1YCFA

Oxidized (di-ferric) fpra from moorella thermoacetica
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
398
structure length
398
Chain Sequence
SQPVAITDGIYWVGAVDWNIRYFHGPAFSTHRGTTYNAYLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDSLKAHYSHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMDEAAKYYANILMPFSNLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKAKAVIAYDTMWLSTEKMAHALMDGLVAGGCEVKLFKLSVSDRNDVIKEILDARAVLVGSPTINNDILPVVSPLLDDLVGLRPKNKVGLAFGAYGWGGGAQKILEERLKAAKIELIAEPGPTVQWVPRGEDLQRCYELGRKIAARIAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystal structures of Moorella thermoacetica FprA. Novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase.
pubmed doi rcsb
source organism Moorella thermoacetica
molecule tags Oxidoreductase
molecule keywords Nitric oxide reductase
total genus 132
structure length 398
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec 1.-.-.-:
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ycfA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1ycfA01
1P9EA 2BF4A 1VJNA 1M2XA 3F9OA 3EDOA 3ZHOA 3DH8A 1RTTA 1CZNA 3I11A 4S24A 1WUPA 2FLVA 1X77A 3OWXA 2M5DA 5ACXA 3W7AA 2ARKA 5EA2A 4U7FA 2VW8A 1SG0A 1CZUA 2M6RA 4ZVLA 2QX4A 3OX2A 1J9ZA 1JA0A 1SQSA 5HH6A 5A87A 2BFKA 3GFRA 2YNWA 2BN4A 4YALA 4CETA 4FR7A 3B6MA 3NHPA 2YNTA 4NULA 1AKVA 4J5HA 1QBGA 2P1EA 3IELA 5FUQA 2QEDA 2YNTB 1A7TA 3I0VA 1XTOA 2M6SA 2QR2A 4TYTA 5LCHA 4LAFA 5EHTA 2FK6A 2BG2A 3SD9A 4EXYA 4EXSA 4U7GA 1JT1A 2H6AA 5ACSA 2DKFA 3KNSA 2GCUA 1TIKA 4AWZA 4Z5YA 3IEMA 2BPOA 3G5MA 2NZFA 3KAPA 2FU7A 4CF6A 4TZ9A 4DIKA 4YAUA 5FX2A 4P62A 1X8GA 1WSWA 3OJWA 4FEKA 4LTMA 2GFJA 1C7EA 2QX9A 2ZNBA 5EWAA 4N82A 2NXAA 5ACTA 5KILA 2P4ZA 2FDXA 5HIQA 4D1UA 1ZKPA 5EV8A 2BIBA 4KEQA 4BMOB 2UYXA 1YKGA 5HISA 4PTYA 4AD9A 1ZX1A 2BFLA 4Z6XA 4TZEA 5A4KA 2QDSA 3A4YA 3JSXA 4FGJA 3S0ZA 1J8QA 4RAMA 4FGKA 3TE7A 2BZSA 1YDGA 4UA4A 1OFVA 2MT9A 5LLDA 2ZZIA 4EYBA 1YCGA 4DY4A 4D1TA 3OJXA 1D03A 1VMEA 4UBQA 3KLBA 3IE2A 5LCAA 1KO3A 1DXKA 4D1VA 4UWSB 1FLNA 2YNUA 1CZKA 3IOFA 2Z9DA 5ULLA 3PG4A 3ZQ4A 2QWXA 4XWTA 4F6ZA 1XYVA 4QOGA 4XDGA 4FGLA 5ACQA 3RKJA 3HLYA 2Z9CA 4R81A 1Y44A 3DHBA 2Z98A 3GFQA 3O73A 4LTNA 1CZRA 1NNI1 5JROA 4RL0A 1QH5A 4PVTA 4Z5ZA 2BTNA 2P18A 2OHJA 3IOGA 3NHRA 2BG8B 2DOOA 3FCZA 3PY6A 4ESEA 1A8TA 4QOJA 4LE6A 5F51A 4C76A 3UXHA 3SVLA 4H0DA 1AKRA 2BC2A 4UWOB 3PY5A 3NHFA 2YNVB 2Q9UA 5AXRA 1QH3A 3N3BC 2FAXA 1D04A 1YRHA 1FX1A 4C14A 1SMLA 4D1WA 5HIPA 4PU0A 5A0VA 1RLIA 2FX2A 2KLBA 5A5ZA 2XOEA 5NULA 4RL2A 4BZ3A 1F4PA 4JO0A 5EMNA 1YCFA 3IEKA 5EAIA 1QHEA 1AKUA 2I7TA 1ZWLA 3GFSA 3LT5A 5AHRA 5AHOA 4HS4A 4YAWA 3T3OA 4QOIA 4Z67A 1BC2A 2GFKA 3U7IA 1H66A 1VGNA 2BG7A 1AG9A 2WHGA 1RCFA 3SW3A 4TYFA 3B6IA 3SBLA 5LS3A 3KEGA 3ZNBA 2R96A 3D7NA 1XM8A 4PTZA 2D5IA 4NQ2A 5LCFA 4BMPB 1DXQA 2HNBA 2Y87A 3BC2A 3TP9A 2A7MA 1WW1A 1FTGA 3ADRA 1E5DA 2BFZA 1AKWA 1ZTCA 1J9EA 1KR3A 5EV6A 5F12A 3NHUA 3NHKA 4D02A 4RAWA 4C1EA 2CBNA 3W79A 5FQBA 1XYYA 4AWYB 2GMNA 3N3AC 4C09A 2P97A 2Z9BA 1I1OA 3NHJA 2X2PA 2FU8A 1WRAA 4GQIA 4YAFA 4ICIA 1ZNBA 4ZO2A 2W5UA 5HH4A 2FHXA 2XF4A 4Z7RA 1T5BA 5AEBA 3L6NA 3F90A 4GR9A 2QJSA 3T9MA 5LBUA 4Y9UA 1TLLA 5ACPA 5K4KA 2Q62A 2FOXA 1X8HA 2QDTA 1BMCA 2BFZB 5LMCA 4C1GA 2V9CA 5TGZA 3ZWFA 4EYLA 4C0WA 2B3DA 5LBTA 1T0IA 4XDHA 3I15A 3W78A 1FLDA 4XWWA 4C1CA 4KEPA 2MTBA 3ESYA 2XR1A 2YZ3A 1CZOA 3ESHA 4GYQA 4LTDA 2Y8BA 1BVTA 2BMIA 1B1CA 3R6WA 4V0HA 3K20A 2AZ4A 3I13A 3LCMA 2WYMC 5KIKA 1KBQA 5EVDA 5AYAA 3SRXA 1V4BA 1KBOA 5BUCA 2X2OA 1AMOA 3FAIA 5B15A 4BP0A 3NFRA 4NLLA 4PVOA 4N65A 3EYWA 1QRDA 4ZNBA 4NQ4A 5EVKA 4C1DA 2OHHA 3SFPA 4TZFA 5K0WA 1X8IA 3F6SA 1DDKA 2R2DA 5DPXA 4Z60A 5FQAA 5ACVA 3X2YA 3W77A 3FX2A 3MD7A 2HNAA 5IQKA 4YQEA 4UWRB 5B3LA 4O98A 5LJLA 2FZ5A 2KQUA 3FNIA 2YCBA 3IE1A 4H2DA 4DILA 1CZLA 2QX6A 4ZVKA 4B87A 3VQZA 4ZVNA 1WUOA 1ZWKA 3I14A 3O2NA 1C7FA 3BV6A 3K1YA 3OX1A 4J8PA 3H3EA 1K07A 4GI5A 2AMJA 3WXCA 1QR2A 4M0CA 2Q0JA 3ZR9A 3QE2A 4FSBA 5NLLA 3ESXA 4GYUA 4Y7CA 3RPCA 4XUKA 3RPEA 5ACWA 2I7VA 2N1MA 5FQCA 4HKYA 5K4NA 5AXOA 4ZEJA 1JJTA 2V5VA 2BG8A 5EW0A 2BG6A 4ZO3A 2MOKA 2WYMA 1AHNA 2WRSA 3X2ZA 4UWPB 3IDZA 4EY2A 1FUEA 3X2XA 3DHAA 3U7RA 2BR6A 2NYPA 4YSKA 3NHSA 2GKLA 2FVXA 3QFCA 1WSBA 2E7YA 4U4LA 1D4AA 5ACRA 3QH8A 2ZKIA 3GAMA 1L9YA 4C1FA 2BMVA 4Y9RA 4YSBA 1DD6A 4YAOA 4N9QA 3AF5A 1FLAA 2BGAA 3KL7A 2M5CA 3N39C 4QOHA 5FA6A 2QMZA 2FZVA 1DXOA 5B3KA 3S2YA 4CHLA 1XI2A 5A0TA 1HLKA 2A5LA 5EVBA 1KO2A 3B6JA 5B1UA 2QINA 1J9GA 2V5UA 3JXPA 4NQ6A 5ACUA 2OHIA 2WYLA 1AKTA 1H69A 4HL1A 3FVWA 4EYFA 4QOFA 5LVAA 4F8YA 5LJIA 3IE0A 5LSCA 3NLLA 2GSWA 3P0RA 2QX8A 3KNRA 3RKKA 3DHCA 4LA4A 1CZHA 4ZVMA 2Q0IA 3AF6A 4YSLA 1RLJA 3T3NA 3HA2A 1GG5A 3FJOA 3L9XA 3R2UA 4EFZA 1XT6A 2XODA 2FU6A 1YOBA 3BK2A 4NQ5A 4H6PA 4QODA 1OBVA 2HPVA 3LVZA 3P2UA 1YCHA 5HIOA 4AX1B 2RG1A 2ZO4A 4UAMA 4RM5A 5K4MA 3OWHA 4HEQA 2MWMA 2NZEA 2YNVA 3QFRA 5B3RA 4J5FA 1JA1A 3OX3A 2FHXB 3AJ3A 4HL2A 1FVXA 2FM6A 3L9WA 5EH9A 3UXEA 2QMYA 5F4BA 3TEMA 3FW1A 4U7HA 5HH5A 1DX9A 4QOEA 3B6KA 3Q6VA 2HB9A 3NHLA 4RBSA 3NHYA 3KAQA 2F1OA 4F6HA 2FCRA 2I7XA 4C1HA 2R97A 1JJEA 3ESZA 3OVMA 3BK1A 2OYSA 3F6RA 3TZBA 2Y8AA 2ZWRA 2WC1A 1AKQA 3NHWA 1OBOA 4WD6A 4GCWA 3F2VA 3HR4A 4AX0B 3G1PA 5LM6A 1BU5A 5LE1A 1BVYF 1FLVA 4TZBA 3X30A 2AIOA 3SPUA 6NULA 4C0XA 3ES9A 4FX2A 4OXXA 1AZLA 1MQOA 2FU9A 2Q42A 3VPEA
chains in the Genus database with same CATH superfamily
5F2EA 3IP8A 3RFXA 3ZV6A 1PFGA 3WKEA 1XBTA 3L7OA 3L7AA 1K6IA 3OTWA 5M04A 4R2XA 4LVNA 3ZLTA 2ZYGA 1TVMA 3KKKA 2ZPUA 3VJKA 4AF6A 2W4QA 3NBYC 1G5IA 2JFQA 3V1YA 5JLAA 2Q4RA 2JI4A 3HXPA 4TROA 5CITA 3OJCA 4O1MA 2B61A 4TS1A 2PYIA 1P2DA 3QOFA 3QVGB 5B3AA 3ZXIA 4C4AA 2WE7A 4CL8A 4ZI7A 1FSFA 1R9JA 2BGNA 4HNAB 4QDUA 1MP0A 1EP3B 1G6KA 1ORHA 4DVGA 2M6RA 2CDCA 4X6UA 5FPPA 4FEAA 3E8MA 1J9ZA 5BRJA 4GMGA 1CPYA 1KAQA 2OZLA 1WIWA 4Q7MB 1GTSA 1QQ6A 2R7MA 1E94E 4MQMA 1MJGA 1QFJA 2YWDA 5FWYB 4R2MA 2Q8NA 5K6AA 4F21A 3A9CA 2B3TA 4LK2A 1AK2A 1KFKB 1GVHA 3FWZA 2XSZA 4LZOA 4QPCA 3UMRA 3KFVA 4HBZA 2JATA 3GEEA 4GXQA 3WFZA 4ZOQI 1G21B 3D4LA 3R9XA 1TEVA 2ALJA 3VC7A 4P2GA 4XQEA 3DYBA 1BE6A 1LZLA 4TVSA 3ZJVA 2YFQA 3ZWXA 1YQUA 3AL3A 1CY1A 1Z75A 3T3HA 1P4JA 1JG7A 1SIUA 4NU8X 3SYMA 1U0BB 1UXOA 3PEWA 4XGQA 5CDHA 4ND3A 2XUQA 1W1WA 5JI3E 2BG2A 1P1KA 4OUKX 4XUCA 4XD7A 2TRSB 2QTFA 3EXHA 1MO3A 4I46A 4L8GA 4HB3A 3FF1A 1MO6A 4BKOA 2VSXA 1KYTA 1SAYA 3G8CA 3N2GB 1GP2A 1N2CE 3A9SA 5EXPA 4DQXA 1GAWA 2JD2A 1Q1BA 3HYRA 4NBSA 5J47A 2ODWA 1F8YA 4E08A 3DF7A 3ENQA 1BEUB 4H0NA 3TJRA 6ADHA 4J0CA 4XD2A 3QXJA 5E38A 5G2OA 5FX2A 5ELXA 3Q2IA 1D7OA 4JEHA 4ZCRA 3R1IA 5AK3A 3GD5A 2GD1O 5E2IA 4GP9A 4WXPA 1FY2A 4LXQA 3D1VA 3QLTA 3EUEA 1XTRA 1PSWA 2OO5A 1X2EA 3DFKA 5EWAA 1G17A 1LW7A 3EULA 4DLRA 5A9SA 1YKSA 1JKXA 3FZNA 4JBIA 3WDMA 5AJWA 1OLUB 5KMGB 1U28A 3GGPA 3Q9LA 5FLYA 4J0EA 2O7QA 2A86A 3LX4A 3L6CA 4P53A 1G3RA 4WLOA 3EDYA 3SBOA 2WFZA 1FDSA 2FF5A 3A05A 4FMDF 1PT9A 2X0NA 1SWVA 3TLGB 1HDIA 3T1VA 1N3IA 3TL2A 2JI7A 1JAXA 2RHCA 4ALJA 5IARA 2G88A 5CYFA 4HYTA 3SHOA 2IXDA 1B15A 4W8HA 4A8JC 1V25A 2PZKA 1AZWA 3KZOA 4RAMA 1VTKA 5KQLA 5JCPA 2C5AA 4RM3A 5GIPE 4UA4A 1AS2A 3W3ZB 4QUDA 2IS2A 2XA2A 1E4YA 1HWYA 4IVRA 2OKGA 1T9GS 1YJ5A 2B83A 2KBEA 4WBSA 1VMEA 2AUMA 2OB1A 3ZK8A 3V1UA 2HUNA 1L4NA 4EA7A 1PJ2A 4DUPA 1XZPA 1MVLA 3PNPA 2YMMA 4C2AA 3J81A 5C4GB 1QGDA 2ODBA 2QLTA 4X8OA 1CZKA 5I6DA 1MB9A 3ZLUA 3PA6A 1Z37A 1PG2A 1GYQA 3PR2B 5CX1B 4RLSA 4PC1A 4X6LA 3D3WA 4ERNA 4GM0A 3V1TC 3PNMA 1RBYA 2XW6A 3NJ4A 4R81A 3EW9A 1EX9A 2RHOA 3L8GA 3O3CA 1Z74A 1PG5A 3FUTA 5H4GA 1KIFA 2Z98A 4U4AA 2EAUA 3B5JA 3IRVA 1YL6A 2ZJ8A 3P2IA 4WRRA 5BNWA 2FMFA 1V2HE 3GRAA 1TTTA 1CUJA 4D4KA 3WISA 1W581 1QO7A 5JROA 2JLUA 1S4MA 5IDYA 1DCMA 4ZTBA 4OQQA 2AMYA 1BA2A 4A91A 1BKSB 1FXWA 1DQNA 1YKFA 1XKTA 4HNUA 3TNDA 2CNWA 3FCZA 4JH0A 3AEUB 4TMYA 2XRYA 2XUGA 1CE8B 3RYHB 5L3SB 3GLVA 3SVLA 1GQYA 1OGIA 2VDLB 3AY7A 2OP1A 4FFNA 4OK3A 4TLAA 3GMIA 2COKA 3AX6A 2CL5A 1FP2A 4JSRA 4CF3A 3IT2A 4OHYA 2ZYRA 2ANCA 4DNXA 5F2NA 3L4BA 4TVKA 3PZRA 5AI6A 4M1YA 1Z4PX 2AG6A 2F4VB 3RFTA 1S2NA 3SE7A 2E4AA 2QSUA 1YRLA 2Z58A 1E8DA 3C1AA 4KQ2A 4C1BA 2ICAA 4OTZA 4V03A 2R84A 2Y3IA 3CB2A 1M5TA 4Q9AA 5HTKA 2CYAA 4GCWA 4YBRA 1JBQA 1KY2A 5CGQB 4KDEA 5EAIA 4RTMA 2GM3A 4B84A 1S4QA 4PNZA 1XLWA 1LH0A 1BS2A 5EQDA 4YRMA 1Z2DA 3R6LA 1SM4A 1YZ3A 3VNBA 1NVGA 1F3LA 3HZRA 1L5HA 2J07A 3GB9A 3LUAA 4RHCA 1COZA 2E89A 3WGZA 2I7DA 3BHIA 4QHTA 4ZOLB 3K1JA 1HETA 2SICE 3IQHX 3E7PA 4FFLA 5EJ2A 5EINA 2Q6VA 4BB0A 4LDQA 3TUIC 2Q0SA 3W9SA 3QF7A 3QEMA 4CRWB 2BYTA 1UR5A 5E4YA 1E9FA 2OCBA 3M1LA 1J70A 4IKPA 2BDEA 3KHTA 4KQXA 1R8QA 3W6UA 4DA9A 4ZZ1A 3L18A 4BLOA 4EO9A 5EHGA 4PGAA 4P3PA 1JU4A 2ZQZA 1O95A 3PWTA 1Y1RA 3O38A 1MO4A 1DNPA 3GJ5A 4MA5A 4D3XA 4E1BA 3DKPA 5H81A 2CVZA 2WM2A 4BO0A 5ED4A 2Q5IA 4HDMA 4OKSA 1HDGO 4A0SA 4YECA 5AM1A 4B9AA 4YQFA 1M74A 4UHDA 5DM0A 1L5LA 5FQBA 2H00A 3FSRA 5FKJA 2F1RA 3KR2A 1QLWA 1RHUA 1XEWY 2G63A 2J6IA 2SHKA 2WV7A 1NN1A 2XB8A 4TOIA 2X4DA 5FAXA 5HEKA 3ROQA 4EF4A 4GKBA 1S2MA 1E79D 2QSZA 4E2XA 4KHPB 5ALQA 2J4CA 5JXIA 2OCIA 4GGMX 1Z56C 2YS6A 3DZGA 3H5VA 3QELA 3G0OA 3MTAA 4M0MA 5JO0A 3NUZA 1M2WA 1Z4KA 2YVQA 4P3XA 4B2LA 5HH4A 3WWOA 3PQ2A 5G02A 3SLKA 3NRCA 1PE0A 2PUVA 5FTKA 1Y7LA 2JBHA 3M4JA 5JHHB 5JAMA 2NO0A 2FK7A 3DTVD 4B3TB 1GFWA 4I1YA 1N4DA 2E82A 1NHGA 1E8MA 3OLVA 2O48X 3K09A 3OOSA 4FN5A 1ONPA 3HI4A 1ONNA 1YNOA 4CTOA 1ZL0A 2ZU0C 4ZQFA 3ZWFA 2LXNA 5JALA 1YU6A 2ZM6B 1ZG3A 3AVOA 4CPDA 3AY3A 4JUFA 4KXXA 2PSSA 3BE8A 3CE6A 2OMKA 2EGGA 2XOKA 5IMBA 4DC1A 2ORWA 3E9QA 2CL6X 1U5BB 5IF9A 1DAGA 5EPUA 3KYJB 4PBTA 2P3OA 3UWKA 1XCGB 2I71A 2ZCUA 4J1NA 4OB6A 4DV5B 1J8MF 4AKGA 4FGWA 2LKCA 1G8MA 2PGXA 4CLHA 4LCBA 3GGDA 5JJ5A 4INOA 5CH8A 4M8IA 1YCDA 3U4QB 2B30A 3HSYA 1KY4A 3RANA 5EUMA 1WF6A 2EGUA 2XH8A 5ALXA 2AW3A 3TL6A 4H4DA 2C1XA 3PGXA 3THYA 3FAIA 3EXIB 3VVCA 1VGVA 2IH5A 2ZE6A 5FD8A 5AVYA 2P9HA 2Q9BA 4HDKA 3DVSX 5AVTA 3IHKA 1HDCA 3E9EA 1X8LA 5FPTA 3LWBA 4CV0A 2HA4A 3LK6A 2AE1A 4E2YA 3WLKX 5A5DA 3NDPA 4C03A 4INPA 3LRPA 4ZDWA 5K0WA 2GEVA 1K7EB 2H08A 4H17A 1DDKA 1A5AB 1LJUA 2H4YA 1X3LA 2BJHA 3KSRA 3MD0A 5I4KA 2FW1A 1I4OA 1I4LD 1RWQA 1Y5NA 2OUIA 2X1HA 4BVKA 4PSKA 1S1MA 1NSYA 2YV4A 3CLUD 2VYFA 1K75A 3PEEA 3URKA 2HTFA 4I8DA 5HPYB 2OGWA 5HQ3B 5CW1A 4RDHA 1YULA 2PT7A 4DDMA 2NO9A 5LNK6 3Q8LA 3C8UA 1V2GA 4MROA 3RG8A 4DYVA 9LDTA 2X3UA 4EUHA 1XELA 2AWNA 3BB1A 1SCBA 2BLNA 2CLEB 2NUTB 5EVJA 2C2ZA 4M1OA 2GI4A 2VAVA 3D6AA 2WMDA 3CG0A 1CZLA 3MXTA 4G84A 4M7PA 5DLDA 3VZCA 2ZEJA 4ZVNA 1M34B 1HV8A 2GN9A 3EEQA 3G8BA 3OX1A 3C43A 2EQAA 2ZRPA 3OO0A 5BYAA 4P22A 1TIPA 5C8VA 2NAFA 3DNMA 2B78A 3E9RA 5T41A 3ESXA 3HKCA 4P6VF 4Y7CA 2W4MA 4I3FA 5I7UA 1OI4A 3Q6NA 1ZGCA 3BKWA 2UV8A 1P9WA 1SR8A 2J7KA 4B4OA 3B89A 1XMSA 4UM5A 5G4KB 3T7DA 4ZEJA 3V4VB 2GPJA 2DUNA 1T10A 3BFXA 4AWAA 3I9LA 2PGJA 4AY6A 5LYJB 2HQOA 2ATCA 1V7ZA 2VHZA 2V5VA 1K5GA 3D7SA 3ROXA 2CLCX 5F73A 4JGBA 4FEEA 1WB5A 5JR3A 3DHVA 2WHQA 4CQLA 2NP6A 4HYYA 5A9RA 7REQA 3CYFA 1EG7A 1YGYA 3IPYA 4WOKA 2B4TO 4CNBA 2WWHA 2JRCA 4A4DA 2Y92A 4Z4QA 2BR5A 3AVQA 2C20A 1M73E 4RFVA 2XNDD 4ZDKA 4EX6A 2FWNA 1QRSA 1Z39A 1ADGA 4FFRA 4Q9HA 2AXQA 4J0GA 2KBFA 3PHHA 4RY9A 2ZYVX 3SJ7A 3LTNC 2WAOA 4RLFA 4D3SA 2RB5A 2VZ8A 1GFIA 1LSUA 2OENG 3ENVA 4QBKA 1GNPA 1Q22A 2EJBA 2OO3A 2QW0X 3IVCA 1HT2E 1O57A 1OX4B 2JCYA 1D2AA 1W0CA 2K2WA 1SOVA 4P92A 4ID3A 3R0QA 3JXEA 2XZOA 2DBRA 2FEAA 1E9SA 5BR8B 2YWXA 4DREA 1U28C 4EMSA 1UANA 4J2HA 1A9XB 1O9BA 1C9KA 2ZBDA 3KSZO 4HGQA 1N2IA 1LC0A 2O1SA 4V0MA 4D9IA 1O54A 1TK3A 3ZIUA 2R25B 2XMCA 4DZRA 3LBAA 4YROA 2ILTA 1VIVA 1AD2A 2KSQA 2FZVA 2QMZA 5FA6A 3RC7A 1YQEA 1Z6GA 3K1AB 2ZJ5A 5DBGA 4EKNB 5KTSA 2GPTA 2YVUA 1X19A 1J2TA 4PX9A 3T3GA 1L5ZA 2JCXA 3QA3E 4HLCA 1F3OA 1K27A 4WLEA 4ZOLF 2WOJA 4H1VA 3V32A 5LU9A 4A15A 1PFVA 5I51A 3NATA 2IRWA 5MDHA 1ZL2A 3JXPA 4D4GA 2OLEA 3RU7A 2WQ7A 1RU3A 2EG9A 1A9TA 2XUFA 2LNDA 3NTVA 4NI5A 5HKBA 4DNQA 1HSOA 1IRXA 4QOFA 4F6CA 4H77A 4CW7A 3HJFA 1M76A 4N40A 2XMZA 1FOEB 2R6DA 2V7BA 2PV0A 3FR8A 3ZNNA 2JJ2D 2B34A 4F3KA 1E2UA 1NVEA 4MOWA 821PA 3K6KA 2ACWA 1Q0PA 3RM3A 1P2FA 5IFKA 5AR1A 3I0NA 3WXMA 3A4NA 1BCSA 3E9DA 7ADHA 4JI0B 2DTDA 3HVHA 3SSOA 1CZHA 4EG7A 3AINA 2B9EA 5JNRA 3ZV4A 1IZYA 3LSYA 1ZVJA 2Y93A 5A03A 1CD5A 1A8SA 2BFWA 3RLFA 2BTQB 4WCFB 2YJNA 4JKIA 1KFBB 4U39A 3GLHA 1KJQA 4RJKA 4JLPA 1V8FA 1EX7A 2IHJA 3WL8A 4QKQA 5FF9A 1RJGA 2JARA 2H1LA 5TT1A 2I3AA 3GJ7A 1O9HA 5L8VA 4H1HA 4L6IA 3LQQA 3P9CA 4AB1A 1DEHA 5C4MA 1ITZA 2QVBA 4MRAA 4A0FA 2MMCA 3CLTD 1II9A 1NVTA 2EIHA 3OX3A 3R3UA 4JJFA 4GPIB 3VA7A 4FSXA 4BO4A 1MJGM 4DJFC 4MW7A 2GZDA 2GVZC 3FW1A 1YJAA 4RIEA 4GH5A 1JLLA 3S1SA 1DX9A 3D43A 2IEZA 1X7ZA 2J45A 3BK7A 2RI1A 5L40A 2VNAA 3O8BA 2FG5A 4IIYA 4GXRA 4R16A 4BAGA 4EOGA 3LT4A 3RLIA 3SWWA 2X76A 1NAHA 1JN0A 3OAAD 1WEHA 2RGEA 4K46A 5H5JA 3VR2D 4C1HA 2PMKA 2R97A 3B60A 3T3DA 4UHEA 2X0KA 3BMNB 3BK1A 3EWSA 2CNKA 3EZNA 1H9AA 4CLOB 1HGXA 3VU9B 1X8JA 3MUEA 3OIGA 4KGZA 5BN4B 4LJKA 3S8EA 2HLDD 1L5RA 2DLCX 2AMFA 1AKQA 3NHWA 2QVGA 2VHCA 2WF7A 4K3VA 4KL8S 4FYYA 4U5QA 5ERYA 3LPDA 5LIRA 3UMYA 4LDAA 5LUBA 2A9VA 2PRYA 3ISVA 1JB1A 3LCCA 4AX0B 1QQBA 3X1KA 3E3OA 4AG6A 2AIOA 3E9YA 1YUNA 3SE0A 1P2BA 2CXUA 3KB6A 4MLZA 1W5FA 1VLZA 3NXKA 3FVRA 1WCIA 4CMAA 4ZD6A 3GJ0A 4Q3CA 1VCNA 4UZFA 1XVUA 4WZ6A 1M2XA 4EYOA 1OZFA 4HF7A 5KTNA 5KWVA 2P4EA 2VJAA 1RTTA 1F20A 5B4VA 4ND5A 4KO2S 1CZNA 3Q10A 4I99A 3KZNA 1N2CB 2BLLA 1U7HA 3I4FA 4R83A 2ZYTX 3UMSA 3VAAA 5BSFA 3W2HA 2C84A 3DYIA 1VJ1A 3FYDA 5JZ9A 3R9XB 3B2QA 1MO5A 4QOSA 3RIMA 1YVEI 4DCJA 4DABA 3CY6A 4MUKA 3P9NA 2BSAA 3TSAA 3BEDA 2WVJA 3WP0A 4EKEA 3UOWA 2FWJA 5DCUA 1CDDA 3JV7A 4YK7A 2OXTA 1UAYA 3AVPA 3TDNA 5LDHA 1ECPA 5EPEA 1PW5A 4OQ4A 4PEVA 2QRNA 3CLSC 2P35A 1J8VA 4NDZA 4FI3F 2NU7A 2X5NA 3PKZA 2ZWVA 3V7NA 2WTXA 3AVXA 2GKGA 4MR8A 5ALZA 2X42A 5CB6A 3VSAA 3FPLA 1XU9A 1GADO 5HX7A 1QTQA 1BKYA 1QGZA 2VXCA 2WEKA 1WZ2A 1AKVA 2HV9A 1EDOA 3UHAA 4C6RA 5IHXA 5K99A 1ODSA 4BATA 2WK1A 4HSGA 4FZJA 2XUDA 3AF3A 4PN7A 4HL6A 4PX3A 3H5OA 1N6KA 2WTEA 2QR2A 2V65A 1QG2A 2AOUA 4QUIA 2JIBA 1E20A 4ZVOA 1OZAA 2C5FA 4R68A 4AULA 4EXYA 1KTVA 3GGOA 1DAOA 1YGPA 2YC2C 4G0MA 1U0SY 2ZWMA 3ILVA 2GASA 4N3BA 1FK8A 2ZUTA 1SQ6A 1JDSA 5CYOA 5MFPA 2P9ZA 4CLEA 3W5CA 3RS0A 1LPPA 3OZAA 4EHJA 2J0UA 4DJJA 1QRAA 1OJLA 3DWIA 3W8EA 3MTJA 1UKZA 3KYIB 5E2BA 2XA1A 4PO8A 4WA7A 1C4OA 4HCJA 6GPBA 2PX4A 3KXDA 5T8KC 1XPOA 3LIIA 1F4VA 1YRWA 4FOPA 3M89A 4RPIA 4OVKA 2F90A 3KJIA 3RSCA 1XSEA 4MW6A 2W6JD 3MMPA 2QRUA 3COYA 1XRRA 1PEAA 4WY8A 3H16A 1GPUA 1U99A 1H8HA 3MG9A 3B3GA 3Q7IA 3SSMA 2ERXA 2C7PA 1CEQA 4UEWA 3K2QA 4BV8A 3I92A 2C4NA 2H51A 1CSEE 3ANYB 3NAZA 3ZW7A 4MYTA 4LGYA 4HPWA 3TRIA 5JARA 4BV2A 3SYRA 1PYGA 3ICCA 5DN6A 4BIMA 4K6HA 4PZYA 1BDBA 4RWZA 3LXXA 4EVSA 3DWEX 1R12A 4IBOA 5JPDA 2QPLA 3LUCA 4GYJA 5FBHA 1G60A 1W85B 3OM8A 1N2XA 1QZZA 3UCXA 4EAAA 1H4QA 4KQGA 2C0CA 3TIIA 2QVZX 1ODKA 3AV3A 3N2ZB 4FGJA 4WQMA 3TMAA 5KHOC 1T4GA 2AIRA 4MVJD 2FGJA 5JCZA 2XUJA 1ZJYA 3E61A 1XNJA 1HA3A 5D5HA 5IZ4A 3ANMA 1ZISA 4IIHA 1D6SA 2PIAA 4JODA 4AJ2A 1SB8A 4IDCA 3OJXA 2C0PA 2VP5A 1GG8A 3PPWA 4HB0A 3UCFA 5AJVB 1OUMA 2OD9A 2QTHA 1GIAA 3KX2A 3NVAA 4ZV9A 5FBRB 3BL5A 3TXAA 2VNIA 3FBWA 3O9MA 3H3FA 2P9TA 1RJ9A 1TKAA 2IKQA 3B3FA 4Y9SA 1LU9A 3IDSA 4WPGA 1YE8A 3FYSA 4EK9A 3GA7A 3RS3A 4B3JA 4JK3A 3GNSA 5CXXA 3WZMA 1I3OA 1PL0A 1RVV1 2Q7DA 3QWHA 4XDZA 3Q85A 1E2LA 1AA6A 1Y44A 3LG2A 2ZPAA 4L57A 1JKMA 3GFQA 3NUQA 4LKOA 1GGHA 4EGJA 4EGCB 1ZLYA 3EQ9A 2YJZA 2P75A 2QG9A 5AKEA 3S81A 4CEJB 4BECA 3JQFA 3USZA 5A2GA 2P0AA 4Z7OB 1D7AA 2GTHA 3TK1A 4UD6A 1DOHA 5LZ8A 2I4NA 3FRJA 1NVBA 1ZO8A 3G85A 2A9JA 4YEDA 4BEJA 4QUKA 3FNRA 4G5XA 3I3SR 1GAQA 1JSCA 2R1VB 3O4IA 4B7CA 4MV0A 3WYEA 4ZICA 4E5UA 2WUDA 1I8TA 4L9SA 5F52A 2GBLA 4Z9YA 1OFTA 3UXHA 3WIOA 4U2DA 1Q1AA 2R47A 1H1TA 5JSZA 4WESA 5JBQA 3BSSA 4BVEA 1Z2CA 5DZSA 2IUEA 2HJHA 5G0UA 2ETXA 4PPFA 5BSEA 1VLJA 2BL4A 2LE0A 1IU9A 3A70A 3AJDA 3D81A 5D01A 1Z88A 2CKDA 3MCTA 5CLGA 2IU4A 1CUVA 3SSAA 5LXTB 2IHTA 1EEHA 3ZCPA 3QTBA 1WB9A 3WAKA 1G8YA 2ST1A 3MGKA 4CKEB 4ENQA 1O03A 5BW5A 5GINE 1UPXA 1B41A 2ZBGA 3QE9Y 3N05A 4KITB 2GKOA 3IRUA 3IAAA 1F4PA 4JO0A 3SF8A 2I99A 2CVPA 3IEKA 5JZBA 2V0GA 1CUZA 1XVVA 4LKRA 1ORVA 4UU0A 1GQ2A 3PYMA 3DE0X 4YRAA 1XDSA 1UC5B 1FX0B 5IAOA 3SVTA 3I9JA 5B1SA 1NJ6A 1RRMA 4FUQA 2JIDA 3AWIA 1KZ7B 2OV6A 2RH8A 4PO9A 4WAUA 1DU4A 2OECA 4F2HA 5KOIA 4DR3B 1PVOA 1E5TA 1D07A 2CJXA 1RCFA 2CYCA 2FRXA 2XUOA 2ZVJA 1H8ED 3WWCA 1DQPA 3EGDA 4FBMA 4G1UC 3R9KA 4CEHB 3W05A 2G77B 1KZGB 4XCQA 3TSOA 4PZAA 2OWDA 3QYFA 4FN4A 1T36B 4IDFA 4XTCS 3ZWAA 5K3FA 4AD9A 4CWAA 2IU3A 3QVMA 3TP9A 2AFHB 2AXPA 4OSOA 4AV7A 3LM8A 5TXGA 1C9JA 3NTQA 2NU6A 1R6TA 1RKQA 2Y4NA 4ZCQA 3RC2A 3WK7A 4BV9A 1F38A 1B0PA 1QRRA 3INGA 1HM5A 4UTVA 1P0MA 2R7NA 4X6XA 5H0IA 1HH4A 1PEYA 1QCCA 3I76A 1EJ2A 3JQ8B 5JZSA 1HL3A 4CMJA 2IBTA 2F3SA 3W79A 1XYYA 3AJAA 3VSDA 5ADVA 2XTNA 1OX6A 4KODA 1DKPA 3BAFA 1NN0A 1V35A 4X94A 4V38A 1MZPA 1EI9A 1S3IA 4NCNA 1H3NA 1N1EA 1WPGA 3OURA 2WTAA 2BFNA 2PXXA 2WKWA 1I51A 3V1NA 4YT8A 3I58A 1MTOA 3IALA 4U6QA 3PIRA 3ZXUB 1OZHA 5FYQA 2Z08A 3TDMA 1P45A 1XN1A 2XF4A 4NAVA 3U9LA 3L6NA 3ITEA 4MI3A 2GFQA 3DF9A 3LBIA 4GZ6A 4BP9A 1TLLA 2JFVA 1M2OA 1C9DB 1DAKA 2XCIA 4DCNA 2W90A 1XPJA 1G0NA 2UDPA 2QDTA 4FNAA 3ECAA 4TS4A 4WV3A 1CUXA 5F23A 3GZNB 1PR5A 2QBYB 4B3SB 5HIIA 1B8OA 2JGLA 5LBTA 1BJKA 3OZVA 2QJTA 5AICA 3LMKA 1YBMA 1T36A 4IO1A 4PE5B 4P0QB 3DP7A 4ZQBA 3K1AA 3DEZA 5LP1A 4MA4A 4ETNA 3CXRA 2Z2IA 4RD3A 5L4SA 1JPVA 1IK4A 2WD8A 3EBLA 1BCRA 4LTDA 5IC4A 2IT1A 1DDIA 3DDWA 3P1JA 4RFSA 1XTJA 4ILEA 1BFUA 1DPGA 3FUWA 3GRCA 3LP5A 1HFJA 3Q3JB 1Y1KE 4WOCA 1DMRA 3W4KA 4I1PA 3NBQA 3H0KA 3LECA 2PGLA 5HIAA 3DHEA 3ONNA 4GKAA 3U9TA 5JNSA 4OQPA 1Z5ZA 2XQVA 3D5QA 2X8JA 4MUGA 2J5QA 2X2OA 1F06A 3DBRB 1SNYA 2I2XB 1ZESA 3K0CA 4EBFA 1MEEA 2WHPA 3DAOA 4F9EA 4LY0A 2C29D 1JQAA 2WJWA 5GJWC 1VE3A 3EYWA 2H3HA 3SLRA 2ZIAA 2D5LA 4K81B 5IULC 4MYHA 4NQ4A 1R8JA 1T1SA 1G1MA 1ZOIA 2YOGA 3PITA 1UEIA 1W5TA 2R7AA 3E9CA 3EIOA 4JY7A 3NBUA 4OJTA 4RCVA 3RSFA 3UV3A 3FDZB 3OKFA 5D86A 5FUBA 3PFIA 3W1WA 1K97A 4RTKA 3K0SA 2C7BA 2PUAA 1IOLA 2PGNA 2BC9A 3A9UA 1KSJA 4WCVA 1AXEA 3Q3CA 3CKMA 4G07A 3STXA 3VJRA 2XUAA 5IQKA 3L46A 5BV7A 4ZCTA 5EJIA 4COKA 1UWVA 2WZBA 1VMKA 3TDKA 5JTTA 3BPSA 3BHMA 3KALA 1KE2A 3O8OB 3Q6IA 1MEJA 4XQ9A 3I9KA 4O98A 5CB4A 3W5SA 1NVKA 1GHTA 9ABPA 3MFQA 2Q5JA 4PIVA 2D00A 4WFKA 1C7RA 4PHTA 3QVWA 1R8XA 4Z4FA 2AJTA 3EIWA 5DRTA 2VH1A 4UCWA 1FP7A 1P1CA 1V6SA 2QY9A 3COSA 4RVNA 1C7FA 3O8QB 4J8PA 1FW6A 3SC4A 3ZIDA 2AI3A 3LDFA 5C1IA 2ZWAA 3TB4A 5L45A 2C4HA 4AS2A 5JAHA 2ZUSA 3DMRA 4FT2A 4GHWA 1KI7A 2Q0JA 3B3AA 3VO8A 5B2ZA 1ZIXA 1TKCA 4F4IA 4MKHA 4R1QA 3QGMA 4ZGGA 2ZUFA 3GJ6A 3RBXA 4XUKA 2F00A 3LYLA 1JHOA 5FL7A 4HNTA 2N1MA 5CM9C 4KXQA 2VJMA 3QNWA 2BRUA 2ZAGA 3R4VA 1IDOA 4K1LA 3BE5A 3FTNA 3GC6A 1NC1A 1P0QA 2VH2A 1Q15A 2E5FA 4K8RB 3PVZA 3IA7A 2YY6A 4OQZA 1P5JA 5A4JA 3KFXA 3LXRA 4D0LB 2Q5CA 3HNRA 3W3AD 2ZRAA 3CVJA 1DHRA 4IH1A 5H3HA 3O0DA 3TQHA 3ZI4A 4UWPB 2WKSA 1KQOA 3WGTA 2B7CA 2R6AA 3C7CB 4LDZA 2ECQA 2B1RA 1N2ZA 3CNOA 4RTPA 1U65A 4I4CA 4NYIQ 2XCSB 1YDHA 1HFKA 3HRIA 4DC0A 4TRNA 2OFXA 2VYQA 4NBVA 4C87A 1DDOA 1PD0A 4Y6SA 5J2UA 3M83A 2GGSA 1Y6ZA 2P0EA 3A6JA 3JTEA 3KEFA 3OUTA 1JH8A 1U2QA 3AHHA 4NNOA 3ZY6A 1A50B 3V9PA 4KXVA 1YMVA 3QJGA 4XLLA 3QTLA 5H16A 5LC1A 2RD2A 2GHIA 3VU8A 3HLTA 4LY9A 4ZXFA 2TSYB 2J32A 3HXOA 1DD6A 4QPJC 1TE2A 4S1VA 1PX0A 3DFMA 4IOJA 3O03A 3TL3A 4C21A 1R4MA 4YMTA 2WRZA 2R1TA 5COQA 5C2JB 3HI6A 3Q9SA 1T5TA 5DGIA 3EC1A 1GL7A 3V8MA 4OD0A 5C7OO 1GCAA 1XI2A 4OREX 3H2JA 3S1AA 2W48A 1JDJA 1TZBA 1QHFA 2PNFA 2Y8BA 4PZUA 3EVEA 1UFQA 1ICIA 2ZJYA 3CVVA 1GZDA 1Z07A 1I01A 1GWNA 3Q11A 4BLQA 4NMXB 4IO0A 3VKFA 1ILWA 1J9GA 3QHQA 1VMDA 2A84A 4UQOA 2Z83A 1UDXA 3U19A 2P2LA 2QN8A 4B6SA 1YHNA 1A2KC 2ZJ0A 1ZK4A 2MYPA 1QFSA 3BRWA 4C4OA 4L8VA 2HMUA 5B37A 3ZJYA 2OXIA 2XPCA 2X8AA 4J2TA 3RVDA 3UANA 3HG7A 3UYLA 1C4XA 1CRQA 3G9QA 5F9HA 5LSCA 4Z3KA 3ASYA 4Z4IA 4AF7A 3A6ZA 3B85A 4D4LA 3CUSA 1F0YA 3EGOA 2YRFA 2BGIA 4C9BA 2C3PA 2VHJA 5HIMA 1RRGA 4P7GA 2CUZA 1YHZA 5IEBA 1NIPA 3HLKA 1XWIA 3QZUA 4LA4A 2P6PA 4WXRA 5AVVA 4C4TA 1RKBA 3S2ZA 1KRXA 4BU0A 3AF6A 3N8GA 4N0EA 4XUGB 3UGQA 5KOYA 2JFUA 4BP8A 1GA1A 2FU6A 2QLJA 2YV2A 3FJ1A 2PKRA 1AUOA 3BXFA 3JAWA 2B92A 4JQCA 4PTLA 4RA6B 1U5CA 2JVJA 3CSDA 3D8BA 2V6FA 1SG6A 3JSAA 1OXVA 4NV0A 4XM0A 5CNJA 2RG1A 2ZAOA 5HDQA 3ZVKA 3TLCA 4TYYA 1NJSA 2CJPA 3UJPA 1ZNXA 1Y1PA 3CA8A 5KCMA 1X13A 2YNVA 4QDKA 1C4KA 5HMLA 3R3ZA 3LKBA 5B3RA 3ZWPA 4XLTA 1M6VA 4WGGA 3KOUA 3KDPA 2IZ1A 4YMHA 5EEHA 1FSPA 2TECE 3IPRA 4JT4A 4GMDA 4E4TA 3K16A 1OI3A 4R41A 1SCUB 2GFIA 4W63A 3VZBA 3GHHA 2X9VA 1DWPA 1N8NA 4MUYA 4RZXA 2C5HA 2X0FA 3WLIA 4AJJA 5DLEA 3JYQA 3ZPXA 1JEYA 2CLLB 4EW3A 1JJEA 1KAHA 1VKZA 3MRTA 4NU5A 4YDSA 3ST7A 4D0GA 3AEKB 1G6HA 3NBXX 2DWUA 3CONA 1IY8A 3KOWA 3LHIA 3ND9A 4QREA 4R1OA 1RJFA 2BSXA 2PNJA 3U5ZB 2HK8A 3WL6A 3IMCA 1QP7A 2O2XA 1B3RA 2IS6A 1IJKA 1PHPA 3F2VA 2VP2A 2BVNA 1DX4A 2WYHA 5JH7B 1VPDA 4ADSG 5AW3A 2HF2A 3EVNA 5AI0A 4KG7A 5IVDA 1Q50A 5DBOA 1VB5A 3OCZA 4RXMA 3QBDA 4C7KA 1WU7A 3DZJA 3G17A 4G4IA 3DT8A 1OE0A 4TYPA 3UA4A 2Q42A 3O8OA 2DGDA 3WJAA 4ARIA 1KARA 1Q0SA 1WUHS 2AHRA 2QQGA 4Z9XA 3UFBA 3ANLA 4KZPA 3VPEA 2YS7A 4OXIA 3SZMA 3SF0A 4WHMA 3VR2A 2ODNA 2IS1A 3CH7A 3ZHOA 2XMBA 2DFLA 5EFOA 4P4LA 1DX6A 1SZDA 2YZ7A 3COZA 5CR9A 4ALNA 4QXMA 4EHBA 5C7LO 4X7PA 3ESBA 1E77A 2J4FA 3H87A 2FLVA 2XKJE 4AW9A 5IKMA 1T6BY 4Q4AB 3EA4A 2A0UA 2H0QA 1N6NA 3FUUA 4US0R 3R7WA 5C37A 5K0EA 2FRVA 4XWGA 2O3UA 2Y9MB 1NBOA 2PD4A 2YDXA 4OU4A 2J0QA 3AM5A 1CRZA 1C5KA 1LRJA 2WJ3A 2CYBA 1XZQA 2E37A 3AHGA 3HKBB 4IRMA 4LZAA 3KAJA 2H48A 1R5NA 5GJCA 3TTVA 3GJXC 4GSLA 3H1TA 121PA 2EZUA 3PCXA 5AKYA 3PTZA 1E6KA 1M5UA 1JQJC 1ZH2A 2NO4A 4M0FA 4PPYA 3LNTA 4NBLA 3CH4B 3ZDQA 3HUFA 4FSDA 3EG9B 1MAHA 1GARA 2WIGA 2AJCA 1E2HA 2OSBA 2Y1LA 3B6MA 3H42B 4YRCA 1ZR4A 3ZJ4A 1NT2A 2ZBVA 5ALJA 1A95A 1Q91A 3ZGYA 4G0WA 3JQAA 3L6DA 4PQYA 3SP1A 4LF4B 1BCRB 1YS6A 4QLOA 1NXOA 4K6KA 4W5WA 1YQDA 1W0JA 5EQFA 4E2ZA 2R3SA 2FPXA 2Z6VA 2QNIA 1GU7A 2OOKA 4U7GA 2Y0CA 5LQCA 2D0DA 5B1EA 2O59A 4TGLA 4MRRA 4ZEOA 1H4TA 4AZVA 3EIFA 4J94A 3LVRE 4C06A 2PHZA 2Z5GA 4YRFA 5AJUA 4EMBA 2DFPA 2GPWA 3V7WA 1HL7A 4YA6A 2WWWA 1L7EA 1Y3HA 5DM60 1WCYA 3O0TA 2WTBA 1FMTA 4IJ6A 4ZYLA 1A76A 1Y1QA 4N7RA 1UT6A 5F76A 1IH8A 1CUYA 3IBCA 2FMXA 2O20A 1K08A 3QMPA 1QVZA 1L5OA 1VBKA 5H83A 3KT3A 1GUDA 1JR3A 2H7CA 1QE0A 1PDOA 2OGSA 2QD4A 4FINA 1BN7A 4LTMA 3ZTWA 3WHPA 4P98A 1LV7A 3DDHA 2A8YA 1EBBA 2PMFA 4L02A 4ETMA 6Q21A 2RHLA 2X14A 3PIIA 2QTWB 3JQ8A 3JYPA 4DRZA 1CS0A 5AK4A 3U37A 1TEXA 2G5GX 2M32A 4LK3A 4L9AA 2RI6A 4DCCA 2PUGA 1HXHA 3BIXA 4WDQA 4ZZIA 4RTOA 4TQ9A 1V11B 1ODLA 4TMWA 2QDSA 2Z5FA 2WAAA 1CKEA 5A1TA 4HZGA 5H1YA 3KNZA 4AJ9A 3AVVA 2CB9A 2HU8A 3EYAA 2GN4A 2QTTA 3KT8A 3R5SA 5JADA 3PFHA 3S0ZA 1MQSA 5HF8A 2BZSA 1U6JA 2YWFA 3W4JA 4KVZA 3AI2A 3QYPA 4U2GA 3OE7D 2ZJ7A 1H23A 1UBNA 1UOOA 4EG4A 3LX5A 4EJFA 3GUZA 4IMIB 4OYRA 4RE5A 1NMSA 3K9LA 2C3OA 2X22A 4RVUA 5BMVA 1ORWA 1G21E 5JMTA 2P3QA 1M1UA 3IQXA 5HKKD 1QYVA 1E2KA 2LGJA 4O3FA 1JJAA 2X77A 1VKHA 2H57A 5ULLA 1VLVA 4F71A 3S29A 4JLAA 4OHKA 1T5DX 4XDGA 2L2QA 5JASA 1QFXA 2DOKA 3U3ZA 4G8JA 3OKCA 3PGVA 4WFJA 2R7LA 4F5WA 1B74A 4ESHA 2VCEA 1E32A 2RGGA 5HOEA 5KX5B 4AQYB 3K0KA 3RGWS 1N0UA 3FRIA 4Z4CA 5HZGA 4ZV4A 5KKCA 1JHRA 4IFBA 2N3ZA 1OAAA 1HZZC 1XA4A 2SKCA 4MV7A 3S4YA 1KGDA 1QH5A 1GAXA 1NRJB 1RM3A 1TF7A 1UBTS 4ETWA 2QLNA 1TADA 2H06A 1UMDB 3IIMA 3RVKA 2L17A 1CEYA 1SBYA 2ATIA 1C50A 4HDAA 2COUA 1NU6A 3IIEA 1AKRA 3IBFA 2ROQA 4LV8B 4UWOB 2FR8C 4RF4A 3DZCA 4PLWA 4QEDA 5A3SA 3WQQA 1CFJA 5AESA 4P7KA 4P82A 3HCCA 1Q17A 4RF5A 3V46A 2E4VA 2R11A 4HTFA 2VTBB 3EUAA 2D1FA 4TL7A 3WGGA 1RQPA 2XF8A 3V55A 2HMAA 2B4YA 2DJIA 2WM8A 5EP4A 1ZVVA 1D9ZA 1XHEA 2AFHE 1SBIA 1BFKA 3VHXA 1U2SA 1XQWA 1G8KA 2WPDA 1RMQA 3CGWA 4DRXA 1C14A 2R4QA 4KWTA 3UQZA 3I34X 1IMJA 2FYTA 4TTQA 3S8YA 2FXIA 2AFIA 2R68A 4BZ3A 3MTQA 5FFNA 4X3OA 3UZUA 2YWHA 4Z60A 4TSFD 1QHEA 1Y6GA 3K0EA 2V74B 3SXUA 1LBQA 1JR2A 4ZEXA 4LXGA 3U7JA 1F12A 2VDWA 3DMHA 1L4GA 3AEXA 3RKUA 5FCDA 1K4MA 3PQ5A 1JEJA 1CFZA 1QIIA 3G1WA 4B43A 1SHLA 1II0A 4MQLA 1YR3A 2PLRA 5GM1A 4KJZA 1PK9A 3C74A 4I1VA 4QATA 5J59A 4DA0A 4YUAA 5LCFA 1ZY2A 4R51A 3FTQA 2JKVA 3QA9A 1VJ0A 4Q16A 4QEKA 1JG4A 3TLZA 4GBJA 1KR3A 2GN8A 3GZNA 5EV6A 1JT9A 1RWBA 1TZJA 3QLUC 4KGDA 3C41J 4Y3UA 1UZMA 1B93A 4JLVA 2FWPA 4WZAA 3ENWA 1LV8A 5LMZA 1EFHA 2I66A 2ORYA 4D80A 1EFTA 1Q3TA 4MW2A 4XX0A 4D3ZA 2YJGA 2AOUB 4G81A 3QLJA 2XJ9A 1E92A 3QELB 2ON6A 2BMFA 3QVVA 1K8XB 4XDYA 2PX2A 2WUVA 3BKXA 5JYDA 1T15A 3FCEA 3WIBA 5KPDA 5FOQA 1E2JA 5KYWB 3TRDA 1YFKA 2V3CC 1KAEA 1J8FA 2X2PA 4KPEC 1YFLA 1WRAA 1ZD4A 4PG5A 5TV2A 1PSDA 1KJZA 3VC2A 2HPAA 4U0JA 4W7HA 3WYCA 4B8WA 2FHXA 5DTRA 4F3CA 3K71B 1FXUA 2H3EA 2VSFA 1XOIA 3B36A 5AKLA 1GPJA 1X8HA 4S1TA 3QE0A 2ZU6A 4PLFA 1AGRA 2A0YA 1WMSA 3MS4A 2PH3A 4EYLA 1YA8A 2YICA 3VGJA 3WLFA 3NEAA 4C78A 3V48A 5ER9A 1MBZA 4PS0A 4EZIA 3L8YA 3KLPX 4IVNA 5ESDA 4EWLA 1RIFA 4ZCPA 1PP4A 1XCJA 1JXOA 1YMQA 1D4OA 2BFFA 3L79A 3RUHA 2MTBA 4LDJA 4OAQA 1AQYA 1JVBA 2HDOA 3NOXA 3QW4B 4WOJA 2XDWA 4XB2A 1ZGJA 5DDIP 3KQLA 3KSAC 1UDAA 4MB2A 3L0PA 5F9FA 3PDHA 1Y5RA 4G5RA 5LBIA 5I8PA 5H3CA 2RDMA 2I1WA 1Z2PX 4Z9BA 4E2FA 3VR6H 4COOA 4E5VA 3F8SA 5AFSA 1P2GA 3DMTA 3MMXA 2O3RA 1U8FO 1O6ZA 1RW4A 4JT8A 4OQFA 3FDZA 4UCFA 2D7CA 4DF3A 3AHJA 3JQ7B 1H0HA 1WS6A 3JY6A 3O4FA 4I55B 3AWDA 4Z8YA 4RTLA 1NAIA 1D6MA 1UXJA 5BUCA 2PLWA 3PQFA 1CCWA 3SF8B 3SX2A 4IHJB 5DO9A 5IJAA 3IMKA 3O8QA 3FN4A 1V6AA 2Q3HA 3ZWMA 5LFAA 3E05A 1FE8A 4XWYA 1GJRA 4ZK2A 4MWZA 3KQHA 3FFBA 1LLDA 4LHYA 1OLOA 5EZQA 1OIXA 2CXRA 2FPPB 5DWDA 5AI9A 2IYQA 3KKLA 3VYTB 3NBKA 4I9FA 3CKLA 1WZNA 2O0LA 1ONBA 4DLNA 3SC6A 4PS1A 4BAZA 4DMMA 2I3ZA 3I2GA 4GQAA 4RHUA 1MR3F 3V2HA 2D8AA 3GDFA 3JQEA 4BJHB 1E3DA 4EJ0A 4DCPA 3ZHSA 3WLLA 3LCRA 3ADKA 2BFFB 4H7PA 5JZMA 3T6KA 4W1RA 1KDVA 1LXCA 3GRRA 1U7XA 3NORA 2EERA 5A1JA 2GCOA 1YVRA 2ZVQX 4ZVKA 4B40A 2YHAA 1XZGA 3O8DA 3UJAA 2Q3EA 4UNIA 2FZCA 3BV6A 3FRHA 1EINA 1WDTA 4KMMA 1M66A 4LSWA 3RTGA 2E0IA 3RTCA 3UV7A 4A2CA 1KI6B 2CNNA 5KJEA 3RU3A 4CKXA 3MHPA 3CEPB 4TYNA 2XB2A 2XYHA 2AKEA 3H3XA 3H4VA 1XX6A 2BM0A 2IYXA 1P7ZA 3DS8A 2KI5A 4MW4A 5D3ZA 4DUZB 3FFTA 1XMXA 3PNYA 1BFDA 2W2LD 2JCSA 2WWIA 3DE5X 4OIMA 4LJ4A 3PE4A 1VDZA 2ET6A 3SOPA 1RJWA 1LFDB 2R60A 2AD1A 3DEJA 3AC0A 4FXOA 4TRRA 2QK4A 3EDQA 2PH1A 2WABA 1FRQA 1M8JA 4AKSA 4I9UA 1WG8A 4YUWA 2EX0A 5DJ5A 1ST2A 2VBGA 4JWTA 1DV1A 2IZOA 3J7TA 4X9XA 5IRCD 4MS3B 1UMKA 1THMA 1GCGA 2BM1A 5H59A 2C4TA 3CRMA 4HWTA 5DK4A 1DT3A 2YN4A 2G76A 3MUFA 3VXKA 3ZEAA 5KDOA 3U16A 4ZODA 1SD5A 4F06A 5CDFA 1V3VA 2OGTA 2R6CA 4OK5A 4ZAZA 2P40A 1WSBA 5BNZA 2E7YA 2JCVA 4HDRB 1GKYA 1Z08A 3A4VA 4DA4A 3SZOA 5ACRA 1QUFA 5E2AA 2R6HA 3O4JA 2VTDA 2A9KA 4CM3A 1D8TA 4L9RA 2OSVA 2I6GA 3C97A 1U3CA 2CXXA 2WUFA 3RFUA 3JZAA 4Q1VA 5JSFA 1TGVA 2DPLA 3FPBA 4O2LA 4RVCA 4ZP1A 4F6LA 4Z3DA 4XB1A 4B45A 5AT1A 1RXUA 4TXMA 1ZGZA 2ZB3A 3VR4H 4F6RB 4IHJF 5HQTA 2C7OA 5ARCA 2WILA 1J0CA 3H8JA 4MNTA 4TVBA 4OLHA 3FMFA 2RGNA 5BQPA 1YDEA 3C7TA 5LOVA 4GL2A 3U31A 3SQOA 4OG2A 3CZCA 2RGWA 3C3EA 4PY2A 1S8FA 4XUEA 4CLXA 1ENYA 1V43A 1UIRA 2Q4OA 3G89A 3KG2A 4I2NA 3OFVA 4P93A 4UXIA 4CM8A 2VOJA 2NPFA 4D7AA 3WK4A 2F3RA 5F3RA 5K7SA 4EI9A 3BBPA 1TYDE 4QFCA 4PQFA 5K8IA 5AHWA 2GERA 5CDGA 4KYTA 4BP3A 5KYYA 1MT3A 2C88A 4ALLA 3FYHA 2QXYA 4FHEA 1KJIA 2O06A 1YZLA 2ZS7A 4ASUA 1H2FA 4BASA 1NW4A 1URPA 5L3VA 1ULHA 2ZRDA 2H1SA 4ZI7F 3OQNA 1GUAA 1KFCB 3NQ41 3M5CA 4EHAA 3RRJA 2FPRA 3MIIA 4YHBA 1KR5A 1Y1SA 3PIDA 3JQFC 4B7XA 1KP2A 2AG8A 2BEWA 5IM5A 3X1XA 1UMDA 4M0DA 4ZMBA 4RU1A 4CCAA 3OEED 4OI2A 4JVMA 3GCGA 4Q3KA 2UYQA 4WOPA 4Q3AA 3BBLA 3WRYA 2VDPB 1ZZGA 4MV8A 3VZDA 2ACEA 2GPYA 2AUTA 4GX0A 2MYTA 3FCSB 3MBOA 1T0BA 3ER8A 4JZYA 4FOOA 1Q7GA 3G23A 1BA3A 4V0SA 2O1XA 3ROMA 1VBMA 1WKBA 3GI1A 1D1SA 3TECE 1C3JA 2O8CB 3LUPA 4EG1A 4JOSA 2AN3A 1UK9A 1OKKA 2WDPA 1JHVA 1Z3CA 4LV6A 4AQDA 4Q9LA 5TJ9A 5K4MA 1IBKB 1ENOA 3EEIA 1H8EA 1DGQA 1MFPA 3B1YA 4GYWA 5B5SA 1TO6A 1LB1B 2J8ZA 1TAUA 3UC5A 4X41A 2I1LA 4NBTA 1G2IA 1GQQA 3ZLBA 4E6PA 5AD1A 5EH9A 1RKVA 2Z1MA 1VMIA 4W99A 4E46A 5JCOA 1YQWA 1KHTA 2QE6A 4NK4A 4DANA 4F11A 4XCVA 4URZR 1YL5A 4WERA 1LS6A 3PGMA 4IRXA 4D5GA 3DKKA 4DNFA 4JROA 4BNVA 2ONZA 1TCAA 2H11A 4XGNA 2EF0A 5B58T 1Y42X 2ONYA 1SURA 2CBGA 2FJUA 4WEOA 3QV1A 2PKWA 2C9MA 5EPOA 4LBZA 1XDWA 1PZHA 3F6RA 3IHLA 1TKBA 4NCIA 4BQIA 5K0CA 4OI0A 4QE3A 1WV0A 3ISJA 1GN8A 2PUJA 3AERA 3LPAA 5FORA 4FOLA 3A26A 2OGZA 4G0VA 4DCSA 1U2EA 1Z7YA 1PSZA 2IEGA 2AQKA 3C3MA 3D7MA 4YNBA 4JLOA 3UKJA 3FTFA 1XD8A 3IDOA 1TU3A 1BD3A 2HU7A 3LQ1A 1E58A 4OHFA 4IYRA 1NYRA 1FJHA 2I6XA 3EXEA 4KQEA 3T9CA 3TVDA 1X1BA 4C4RA 3ICPA 2W22A 3R77A 1E0DA 3O2SB 4AAYA 5T4FA 3T5TA 1JG6A 4EELA 5JH7F 4BLPA 3F9OA 1KZYC 2BFBA 1TF5A 3M8KA 2FOIA 2E6KA 3E81A 4JXKA 4BBPA 4LYYA 4CV1A 5EWLA 4HN9A 3GUHA 1EESA 2G06A 1ZRHA 5TIIA 1BGWA 3VH2A 3KOZA 4MR9A 1KGSA 3IEUA 2GVDC 3BTVA 1PV4A 4Z53A 5JS2A 3EG9A 3WYDA 3DVRX 2OG2A 5ACXA 3WGKA 3IUQA 2VK2A 1UPUA 4QUAA 3N70A 1Y4SA 1EP1B 4HDKB 2GRAA 3RT7A 4FFMA 5HJ2A 3AW9A 1P3DA 3MWLA 2EWMA 5L95A 1LSOA 1N1DA 4J16A 2NWQA 4QU0A 5JJLA 1PZXA 4NJOA 2IYWA 5CIQA 1PNQA 1WW3A 5JV5A 1QONA 4AIRA 5ALGA 1W36D 2C42A 1AV7A 1MW9X 1JLKA 1YAJA 2V4ZA 3C8DA 4II3A 4BQOA 4FR7A 4IKEA 4DRYA 3PT5A 1KC1A 3U4MA 3GV0A 4MUJA 4NNJA 4U1RA 4CTJA 4ER3A 4DQUA 3DMDA 4JKOA 1MFZA 3IV6A 1KF0A 1EVKA 2I34A 4BLTA 3QX7A 2QEDA 2ASVA 1NSTA 3P94A 2M6SA 5JY6A 2Z6UA 2Q21A 5LCHA 1ZOPA 2JFXA 4HJRA 1NMEA 5H9VA 2Q1TA 2XYPA 3ROPA 1T6NA 2H2IA 4LXTA 2ACVA 1FFCA 4W7IA 4B6GA 1FL9A 2V54A 4GVLA 1A27A 4PG4A 1P1HA 2PQMA 5BOVA 4R1LA 3VPGA 2XRZA 4R40A 1J0DA 4NK5A 3I9V1 3PA8A 1NNEA 4BPBA 4J4TA 2EXXA 1YS2X 1DMSA 2VHEA 3CMMA 3ANSA 5AOCA 3QPCA 4Z5YA 2XT9A 1E0KA 3G5MA 1U8ZA 4OX9Y 721PA 3PSAA 2HRCA 5CNMA 4C3VA 3UMVA 1H2XA 1I7NA 1XEAA 1OXTA 2YXLA 3WTCA 3EMBA 5DHFA 4YUZA 2Q6KA 3VDXA 4NP6A 1JMKC 2J0VA 4W8GA 5F2OA 2ZIEA 3PB3A 5LUAA 2J9ZB 2A7QA 2CWDA 1VA4A 3L06A 4YCJA 2ZBQA 1Z7BA 4CCSA 2Z4SA 5KILA 3BS4A 1WQ4A 3N2YA 2VAPA 2PXHA 1Z47A 3GMDA 3KJQA 3N87A 4JVSB 4P86A 1EQUA 1EUZA 2C31A 4ON9A 5JYBA 3KTDA 2YXPX 4NHEA 1H0KA 4HC4A 3WMFA 1YKGA 4FKZA 2XT0A 3G1UA 1Q21A 1D2HA 2UZ3A 5D51S 1PBNA 5DGDA 3IURA 4KREA 3SS8A 4JLBA 1IC6A 3JD2A 3NHZA 4FZRA 5FPQA 4O4IB 4Z9AA 3A4MA 4LRXA 4H3SA 4R7ZA 4REQB 1QV6A 4PG7A 5CT8A 4EYQA 3TR5A 2M1XA 4M9XA 4R9VA 2YHEA 3K8ZA 4ODIA 2P2SA 1VP9A 2Y0BA 4E5NA 4DY4A 1WHTA 4LDNA 5A71A 4WH0A 1KMHA 2XGMA 5AH0A 3IE2A 4HNRA 3NGLA 3NANA 4H4EA 5KHLB 4BQFA 2MDTA 1C80A 4ZYZA 2EEZA 2IOQA 3TJZA 3N58A 2FNAA 4YAJA 3FMPB 3HCPA 1KMMA 1XKXA 5KNCA 2QWXA 3MCAA 3AKYA 4G8DA 3R0JA 2H1WA 1XB2A 3V4PB 1SBZA 2RHJA 2IYFA 1HNZB 4QAJA 3R8XA 2C5BA 2Q7XA 5EJ7A 3D64A 3Q6MA 5LD2B 3DTTA 4N39A 2PIDA 4L74A 4UHHA 4AP6A 4IF4A 4P5EA 1U9IA 4QULA 1TPYA 3L1IA 5EP2A 4A16A 5HF6A 3VYSB 4B85A 1CUHA 1B0AA 3JASB 4RL0A 2QD2A 3K72B 5DI3A 3SZLA 4X90A 3MZ0A 2BFCA 4OXQA 3WNZA 4EHKA 1E7SA 1PZNA 2ADFA 1UODA 2DSNA 4G9GA 1LDNA 1UKYA 1T0HB 5JYCA 4RQUA 2V4MA 3KLMX 4L95C 3RDPA 3AR8A 1Y4AE 1XROA 3NHRA 3OHSX 1PGNA 1RHKA 3DE7X 4N0PA 4NYMQ 3TR0A 1W44A 3I2HA 2Q50A 1V95A 1CJBA 1LDYA 1LPBB 4LNAA 5TC4A 3D6JA 3LUFA 2IDMA 1FNSA 3LZCA 4Q6WA 1SOAA 4QOJA 4RGYA 4YRPA 3VR5H 4A9AA 1I5EA 5HK9A 1XZNA 1Z7GA 2ZJBA 5HVNA 1SHJA 3SXUB 1NVUQ 5AVSA 1U02A 1ZJ4A 1GPKA 2RAVA 3ZHZA 4F60A 3G1TA 2RJNA 3N3BC 2EFCB 4QT4A 4DBLC 1O96A 2X1LA 1PWZA 5ALKA 3NM5A 3K0CC 3UJCA 3VC3A 4ZT5A 3RSOA 2V8BA 1UKAA 1OXUA 3A3PA 5FDFA 4JJ4A 1OCEA 4RORA 1IUNA 2GYVA 4B33A 2C7RA 5BNIA 2HK9A 5EYPA 4GXTA 2GN1A 1QV7A 5B57C 2C59A 3CUUA 4WKBA 5TE9A 2MJLA 2XF2A 3Q9NA 3OZGA 5CAEB 3T38A 3OJLA 4Q47A 2BFPA 5E3JA 2BH9A 1LRLA 3EOZA 3H5RA 4KIGA 5CX1A 5KC8A 3JAMA 4BY9E 2PUCA 2DVMA 1Z0AA 4Y0NA 1KI9A 3U39A 4PYNA 2I2WA 1XLVA 1FFDA 2DETA 5DTQA 3ABQB 1H1LA 5DMXA 4YV7A 4HS4A 1XIVA 4UMDA 4C7XA 1J0AA 3UW3A 1UWLA 1EXDA 2NN3C 1UBSB 3IERA 2R1TB 1CUGA 3MQFA 3UB2A 1P0FA 3LPMA 5TS2A 2BG7A 5KJ6A 1WABA 2NU8A 3WJ1A 5LZ9A 1ISJA 3EJ6A 5LS3A 1FBNA 1H2HA 4OATA 4JLDA 4OH1A 4REMA 5IXYA 2VFAA 3IX7A 4PTZA 1D0SA 1T8WA 3HO1A 3O74A 1EAMA 3PUZA 1LPOA 3AM3A 1U3DA 4IG9A 5AM0A 5CDYA 2AKYA 5EL0A 2ZSBA 3TGLA 3ZQUA 2RCNA 3VDRA 2EX4A 3ET4A 5B36A 2YIDA 2CN1A 2ZIVB 2O8FA 5K8JB 2NXEA 4FW9A 4H59A 1Y7HA 5E9AA 4P0PB 1USIA 1DZ3A 1XEXA 4CL3A 3FOFC 1V5IA 1IBRA 4II7A 3RVQA 1NL3A 3X0DA 1Y8RB 1JEAA 3K31A 1XJCA 1IZ8A 2R5FA 4HDSA 3S5JA 1RPNA 3WE7A 2IUTA 5DNAA 2GMNA 4IXDA 3N3AC 3DNFA 4H31A 4G01B 1BOFA 4B7ZA 3TOSA 2ZANA 5G0TA 1XP5A 1WL8A 1MLDA 2V1UA 5EGNA 1OV6A 2G72A 4Z2AA 4OP1A 4IIEA 5J4VA 3OQOA 4FVTA 4WFQA 2UXCB 1N6OA 2K4MA 4DUGA 5F98A 3CTPA 2ZBEA 4XW2A 4AIIA 1UJNA 2MU1A 5C8YA 3GBPA 5AEBA 3TZ6A 3HCEA 4LHEA 4AD8A 5J2TB 3GQVA 1I32A 3PSHA 1XZEA 3L1VA 4X3CA 5HE9A 1EHCA 5J5CA 2DRIA 4OQDA 3RHZA 4AT1A 4JCOA 4P4GA 4GKVA 2ZRLA 4CCWA 2JFYA 4L0MA 3UEOA 3H2YA 1WLSA 1I9GA 1EB8A 2QHXA 4IDBA 3NC4A 2ZCVA 5KNBA 2OAEA 1EH5A 1XXLA 1T9ZA 3LHKA 3WK8A 3DAHA 2VNKA 3F4LA 3KWMA 3ZHTA 3JR3A 3IDFA 3ZBPA 5GAJA 1A4RA 4EP1A 4ZEWA 1Z68A 2O2DA 2Y1GA 3MJEA 1K2VN 4ITVA 3P0HA 4UBMA 3T0FA 5C1PA 3CINA 1SULA 2Z2JA 3LWZA 4RHTA 1W9MA 3UWDA 3NPMA 4R0MA 3OKAA 4NOLA 4JJ7A 2AZ4A 2DT8A 3GOQA 4FYHA 4R7GA 3I13A 3A1FA 3SDBA 4RFSB 2IDZA 2W0MA 4IIJA 4CUZA 4GU5A 2IH2A 4LOJA 2H1FA 2VJYA 1L9XA 2V7QA 5AKZA 4CKBA 1LY1A 1UBKS 2XBLA 4H16A 4ID9A 1M1ZA 5KJ1A 2IHBA 1O4VA 1AMOA 3GOHA 3EFEA 3SEFA 5D8DA 1X1TA 1KKUA 3SDZA 3WQHA 2H9AA 1RAAA 3QXSA 3KQMA 4TKZA 1JU9A 3RVLA 3VPBA 1DINA 4CM4B 2OHHA 1JEOA 3KKQA 3CMCO 2IDJA 3K9FC 1Z4JA 3DCNA 1QTRA 3SSNA 2P6OA 3FCAA 4CLRA 4J0DA 4PINA 5D5PA 4EHFA 1PWYE 2I7CA 3HXKA 4D9EA 1GUYA 1L5VA 1ND6A 3T99A 1AO3A 3ETGA 1AX9A 1Q6YA 2AJBA 3RUPA 3WA6A 5FJJA 3MD7A 4ZDIA 3HJAA 5IJ9A 4ARZB 4EMUA 1R9MA 3G8YA 2WUEA 4QLAA 3WOHA 1XN4A 3R40A 4WXMA 5AQEA 5HK8A 2HFJA 2HA7A 4KOAA 2ZULA 4N3NA 1XLTC 4ZT7A 2VUSA 3M1YA 1E64A 1SUCA 3FNIA 3MELA 3M6LA 2I4MA 1PJ8A 4IXNA 4TM8A 4QVIA 4JX9A 5HUQA 1UL1X 3CR3C 4WN3A 4BVBA 1UJ6A 1JEQA 1XRNA 2IYEA 4ARSA 3B1FA 3GVHA 4JELA 2WVHA 3ODGA 2FUKA 4P1ZA 4RIGA 2Q7OE 4QLBA 3L82B 4MJ7A 2XUZA 1GNLA 2Y76A 5CBPB 1IL0A 5REQA 5COBA 1BN6A 4YJDA 1E3JA 1EM6A 1Q95A 3D4PA 3PJFA 3QFSA 5ALRA 1WP9A 3OOWA 1C0PA 4JOCA 4TTTS 5JE8A 4DEVA 2G6BA 2VJLA 2VUHB 5K3FB 4EYGA 5DYNA 2FPKA 2QTGA 4C6TB 1XZFA 4WUTA 5CG2A 5F7XA 1WCWA 1QM5A 2VPTA 4MQ6A 3WMGA 3AGQA 1QB8A 2A5FA 2UZ1B 4ENUA 4TL8A 1ESDA 4CMKA 1XDDA 1YQTA 4YAEA 4AM8A 1EDBA 1U2GC 5K0GA 1FZTA 4BMVA 1AXGA 1T24A 2I76A 3IKMB 4XGRA 1ACMA 3H5LA 1AKNA 1J0BA 4EPVA 3C5CA 4X65B 2QMEA 2R66A 5IVHA 2ZIXA 5LYYA 5CTJA 3U48A 4QQNA 1T29A 3HJRA 2BR6A 3DDCA 4C0BA 4NR0A 1U1GA 4Z1MD 4K9SA 5CDFE 5DNVA 5EJ8A 2GZMA 4IW3B 3IT0A 3NGMA 2FOLA 2ATEA 1NYQA 2VXBA 2UYCA 4WZBE 3DXZA 5CX4A 1W4CA 4C1FA 1LBTA 1ZOLA 5I7VA 3EZFA 4CM9A 3D6MA 3EFBA 4GLBA 1YR2A 2ZSJA 4QUEA 3CVYA 4MDEA 3QITA 2EP5A 3A6GA 4LBVA 4B82A 1HRDA 3GEMA 2WT9A 1KZ9A 1YZTA 2ODQA 2XOKD 3FI0A 5E7MA 2EZ9A 5D3QA 1BC5A 1S89A 3PJEA 1BHJA 1U0OC 2B5VA 1PR1A 3L2OB 3ZE9A 5CYGA 1RYYA 3AUUA 3BCUA 1TMGE 4I6GA 2Z30A 1Y4DE 3QVSA 1P6QA 4QOHA 3UW1A 1DCFA 2DZDA 4JL6A 3VZPA 4B75A 4B48A 1DC4A 2IUFA 2WKQA 1HPLA 1SD1A 3FNEA 5BUSA 2PT9A 1WNFA 2CV2A 1H6CA 1UMCB 1ADBA 1OVMA 4FGZA 4KVAA 3A6DA 4M1MA 3U61B 3L7KA 3OPYI 2Z4RA 2D7JA 4ZQIA 5FLEX 5AW2A 3RADC 3CLHA 4E3ZA 3DTVA 1ZRNA 3GJQA 1TOAA 2PTGA 2E4WA 3VR6D 3MJRA 1XO1A 4ZC1A 4HHEA 2GBGA 3LW8A 3OQIB 2I2BA 3TI7A 3RK4A 2IDKA 1QKKA 2QGNA 2JK1A 4KR2A 2W71A 2G4CA 4P4SA 2O54A 1NLZA 3ICQB 4Q3BA 4B7UA 4MCHA 3AKCA 4KVGA 2O2SA 1AF4A 2A78A 3LUGA 1HQYE 3R3WA 3ME5A 4QZVA 1JU3A 3ZYCA 4JITA 4HZUA 3W8FA 1DEKA 4WLVA 5ICFA 1EXWA 1RZ3A 3GLTA 3H4TA 1PGPA 1XL0A 1QE5A 4Y2YA 3TLAA 2IYPA 3B13B 4L50A 2GEKA 3HJTA 3BYZA 3G0IA 4JKYA 1TLTA 4YSLA 5EVCA 5EWMB 1ZM2A 3R2UA 1ADFA 1XT6A 4L7QA 3U7GA 5JANA 1M2KA 3K6SB 2HA0A 1XPUA 3QHPA 1C9MA 1PKXA 3LY9A 5ALEA 3ZLVA 3I04M 3PXEA 3HCFA 1RI3A 4HEJA 5IK2A 4IIXA 4HFRA 4NZMA 3KD3A 3JVUA 4OAOA 3UUEA 5LZ4A 4TLCA 3AUFA 1W36B 2WLSA 1Z0SA 4JT2A 5DU2A 1C8BA 4HL2A 1YR1A 3TNLA 5EHIA 2FHXB 1RYFA 4IGAA 2Z3VA 1N78A 1FP4B 1VJRA 2GCGA 4QM6A 2UYOA 4N8SA 4NHOA 3Q6VA 1CLUA 4KUEA 3WY9A 2D4AA 4RBSA 1Y4UA 3FGPA 3NHYA 1WPXA 3BD6A 5U4QA 3I73A 3QVXA 2B5OA 2R00C 1VPWA 3AFMA 1DXHA 3OVMA 2R8RA 3QEJA 3ADPA 2WT8A 4R2IA 3FBGA 3RH0A 2OYSA 2CFCA 3T9DA 1XTIA 1SCJA 1Q7RA 2FTKE 4RKYA 4TT3A 4XJSA 1XRJA 1A77A 2DH6A 3CT6A 3GJSA 1Z2AA 2FE1A 3CF4A 3TLGA 4CQMD 3R09A 1EFPA 3WL4A 4MKXA 3N8KA 2QTMA 4S0ZA 4MKFA 1P19A 3BMQA 2W2NA 3N8IA 3PX3A 5LE1A 4B4WA 1KU0A 3LVFO 2VTBA 2EBWA 4Q34A 4YO7A 1XRPA 3FHCB 4BX9A 3FWNA 3Q15C 2RB4A 4FDLA 1RXCA 4ZALA 2YNTB 5EWLB 5B1IA 2Q1UA 4I5DA 3OT5A 1QVVA 3NYQA 3HN6A 3P20A 1VP3A 4RHXA 3AI7A 3SKXA 2M1ZA 3UG7A 3WKCA 2Z6QA 1WF3A 2FFRA 1TYZA 4G1FA 5HFJA 4C7VA 4LJ9A 4S24A 3KOOA 3IL2A 1WUPA 1F1JA 2JCBA 2FZWA 2PZAA 3DMFA 3GGGA 4W82A 5LDGA 2M5DA 4CKEA 3D3KA 2OB2A 4ROTA 3VAYA 3PHCA 3QOWA 4OV6B 4D41A 1B00A 4DLLA 3QKIA 1EVJA 4GE3A 4FILA 4R4JA 2BHSA 3ZGZA 3DBHB 4RMIA 2FWMX 4YCCA 3ONDA 3EXHB 3DOIA 3T1NA 2Q46A 4D42A 1VFNA 4MWDA 4UBNA 4L0CA 4XA8A 5C8YF 3EQ2A 1E2EA 3E9MA 4UUBA 4AZSA 2O7RA 3C5HA 1B23P 4KTTE 3W06A 4MV6A 4EVIA 4X60A 3IIJA 2HLNA 3BIWA 4I1RA 3C8HA 4MINA 4NULA 2JFPA 2CDNA 3IP5A 4AVYA 4A5OA 2BFEB 2G83A 5CLIA 1N8TA 1HTBA 4LC9A 2AVDA 1MJ5A 3ANXA 3PR1A 5C5DA 5FUQA 4JP1A 2Y0DA 4ATNA 2R8BA 4IQ0A 2D1TA 4HUJA 3RFCA 1OX5A 4TV8F 4Y2JA 4OEHA 2W2XA 3VI4B 1L5WA 2C8JA 5ITZA 4UVGA 4RKQA 4JLUA 5EJ4A 2XMQA 3MYRA 1JT1A 3UMGA 4Z1MA 1QO9A 1CETA 1UJCA 2DKFA 3OH8A 3OQIA 4MUAA 4H3VA 4BUZA 1LDMA 3EDCA 3HWWA 3L01A 5IVIA 4BVHA 1G20B 1UM9A 4ENVA 1F6DA 3PC3A 3T95A 4DMKA 4TWRA 2OZEA 5DHTA 3NIWA 4DV4B 4EFDA 4BBJA 2ERYA 4YV1A 4O3MA 3RJMA 1QHGA 1G5HA 2IP2A 4DIFA 5FUMA 5GONA 4HH4A 1M2JA 2VO1A 2Z5LA 1ISMA 3AZPA 5FLKA 1I10A 1XJ0A 3R5HA 3H6HA 4D1UA 1GL9B 3H18A 2I3DA 4ALIA 5I7HA 4RF2A 3EXG1 1N4AA 4EMTA 5EHZA 1XEWX 5AK5A 5E6UB 4FB5A 2PX3A 5BPFA 1DRJA 1W2HA 2J87A 2QDXA 4P35A 3TMKA 4C04A 2RCYA 2DM6A 3ZGLA 2WHYA 3LQYA 1NC3A 2BP7B 4MLCA 2EJCA 5FI1B 1LBHA 4XD7D 2BKUA 2BFDB 2R87A 1GZ5A 1P4RA 3I72A 1VFPA 1MIHA 3OSUA 5BQ3A 1KS9A 2OFPA 3GFOA 3LPCA 3EPPA 1EK0A 5DN6D 1NY6A 1OFVA 1ZJWA 1MTZA 1Y48E 2JFNA 1RE1A 4MS4B 3U0BA 1YCGA 2ZTSA 3TD9A 1G66A 4HWKA 1D03A 5CBKA 1ZCJA 1MRSA 2ZSUA 4MEJA 3S7TA 1TM1E 3IIKA 5JVDA 5JXHA 1U4NA 3T7TA 1U5BA 5CA0A 1YSCA 3CRNA 3WGMA 1SBCA 1GQFA 2OOSA 3IO3A 3CVWA 1I4DD 3SHFA 3D8TA 3L04A 1I5RA 1BMTA 4MGKR 1CVRA 1GZUA 1QK5A 3KYCB 4KV9A 4XVRA 4DZTA 5CEFA 4DB2A 4GOND 3R6DA 2QNBA 2BH2A 2XE7A 2ZE7A 4X1KB 1DAEA 3HLYA 4ZAFA 4PZPA 5SYMA 1LLUA 1KI6A 2JBWA 2Q0QA 5F3WB 4X66B 3QBVA 1GTZA 2WFLA 2YJ6A 4QBTA 2GEUA 3ROKA 1C1YA 5MFZA 5KB3A 4RKRA 4MV4A 4QA9A 3JQ9C 1G8PA 1SKUA 3GELA 2HRQA 3I52A 2FKNA 2OBNA 5B7NA 1ULAA 2P18A 2JPDA 2GNOA 4MVJE 2IELA 2IF0A 2CZGA 3G0CA 1YQGA 3HUDA 3BFPA 3G9ZA 1K6JA 3J80A 3O8CA 2IIVA 4J03A 1E4EB 3H17A 3M5PA 4MUMA 4K1XA 4AJPA 2QZZA 2H63A 3T9FA 1KOGA 1CUFA 1OWNA 3P9KA 4IDHA 1FMCA 2VP4A 1GTJ1 1LLFA 3W5HA 5LZ2A 4MR8B 3VPCA 5DBHX 1OXBB 4JS0A 4Y9TA 1WBDA 4MS4A 5IN5A 4BC1A 5C80A 2NZVG 2K7FA 3ETJA 2YJ5A 3K30A 4KE9A 5KHAA 5EXTA 4AMBA 1ARZA 4Z51A 1K8QA 5FL7D 2WQZA 4WBNB 3JYNA 5BN1A 2CXPA 1H9BA 2LIVA 4LISA 2I6SA 3IQGX 2YASA 1U1IA 1ZMXA 5EHXA 4PU0A 2BDUA 5AW9A 1G42A 5TGTA 4ENWA 1SA0B 3WGNA 4JXZA 1TYEB 2XOEA 5JEDA 5DNEA 1VLHA 3IQWA 3JVIA 3QIAA 5EMNA 4I4TF 2QRVA 5TEVA 2HLDA 1KO7A 2XX3A 3HY3A 3ZE6A 4DIMA 4Y2QA 4FCCA 4AWXA 3NNNA 4F4UA 5T3YA 3VNSA 1EGMB 4Q0MA 5AHOA 4TT8A 1SGWA 1J7JA 3E0QA 3EOAI 3OQ6A 5EIFA 3SYTA 4ZCIA 2IBSA 3MHTA 3UXYA 3L8MA 3MBKA 4BXOB 1LI4A 3RJZA 1ZI9A 3BWYA 3ZJUA 3K70D 3SW3A 3OG9A 1IEVA 2MHCA 2Z2ZA 3SBLA 2VQSA 1MUUA 1NUUA 3KBBA 2RHWA 1E1DA 2UZ0A 1QBKC 2H9IA 5GIOE 4TKVA 1DQRA 3K9NA 2ZW9A 1ISHA 1GPBA 2Y87A 3IIIA 3BCHA 2YBEA 3R5FA 1WW1A 3X1YA 3ADRA 4BFLA 1V26A 3G8DA 1UDBA 4GSKA 3V8RA 4C2BA 1MXHA 4E7OA 4CLOA 2VZLA 4KN8A 3W5DA 1DKMA 5K8LA 2A30A 3RC8A 2JKZA 4E22A 4RAWA 5HDBB 1XD2A 1IEWA 2GBIA 1YR9A 3HYCA 3N2NA 3LGSA 1T4DA 5FB3A 5HBRA 3OLYA 2I8LA 4JC4A 1J07A 5K6RA 5IMSA 4JQOA 4MHSA 4M76B 1U0LA 4X95A 1E59A 5CT9A 3ET5A 3SX4A 1G2QA 621PA 1GFSA 1IPHA 2C2HA 1XF1A 4QJBA 1XZBA 3IAHA 2E4ZA 3M9LA 4RJTA 4V39A 2KM1A 2DU8A 2PCJA 4D56A 3IBGA 1E69A 3ESAA 4G5FA 3K0AA 4O2RA 1JMYA 2QYHA 1I24A 1R3UA 2XE6A 1JS1X 4PIPA 3WA7A 2WA1A 2QL7A 2O0MA 4LJ7A 3OZIA 1Q2XA 3LC2O 2BF7A 4EABA 3D3NA 4ER5A 2GSDA 4XOIA 4B2PA 5H82A 2H59A 1ZHHA 4EJSA 3KUUA 5IAJA 4NAUA 4NMWA 4R01A 1ZSYA 2YH2A 3UKDA 2ATVA 2BFZB 2Y8EA 2FQXA 4DQKA 1VI6A 4UPEA 5HF5A 5JPIA 5LMCA 5BVHA 4YACA 5AKKA 2W2KB 3EB9A 5JT1A 1M72A 2QUHA 4KW7A 4X8HA 3BJRA 3K35A 4KHZA 1UQTA 2AC2A 4HAIA 1RC8A 4XWWA 4BVAA 2CMKA 1R6DA 1TFUA 2QR3A 2F9FA 1NUTA 3RS7A 1XZMA 3PC8A 4MWSA 1WXQA 3EBOA 3HCWA 3ZIAA 2FH5B 4IZIA 4GYQA 1HE8B 3G13A 4QUHA 4RELA 5TT0A 3VV2A 4D9BA 5GGXA 3TLJA 1PS0A 1R4NA 3LV8A 3OFNA 3VR3D 4V0HA 4HP8A 5KYUB 3JD3A 1NQOA 2ZJZA 3KLOA 5T6BA 1ST3A 2JGIA 4PSVA 3J81k 2BM9A 4CLRB 4CZ2A 1PIWA 1BMFA 3FNHA 3HC7A 3KQQA 4Q4HA 1QPBA 4G3XA 4MCAA 2I8AA 1SG9A 2QTBA 3IMEA 2EOAA 2JC3A 4KDCA 2EJUA 1UT8A 1PQ4A 5FOWA 1I2CA 1IIRA 2XMPA 2X6TA 3ORRA 3AILA 4KE8A 4X85A 4NH0A 5CDTA 2FSGA 2GAJA 1UPBA 3A6LA 3ZV3A 5JFGA 4GKKB 3A3KA 5I9BA 3SFPA 4LSGA 2GRUA 4JOQA 1ADJA 4ZMSA 1X8IA 3B70A 2ZSEA 4OMUA 4NFHA 5D3KA 2NVBA 1SU7A 2FPLA 4UAGA 3U7QB 1KZ6A 3C5WP 1V7QA 5IJ9B 1PR4A 2DQ4A 3RUIA 2HU2A 1MB4A 1H5UA 3NBZC 1VG0B 2DBVO 3PNOA 1YE3A 3EHDA 2XNSA 3KOYA 3TRFA 1RWWA 3DO6A 2G8LA 4YP7A 1GSIA 2UZIR 1NZFA 1E7WA 1Z0JA 4CU2A 5BR7A 1KKLA 1T34A 3EXEB 4RCZA 1CUSA 3AO0B 3Q98A 5LA6B 1ZIDA 1T6XA 2OZPA 5CEEA 3BWCA 4QSMA 2GAFA 2J9GA 2WSIA 3IJRA 4HUTA 1JAHA 1U7OA 1VHTA 2XTZA 2J0UB 5DSTA 2FMTA 4RMJA 4MMYB 2Z2XA 2AWOA 2YZGA 4UNRA 1W88A 1NRIA 3N2GA 1JAYA 2MINA</