIA 5CCEA 1BC5A 4GE3A 4KE8A 4NJMA 4V0SA 4WGGA 3PXEA 3TDMA 4INZA 2WZBA 2Z3WA 3FWNA 1DD6A 2BMDA 4PICA 4FYIA 2JI4A 2A3NA 2I4LA 2IYPA 3PDWA 4I1SA 4LJKA 4NZYA 1Z4NA 5FEUA 3BF7A 1Q1AA 1B2LA 3CT4A 5BW8A 4EVRA 5CH3A 5F78A 4JYZA 4UCFA 1IN8A 4B73A 2BC9A 4KCGA 4HNTA 4N0DA 5KO2A 1F0KA 2HQ1A 2IXTA 4KSCA 1WZ2A 1RRVA 2C8VA 4UTNA 2WJZB 5FH9A 4DR2B 1OWMA 4B46A 3PP8A 4MWGA 5GZ1A 4FDVA 5JRDS 1E0SA 1C8LA 2OBXA 3QU2A 4P86A 5ALEA 1H2XA 3PNMA 1E8NA 1YR9A 5EINA 3H6HA 3PR1A 1L8XA 2V98A 4IDCA 4RD3A 221PA 4FKZA 2PNFA 2VVTA 1QH8B 4D5GA 4J1NA 1E3IA 5BQPA 1ADYA 1KIMA 2VSFA 5DFAA 5NULA 4PTYA 4C3UA 3C3EA 5JLAA 2J3HA 3N2NA 3PQ6A 3II6X 2PAAA 5EESA 2R4TA 4IQGA 3GGCA 4WH0A 4TYQA 1JZTA 1T13A 3F9RA 4R2KA 3ZXYA 3S1SA 1OI7A 1XQYA 1GT6A 4I5EA 1UFQA 2O2ZA 3TFWA 4CQLB 3V4ZA 2O3TA 2RSLA 3JZDA 3ORFA 1K8RA 1W5SA 5L9AA 3JYLA 1ZOIA 4OB8A 4EY6A 1XTUA 4TLDA 3CTPA 4RESA 5EWJA 1L7XA 2AJCA 3RFFA 4AWXA 3RSZA 3QWFA 5CA1A 4ZEXA 2PZFA 5LMCA 1RI3A 4TS3A 4I3GA 1Q15A 3JASA 5EFZA 1OD6A 3VVCA 3F3SA 1R88A 2XHEA 3EY9A 4DRYA 2VYCA 3EW7A 1TM4E 3ABOB 4BRZA 2BRUA 3AR7A 3SSAA 2AXNA 3IHKA 5DBIA 2FQYA 1EUDA 1W47A 3DEZA 1I6WA 2PS9A 4AQDA 1MQOA 2OGUA 1OF1A 1JG1A 3SFPA 3LSTA 4BB5A 1UBGA 1KMNA 1OI3A 3TSZA 3VNQA 4D8XA 1Y44A 5IASA 4DY4A 2C00A 2AJDA 4RWEA 1USGA 1E94E 1YRAA 2G5GX 4RTRA 5ACWA 1G6HA 4A73A 4AQYB 2JCYA 3NBXX 1AC5A 1NV9A 1NW4A 1R0XA 1DCKA 1VFNA 4MPJA 3RIXA 2LCQA 4CIVA 3RK4A 1JI3A 2WMYA 4ND1A 2FZEA 3HJAA 3NS7A 1E2JA 3RVKA 3T7SA 2B4KA 2IW1A 3H5NA 2YFHA 2WM8A 1F0NA 1EESA 1J09A 4J3NA 3ZI4A 2HM7A 2A7QA 4LG1A 4B74A 3LYLA 5K8TA 3AJ8A 4B7ZA 4F2WA 2O23A 3QKIA 4Q21A 4XB1A 1GILA 2Z2XA 3FGNA 4KO8A 2L17A 2J3LA 3IUNA 1OT5A 3P1JA 2BDTA 2WHPB 1TM2A 3D8NA 4L74A 4RD4A 5JMWA 3IEVA 1W73A 1AT1A 1ESDA 4YJ2B 2HA6A 2PTHA 3MIZA 1XXHB 2UVPA 4IIJF 5HCUA 1AMOA 4Z7RA 1Q7TA 2Y67A 1UKZA 2ZUTA 3G1PA 1C3JA 2OL4A 3K3PA 4ABTA 3FR8A 3QBTA 1L4FA 2EKLA 2VYFA 4FT4A 4KQFA 5EP2A 4Z4IA 5IT0A 5INTA 4NQ5A 1I6LA 3IPAA 5JWHA 1CCWA 1N2CE 2EHJA 2Z4RA 4JYBA 1NBMA 1O5IA 2HC9A 5TSDA 3X1KA 1LJ8A 2V7TA 2YIMA 1TD9A 5KS2A 4RV4A 1JEDA 5SY6A 4MWTA 4RJKA 4DQVA 1WDMA 4G4GA 3MHTA 3VQZA 4D8UA 1B8OA 5FADA 5AHWA 4XFKA 4GI3A 1UJ2A 1IONA 3R6DA 3PU6A 3QUTA 4BNDA 3IP8A 3ME5A 3AETB 2ZB4A 3U7QB 4DLUA 4AG6A 3I5AA 1LW7A 2I87A 5D5PA 5GAJA 4OB7A 2FNAA 1C1XA 4GXTA 2OFPA 2NSLA 1UDBA 2V7QA 4RABA 5E8RA 4BX9A 4ZT2A 3PJEA 1WUJS 1FTGA 4B4KA 1EFHA 3FW1A 1NASA 1ML3A 2WJ4A 5FEMA 3T4PA 3IAHA 1ZL0A 1UFOA 4FHDA 4HGRA 1JSZA 3ZCRA 4B43A 4BWGA 5IM4A 1GN8A 3HNPA 4L9SA 3CH4B 4D8WA 1NV8A 2HSDA 4PE5B 1CIVA 1V6SA 5BT8A 1XJQA 1U4OA 3GT3A 1N8SA 4PPFA 5KWEA 3FWZA 3ICPA 2F1KA 4U39A 4CT5A 2QRJA 4DSNA 2P9FA 4YN3A 4F7DA 3PPYA 4OSEA 1FMLA 1K63A 5FPYA 5CCXA 4CQMD 1F4PA 1FDRA 4DWOA 2DBVO 1N0HA 4O3MA 1F06A 2D0PB 1HDCA 1K7FB 4IEEA 3I6BA 1XNHA 4MRSA 3RUFA 2X9LA 1H2AS 2EWVA 5JO0A 1PJSA 4TMWA 4FOSA 4OBXA 5AKEA 3E9RA 1NDQA 1O97D 2CJFA 2RDMA 2CMGA 2AMVA 5JD6A 2P11A 3DBRA 3VZSA 3ZJ5A 1VZ2A 2PR7A 4EX6A 1QRRA 3A7EA 1PZXA 4UA4A 5JECA 2PUVA 1WCXA 2I4OA 2LWIA 2PV7A 4GYJA 1F3LA 4CF3A 2OQRA 5DX0A 2E9SA 2G9UA 4EGFA 2BCJQ 3HLKA 1RJ9B 3OO1A 4DXDA 1ZK3A 3A11A 3PC8C 5TF4A 3T9BA 3RVMA 2G4VA 3L1JA 2CFOA 1DKQA 4LNHA 5FRDA 3EIOA 4K3UA 1CG6A 4O2BA 1WDWB 2PU5A 3FY4A 2E48A 3QLVA 1J2UA 2R8ZA 1KXZA 2QRHA 3OTIA 1KPGA 2PGLA 4OJQA 1PT7A 4XYEA 4EEZA 4K9LA 2CNOA 4IX9A 1BKDR 2UYOA 3GZNB 4XB2A 2Z8YA 1W25A 1YWGO 2WMOB 4LGMA 1JFLA 2PMBA 3GJ5A 4MUMA 5C8ZA 4QUJA 5K4GA 2H1CA 2BP7A 1ECFA 3GMTA 3HYTA 1DJPA 2MJLA 5IVHA 3WIDA 3C4QA 4YV2A 3GD7A 5DIZA 3VYTB 1SKUA 2IU3A 1A4XA 4MYTA 2IODA 3W34A 5A9RA 1GUAA 1GPAA 2ZI9A 2AR9A 4NZOA 3SQWA 3IBFA 4YSKA 3QTTA 4J9VA 1XV5A 3BWBA 3QKUA 1KFJB 2IXFA 4IW3B 1U0TA 1DUVG 4UBIA 1SC4A 5DNWA 3STXA 3QXCA 3WWEA 5A4AA 1A8UA 1G4UR 1ZKDA 2LP4Y 4UWPB 2B1IA 2ARKA 4Y9UA 4CIYA 3TN7A 4FQ8A 1VLHA 1WMAA 3CVOA 4IKEA 1AKNA 2HQSA 5U4XA 4HXYA 2RC6A 2RGDA 1KEVA 2VF7A 3PTZA 4D6YA 1PZHA 4DCCA 2ERYA 4EHKA 1ZSNA 5CT4A 4C09A 1Z6GA 3GEPA 1Z0JA 2C59A 3UC5A 3LFHA 4MARA 4UNIA 3U0VA 1BU5A 1X7ZB 4B2LA 4S12A 3PPVA 1CIPA 3C7AA 2HF8A 3OA2A 2NTNA 4QNRA 3ZZTA 2CV1A 4JBXA 2AG1A 5FBZA 4Q18A 3EGDA 5A1TA 5HUJA 3FRIA 4NVRA 2OLJA 2ZWOA 1KDTA 4WOPA 5FOVA 4RPHA 1AXRA 1LF0A 4O4LB 4GU5A 1MENA 3X1ZA 5CFZA 5ED4A 4AWZA 1L3CA 5K3DA 5BRJA 3DUFA 2HTEA 5FDFA 1ZS9A 1J8MF 3HWWA 3NANA 5A5DA 3AVWA 3HB9A 4I19A 1OX6A 1K75A 2B83A 3EVFA 3HXKA 3GCWA 4P80A 2GPTA 4ZCLA 3OZDA 3FPHA 2ONJA 4J0CA 4EF6A 4YAUA 4V1CI 2B1QA 2Q7XA 2V03A 4HADA 3LT1A 4YP1A 1V6CA 2W6MA 1NVVR 1P33A 3ND9A 4Y0VA 8ATCA 1WSWA 3PGXA 4YI3A 3PEWA 3ZW9A 2PXXA 3BK1A 3CX8A 4AG5A 4PZCA 1NM5C 5KYXB 3B3QA 3V2UA 2UUCB 5HIIA 4Q37A 5C4GB 3S27A 4RC9A 2Q0JA 2I8CA 4BJ6A 4EY2A 2WIKA 3OQIA 5J5CA 1ZSVA 1V4BA 4UXJA 4D96A 3KSMA 4QQFA 5BN4A 1LSUA 4JVOA 5CHEA 2QZSA 4RM3A 1JLRA 2WSMA 1E1RD 1NVMB 4PX3A 4Q4AA 3ZK8A 5AW0A 3HABA 2A30A 4BU1A 3QJ5A 4UKDA 4MPTA 1K89A 2H2IA 2X8AA 4RNCA 4L9AA 2YHBA 3HXQA 4Q0MA 4OQEA 4Q82A 1V11A 4HZUB 2FR0A 4G0OA 2CL6X 2X15A 2LBPA 2DQSA 2RI6A 3HDVA 1SU6A 2BWJA 1P1FA 3BJMA 2VEOA 4R1MA 3JVEA 3PNVA 4QTZA 2CFUA 5F23A 1EVIA 1I0LA 1JKJB 1OFUA 1UDXA 3I73A 3LUAA 3MINA 4QFDA 1ENPA 3ZNBA 2R79A 1DLJA 3GQBB 2V5UA 2YR0A 3IVMA 3HU5A 3ZD6A 2TECE 3V33A 1T1IA 2WJAA 3G7UA 4MGKR 4ND3A 2FWAA 3CH7A 4NH0A 2ZW9A 4RH0A 2AMYA 2HWYA 1M2VA 4MQMA 4UJ5A 3IDQA 4KH0A 3VPGA 4BVKA 1QTQA 3FUTA 3PUYA 1AK2A 3G0GA 4FQ7A 2M1ZA 4KO1S 1NQUA 3QVSA 2FEMA 3COPA 3FGOA 1I1OA 3GGGA 4CM9A 1HFJA 3TX6A 3ODPA 2Y6VA 2ZSJA 4L50A 1WUOA 1PVVA 3B1KA 4JR1A 2YWRA 5BORA 2AW3A 1RSZA 4G5SA 2C2HA 4TSKA 1FQKA 3EDCA 4HWRA 4MA4A 4ZVOA 4AUMA 4GF5A 5A3QA 4ER0A 1TCCA 3CNEA 3QYJA 2VJMA 3MWYW 3EZ6A 4U7TB 4M36A 3OJLA 4RTJA 1FNDA 3BXZA 1GTSA 3DBLA 1JQAA 1GXSB 2GRAA 2QX7A 2GQ0A 1ZIOA 4Y0NA 5CDFE 2EIXA 2O7RA 2ASEA 1Q1ZA 3CMCO 3FOCA 1YRBA 3PHGA 2CN1A 4ZK2A 2AZTA 3GV0A 4EG1A 3SQXA 1A5AB 2YXPX 4UVDA 1HDZA 4CM7A 3GPIA 2GB4A 2Z57A 1XZJA 5JJIA 4JGGA 4KXMA 2PL3A 1A8QA 4ZYTA 2QYHA 3L4BA 3OE5A 4L15A 3WAGA 2E4UA 3OOJA 2VWHA 1E1DA 3GPDG 4BFLA 2B5WA 2YJZA 4KKVA 3USES 1EE1A 1NLFA 3ZCXA 3BL8A 1YVUA 2ZP1A 4FYMA 2I7VA 5MN4A 4ZI7A 1E6LA 1M0TA 3CT6A 5TT1A 2GFKA 1GU7A 1RAHA 1WUKS 2C4WA 2GESA 5SYAA 3CRVA 4WK6A 1EWRA 2WPNA 4HHEA 4N0MA 3IAM1 2VJKA 3DUWA 3FNRA 2GAOA 5E4TA 3TAXA 3EVAA 3DLCA 1XD8A 2XTMA 2XYRA 3I1FA 2OG2A 3V6LA 1CZLA 1R4NB 2IOHA 1NNEA 4MB6A 3GLFA 2X5KO 3F4LA 1GPKA 2O4CA 4WV3A 4XQ9A 1PR9A 2CLCX 2Q7OE 3IP7A 3DBHA 3FPKA 2CMDA 1LWOA 5DHPA 2DETA 1XZDA 2Q5FA 3JWHA 5JHHB 5BXQC 4JUAA 3MBOA 2FF5A 5EC8A 4F3CA 2P75A 2XUPA 2Y68A 1A9OA 4I08A 3CNLA 1ZR2A 2D4HA 2VQSA 5IKPA 5ELXA 2GD1O 2HUPA 3A4TA 3NAZA 2H11A 4UAVA 5KOJB 4ARSA 2H92A 1CVRA 4AS1A 1SIWA 4YPFA 4LHSA 4V0QA 3PHLA 1J90A 3KPJA 1KK2A 2YWCA 1U8AA 1JH8A 3AWIA 3HI4A 4LBWA 4G0ZA 5EUQB 4N3BA 4B4VA 2Y93A 2QVZX 3S7ZA 2F48A 1B6GA 3LY9A 1T5LA 1L6RA 2DWCA 5DM0A 3L82B 5BO5A 1TK2A 3S0ZA 1G7CA 2YC2C 2ZJ2A 2CC2A 3C43A 2CXTA 2I03A 1P3Y1 3FPEA 3ZXSA 4D6PA 4UATA 3BH7A 2BFCA 2JCSA 1X19A 3UK7A 4MDHA 2HGZA 3P0FA 4KLNA 1LD3A 2O1WA 3T1TA 3J81A 3HK2A 3AYXB 4B44A 1H0KA 3G49A 1DIOB 3K9GA 4MVYA 1C1YA 1NONA 1Z7GA 5JSZA 2NAPA 1P9NA 3EXHB 3RSGA 1K98A 1QHYA 4FDTA 2RGUA 1EDOA 3LVBA 2JIBA 5F21A 4AN4A 1LVGA 2QTZA 5M34A 5J4HA 4GKJB 2EP8A 3PQ3A 3GUYA 3V8PA 1EHCA 4M1KA 3WZ2A 4PC1A 4CR6A 3AF0A 4TTRA 3C3XA 3RF7A 3AM4A 4IR7A 3MWEA 4NDAA 4QIHA 1T4BA 1JHUA 4JWTA 1Y33E 4NY1A 1ZH6A 1HYEA 1SK9A 2Z3VA 1KBZA 1QAQA 3NTLA 4YXWD 1MRNA 1AMUA 5ACVA 3A3YA 4M8SA 2C7VA 1G18A 1TRHA 2OV2A 1U3FA 1VB3A 2FMKA 2L42A 2O6HA 3MWKA 4EM6A 3LKZA 4CUZA 5DSXA 2WABA 2XEXA 1EP1B 3NDBB 2FDRA 5TNXA 3Q98A 2QM0A 3LDUA 2GO7A 2QM3A 4D97A 4KEQA 2OKCA 1VI5A 1HKHA 3V7FA 3PC3A 1X0VA 3WJ2A 3SM9A 3T4EA 3MRSA 1NBEA 1ZRSA 2FCRA 4C5BA 5B2FA 1RQNA 4UBLA 4W99A 3R7SA 4ZMRA 5KVAA 1U9ZA 2AE1A 2DQZA 3M3PA 4KDCA 3ADCA 4GLOA 7REQA 3O0TA 4M53A 4MWDA 4Z49A 1BD3A 4EJ0A 1LDNA 1A96A 3E18A 5E0KB 4AS2A 1H5UA 4A1OA 4Z3KA 2BW0A 4M1EA 5H0IA 4X8OA 3WK5A 4YP7A 3HUDA 1SHTX 4D3SA 4HQKA 1DXHA 3ER6A 5EKDA 2E37A 4WXYB 4C1HA 2ZTSA 5IWCA 4RCVA 4GPBA 5KC8A 2ZXEA 1KYTA 2IOQA 2Q4DA 1QMPA 5IP5A 1N7GA 2C96A 3QIAA 2V1UA 1TF7A 4JLPA 4B7AA 1UJ4A 1CUIA 2P79A 2PUGA 4KFTA 3LUGA 5EMKA 2I7XA 4CL2A 1CJMA 3ESDA 1D6MA 3RU2A 3U7HB 4QU0A 4D46A 2KI5A 4BKUA 2OUIA 3D7SA 3DTVB 4YROA 3B36A 3MMSA 1UJCA 4ZQIA 2R5NA 4Q1DA 4K1LA 3DYVA 2XE7A 4RY0A 3TBKA 3C97A 5K5EA 3K8YA 4RANA 2G25A 3RAFC 2WYOA 4NMWA 4MK4A 2H4YA 4GXQA 4QGSA 4UWRB 4MROA 4DRXB 4CKWA 5K8UA 5JS1A 1ZITA 1D1TA 2FSUA 4OGKA 3UXYA 3I42A 5JANA 4HDRA 2OCBA 2R48A 3RJTA 1Q7EA 1J70A 5SZJA 3TFOA 3TZEA 3W6ZA 3AUJB 1ADBA 1CUBA 1P0IA 1T6NA 5G0WA 3KJXA 4F12A 5K4NA 2E4ZA 3L07A 4RBNA 5KI6A 5KNBH 3WHKA 3BICA 5CM8B 1ZGJA 4JIMA 1SA0A 4RW0A 4BFYA 3OZEA 2R6HA 4JSRA 5DMHA 1C9MA 3V55A 1SURA 1RMQA 3L0OA 1TZCA 4YUAA 4CXMA 4LEIA 3SC2A 1VIVA 3OCUA 4FFBB 3TUIC 5LQKA 3VR5A 2NZEA 3HRHA 4UVIA 5F12A 721PA 2Z4SA 1QFMA 5DTJA 2DGDA 3KVOA 3K70C 3HN6A 3W9UA 2B7CA 1O6BA 3PGVA 3K5IA 4S0ZA 4ZXPA 1E98A 1FNBA 4MRAA 4CEJB 4R0MA 2JCVA 3RC9A 4D9MA 4LF4B 1T10A 5CVJA 3TZ6A 1EX6A 2RGEA 2AQKA 2JLWA 4Z1MA 3P0RA 5H9VA 5C80A 4BNTA 3W8FA 4HXEB 4B34A 2JLSA 2Z1DA 3V8QA 1P9OA 5ED0A 5KX5B 2C98A 3MGGA 2VN8A 3NYRA 3LNCA 4BFSA 2ONYA 1SMKA 1TT5B 3WQBA 1VYHA 2VBFA 2MTBA 2VHQA 5I7HA 3PENA 1OXVA 1JA9A 1K5PA 3PJGA 4A2QA 1FY2A 4XGNA 1P1RA 4BRUA 2FFHA 3BGOS 3DKIA 3IQIX 3KOZA 1AMNA 2NNLD 9LDTA 2JGLA 5DV9A 3ZQ4A 5I45A 4Z5YA 1RJEA 4MVJI 4MVCA 5KYNA 4HEHA 3IIEA 1KDPA 1V8DA 5E6SA 3NONA 3OIDA 5KVVA 2YNUA 2C2BA 1AU9A 4TSFD 3TMYA 1F8YA 1V2GA 2WICA 1S3SA 3ZNNA 2OBFA 1F9AA 1EHYA 1L4HA 4KPYA 4JQCA 3EVNA 4RZIA 1GZDA 1T1SA 3BMQB 2NUTA 4RTPA 1E6EA 4C1GA 1F3OA 1O0SA 2H0QA 3I32A 3FLBA 4X91A 1TGVA 4EUSA 4BJHB 5CVVA 5B1HA 1AK1A 1DOAA 3I0ZA 1N9ZA 4HMOA 3LUHA 4JYAB 3B12A 1Q0QA 3JAKB 4YFVA 4XWAA 4BZZA 1H2WA 2I80A 2V6MA 1ZI8A 2NM0A 2ZR8A 3I39X 4LMBA 3RUDA 5BQXA 3A28A 4GZ3A 3ZCTA 3O82A 4AJNA 3JWEA 1BE1A 1UMCA 1IPFA 2O7VA 3T9CA 3T3GA 1ZVMA 1SKQA 2NU8B 1JI0A 4OXIA 5FPSA 2CDNA 3H2IA 2VHEA 1X7HA 2TMDA 3JQ8B 9LDBA 1WOYA 1STOA 2X3YA 4IEFB 4HNAA 5G3YA 4EXYA 1XTTA 3NFYA 3R6WA 3Q6NA 1SHKA 1SUPA 3RNOA 1VKRA 3TMKA 3U1BA 4MS4B 4P4UA 3LZ6A 1QYVA 3AM5A 4C4TA 4K2HA 3EDRA 2GM5A 2GUWA 2HD4A 1YGPA 4N3NA 4Y2HA 2Z5LA 3EDMA 3N8HA 2J09A 4YJKA 5BT9A 5IXYA 2C5GA 5KEIA 1ZDMA 3A1WA 3A6DA 4NBRA 4ALNA 5KTNA 3VOAA 3DL4A 4E2YA 3T15A 2Z6UA 5DTRA 1BEUB 2ZS8A 4LXHA 3W0LB 2A1IA 5K0SA 5KOYA 1F8UA 2ZTMA 3GL9A 3PNBA 4KE9A 4PCVA 1P8AA 3QI2A 1T2FA 1SRQA 2PZJA 3OLQA 5ANRB 3FPSA 5HDQA 5IBCA 1FNMA 5TJHA 1GPUA 3FKSD 3W77A 1V7QA 3K05A 4EKIA 2GWRA 4I1RA 2E1RA 4P1ZA 4JK3A 2Y92A 1H1LB 1SBTA 2IVZA 1OLSB 4MIEA 4PHTA 1LLCA 2NUBA 3O03A 3Q7EA 4WBNA 4M0FA 2B2CA 1RZRA 1DCTA 4F1KA 1DXOA 1X2EA 3T3EA 2ZITA 2I7CA 1KO1A 3CPJB 5AKLA 3OM1A 3GP5A 3R4CA 4J4BA 4K6GA 1SBQA 1X1EA 2VDRB 1E3SA 4TMFA 3TPCA 2R6AA 2CJWB 2R6CA 3DEFA 3H4IA 3PEUA 4EABA 1E9EA 3EJWA 4C04A 2NQTA 3F6EX 4P4TA 1KAQA 4PPGA 4OQPA 1GLGA 1NHWA 3QA3E 2OZLA 5AJUA 2CBXA 4Y2VA 1P73A 2WEKA 3IOBA 4UVEA 4LJAA 4LPKA 4GD3Q 3VJRA 1YKGA 1C1DB 4HKTA 4PFJA 3UT5B 2Q6LA 3HZOA 4EUKA 5B7NA 1AS3A 1XDDA 2X42A 4J8PA 4GM4A 2WSYB 1C29B 3FCEA 1V4VA 4OO3A 1A9ZA 1Z8FA 4JO0A 1W1UA 4ALIA 3K0AA 5E6UB 4DUYB 1TLTA 1TVKA 2AK2A 4RA9A 2XWQA 2XF8A 1R5OA 4HN4B 4F4FA 4FFRA 1TIBA 2X7HA 1MB4A 2QM7A 3MUOA 4IUDS 1LFAA 1ETHA 1P1KA 5BV1A 5HKOA 2H6EA 3QQ5A 3QX7A 3L1KA 3V3KA 1D7OA 3Q9NA 1LPNA 1P2TA 1O95D 2ODWA 4ZARA 2CE2X 5GVSA 1IDN1 3UOWA 3X1XA 3AVQA 3EDOA 4X00A 4AY5A 3LI2A 4KXQA 5GTDA 2RFLA 3U17A 4MRMB 4UAGA 3O6VA 4AZWA 1K4MA 2BEWA 3H1EA 5IAEA 1QGYA 1EP2B 4K1XA 5EH9A 5L3VA 1TFUA 1E2BA 3WA6A 1UP4A 2QNBA 3R7FA 4GKVA 4HLCA 2Q21A 4JI1B 3MAAC 4IHQA 4PYLA 1DJLA 4GH5A 4WDQA 5ENDA 3WB9A 5EWLB 3UMSA 1EFPB 3UXHA 4Y3UA 1I0ZA 1QZUA 2VZ9A 1QS0B 1V8BA 2COUA 3JQ7B 4LK3A 5EWMA 3E82A 3RC8A 3L8DA 1BMQA 4MQFA 3ZR9A 4HRVA 2OAP1 4FNGA 1O2DA 3AG5A 3R8CA 3S68A 4A0HA 3A1VA 2FZLA 4IQ8A 5K05A 5HIOA 5LVAA 5F4ZA 1YCGA 2VTEA 3G0DA 3VPAA 2X9VA 5B4UA 3VSBA 3C70A 1JJEA 5LCFA 3SKYA 1JBQA 3MN1A 5EHIA 2ZCVA 3N2GB 4AP5A 2JIRA 4BV2A 2O2HA 2P40A 2WJWA 3IP5A 3M6VA 2P6PA 1M2JA 3Q0EA 4H3VA 4B8YA 3ELDA 1BX3A 2YCBA 3I1JA 1GOTA 2PK3A 2RC5A 3E03A 4QUEA 4B3DA 4ZHQB 3TQCA 1GRCA 3QE4A 2WR8A 1JW9B 3LKVA 3ZKAA 4G1FA 4XR9A 4AIIA 2CXRA 2ISCA 4HPJB 4OOFA 1I1QB 1U5AA 1U2DA 2R3SA 2E89A 1C50A 4ON9A 4PSAA 3R7AA 4NIMA 5H02A 2R2DA 2NYRA 7ADHA 2MSWA 3FCAA 1KI6A 4JBHA 5AM0A 3STUA 1XJWA 1YB7A 4TZKA 4WN9A 1SU7A 2WVHA 2ZJ6A 4ZD6A 3BIOA 2QMOA 1ODSA 5BSFA 3G0HA 1ZP6A 2P3LA 3PVSA 2D2FA 1J0BA 1XEWX 4RSGA 4JWKA 2NT3A 4DNFA 4DPKA 1ZD4A 3LRPA 4DY6A 4MTCA 4B17A 3RKRA 5D3KA 1MBZA 4ZKDA 3L7IA 3NVMB 5J59A 4CHTA 1MEEA 2BJVA 5C1IA 3ZR4B 1KMHA 4BYGA 3HQ4O 3L92A 4JODA 1GVHA 4BFVA 1HF3A 1YKSA 4A0FA 1HM5A 5CAEA 4L28A 2AN4A 2Q5CA 3E1KA 2BCGY 3QHAA 5EQFA 2Q50A 1E0DA 1T43A 1G8MA 4CFYA 1T8SA 4P7KA 3CCFA 1Z35A 2G9ZA 1J8YF 4WERA 3R74A 4EG4A 1PE0A 5SYMA 2AG0A 2XI4A 4B3FX 3BFVA 4BMSA 1AKYA 4X7PA 1E3DA 1BX1A 1A9YA 4O4JF 1NPYA 4TTSA 4LHYA 3K4QA 1FF9A 2VHXA 3LQ1A 4G1CA 2CZCA 3KWFA 3WYFA 4LXQA 3W6OA 2WTMA 1DO2A 2ZRJA 3OICA 4FE7A 3RUHA 2IPXA 3PVCA 2XVYA 2NZFA 1BO6A 4NJEA 3BJZA 3ER8A 7GPBA 3CWCA 4F6RA 1VJTA 4PZ0A 2EKQA 3UWPA 4HUQA 3RHSA 4FD2A 2WM2A 2VNHA 5IAKA 1D7AA 4NH4A 4ZVNA 2ZZMA 3K0CA 1V8FA 5DU2A 3VOTA 4ACAA 2WLTA 2BMVA 5J9FA 1CB7A 5EE1A 1NQVA 3MJDA 1C7FA 1YBAA 1YQTA 3SJZA 4YACA 2OZVA 4OAOA 3VKGA 1TMGE 3GRZA 1TM1E 5EQTA 2RHDA 4W5QA 1U2ZA 1TCVA 3WX0A 3VPFA 2GLUA 5I9BA 4A3SA 3HADA 1FNCA 3WY9A 2VDOB 3UCEA 2ZUBA 3ESBA 3N53A 5EGNA 2BFMA 2HEIA 2BGTA 1Z0ZA 2R1TA 4RACA 5LWQA 2VKQA 1VBFA 3SKXA 2E85A 5CXXA 2AF3C 1U0SY 1JFFA 3C8UA 3DD1A 3JQ9C 1K8ZB 2CJYA 3D81A 5IZ4A 3BMNA 1ZH0A 3E2PA 4QUKA 2OHOA 4YJDA 3LM8A 4CMEC 1PV2A 4RTOA 5KOHB 2DQYA 1FB5A 2YJNA 3TXAA 3DP7A 2DY1A 1NN1A 3AI7A 3TG8A 1GARA 4RE6A 4BRWA 1O95A 1EINA 1U31A 2XB9A 2GBLC 4IF6A 3LCRA 4BN5A 3ICEA 2WIBA 4WESB 2PCLA 3IR5A 4IINA 5HIKA 1NHGA 2X58A 1OZ0A 1ZMXA 3G68A 3G5UA 4WDRA 5AW2A 4HDMA 5JJBA 3OOSA 4TM8A 1OWNA 4YTEA 1ZHHA 1U2RA 2WRZA 4RHUA 5B4TA 1KR2A 1YTUA 2J9GA 1QFZA 3ULKA 1F7VA 3JQAB 5MGBA 1GPDG 4NL4H 3OC6A 4KXFB 1OT3A 3JVVA 2HSZA 1SU4A 4FJ1A 3OU2A 5AI6A 1XM8A 4YCBA 3V80A 4EFZA 1U04A 1N36B 1NQAO 5BPFA 1NBAA 4U2BA 4Z7QB 5JPCA 4G25A 4YT2A 1MJNA 3QPCA 3D5TA 4LYJA 1GNPA 4YB8A 1T5HX 1ZOLA 1R2QA 3E6AA 1KWKA 1EGAA 4NONA 2ID7A 4H4CA 1XROA 3FB1A 4HH4A 1M0SA 1GNRA 2FPLA 3ENKA 4HLUC 4C89A 1CS4C 3QPUA 1SXJC 1T1EA 1RWOA 1T9CA 1KVSA 1VYTA 1ZI9A 2OD9A 3G2JA 3IBSA 1Q92A 1YQUA 1I4OA 1VSUA 2PQ2A 2PT5A 4CIWA 4KVAA 3ELBA 3WBBA 1G41A 5BOSB 3WGIA 3H9EO 1MO3A 2PWAA 2AGVA 3OQBA 3CRZA 2QUIA 3A6HA 5SY4A 5KJ6A 1ZGBA 4IIJA 5I7VA 3LOUA 2PMFA 5AXOA 1YKFA 3PCRB 3O90A 2NG1A 4L8YA 3E9MA 2FQXA 4ZGBA 3AERA 2PXCA 2GFIA 4HYTA 5AM1A 2QJSA 2QEQA 4K05A 3B2QA 2GBIA 2C8JA 4G56A 4U2DA 3IOMA 3ZWYA 2VNAA 4NJMB 5FWXA 1S89A 1YMQA 2G8NA 2JFQA 1VKJA 4N47A 5SZIA 1PS0A 5CITA 1JHDA 1R4MA 4AWYB 3URKA 4B0PA 1O96A 2QS9A 4TS1A 1RQ7A 5TS2A 5KWSA 1M73E 2X7XA 3U0BA 2XTZA 1VSVA 1KYQA 1M2NA 2RGCA 2X5NA 1D6NA 3AOEA 3FFXA 3ND7A 3M83A 1GAWA 1A4UA 4ND7A 4RZQA 3GDWA 4X93A 6ADHA 4MLPA 3UMYA 2GXAA 3T5PA 1G3UA 2ZLBA 2NV0A 1NVWQ 1K92A 1FA9A 4N7MA 5H59A 5K0BA 3VRHA 3H83A 2OBLA 4HY3A 1CUYA 2FW1A 3A1EA 1NR7A 3DDWA 3QPVA 2ZS9A 4KKXB 1N0WA 1G5HA 2HREA 4MUAA 4C2AA 4GSLA 2DM6A 3G1UA 3ROKA 1GRQA 2WWHA 3LUBA 1KPHA 2HPVA 5HCIA 5CBPA 3HP1A 2VDKB 4XDYA 3LKDA 1HMPA 4GX0A 2OCLA 2CNLA 4ZCPA 4J0HA 2FP4A 2R96A 3D2AA 5EVKA 3V4SA 2CUKA 5SY9A 2C5BA 5C52B 3ZHOA 1G8KA 3O4HA 3SFTA 3BXPA 4D7AA 2XMDA 3P94A 1TZMA 2BUCA 5A1JA 2ZSAA 3AZPA 3W3AA 3DHBA 1AS0A 3DE7X 5IXJA 4F5YA 4M7RA 2GASA 1RJFA 2R6DA 1FQOA 3DE6X 4JP1A 2XV1A 2GEKA 4UQPA 5EWJB 1OV4A 2V8BA 2G1PA 2WJIA 3CR8A 5CA1B 2RI1A 4RYLA 3ZW8A 3NW9A 1JVSA 1HE5A 2CL5A 2L18A 3RFUA 3JASB 4BTLA 3COJA 3H1PA 3TB6A 3D0QA 3B1ZA 3IPLA 1TYCA 1NTOA 1YCFA 5CVUA 1F2DA 1XAGA 2AEJA 5EZYF 2DCMA 1EUDB 3FZYA 3LH5A 2PUDA 2N3ZA 4JSYA 4Y0AA 4R8KA 5KWIA 1PG2A 1UXGA 3I72A 5AJXA 2FWBA 2NYUA 5CM9C 3ZZMA 1JDPA 5LM3A 2FPPA 3KO8A 3L7BA 1Y6JA 1XEAA 2OAEA 3ESAA 3ETHA 3R3XA 4FHGA 4GC5A 3R23A 2C88A 4BJ3A 5KQSA 4B3MB 2AQHA 5DI3A 3IBGA 1PNVA 2GZAA 2GYWA 3MTQA 4LKRA 1UOQA 4N82A 4YJGA 4MWSA 4CKEA 4Q9AA 3NIDB 5I4KA 5IHPA 1TC1A 2H31A 5B37A 5KYGA 3ON5A 1YOVA 2W6NA 1E2DA 3ENQA 3F78A 3D9QX 2NLOA 3FWYA 1Z07A 3LPLA 2X4IA 4GVXA 4D4IA 4Y6SA 2JGKA 3WADA 1JX6A 2QQ0A 5HUQA 5L7TA 1Y3HA 3FVVA 4PZEA 5DISB 2BV3A 1DB3A 1T26A 1UMBA 2C29D 4S24A 3W2GA 4DNXA 3GDHA 1ZMBA 1GJRA 1C7QA 5JQWA 4V24A 5I9SA 1WMDA 4YVFA 3FUUA 1RMTA 1X1RA 2WYWA 1TYEB 3KR1A 3F9IA 5B3AA 3R5KA 3S5UA 4QBKA 1IIRA 5LCAA 2UVPB 1D6JA 3E7PA 5E4FA 3T7KA 4MRVA 1UPAA 4AYXA 1IRXA 1KFBB 4NQ6A 2WYIA 3INNA 1O1YA 4DJAA 3FKJA 2B0CA 1HTWA 2Q2NA 1XQWA 2VJPA 4PPNA 3GDGA 4JI7B 3TVTA 1JDTA 4HFMA 1QKIA 4OXYA 2FEOA 1H8HD 2DLDA 2OR3A 5JASA 3GLSA 2PQ0A 3GGOA 5M04A 4AKSA 1U0LA 2VBIA 4JI5B 3KAJA 4IMRA 4B80A 4MQ4A 3N86A 4TXLA 5IC4A 3ER9A 1T0UA 3PGLA 3NNNA 4LSMA 1USIA 1V2HE 2CVPA 4XYBA 1XHEA 4NE9A 5TPWA 5C8YA 4E33A 4MW4A 1MORA 1YH3A 1VJDA 2OXFA 4L85A 4D5EA 5BSHA 4XWWA 1N33B 1ZICA 3TLKA 4BNDB 3FTFA 1MAHA 4KLRA 3GNQA 2FW6A 4NF2A 3SXPA 4EJ2A 1NOJA 4E4YA 2HV8A 5JY1A 1Q84A 1C1XB 1GQRA 2IS2A 1J00A 4DR1B 3GVPA 3ZDQA 1O58A 5FL3A 4R2WA 1F0PA 1UJMA 3HWSA 4OI2A 3ZWKA 4WCVA 2QUKA 5IJ9A 1NSFA 1XTZA 1SG6A 1WXIA 1N5MA 2XW6A 3OAAD 4HZIA 3I12A 4REQA 3U7GA 3F46A 3OCYA 1OJ7A 4HNQA 2PVPA 1YRLA 5I5GA 2ZUFA 3N6VA 5F2EA 3TB4A 5JDCA 1GAXA 2O2CA 3NEAA 3UA4A 3KZKA 2RAFA 2PLFA 3DZHA 2ZTVA 1XL0A 2R4QA 1XDUA 2QI9F 5IULC 1UT5A 1KTVA 1FYWA 3C1AA 3OE1A 5L3SA 5HYVA 4F5ZA 1HOXA 5ITSA 2BKVA 2XQGA 5D3MA 5FBLB 1UBOS 5EW0A 4LMPA 3IT0A 3IUQA 5T7BA 4DV3B 3M6FA 3WQHA 5JDIA 1DKOA 1E61A 2NO5A 3N2LA 4NFSA 1ZMOA 3W1WA 4ZZ0A 4YP5A 5JNRA 2C2ZA 3ZDXB 4HH0A 3ASUA 2J07A 5KKAA 2FU9A 1AM4D 5DHUA 2PBFA 1L3BA 2Z3ZA 1BJTA 4XZ3A 3ANSA 5FF9A 3TNJA 4YX9A 1W75A 3DBRB 4TRJA 3LQYA 4TMVA 4F7WA 4FI3F 1Q3HA 3CJTA 1DIHA 4P4NA 4MP8A 3BAZA 3A1TA 4K9MA 4W4TA 3FZEA 4KIUA 4X44A 1UFKA 4QVGA 3VZPA 2AQIA 4YCCA 3J80A 1WU8A 4MUEA 3OFND 1NY5A 3C5VA 4O63O 2Y9MB 3G5MA 1YF3A 3WYAA 4O2BB 2Y8EA 2EFYA 3BXOA 3ZZUA 1YDMA 4D9KA 2ZT7A 4NXMB 5LYYA 4PSUA 1XQXA 1GR1A 1UH5A 2W90A 2BMFA 1JWBB 3C6ZA 1PJZA 3KZOA 4KQXA 3PXDA 3D59A 5ELLA 4J7AA 3SHTA 1TQ8A 2B98A 3GJQA 4UTXA 5AO9A 1PGJA 1ENOA 2IEIA 4YSBA 1IC6A 3VJKA 2QNIA 1XZFA 2FY8A 2QG9A 3A4VA 1U2SA 1JKIA 1E1LA 5LA6F 4KREA 3ZGXA 1BGVA 1ZM9A 5F1YA 1I4LD 4HMPA 4AKEA 5FR2A 2OXTA 2BP7B 1GA1A 4ZN6A 1KEEA 1QJCA 4KH1A 2VF8A 2Q0HA 1FVXA 1JMYA 1NW6A 1OMOA 4Q9IA 5DBFA 4ZANA 1UQUA 3GELA 3BFJA 4JHXA 1JH9A 3IRVA 4YJ3A 4W5HA 4EBBA 4ZALA 3TDNA 1P5ZB 1UFVA 4MKFA 3QOFA 4CMAA 4XPZA 5AKGA 3RRXA 2H1OA 2LKDA 3L7KA 2C77A 2UKDA 2F90A 4CCAA 4P58A 3C3AA 4ITRC 3IUSA 5JWOA 3REQA 2PKEA 1OFUX 4D1YA 1CZNA 2I4MA 5AVZA 3ZIUA 4R8SA 4UHKA 2BH2A 4XUKA 2NQ2C 4CU5A 1CUHA 3VR2D 1ZD3A 5I8PA 3EPJA 5DM4A 3OTWA 3FB4A 5FFFA 4BUZA 2Z58A 2PX0A 1J0AA 5IKEA 2JJ1D 3UK2A 2IBTA 5GM2A 1WUTA 2JIDA 4JDUA 4D98A 3TRDA 3U4AA 5C1BA 3AWDA 1XU9A 3CX3A 3EGDB 3MWLA 3JSAA 4M0PA 4QUAA 4E03A 1BCRA 3PSAA 4TZTA 2F3UA 3MD9A 2PL5A 3FOZA 4HO1X 2FRXA 1NQ5A 3PY6A 3KEGA 1WQ3A 3PRKE 2JLZA 3DUFB 3IVGA 4KX3A 1Q77A 1U0EA 3HB1A 5H3CA 3N2IA 3V46A 3JVUA 1H8HA 4TROA 4GXRA 1JEJA 1RLJA 4IYRA 3LUKA 3WWDA 4Q3EA 2OWEA 1YK0A 2IHYA 4HXFB 1ZNBA 1R15A 4E6EA 1Q7RA 2YHSA 3T5GA 1YZGA 1J5XA 3BIWA 2HRBA 1A27A 3BN3A 3BFXA 1KZ7B 4BX0A 5KMGA 4CM8A 1G9TA 1NQWA 2J7PD 5E6RA 4DYDA 1IZYA 3IDSA 3OQIB 3F5QA 2CXXA 4CTOA 4N40A 4FEAA 4DM4A 5BN4B 1VJRA 1I5EA 3DXZA 5H81A 4Q4AB 1KH3A 2M6KA 3U6KA 4IMPA 2X4DA 2CF5A 5EJ4A 3GA5A 1BEZA 3TEJA 1XEWY 1ZJ6A 3BULA 3PUZA 4MIOA 2EZTA 4MO2A 2YJ3A 1BRMA 4OGGA 1V11B 1QIIA 4KQKA 3SYNA 1JJBA 1V35A 3ZTYA 1O6ZA 1ODJA 3FOBA 4J43A 3E4CA 2VC2B 1PHPA 3S29A 4HDSA 3WYNA 3MINB 4UDNA 3SEZA 5C46F 3WLNA 2FQWA 1IZ9A 3NDPA 3H9CA 3UGKA 2AEEA 4EZBA 5AJLA 4TKLA 5CH8A 1ORHA 1GNQA 1I9GA 3MGCA 4F91B 2XT9A 3SR0A 1M66A 2PZLA 3BTUA 4NYMQ 4BXOA 4OXKA 4KZPA 1BTOA 2F64A 3AINA 3KSDO 3FCCA 1L8LA 4YO8A 4DB4A 1M2VB 2OILA 1A9TA 2H2WA 2NP6A 3EXHC 3E9EA 1JAHA 4QPCA 2XMBA 3IP3A 3WICA 1IOWA 2RI0A 2TS1A 1XTRA 3OZUA 2FUNB 5AI5A 2ABWA 2OPBA 2PHZA 3MFYA 3HRIA 1T24A 4Y9RA 2J87A 3CNQS 5E95A 2EZUA 3IE1A 4QGAA 1NIJA 2FE4A 2FLVA 2JFOA 1JDBB 1FL9A 3E8SA 3KC2A 2OGSA 1ZD9A 3PUKA 1VHTA 3EH1A 4JOBA 4QJ4A 4S1TA 5CR9A 4F4JA 2FM6A 4YV7A 5EV8A 4K6OA 5C2JB 1I2CA 4LY6A 2VJMB 2ZE8A 3OFNA 1BVTA 3B48A 2CHQA 5CDHA 3DBLB 1TMOA 4YGXB 1H5QA 1RVV1 2BM9A 1UT6A 1OPRA 1VKOA 2XTJA 3KKQA 3MJRA 3MT7A 2GO1A 3UNXA 1AXEA 2RHJA 3GJTA 3SKVA 3V97A 3JQRA 3WYEA 4NMHA 4W1PA 4IWNA 1N2EA 1V26A 3EXG1 4OJKA 2QAJA 3C3KA 4TYFA 3O4RA 2IXBA 3TOCA 1LNQA 4J91A 5BWCA 5JEDA 4RV9A 4H0DA 4J7XA 1E1MA 4UM7A 3RS7A 1R6UA 3TTWA 1NZDA 3D8HA 1M6EX 3QFHA 4Q7EA 2BZSA 3RDPA 1N2IA 1OHHA 1SWWA 4TZ6A 4BWFB 1KO4A 2JW5A 4S2EA 2W6OA 2AFIA 2ZYTX 1TECE 1LI5A 4ZI7B 1R3UA 2VXYA 4ITVA 3V1YA 1UZNA 1JHMA 4IXTA 2Q3FA 3BTOA 3DVLA 2YWEA 1QHSA 2OPHA 1OC4A 1ZEJA 1LQ2A 1PL0A 3HZZA 3KAPA 2GHRA 2ZWVA 4PHFA 3KDAA 4QEKA 3M5WA 5EXEA 1XF1A 2DUWA 2ZB8A 3E0XA 3GK3A 3H8SA 4RMGA 3DQZA 5HK8A 3Q8MA 4OX9B 3MWDA 1E1NA 3H5OA 4QQRA 3LDFA 1XZCA 3MJTA 3MTBA 2BTQA 3NEJA 4RV5A 1UF9A 3S5JA 3GLFB 3IAAA 4JH0A 1U9IC 4W8HA 2EAUA 3DBHB 4D99A 1DQSA 1KAHA 1MMFB 2WNSA 2YS7A 4LJLA 1YZKA 1M2KA 2JJ1A 4L5IA 3TRJA 5CIYA 2EIHA 3IAS6 1IM2A 3WKAA 2ZVQX 4PR0A 2PWYA 4F71A 1XRRA 4D9JA 1QF9A 1EDZA 1QPBA 3H9JA 3V00A 1HTBA 4LXYA 2PH3A 5ISMA 1GGJA 3F7MA 3TD9A 4QOFA 3NHWA 4LISA 1R0LA 1ES9A 3R3HA 3I6IA 2VO1A 1EQ2A 1YA6A 3F2IA 1RWNA 1ULZA 5IFKA 2IX3A 3EWNA 2Q62A 2QP4A 1NU8A 3S55A 3HY3A 5LDHA 1OGIA 1K7YA 1UCFA 1VMDA 1OI2A 1UBRS 2GJAA 2H7CA 2OBNA 3H75A 3RJ5A 3ND5A 3PC6A 4DIDA 1B43A 1XP5A 3EXG2 1W29A 5KIAA 3ND8A 4EO7A 5LP6A 4KQIA 2BFCB 1RADA 2I2CA 3JCZA 4P7BA 3W9SA 1HLPA 2QRKA 2QPLA 4ZVQA 4M0UA 1JG7A 1H2RS 3A58B 4FFWA 4IOKA 5T41A 4B6GA 2VDMB 5JSZB 2WE7A 1KDYA 5PNTA 4NV0A 1WP9A 1QPGA 2P9YA 2J7PA 3TAUA 1P2BA 4J0KA 1N5IA 3R75A 5F52A 1AK9A 3WQSB 1W4LA 4PLHA 2W8ZA 4QAQA 1R0WA 1SOAA 4CKBA 4R9NA 3EIHA 1WE2A 4A2CA 5LOVF 1YJQA 1NN5A 3DFMA 4BBPA 3LTEA 4HGYA 5TY0A 1P77A 1G3RA 1XMJA 3MWEB 3R1IA 5G1PA 3IQEA 3FYDA 4XLTA 3D6VA 3DC2A 2ZQZA 1G66A 1E3TA 1GGKA 2OXCA 3NJ4A 3BCSA 3TD2A 3KVNA 4XJTA 1ORIA 3BJRA 3UB4A 3HBLA 1SN7A 1JIIA 3SMVA 3ZI0A 1N5OX 2V6GA 1FK8A 3H87A 5DTEA 1O3YA 2O2EA 4RVNA 3Q9SA 5GV7A 1QGZA 3E4DA 3Q7IA 4YASA 2I2AA 1KP3A 1C7ZA 2YFYA 1CBUA 3PQDA 3UKDA 2EOAA 2W2VA 2ZJ7A 3DMGA 4IJVA 1BN6A 3MT8A 4KQWA 4UASA 1U7ZA 3COSA 5F5NA 1N1DA 1AQ6A 1YNSA 3VBEA 4WD3A 1GG5A 5G02A 2ET6A 7REQB 2LD4A 3RB8A 3C4VA 3GAAA 3AUUA 3DNFA 4KO4S 5HF9A 2WT4A 5ESRA 4FMCF 2C3PA 4IJ6A 5CB6A 1GUFA 2XUAA 5HE8A 1MPTA 1L7EA 3B2NA 4KMOA 5DP1A 2VAMA 5AK5A 5HK9A 3JD4A 2B7LA 3RCBA 3OQ1A 2QRQA 2PUCA 1L4LA 2AKYA 2YRWA 5EPEA 2OBYA 3H5AA 1N1GA 5GP1A 4D6XA 4ZDIA 2C7QA 4M4SA 3FX2A 1T2EA 1NKVA 3GFGA 3PIRA 2HPZA 3QBEA 4NZ9A 1ZUD1 3B82A 4F85A 3E8MA 1XDBA 3NBMA 4YUVA 1A97A 3NBKA 3NAGA 1ULSA 3C1UA 1V5WA 4ZQBA 4RY9A 3DCNA 3MOGA 2G1UA 2IF0A 3IMCA 1VKZA 3LUPA 4S1PA 4WJKB 1NAIA 2A4KA 4OEHA 2VTBA 4Q4LA 5BVHA 1NVUQ 3M6XA 2KPOA 2P4QA 4RA6A 2YNMC 3BRWA 4J16C 5IKXA 3NUZA 1U81A 3DV9A 3VX4A 4CKWB 4D4KA 2IH5A 3SSOA 1NUQA 3KU4A 2IDKA 1JU9A 4H35A 3ZQJA 2CLLB 4HDRB 3SXUA 4FC6A 1ZHOA 3DH8A 2QW1A 4KG7A 1XG5A 3E3MA 5HKBA 1RXVA 1G2OA 3N07A 4TZFA 2OHVA 3OFSA 3DMPA 1U2EA 2O57A 4URZR 2XITA 2Z83A 1SA0B 2YZ7A 1IIBA 1XA0A 3BE4A 4X1KA 2MYTA 5GJWC 4TMYA 1EXWA 2IOFA 2EW8A 3RABA 5CB8A 4B3XA 1G4AE 1B41A 4ALMA 3EZFA 1F2UA 1ENZA 2B1GA 2WDZA 3BJIC 4JT4A 3SC2B 1DOHA 1V1RA 3NV7A 4NK5A 2RG7A 3H3FA 2R6ZA 1GTVA 3QLUC 1O87A 4IIXA 4KVGA 4P62A 3JQBC 3GJ8A 4AFNA 2ETXA 1Y37A 4PAQA 5HFJA 3ZYCA 4I5GA 4AG3A 2ZE5A 1D3AA 2AI3A 4QFMA 2YBEA 5LU8A 2QU7A 1N3LA 1C0IA 1KIFA 3DXYA 1VGNA 3WP0A 3Q11A 2G9QA 2NXNA 1R8YA 3JWJA 2CHEA 4EGCB 6CHYA 1QYWA 5LCXA 2PY6A 3AFHA 3L1UA 5FFNA 3WC4A 2R62A 4LCEA 1CJTC 2AR7A 3ABRB 4MUJA 4GOMD 3OSZA 1IEVA 3BD8A 3ONNA 3HCEA 2HHLA 1GKUB 3FLEA 4H7FA 2E6KA 5DSZA 1A72A 2EEPA 5HA5A 3YASA 1T1GA 3EX7C 5AM2A 1TJ3A 1HE1C 3KTDA 5CFOA 4KUEA 1B6SA 4YDQA 4YMWA 4LWOA 3BMOA 1NUAA 2PO7A 1XDZA 2IPNA 3AJAA 1WY5A 3P2MA 4QTTB 3AIIA 5KYVA 3EC7A 1VLLA 1HTTA 4P0TA 1I33A 4WLVA 2EX1A 3E3NA 3I0MA 1E69A 3L9WA 5E1BA 4DA4A 5E6SB 1CHNA 3GGJA 3PQCA 4E94A 5ACQA 4XUGB 5BN5A 5J1SB 1YRWA 3FYUA 4O02B 3WGYA 1W5AA 5ECWA 5AW5A 1R66A 2C9DA 2C97A 4UXHA 1DLIA 3VPSA 5CVTA 3DLTA 2NUTB 1CW2B 4PQYA 1U7OA 2TMGA 3QFSA 1PFYA 2WNHA 2JJMA 3RHFA 1SEPA 4S0XA 3EGVA 2MSEB 1YUNA 2D1QA 1QRSA 1J21A 1KMIY 4ODIA