1YCFA

Oxidized (di-ferric) fpra from moorella thermoacetica
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
398
structure length
398
Chain Sequence
SQPVAITDGIYWVGAVDWNIRYFHGPAFSTHRGTTYNAYLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDSLKAHYSHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMDEAAKYYANILMPFSNLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKAKAVIAYDTMWLSTEKMAHALMDGLVAGGCEVKLFKLSVSDRNDVIKEILDARAVLVGSPTINNDILPVVSPLLDDLVGLRPKNKVGLAFGAYGWGGGAQKILEERLKAAKIELIAEPGPTVQWVPRGEDLQRCYELGRKIAARIAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystal structures of Moorella thermoacetica FprA. Novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase.
pubmed doi rcsb
source organism Moorella thermoacetica
molecule tags Oxidoreductase
molecule keywords Nitric oxide reductase
total genus 132
structure length 398
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec 1.-.-.-:
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ycfA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1ycfA01
6NULA 2VW8A 2BFLA 3X2ZA 3NHRA 4TYTA 2M6RA 2QR2A 5EV8A 1ZWKA 1X8GA 5EVKA 2D5IA 4GQIA 2UYXA 4C76A 4PVTA 2WYMA 4D1TA 1T0IA 1DXKA 5HH5A 3VPEA 1T5BA 1TIKA 4RAWA 3K1YA 1RLIA 1YCGA 1TLLA 4Y9UA 4UWSB 3FW1A 4ZVMA 5NLLA 2BMIA 5B15A 3QE2A 4HKYA 5ACQA 4Z5ZA 5EAIA 1XYVA 4ZNBA 4D1UA 1X77A 2GKLA 5A87A 3IE2A 4AX1B 2HNAA 1CZHA 1VJNA 3NFRA 2FM6A 2I7VA 4LA4A 4ZO2A 3AJ3A 1I1OA 3ZR9A 5AYAA 4F6ZA 1XTOA 2FU6A 1QR2A 5LM6A 1H69A 4S24A 2FOXA 4GCWA 1AZLA 5TGZA 3K20A 1V4BA 5FX2A 1NNI1 2FZ5A 2WYMC 1F4PA 4C09A 4YAWA 2Z9CA 2H6AA 4H0DA 1DDKA 4LTMA 2GFKA 3EDOA 5AEBA 3T3NA 3GAMA 4Y9RA 1C7FA 2OYSA 2YCBA 3SFPA 3ESXA 5HIQA 2HNBA 4AWZA 1KBQA 2P18A 4Z7RA 3IDZA 4UAMA 3P0RA 5FQAA 5HH6A 4ESEA 3NHSA 1ZX1A 3U7RA 5FA6A 3DHAA 1FTGA 1AG9A 3O73A 4N65A 2W5UA 4BMPB 2BG6A 2FAXA 2Q62A 1DX9A 2GFJA 4C1HA 4UBQA 2Z9DA 3SW3A 2BG8A 1BU5A 1ZNBA 2MOKA 2M5CA 3NHYA 2XODA 3OWHA 1AKWA 5LJIA 1Y44A 1B1CA 5LCFA 3ADRA 5FQBA 5A5ZA 1FLDA 5B3KA 2OHIA 4HS4A 3RPCA 4EXSA 4J5HA 4KEPA 1RCFA 4J5FA 3G1PA 1VGNA 5JROA 4C1CA 3B6MA 1SMLA 2Y87A 1BC2A 1FLNA 3BV6A 5IQKA 3IE1A 1KO3A 3SVLA 5AXOA 3KNSA 2X2PA 1QBGA 2NYPA 1YKGA 4XUKA 1WUPA 1BMCA 2P97A 1E5DA 4C1GA 4PVOA 5LE1A 4QOGA 3QFCA 3OJXA 2M6SA 2Y8AA 4TZBA 5ACWA 4O98A 4LTNA 2OHHA 2QX4A 2BGAA 1J8QA 2MTBA 4QOEA 2QDSA 4XWWA 3W78A 2XF4A 5B1UA 3TE7A 3IEKA 2FZVA 1JA1A 3ESYA 2WHGA 5FQCA 3GFQA 4HEQA 3RKKA 1X8IA 4DILA 1YCHA 1M2XA 4F8YA 2E7YA 5ACTA 2Q9UA 2V5VA 3SBLA 4C0XA 2QEDA 3FJOA 5HIPA 4OXXA 1JT1A 1FLVA 2GCUA 3BK2A 1WUOA 3JXPA 2Q0JA 2Z9BA 3QH8A 4JO0A 5EVBA 1AHNA 1OFVA 4EYBA 1JJTA 1SG0A 2FU7A 3A4YA 3I14A 2QX9A 4TZFA 4WD6A 5EA2A 2FK6A 3TP9A 4HL1A 1C7EA 1AKVA 1FX1A 2WC1A 4B87A 4C1EA 4AD9A 3N39C 3F6SA 4RL2A 5K4NA 5LSCA 3BC2A 4RAMA 5EHTA 1A8TA 1AKRA 4YALA 2BR6A 3TEMA 4EFZA 4DIKA 3IEMA 2FU8A 4YAOA 1DXQA 2MT9A 3IELA 1ZKPA 2BG2A 4ICIA 2WYLA 3W7AA 3NHFA 4N9QA 4ZVLA 2BC2A 3OX3A 2NXAA 4FSBA 4NQ4A 4ZO3A 5LCHA 4RM5A 2DKFA 4YSKA 3ES9A 1XYYA 5LBTA 2ZKIA 3TZBA 3X2XA 2YNVA 3F2VA 1DD6A 5A0VA 5K0WA 1WRAA 2AIOA 3SRXA 3T9MA 3VQZA 4LE6A 4CF6A 3I13A 2YNVB 4GR9A 3L6NA 4AX0B 1QRDA 3RPEA 4FX2A 2BN4A 3ZQ4A 1ZWLA 2A5LA 2Q42A 3JSXA 3FNIA 5LVAA 4Z6XA 3Q6VA 5FUQA 1KO2A 4Z5YA 3L9XA 3LT5A 2WRSA 3T3OA 1X8HA 1YOBA 2V5UA 3I15A 2R96A 5ACSA 1CZOA 4U7GA 2BTNA 5NULA 2BFZA 5A4KA 3X2YA 2KLBA 1RLJA 4PTZA 2QINA 5EWAA 3ZNBA 4NLLA 2BFKA 2QX6A 3PY5A 3ZHOA 3PY6A 4HL2A 5ULLA 2R2DA 5HIOA 4UWRB 1KBOA 3KNRA 3ZWFA 1D4AA 2FDXA 5F12A 5ACPA 1VMEA 1BVTA 3NHJA 2FCRA 2B3DA 3H3EA 4TYFA 4CETA 4C1FA 4F6HA 4U7HA 1MQOA 4Y7CA 4UA4A 2X2OA 4QOIA 2Q0IA 3ESZA 2F1OA 3IOGA 2ARKA 3B6KA 2QDTA 4NQ6A 1QH5A 4V0HA 4EYFA 2ZZIA 3R6WA 5DPXA 3P2UA 3MD7A 1WW1A 2RG1A 3NHUA 1YCFA 2I7TA 5AHOA 3L9WA 1YRHA 1YDGA 4ZVNA 4FEKA 5KILA 4QOFA 4PU0A 1XT6A 1AKTA 3B6JA 3NHWA 1JJEA 4H2DA 1JA0A 1CZRA 3RKJA 3GFSA 1XI2A 3IE0A 4FGLA 1BVYF 4LAFA 4C0WA 2BZSA 3OWXA 1WSBA 4BP0A 4YAUA 3UXHA 3R2UA 4CHLA 2QMZA 2ZWRA 3N3BC 3O2NA 3DHCA 3X30A 3PG4A 2XR1A 4YAFA 4U7FA 2BFZB 2FHXB 4U4LA 5LCAA 2BPOA 3FAIA 2GSWA 2CBNA 3OVMA 1HLKA 5AHRA 3EYWA 4XWTA 5EV6A 5K4KA 3NHPA 3DHBA 2ZO4A 5B3RA 4FGJA 1KR3A 3FVWA 4R81A 2QWXA 2BG7A 3QFRA 2P1EA 2N1MA 2MWMA 4FGKA 4GYQA 2I7XA 4N82A 3WXCA 2XOEA 4EYLA 3BK1A 1J9GA 2BG8B 2HB9A 2V9CA 4NQ5A 4XDHA 1H66A 2A7MA 4FR7A 2DOOA 1GG5A 3I11A 2QJSA 5EVDA 5KIKA 5A0TA 5F51A 4QOJA 1WSWA 4C14A 2KQUA 3KLBA 5ACUA 5BUCA 2YNWA 3HLYA 3OX2A 3I0VA 3S0ZA 4YSBA 1FVXA 3GFRA 3HA2A 4NULA 4Z60A 1FUEA 4D1WA 1K07A 3SD9A 4NQ2A 1L9YA 2YNUA 3S2YA 4D1VA 5LMCA 5HISA 5EW0A 4YQEA 1SQSA 3OX1A 5ACXA 3F6RA 1J9ZA 2QX8A 3HR4A 3NHKA 3G5MA 2HPVA 3AF6A 3N3AC 4BMOB 3FCZA 3OJWA 5ACRA 5LS3A 5LLDA 4M0CA 5K4MA 4DY4A 3B6IA 4AWYB 1D03A 2YZ3A 5HH4A 3W77A 4RL0A 3DH8A 3NLLA 4Z67A 1A7TA 4H6PA 1P9EA 1CZLA 2P4ZA 2YNTB 4PTYA 2FLVA 5AXRA 3KEGA 3AF5A 2Y8BA 4C1DA 2AMJA 3FX2A 2ZNBA 3F90A 2Z98A 3F9OA 3U7IA 1FLAA 3IOFA 1J9EA 3NHLA 4LTDA 2FHXA 3UXEA 2QMYA 3SPUA 2GMNA 5B3LA 5ACVA 1CZNA 4UWOB 4GYUA 4J8PA 4ZVKA 3KAPA 3D7NA 2NZEA 1D04A 1OBVA 1RTTA 4TZEA 4UWPB 5F4BA 1AKQA 3LCMA 2R97A 4TZ9A 1QH3A 2BMVA 4QODA 2M5DA 5EH9A 1QHEA 1AKUA 4BZ3A 4RBSA 4QOHA 4KEQA 4YSLA 5LBUA 2YNTA 4EY2A 4P62A 3W79A 1CZKA 2NZFA 4GI5A 1ZTCA 4XDGA 2BIBA 2FX2A 1CZUA 4EXYA 3KAQA 2OHJA 1DXOA 1AMOA 2FVXA 2BF4A 3KL7A 4ZEJA 4D02A 1XM8A 2FU9A 5EMNA 3ESHA 2AZ4A 1OBOA 3LVZA 5LJLA
chains in the Genus database with same CATH superfamily
2D00A 4DJEC 3CPSA 4IZOA 2H2HA 3H3EA 2PQ0A 5EHQA 1L5GB 3DF7A 3G2PA 1P2SA 3IH5A 4RJJA 3WHLA 1KZGB 4HN9A 2ZUTA 3FYUC 5IUJC 2QDKA 1RPJA 4Z5XA 3KQUA 3QVSA 1RYZA 5LJLA 2B34A 3D2AA 3E15A 3NATA 1YC2A 3D3NA 5FQOA 2PBFA 2G5CA 4OXYA 3W5UA 1UBEA 2PL3A 5GAJA 4PC3A 5JATA 1MIOA 4RUKA 4OTZA 3GJ7A 4HLNA 1YZNA 4OGKA 2W71A 4KBGA 3OTIA 1RJGA 4F5YA 4QOSA 3R4CA 3Q72A 5AOAA 2PMWB 5LUAA 3DV9A 1D3AA 2BGNA 2W6IA 3K1YA 3KZNA 5LQSA 3OZAA 4F6LA 2P6RA 1A8SA 3C2QA 2IBSA 2WNIA 2VIIA 4MRVA 4QULA 4C4ZA 2YVAA 3ADDA 2WG0A 4DJDC 4OH7A 1N5RA 3WDSA 1GGJA 1IWPB 4JSRA 5CA0A 3ZVKA 1G98A 2O07A 2UZ0A 3REQB 4DLZA 3QYAA 4HGZA 4R8RA 2WF9A 4M38A 3I64A 1EINA 4CEJA 2HNAA 3OM1A 1E1YA 4QXQA 5EXTA 1TYAE 2GM9A 3WMEA 4B35A 4ZQGA 3H04A 4GQAA 4M53A 2C4VA 2FM6A 3H8JA 2KS6A 5IM5A 4FMPA 4S1VA 3VU1A 1QMPA 2EZ4A 4QBKA 2I87A 3EIXA 1E0AA 1OILA 1T3GA 1UK9A 1H69A 2VYQA 5DTEA 4DA8A 1XN1A 1Q3TA 4L8WB 2WEKA 4G84A 1SUSA 4WZBB 1I32A 1MRSA 2VJDA 4F2PA 1RBYA 5FBLB 2ZWPA 3ESDA 1QH8B 4ZT4A 2Q9BA 2Z9CA 3MPUA 4F9GA 1JYFA 3EFEA 4OO3A 2BVNA 4WRRA 4YRZA 3USES 4QZVA 4IDBA 3GLFA 4DYHA 3IYLW 3FOAA 1E9AA 1Q57A 2BELA 2G9ZA 3BGDA 4NIMA 3U7QA 1LS6A 2XWJI 4RKYA 5IZ4A 1CUIA 1RXWA 2C2BA 2HMYB 4D6YA 5J4LA 1PLKA 4N8SA 5B4UA 2J08A 2H0RA 4TLEA 3PPXA 2EBUA 3ZOKA 3R7BA 4ESEA 2OV1A 2CG3A 2F59A 4BS9A 5JZSA 1GDDA 2J9GA 5F9HA 4NAUA 3ZE7A 3E81A 2VHJA 2YWRA 3BWVA 3TQOA 2AVNA 1F0NA 4RHTA 4ESVA 4Q7EA 3FZNA 3JD3A 3HGMA 3OY2A 1DZ3A 2BG6A 4BXOB 1CVRA 1GG9A 3HLTA 1H5QA 2PRIA 5C8YA 1VPDA 1LQ2A 3CXRA 1XZBA 3U5ZB 3IEPA 4KQ6A 4F2GA 1V6AA 1OY1A 2ECOA 1EVIA 3ROFA 2V7EA 3LU1A 2X8JA 5TPZD 3ZBPA 1K1EA 1UDAA 4HKTA 2JLUA 1G20A 2PUDA 3IBTA 4A8JB 4IMPA 4HG2A 1TM5E 3N0TA 4FFBB 5A5ZA 3B85A 5B3KA 1BHQ1 1NQWA 1KMQA 2XCLA 2HFJA 1T2FA 3CUWA 3OZDA 3SDZA 3MYYA 4GYYA 4K26A 4ZQEA 4J5HA 2ZR0A 5CLIA 5I7AA 4JJZA 1DQNA 2NQ2C 4P4SB 4IAOA 2FEOA 1VBMA 4EA6A 3G1PA 1WCWA 3H9UA 3KSUA 3D4NA 4MWOA 2W6PA 4BIIA 5KSYA 3IQHX 4TQGA 2G8LA 3RVRA 4MK4A 2Z04A 4M36A 1JAHA 4URHA 1NJ8A 4M4SA 2K6GA 3UJ7A 1X0XA 2Y87A 5GTDA 2ZRGA 4PX5A 3CW2A 3LUDA 4AP6A 3E7XA 1HE4A 1KYQA 3V1UA 4OG2A 3S70A 2P97A 5BN3B 4Z86A 1MFPA 1D2HA 3RE1A 5C3MA 3HWWA 2AWNA 3OAAA 4R2MA 4TZBA 3UEOA 1M72A 3MWDB 2D3WA 4RFVA 3DZBA 5IABA 4B8YA 4R3WA 2PMFA 1U90A 2VYFA 2D5CA 4B74A 4B7AA 3VA7A 2AK3A 1NLMA 4XASA 4L50A 2QNIA 4R9RA 1TQ8A 2GASA 4LHSA 1T43A 3JQ7A 4PGFA 3U1VA 1N78A 3PJDA 4LZLA 2C31A 2R7MA 3VKFA 5CYPA 2H16A 2FZVA 3NBKA 4JC4A 2BFDB 4O4LF 3IUNA 3DE5X 5BXYA 4P5DA 4QQFA 3S81A 4OXKA 3S5JA 2I4MA 3MYRA 3R3HA 4X45A 3SJBA 2ZJ5A 2ZIWB 3U19A 2AW3A 2GMWA 2FMIA 1QZUA 2WVHA 4CXMA 2BHSA 2IYPA 4D3YA 4XI9A 1GITA 3R8XA 4FFLA 2B4YA 4WNYA 1Z35A 3LHDA 1GIAA 3ANXA 3QWIA 3UK7A 3LCJA 3BA6A 3SQXA 2O0LA 2YKGA 1DO0A 2HC9A 2WE8A 3WNCA 2EKQA 1RACA 1WW8A 3LECA 4MV9A 3BK2A 4I66A 4N48A 1MP0A 3ETDA 3IESA 3TEFA 4EKGA 1Q1ZA 3IAAA 1VJTA 4I8DA 5GZ6A 4LRXA 1TKBA 3H18A 1OC2A 3L5OA 5JDCC 3DYVA 4QYIB 4Z2YA 1NKTA 3HR7A 2I3GA 3PQ3A 2V7TA 2Y1GA 5J59A 3Q1LA 3SU8A 2QQEA 4PSKA 4WZAB 5LP1A 1ARZA 2Y2UA 3M6XA 5LDGA 3CX8A 4MICA 1T6BY 3AF1A 2G9UA 2P2LA 3LX6A 4PNEA 4B3FX 1NOIA 1HYHA 3GIDA 3W04A 3WNQA 5F77A 1NFRA 2ZI6A 4M0KA 3WRYA 5C8YF 4QIHA 1AQNA 1YDHA 3E7DA 4AD8A 1W5EA 2UU9B 3KELA 3AZPA 3MUOA 1ESEA 2BMWA 3F6SA 4GIBA 3MQFA 4JLBA 3MWJA 4QGSA 5IULC 3UENA 1QIKA 3QVKA 5AOVA 1D2NA 2G1JA 1X80A 1U0SY 1JAXA 4ZCSA 3MHPA 1DDIA 2BKAA 5AQEA 1EHYA 5IKXA 1AD2A 2ZLBA 3ML1A 3U9TA 3KFLA 4CIVA 5JUWA 2W48A 3IEMA 2FU8A 2BTQB 1ZKPA 3TRKA 1KZHA 3DKPA 3H5WA 3NDRA 1C4XA 1J8FA 3W7AA 4EI9A 4ZYLA 1HZZA 3SQLA 3H5RA 4NQ4A 4I50F 3G7SA 4Z51A 3UBMA 3O75A 4G9BA 2W2KA 1ELOA 1S8OA 4P84A 4F3CA 2FPGB 4PPNA 4MRAA 4ZOQI 1QH0A 2A14A 4BJ3A 4GPD1 1NKSA 1UKYA 4PZZA 3BD7A 5CW2A 4D6PA 5KYXB 4XVUA 4G9GA 3X2XA 1R7RA 2G17A 3D3JA 4L76A 1LPAB 3V9AA 3VVBA 1RAGA 2C20A 4KLRA 4NQZA 2FOIA 4ERNA 2Z1MA 3T38A 3CO0S 2RB5A 1JJ7A 1SZPA 1W6RA 5CNMA 4PN3A 5C5IA 1N7HA 3P9PA 2BI8A 4PBTA 3VX3A 4R98A 1PWHA 1D2MA 2PD4A 2ZDGA 4IM7A 5F5NA 2FPIA 1KFJB 4HLCA 1VIDA 1PLJA 3B48A 2VP6A 4G5YA 3WSTA 1SG9A 4MI6A 1QVWA 4G26A 4UE6A 4TQ9A 3W0LB 2JGIA 5FTNA 3TAHA 4B3DA 2JC3A 1CNEA 1OVMA 2OPBA 2OUKA 2WSMA 2XE6A 3OEEA 4NABA 5KC8A 3KSAC 1OKKA 4L95C 4CDGA 4D9CA 1PEDA 4EO4A 1QHIA 2R4TA 2X13A 1NXQA 1FUUA 4GKBA 4E11A 1TAHA 2OVBA 3QV2A 2Y9PB 2C1ZA 2YFQA 4D0RA 1X8HA 3MM4A 5AI4A 1DBWA 4J1QA 1NUTA 4LG1A 3BL5A 1FFBA 4E33A 3AETA 4L1KA 4I08A 2EBWA 3BCUA 1QORA 3WI7A 2JFYA 2ZRBA 2DFVA 5JANA 1QK3A 2VAWA 2IW3A 3CV3A 3CX4A 1LSUA 1PR9A 3WB9A 4YRDA 3BS4A 4EY3A 4EIWA 2IQ5A 5IXYA 1ODSA 1E18A 1KEZA 3AIIA 3GOQA 3NM5A 1L4UA 4NFHA 4F21A 2ZE7A 3PPWA 2Q2NA 4ALNA 2O8FA 4NKRA 5HIAA 4ENUA 1WKVA 3SGLA 3JZDA 4BNTA 2VO1A 3ACDA 3ZU5A 1RRKA 4KRXA 2JD0A 3E5HA 3NOQA 4ZTBA 5HJ7A 5I7VA 1CEEA 5FLKA 2HMTA 1SQFA 2Y6VA 2MYNA 1Z4MA 3LT4A 4E4TA 5HM8A 1Y6GA 3ZI0A 1PJCA 3INGA 1ZVQA 2AMFA 4ER7A 3D3WB 1QPZA 3E9NA 3AINA 5IH7A 4RZXA 3P2JA 2YFKA 4RH3A 1FSZA 3MD7A 4Q66C 3TLAA 4RXUA 1BMTA 1OLUB 2N1BA 2P2CA 1MB0A 2JGKA 2M98A 1RJDA 3KT6A 4DV0B 2QYSA 3B3GA 2B37A 1K5DA 1QTNA 2FR8A 2G9NA 1T24A 4YYEA 2QRQA 5HOQA 4V0LA 3GU3A 3O9MA 3OE4A 2DY0A 2XV1A 3LY9A 4WFJA 1IMOA 3FWKA 3P0HA 3ZDZB 5JJBA 2C4UA 3HYRA 1B6SA 1CLUA 2M32A 3CWCA 3E18A 3U49A 3UPUA 2IHKA 3KL2A 2VK2A 2RHDA 3J81A 1P5JA 3AZQA 4N5HX 1A4XA 4BEJA 2HA0A 3MUNA 1YJCA 2JFVA 4P3NA 2J9XB 1UDXA 2DJ5A 1OXXK 1WKBA 4RTQA 1ULTA 1TVCA 2II6A 2XH8A 4ERXA 1ENZA 1L4BA 1L7RA 4KFUA 5LYJB 1EHCA 5CK5A 1T1SA 2WUVA 2Y27A 3R6LA 2AZTA 5A4DA 3JR7A 3QVMA 4NAHA 4X6YA 1KZ1A 3HFRA 3LQRA 5ICMA 4KO2S 1UEXC 4JLPA 2C77A 2KWIA 1BVHA 4L57A 2GSWA 4NFYA 2Q2QA 1E3DA 1XTBA 3B8EA 1DUSA 1RM5A 5C5EA 3ZH2A 3BHIA 4QXPA 2TMGA 1ZMXA 3GZNB 4XQ0A 2I4RA 3WMFA 3ZQJA 3LHKA 1E59A 4PQYA 3DEYX 4KK3A 3UGTA 2G82A 2RK3A 2V8BA 5AUQA 5CCBA 1MO5A 3GO4A 3V1KA 4J3NA 2I55A 4PLZA 3CZQA 2Q5IA 2QRHA 1B6TA 1ZGAA 4R81A 1FQOA 5FOTA 1Z7YA 4JLWA 4L8YA 3RLFA 2R8RA 2FHSA 4HNGA 4K6KA 1IOVA 2G63A 3EF3A 1SOAA 3EVFA 1NBIA 3TCKA 1IC6A 3RSHA 1EFTA 4AK9A 1HE5A 3RU9A 3K5PA 4UOQA 1KDRA 4DR1B 1YR8A 1RQRA 4X41A 5BSTA 1ZH6A 3GL9A 4IINA 3OIGA 3ROPA 4ZYXA 3PCRB 3VNSA 3PC2A 3Q0TA 5LQMA 4HAZA 8MHTA 4UUNA 2QM8A 2PG3A 3G79A 3LLUA 4HADA 2XUPA 2MINB 1I10A 4EHAA 3U0BA 2NZYA 1NF2A 2RHTA 3DONA 2EBHX 4OU5A 4TV9F 1FMJA 2WTUA 3F49S 3V7NA 1JLRA 1W4LA 1XTVA 4OYLA 1RCUA 1XVUA 4NULA 3UJAA 1N5IA 2L19A 5GONB 1NF3A 1JQAA 4MW4A 1U3FA 4WESB 2MJLA 3LZCA 1IM2A 4A1FA 2VEDA 3FAKA 4EX6A 5B5SA 1T4BA 4HFRA 1X6VA 4RVNA 2OD7A 1M2VA 5B1DA 4TYMA 4LX0A 3AI7A 1N0WA 2IF2A 3QLVC 5EJGA 1WDLA 3P9XA 2QX8A 2C92A 2EFJA 3NHKA 2RJ3A 2DE0X 2K2QB 2O2EA 4RIHA 1ZLYA 4YIKA 4RTJA 1JLHA 2VZ0A 2J67A 1ZVVA 4IICA 4QSHA 3UUFA 2JLSA 1FTNA 4XIFA 4LF6B 1Z16A 3KU4A 3ONDA 3PFCA 4P83A 4GSYA 4ZC1A 3MRTA 4FBMA 1Z33A 1NXWA 4KXQA 2GJ4A 5AH0A 3THYA 4HGPA 1ONPA 3GRYA 2XRFA 3OIDA 4WLNA 3WP0A 2YNTB 1IUOA 1L5HB 4DVJA 4OJMX 1BFDA 2R68A 4LYAA 1R0ZA 4EARA 5IKPA 1NVGA 3N1UA 2ZE6A 3IUEA 5FWXB 1SUFA 1OREA 1XTZA 2G6TA 3IOFA 3PDIA 5K2MA 1TQ6A 2QF7A 3WK5A 1HT0A 2GVNA 1EVZA 2I2CA 3HMKA 1WVGA 2Q3HA 3TNJA 4B1FA 3SMQA 1L4LA 2FF7A 4RY8A 4R1MA 5A4FS 1PAUA 3A6HA 2BFOA 2X9NA 1AUVA 1GY8A 2PCLA 4OCZA 5EIAA 2MSEB 1XRNA 5GM2A 2XRZA 4GYUA 1G8MA 3I61A 2GBLA 2PGXA 1C9KA 2R97A 3ZWVA 3ENWA 4JEIA 2OZVA 1Z3IX 2A1UB 2EZTA 2ZB7A 1V5IA 2ZUUA 3T3DA 3V7WA 4F6RB 3GT4A 4EEKA 3HBLA 1Y8QA 2C84A 4D44A 3NZEA 3P1JA 3HDHA 1GA4A 5IEBA 3KNZA 1CUCA 3BF7A 1QTIA 3ETHA 4U2GA 3R9IA 4CQJA 2ZBPA 2GPTA 4TXLA 1I3CA 4C0QC 4BXOA 3RU2A 1WU8A 3ED1A 1OASA 1C4OA 2XNDD 3AUAA 4GPZA 5AVJA 4XGRA 1KETA 2XUGA 3OUUA 3VYRB 3V4ZA 1MJHA 4P0TA 3L8YA 3E7FA 2UXDB 1C1HA 2EGUA 2FQYA 3BZBA 2QUZA 3OIVA 4B3CA 4B85A 4M2LA 5CLJA 2CSUA 3TW6A 5LOVB 1SXHA 4MWBA 1KY5A 4YPVA 1GKKA 4MIKA 3GJ5A 3PUWA 4MYSA 2ZXFA 3D8BA 4ZZ3A 3QFFA 3PQFA 2DSNA 4ZEJA 3GUYA 3SQOA 1YAJA 3WLKX 1FXUA 4QT4A 4B4VA 5KB3A 2I8AA 2O2SA 4QGFA 2XJ9A 5HFAA 3RVBA 5CCEA 1VQ1A 1K7CA 1Z7BA 4WK6A 3K94A 2IODA 4K8OA 3EZ7A 4HN4B 4KVFA 1NSFA 3I9OA 4YUZA 3K2IA 3GYGA 1D5WA 1FZQA 2OAP1 2BGMA 2W0SA 1YRAA 3FG9A 1SBYA 3GCWA 3R41A 4UCQA 3B2EA 3TZKA 5DHPA 4EEXA 4ESOA 1JEYA 4AJKA 1H2FA 2IYWA 3F78A 4ABTA 3OZXA 1Z34A 3OSUA 4DQKA 1X8GA 3Q7IA 4JD5A 4C5BA 2HAEA 2QRMA 3E3OA 1JE1A 4FXPA 5KTNA 2OGUA 4ZOLF 4YUWA 1GV1A 3HWX1 4KE7A 4LBVA 1OZ0A 1VJCA 3EX7C 1JJVA 1NRXA 4GI2A 4DIEA 2GH1A 4URXR 1IN7A 2CC2A 2Z5VA 3H1AA 3W6NA 4AXBA 2H2IA 4RAWA 1UCFA 1PS8A 5HKOA 1FVFA 2NUPA 2IS2A 1OX6A 2X8JB 3EA0A 3GMIA 3RVJA 2BWJA 1PNOA 3FPJA 2YOGA 4FCCA 5KYXA 3U5TA 1HE3A 1NURA 2OP1A 1PQUA 2MCFA 1SFRA 4NPAA 3F4LA 2NZ2A 1JZQA 3F5FA 1J25A 2JEZA 5ENVA 2ZSAA 1JPJA 2J31A 3QVTA 4DB4A 1KMHB 1YXMA 4MO2A 2I99A 5ALFA 5L8VA 3U6KA 1HSZA 1O4WA 2YASA 3KSDO 3NFRA 2A33A 4RABA 3EA5A 1UZUA 2I7VA 3ONNA 3KT8A 1KPGA 3K0SA 5E2IA 1I2BA 3LOQA 4F6ZA 2RHLA 4O4IB 1T4GA 4I5IA 4EO7A 4O0LA 2XYVA 2AKYA 3FM9A 4X62B 3ETLA 3S0JA 1JTFA 2PXAA 3O74A 4XW2A 4D25A 5DSXA 3HB5X 4L51A 3MIIA 4C09A 3DQQA 3LNTA 4LWOA 4M8NE 1EVLA 2PMCA 1IN4A 4DLKA 5CFMA 5JO9A 2WJPA 3W6OA 3VSDA 2WUDA 3P0JA 1ZR2A 3KSZO 3WICA 1TYEB 1Q44A 2HADA 2C8JA 2FYTA 2GRJA 2BBWA 4QTXA 5BWMA 4GVPA 1D1PA 1M2NA 1P7YA 4HDKB 3C3JA 3QBDA 5BPFA 3ZCSA 2GPYA 2QLLA 5DOVA 3UAVA 2JKYA 5DHSA 5LKAA 4LFAB 2G6BA 1CF9A 2ZROA 3AJ8A 2HK8A 1YQXA 5F7JA 4AZTA 3GCZA 5DU2A 5HZGA 2CB0A 3HN6A 1JZSA 1GSAA 2GEDA 4Q1CA 1O2DA 1NJFA 4OOFA 2Y0EA 2I3ZA 3HK2A 1WHTB 4OVKA 3SSOA 1C7IA 1C4WA 4Z9AA 5KS2A 3C48A 2V3VA 1JE0A 3OWHA 2UYHA 1WS6A 2Z5GA 1DEOA 1MJFA 1G6KA 3F6EX 1QKIA 4ZVVA 3MWYW 3CVXA 4BMDA 4J90A 1A9TA 2J59A 3MS4A 4ND6A 4ES6A 3AR4A 4O1IA 1NFFA 1Z07A 4ZRMA 1TXGA 5LYJA 1G8GA 2JFHA 5FADA 2NQ8A 2A5DA 3DWEX 3DFIA 4GLFA 5BNIA 3EQ7A 4HDKA 4TMYA 3HA7A 2PH7A 4M8SA 1F8GA 1L7VC 3HU2A 1HT1E 2NNLD 3IKLA 5AMXA 2IS4A 4Z1MD 1QYVA 3HKDB 5BQPA 1CY4A 3RADC 3LT0A 5CJJA 4DCCA 1ODIA 1SXGA 5EMMA 3VZSA 3KSBC 2WMDA 3C6ZA 4KIGA 1FLNA 1JJIA 1SCJA 2X7JA 4RVUA 2EKLA 1SKQA 1OTHA 5AXOA 2HJ9A 2NUAB 1QBGA 3WLJA 3KU1A 2JGAA 3PDWA 4NZNA 4UMDA 4DLVA 1WBDA 3LLSA 4S1OA 5JNWA 3D4BA 3OO1A 4HNUA 1E2BA 2VHUA 2DR2A 4O25A 2DLDA 5B6PA 3I4FA 3TBFA 3ZWNA 1TU3A 4NMMA 2O2YA 2QM0A 4TVBA 1F3LA 4WUTA 4X8LA 5JI3E 1ZUIA 4MVJF 4MVJM 3S2EA 3KT0A 4AG6A 2GD1O 2R7LA 621PA 3KJZA 4ALLA 2MTBA 4PXSA 1O89A 3QUSA 2O2IA 4YT4A 1T5LA 3C3BA 3D6TB 1U2RA 4CI0B 2XF4A 1E5VA 1U7OA 2NO0A 2W90A 2FW0A 2J0SA 1WAMA 1U8EA 1XZDA 3QELA 3ZGYA 2D59A 4GM4A 1VA5A 1YB2A 1LTHR 5SZIA 4IEIA 2Y4OA 1UBRS 1SURA 4BWGA 4UU7A 4W5QA 3EMBA 2GHRA 3PKZA 7MDHA 5F33A 1F2TA 2CLFB 5E7MA 2OGSA 1L5FA 4O4JB 1W75A 2C5SA 4WKCA 2DFPA 4RNCA 4BWFB 2VDOB 4WKPA 3A1TA 4AMZA 1G7TA 4C6TB 3I53A 3VNAA 1ZO8A 3FRJA 3K2BA 2DZDA 1TD1A 1NOJA 3DEZA 1N2XA 2NV6A 2NZ8A 1P7WA 4YBZA 3VAYA 4A0QA 2PZ8A 2GCUA 1QXSA 1VB5A 1RBZA 4JX8A 5I8ZA 2M6LA 3WBJA 4QARA 4TLCA 1DB3A 3OT1A 4WCVA 3HC7A 4FK8A 1BXRB 1LC0A 5KYUA 1M2FA 4RQUA 4O5AA 1ZD5A 5E3JA 1RIFA 2XT6A 3SZLA 1THGA 5KJ6A 1NAIA 1RKVA 3ICCA 4Q4JB 3MZ0A 1Q7RA 5K4GA 1AHHA 1MW8X 3HU3A 3HWSA 3EVZA 3G2NA 5DBHX 4QUKA 2XUIA 3DS8A 1EFAA 3RYIA 1C0PA 2DFLA 3A25A 3AZOA 4B6RA 4EL0A 4JBGA 5TQVA 4F3RA 2MIIA 4K9PA 4R84A 1T4CA 1GLNA 4KGDA 4OL0A 1KDYA 1X92A 2HCBA 2WMOB 3QTBA 3BOSA 2OECA 1ZU5A 2BFNA 4FYVA 5I4CA 3H8SA 4O4JA 5BP7A 3B9PA 3MINB 2FWRA 1L7BA 5CDFE 4WCFA 1Z75A 4Q9KA 1PFYA 3KJQA 4HV4A 4DOMA 1GADO 4II7A 2Y99A 2JB9A 5CH3A 1DKMA 3FNRA 1DBVO 1QHNA 3B82A 5JCJA 5CT8A 1YR6A 4J76A 2NU9B 5C4IA 1Z5NA 1Z2EA 4YN3A 5LXTB 2JZCA 4JC0A 4DA0A 2AYYA 4G56A 3SIRA 2C3UA 3QPVA 4RS4A 1C1DA 1FC0A 1EJ0A 3PLNA 5C1PA 2YNVA 3BD8A 2G0AA 5DM4A 4MITA 3L6CA 3TVYA 3UMBA 3OOWA 3ZW7A 3OTOB 1S01A 4G81A 2IEIA 1CQXA 1Y6RA 2ZUSA 4JVOA 4KQKA 3R9WA 4JSYA 1P1BA 2BH2A 3HRHA 3NWPA 3HGTA 4P08A 2R8ZA 2VJQA 4IDAA 2YOHA 1KAEA 2IZOA 1ZSYA 1B1AA 3DJFA 5DKFA 5TPZA 4UNRA 2BN4A 3TJZA 3CNHA 5A4AA 3AIOA 1C3JA 5BR7A 5BW8A 3JSXA 4JHXA 4YRAA 5HILA 4CQMD 3V1NA 3WGLA 5A5GA 4HDSB 1MOZA 4AS2A 4GC9A 3L49A 3ITNA 4QM6A 5K1ZA 4ZAFA 1KS9A 2R96A 2GRUA 3HA5A 5EJAA 4CNQA 4ZPJA 1WV1A 2R6R1 3TSCA 1R4MB 1U8UA 1QUFA 2WW8A 4R1NA 2PSJA 3ESBA 3WKCA 3GBSA 4I1YA 3SEAA 5F2EA 4BJ1A 1I5RA 1CBUA 4Z49A 2BFZA 4LXGA 2AJCA 1R0LA 1KJIA 2RHBA 3D9QX 4CRWB 5JSYA 1RWOA 4MQ6A 2IF0A 3CF2A 3CO5A 1N2ZA 2H1OA 5IT0A 3I6IA 4C03A 1DJQA 2ZSJA 2FMKA 3RC9A 3HZOA 4OUDB 1VDMA 5F12A 4GOXA 3WDMA 1A1VA 3KR0A 4AC9A 4MW9A 3ZV6A 2GLXA 1QYDA 3ZE6A 1YC5A 2HSGA 2VZEA 2WAAA 4TYFA 4XFKA 4YHBA 4MVJI 5HE8A 4YASA 2I9KA 2CEKA 1C81A 1RXSA 2C2KA 1SU7A 5CT4A 1B14A 1DQPA 1TPYA 5AJTA 2ALJA 3PXAA 5JNVA 2AFIA 3C7TA 3TUJC 1TC1A 1AS3A 4EYOA 4V0HA 1PZHA 1Q1GA 3BJZA 3K05A 4HTFA 3HFGA 4O3FA 4CODB 5JFGA 4NE9A 4EYFA 4MRNA 4MJ7A 4OHZA 3TQQA 4MIEA 4MMXB 3FTCA 2P62A 3QXJA 5J2TB 3A3KA 1HE2A 3FMVA 1NZFA 3R20A 3SLKA 5IF3A 4PU0A 3V1MA 3K72B 2CFCA 4GMKA 4EGCB 2AN3A 2CF5A 5BYBA 3PJRA 4RPGA 5BSRA 4HVAA 5KVAA 1KYIA 1MT0A 1PT7A 2WWGA 1VMIA 2ICAA 3QXGA 4HJRA 4OFXA 3LW8A 4UQPA 4KLAA 3TM4A 4DZRA 3Q6IA 4WXMA 5L9AA 1BW9A 4J0EA 5FF9A 2ZUEA 4EQ6A 4BMYA 3PX7A 5EUBA 3OT5A 3FMFA 4YMVA 4YJ3F 3GAFA 3RK4A 3RS2A 1X13A 2OORA 3VPSA 5BT8A 1D8AA 3LC0A 2Q7XA 2G1AA 1GR0A 3PUYA 5DTIA 1TM4E 2R1VB 5CPFA 4X1OA 4JLUA 5IVKA 1YRLA 3MCTA 3NV9A 4X92A 3T7SA 5AKYA 4QDUA 1OH5A 2O1XA 4YVFA 4WECA 1DCTA 1T9DA 3OP1A 4XIIA 2PEYA 3S2SA 3WXBA 5CD9A 2CHVA 4TYNA 3TGWA 3UC5A 1U8FO 3MCWA 4I0WB 3K0CA 4XQCA 5JSKA 7ADHA 4DNQA 3GVIA 3ZHCA 3WGHA 5L7TA 4GMDA 1NVTA 1JHAA 1VI5A 3OFSA 3REOA 5JXIA 5EV6A 3TW8B 3NHPA 3C87A 3Q7PA 4OL9A 1I01A 1NVDA 4PCAA 3J7TA 1NQ5A 2N47A 4KEAA 3D7MA 2GTIA 4BNXA 2O8CB 1ZK3A 2XUHA 4KI7A 3D4OA 3FVRA 1DIRA 3LXUX 3VU3A 3FUXA 1HQCA 4LN1A 3IIKA 2PSFA 1SXJA 4RYDA 5JCXA 1NOKA 2YRFA 3QX3A 1C80A 4QJIA 2C61A 5T3YA 2ZTUA 3WXCA 2PGJA 1UODA 1XXHA 1R3UA 1PFWA 4L73A 2D7DA 3IP6A 2IZ0A 2V9CA 1JKJA 4IHJA 1RABA 1A9QA 1YZQA 4HDMA 2WM2A 1DC6A 4L4XA 2B5VA 2CXTA 2EEPA 3ABRB 4QBFA 3DAGA 2IZ5A 3IVAA 4S35A 3T5BA 421PA 4L5YA 4DR6B 2NAPA 4XKJA 1W94A 4OQNA 5AUPB 2DOOA 2QJSA 1N0VC 2P9BA 5FDFA 1G2IA 1REQB 4GZ3A 4MZDA 4WKGA 1J22A 2GYYA 2QPTA 4JL6A 3AEUA 2EC5A 3GNTA 3JATA 2QD3A 2Q3MA 3M6VA 4M1SA 4CIXA 4KAAA 2VAMA 3M4JA 1F1JA 4QC2A 1R9NA 3V34A 3R5TA 3O1LA 4XX0B 2XADA 1N9GA 1A8UA 1QJCA 2YNWA 2FETA 3TZCA 1JG2A 4W1PA 4ISCA 4ZYWA 1E2NA 2BKXA 3GFRA 3H6KA 2F1IA 3R5SA 5JNSA 7GPBA 2NTJA 4CMEA 2NYVA 3DZIA 4X7BA 5JFTA 4EFKA 4C07A 1SVKA 1IJEA 1T1GA 3OIWA 2ZRNA 4NOJA 3J80A 3WV4A 3M2PA 5EQJB 3ZDXB 5F7ZA 3LKVA 4BU1A 3JQ6A 2FTKE 3KOMA 3ZYZA 4JA2A 1SR8A 4CEIB 1SHJA 3K96A 4UREA 3OX1A 4TWAA 1OD6A 4FCWA 1BG6A 1J9ZA 1CEQA 4L22A 2PYDA 1NI5A 2QL6A 1B15A 3EJ6A 3JQPA 1TZBA 3KKEA 4AZ3B 3M4ZA 3QMVA 1A9ZA 1IJBA 1W5BA 3STWA 2R6HA 4IIJB 4R8KA 4EYQA 3GYBA 3MILA 5C7YA 3FVTA 1LI5A 1P6XA 3EGXB 5DGTA 1HNWB 2IXBA 1Q11A 2UZ3A 1MV8A 2ZK7A 3DVAA 3HB9A 4H15A 2JI7A 4J07A 1P5FA 4A2QA 1Y80A 1XD2A 1DC8A 2QK4A 3JD0A 4IWNA 3HCBA 3SS9X 5A6SB 3FD8A 3ZIAA 1S02A 1WCYA 1C14A 1L7PA 4GP6A 4I1OA 4PZAA 4Y1EA 1GGEA 4MVXA 1OWLA 3E3LA 4YRLA 3MJSA 3NIGB 3UCEA 3HR8A 5ALPA 4F1WA 2WG2A 4GR4A 2MSKA 3U7IA 4ZT6A 5BUQA 3DHYA 5BMVA 3VO9A 2RK6A 1AGPA 1HKUA 1UPXA 5M04A 1D1QA 3NNNA 3RBXA 3V2HA 1YS2X 4K9KA 3A6ZA 2ZI4A 2BHRA 3SPUA 4G8CA 4HQ0A 3VI3B 5T8KA 1E1KA 2GKSA 2I2XB 1PG2A 3IQIX 1T6ZA 3BIFA 3OCUA 4J8PA 3WTCA 1P61B 4IRUB 4R2WA 5GY7A 1GKLA 3W90A 2Y1EA 4XWKA 1ZHHA 5E6RA 1EA5A 1KIAA 4GICA 5DCLA 5G3ZA 3HWRA 3X2SA 4L4SA 4D9JA 3O8DA 1Z5OA 1YQQA 1GCOA 2XQGA 4MS4B 4AN1A 2M5DA 1AKUA 3HHPA 4D3SA 3DPSA 3G2MA 2AMVA 5IHXA 1OKKD 3PLAE 4MS3A 2EFHB 3EJWA 4RTRA 3CKYA 2CNWD 1LK7A 2WTBA 5F2KA 5HMMA 5A6SA 1PYDA 1UMDB 1PHPA 2B8EA 2Q8NA 3HZRA 4FQ8A 4HEA1 4R69A 4FSXA 4YJKA 3Q98A 5D6NA 4R2HA 5DXAA 5IJXA 1JN0A 3QKIA 1YS7A 2L17A 3JZMA 2BIBA 1CZUA 3MA0A 1VIYA 2R751 4C04A 1JWBB 2VWQA 3BB1A 4OMUA 4JR1A 3RIHA 1ULSA 3UG6A 4HDQB 3PYLA 3GUCA 4HNTA 4L8VA 5CD1A 2GHQA 3TZLA 2MSCB 2N46A 4KU4A 1ECGA 3ORRA 3WRVA 2AN5A 4GG1A 4I1PA 1X87A 1YQDA 2QLTA 3RUHA 1EM8B 1R9MA 4YT2A 1SUDA 3LVZA 3NGMA 3KJHA 4PHCA 3UWPA 3DBHB 5CPBA 1R10A 2PAAA 3SLGA 4E94A 3OQIA 4K8RB 1Y8QB 3ROEA 4OHYA 3AHEA 2C54A 5EV8A 2IXFA 2EU8A 3MSXA 3OCCA 3M1AA 3C45A 1IY8A 3K70D 4Q12A 4DGQA 3GJZA 3AEQB 1J7JA 1NXTA 2FEAA 2JI4A 2Y3IA 3HXKA 1YK0A 2NU7B 3JQAB 4HTAA 5IJ0A 1ZN9A 1A71A 3AUXA 4PVTA 3BEDA 5FEUA 1NUAA 1ID1A 5JZOA 2GAJA 4O5OA 1M2EA 1SUEA 4CG2A 3CH7A 1T5SA 4M54A 3EPKA 3A9VA 4QRHA 1KTVA 1PX0A 3NYWA 4KREA 1QC5A 2FG5A 1SOMA 1NA5A 1PS0A 4JQSA 4L0MA 4ZVMA 2JJQA 2HWYA 2ZYDA 3T5DA 1IOWA 1WMAA 1IN5A 3T5TA 4R68A 4ND4A 3DTVA 4QECA 1EEXB 2VRWA 2NSHA 4RS3A 5EAIA 1YT5A 3MHTA 3K4HA 1SNYA 2AJDA 2CUTA 5BSKA 3EDCA 3BFJA 2BP7B 3ZWBA 1WP4A 2CVOA 4XCVA 3RJ5A 3VR5A 2BTOA 3HYNA 3DXFA 2W2MA 3K6RA 5EKXA 4ZO2A 4OLAA 3BWDD 5DT9A 4Z4QA 4IZIA 3FPBA 3QQ5A 4YAJA 4EHBA 4K2HA 3MTJA 2W37A 3ESAA 2VP2A 1O0CA 3D2BA 1W29A 4LRTB 4QTUB 1JSRA 1QGUA 4PVCA 4AF7A 1Y48E 1R0WA 5BQOA 4FQ5A 3ZX4A 3G8DA 2E82A 2XY4A 2IV2X 2I91A 2D5LA 3MT9A 1RRGA 3ZWPA 2B0CA 1Q3KA 4OSOA 4DUGD 1DUVG 2BMJA 3WVNA 2NU6A 5KHOC 3EZYA 4ZGBA 1X14A 2QTRA 3C8DA 3N7TA 1KK1A 4GOLD 5CP8A 4MKGA 5ADVA 1CXZA 2BH9A 4TOIA 3IP7A 2YWFA 2PZFA 4U39A 1C7FA 1ZK2A 2GXSA 3SYMA 4J0JA 1CB7A 3EWIA 1Y89A 4QE3A 5LQUA 2FSGA 3FIUA 4MA0A 1NZJA 3OMLA 4G37A 3SHWA 3O8CA 1U2ZA 1RZUA 3E70C 2SBTA 4UHCA 2JGMA 3W2GA 4BFTA 4G89A 5FA6A 5T6BA 3ZLUA 5C46F 4LOAA 4FI3F 1QYCA 1WXWA 3MF4A 4ND7A 5TR9A 4DABA 1U1GA 4S1PA 1Y7HA 1HM5A 5TJHA 4H1UA 5HRAA 3CGGA 2F3QA 3JS5A 2CUZA 1KI8A 2DBYA 4RJ2A 1K0FA 5BMVB 1V8PA 3FDXA 4GP7A 3KQMA 3SEQA 1ZU4A 1NNUA 4HYTA 2WF6A 4TKLA 1O97C 4KSCA 2JGDB 4AKEA 4YX9A 2IH4A 2J3HA 3G88A 3WNDA 4KWEA 4EGQA 5K0CA 2V7UA 1F12A 4FFSA 4P3XA 3ELUA 3DKRA 4QPCA 4D80A 3A6DA 1YF3A 3CBGA 1PGPA 4F8EA 5A4IS 1RM0A 1U8YA 3ZV4A 3DLBA 4RHUA 1ABEA 4RNDB 1MX3A 2Z3ZA 5KOYA 2Q5CA 2VJKA 4UBNA 4Y6SA 1XSEA 1FX0A 4KZKA 4YLEA 3RPCA 2CMDA 2FW8A 2WIGA 3AX6A 1VL2A 5EPOA 4E08A 2A58A 2ODAA 4HF7A 3ZWXA 2F00A 5A5DA 1PFKA 1TRHA 4ITUA 4DGSA 4LMRA 1M5TA 2HNKA 2R6DA 3EZLA 1XALA 2EHDA 4X1KB 3EH1A 3RAJA 5L53A 2HJHA 1FBNA 1AUOA 5HKLA 4FSDA 2QG4A 1V4VA 4G6ZA 4LQLA 3CEJA 4QA9A 1GGFA 1XRPA 1ZM2A 4UAVA 3EDRA 2F6RA 3DBIA 3N58A 1XMVA 1R8JA 4RTKA 3KNSA 2AI2A 1G9SA 1AE1A 4RQTA 4AWBA 4RK1A 2PX6A 2QYTA 4HUJA 5E3HA 4XUKA 3MERA 1SOUA 4Y8VA 1NP3A 4G25A 2IVZA 5CJPA 3MXTA 4ZJYA 4HHEA 3HVHA 5ITSA 3BMQA 1K98A 2EARA 2XUQA 5JAUA 5DNVA 1SA0A 5FPHA 3D6UA 3VDNB 4MV8A 2H29A 1GEGA 1QYRA 4BQQA 4MCJA 2FP4B 5JBQA 3JQAD 3RFUA 2ZR9A 1L4NA 3GDOA 3OKCA 4HVLA 1EFUA 4MR7A 3RRBA 3FROA 3Q3IA 2PPLA 4DLWA 3CWQA 2OQVA 1G55A 1GXSB 2ZIEA 1YRBA 2Y1CA 4I19A 4GPIB 3S1SA 1A5TA 3HKDA 2BC9A 5DV9A 4FHDA 4QJ3A 1VBNA 2RGXA 4MI9A 2GBLC 4PSUA 4A27A 1Q1EA 1Y0BA 4IIBA 1DCFA 1RJ9B 1NDUA 3IIMA 2C9BA 2WZQA 1X0VA 4YBRA 4QDJA 4JUDX 2CVPA 3EF0A 3FGNA 2IH5A 1Z25A 1BFUA 4Y2XA 4OXXA 5MF6A 4XRRA 3FNGA 4Y2PA 1OWPA 5A3SA 1B43A 2G08A 1N4DA 4CI9A 5PGMA 5K6AC 3JQCA 1ODTC 1XNJA 3GHHA 1Q77A 2RGBA 3SQDA 5BWCA 5MFPA 2Q6OA 4YRIA 1DPFA 4UHFA 1OFVA 2AEFA 3NQ41 3V4OA 1C0LA 2GEKA 2OSVA 4QUDA 1DKNA 1A3CA 5HTOA 3IAEA 1K4YA 4CEIA 4W63A 3QU5A 3I14A 4CL3A 2H11A 3AKEA 1JB1A 4IOLA 2CHFA 3QELB 4G1UC 1U3WA 4ZJPA 3NIDB 1RWQA 3HCRA 4YCDA 1NM5C 1Y9EA 4AM8A 4C1EA 2X19A 3DVSX 4G9EA 2WJIA 1KXJA 1DFGA 1OC4A 2CBGA 4LZOA 4RKWA 2CL7X 1JZTA 4BGUA 3ASYA 3WGYA 3WIBA 3JALB 3QJGA 3F5SA 1C7ZA 4D46A 3CU5A 5I7FA 4JELA 4CTNA 1UP6A 4QUAA 5FAXA 4GRDA 2BLLA 4DPLA 5HKKD 2ZB8A 1U5AA 3T3HA 1GDHA 2JVKA 3HNOA 3W6UA 1T10A 3F2IA 4E5YA 3K71B 3U13A 4ZVLA 3V97A 2BFFA 5F3DA 1ZJ6A 4GI3A 3DDZX 2QLNA 5KQSA 1BXRA 1NQVA 2QNRA 4L0DA 1NR7A 1T25A 1TCCA 3AB8A 5AVSA 1P77A 3QKTA 4NEHB 4RY9A 2WHRA 4RYLA 1IPHA 4W8OA 5AW3A 1P81A 5CMLA 4AUMA 2OFPA 5FA5A 1BYUA 2VYVA 3H5AA 3PQDA 4R8MA 1KI2A 3L05A 4LJRA 1B74A 2P78A 2AIOA 1E32A 3T9MA 3TX6A 4PLFA 4TVSA 1UJ2A 1T4CB 2H1HA 4N7JA 1JI0A 2C7GA 2VP9A 3F0TA 2GK6A 3CTPA 1OAAA 2FFRA 2WNHA 2ZEJA 6REQA 2QZ9A 4GX2A 1IL0A 3KJIA 4PAOA 5TGDA 3WNBA 16PKA 5EKSA 1KYVA 4HZGA 1EB9A 4KC0A 1L6RA 3L0OA 1JHXA 2F1RA 1H85A 2NN3C 2JCYA 4FGZA 1QCZA 1YKSA 3ONFA 1P6QA 4KLCA 5EWJB 4CM3A 1OAOA 3OIUA 1OMOA 1I0LA 7REQB 2W0MA 4QQ8A 1GAWA 1U9JA 2J85A 2UDPA 5K6RA 1LLQA 1ZKMA 3GX1A 5I7SA 5B30A 3JTMA 2OCPA 2ZWMA 2WUGA 4IJ6A 4V0ME 1KR2A 1E9VA 4RANA 1G60A 1I5OA 2VNJA 3H5OA 3I37X 3LQYA 4IWYA 3TE6A 3G89A 2CBNA 4V0OA 3BGOS 4KDRA 1BVTA 5HCUA 3A1UA 4R01A 5IAKA 1DIHA 1Y9ZA 4YT5A 2I1QA 4HDSA 4UD2A 5FB3A 3GZ4A 4I1VA 1MQOA 3NHBA 5ALGA 4OIFA 3W9BA 2B4QA 4IGFA 5KWEA 3BSFA 4AUKA 3R76A 4XGQA 5JJIA 2IDMA 4FYIA 3UZUA 1CX9B 1OTXA 2P1ZA 3DDUA 1BKSB 1NSTA 2A9PA 5BNZA 3QBVA 4LJ7A 5I7WA 3QLUA 1U8XX 3EK2A 1KI4A 3B6EA 4DIMA 3Q8WA 1NN1A 3GDHA 4PHFA 1UMCA 2YWGA 1XAGA 3DR5A 2R8PA 5A1TA 4O2BA 4Y2HA 2DUNA 3P4YA 3HDQA 1F8XA 4X54A 1M2WA 5GIOE 4FJ2A 1IZ8A 3K6SA 4W7HA 4XYEA 1JHQA 3HO6A 3BTOA 3H7AA 2YTZA 2HMUA 3R9XA 4C7OB 5CVVA 4HWOA 1FRZA 2ZBUA 1KYZA 4Z4IA 2R2GA 3WLMA 1ECPA 5F2OA 2PZJA 3NTRA 5B1SA 1C1XB 2C8LA 5EERA 4LAFA 3T1TA 1EDOA 4MV5A 4CE6A 4OGGA 3O0DA 2WICA 3P2EA 4US0R 1IZYA 1VKNA 4CT0A 1OFUA 1P3JA 3EEBA 2XWBF 1P45A 2HCJB 3RF7A 4BBZA 2IA5A 1UC8A 2J0VA 4MO9A 4GMGA 1PFGA 5FBRB 4PG6A 1U2EA 3AF3A 2ODPA 1UFRA 4IZ6A 1IZZA 1KKLA 4PHGA 1OZHA 2J3DA 4PV7A 1M6VB 4OAPA 2J9FA 1UZLA 3UK2A 1NNSA 2ZBQA 4ZPXA 4IR7A 4HO1X 3WRWA 5ISMA 1ZJ4A 1ZNYA 1NW4A 1OIWA 1PWYE 2ECPA 5FT9A 1NN5A 3Q41A 2ZIFA 4HYYA 3FBWA 1NYLA 2XB4A 5C0OE 3FMGA 3FCEA 2O9JA 4JT8A 3L1VA 3N2GB 1B8PA 1T8UA 2C1XA 3AY3A 5G1NA 3X1XA 4LCJA 1JX6A 1QHFA 4QU5A 4ZOEA 4A2WA 1GQRA 1K08A 4U8GA 5H9WA 1VZ3A 4HAUA 5LNK1 2I7XA 4GYQA 4WDQA 1T9KA 1Y81A 4LGVA 1X42A 2QLFA 2WYIA 4Q4HB 5FPYA 3W3ZB 4TWRA 3ZY4A 1GTL1 4M7RA 3L8FA 4QPPA 5D87A 2O06A 2M9MA 3RUEA 3PEFA 4L6AA 4K9LA 4M1OA 1L4KA 2A0XA 4QFDA 1LDMA 3E5MA 4HDOB 4M1YA 1Y63A 1JG6A 3KS9A 2ZSKA 3AUTA 3C3CA 1P2GA 4X66B 3LDHA 1H66A 1TUBB 3EAFA 4FFWA 3I11A 5KKAA 4S05A 3NM4A 4BNIA 4PSCA 4Z0HO 4E2YA 1YS6A 1WSWA 3MN1A 1H2ZA 1R88A 1CY2A 2GJ8A 1KMNA 4GNKA 2C4KA 5L3SB 1HFKA 1U28A 3H11A 5KJEA 4BMOB 1EUDA 2FSSA 3Q2KA 5LA6A 1X2BA 5LYYA 3Q9LA 1F6BA 4LNUA 2Q6TA 1NU8A 3L1HA 4F5WA 3OZWA 3B52X 4EF6A 2OT3B 4F4IA 1YVPA 1JQ3A 8GPBA 3T61A 2QL9A 3ZJVA 1UQRA 3U81A 1DHRA 2Y8EA 3SNHA 2D7CA 2KBFA 2YXPX 5KDLA 3E84A 1P2VA 3S2YA 2YJGA 3P9KA 2A7QA 1V8FA 1D6NA 1Q7BA 4JT9A 4QUHA 3OZUA 1Y1QA 4PYQA 1AV7A 1Q7CA 1W85A 4RC9A 5CGZA 5E4JA 2QN7A 5EW0A 1MV5A 3RSLA 3GT0A 1A4IA 5DIFA 2Q0QA 1G5QA 1YZVA 2GLUA 2C58A 2NO5A 3ZQUA 4M0EA 4EI7A 4EZEA 3EZXA 3Q3VA 3ANMA 2O7SA 2HXYA 4JUIA 4N5MA 3UGKA 2GD6A 1LVUA 2FEWB 2ZI7A 2ZT6A 4LBZA 5DNDA 4QDOA 5FOVA 5KO2A 1DU4A 5K4MA 3OQ6A 4ZREA 1VP9A 3O8QB 1KDVA 4TRRA 5A9SB 3H97A 5EWLA 1VXRA 4JN6B 5H83A 2HMWA 2Y67A 1HTTA 4RPKA 4N12A 4F9FA 5IBCA 5LDHA 2PWBA 1YA8A 4TTSA 5KWIA 2VXOA 3OC6A 2P4ZA 3K9GA 1S4MA 4Y30A 2ONKA 4X90A 5DHUA 3FZEA 3WWCA 3AF5A 2IFTA 3LYLA 5GVRA 2DU8A 1K4MA 3FX2A 2QOEA 2FSVC 2IPNA 3F90A 4U02A 2CV1A 5EP2A 5T6MA 1HLGA 1DJPA 1VIMA 1CF2O 3BJIC 4LKRA 5D86A 4QXRA 3H4TA 3IVMA 3WLLA 1PE0A 3VU8A 3F97A 2ZYGA 2VZ9A 5LP6A 4DV3B 1DMRA 2ZSIA 3KPYA 4N5LA 4UWOB 2VSNA 1ZJYA 1Y3IA 2ZIZA 2WSIA 3BFVA 4X1YB 2AE1A 5FA8A 3K1JA 2F90A 2V7QD 4N41A 2ZQZA 1VJ1A 3VYTB 4UQLA 2DB3A 3FCCA 4YJHB 2NPIA 3TLXA 3HXTA 5CH8A 3T41A 2F1KA 4FHGA 4DNXA 3TD6A 4BBJA 4ZIRB 2RH8A 3CZ4A 2RG7A 2DT5A 3OO0A 4P4LA 2WSLA 3HDVA 3RK1A 3RVNA 2GARA 2IE0A 1NVXQ 3N7UA 5CDFA 5A9RA 5D85A 4URFA 4RD4A 5DNUA 5EHNA 1NP6A 3CIFA 1CP3A 4RTNA 1T1RA 4R1TA 4RGVA 1DXOA 4I4TF 4PHHA 1ABBA 4KDEA 4X1YA 2YHBA 3K0AB 4PZ0A 2PL5A 2ETXA 2XUKA 3CUSA 1WIWA 4L8GA 1QP7A 4EBFA 2VI5A 1EDDA 3AOGA 4C88A 2QYOA 1XQ6A 4PRLA 4BNVA 2NQTA 3I9MA 2JLCA 3WZ2A 4X61A 1RM3A 4PYRA 3RT1A 2DBZA 4JI2B 4PGHA 1HE8B 1KVRA 4H7DA 2OE2A 3OPXA 3NHRA 3IT2A 3QLVA 5GV7A 4LFCB 4Q82A 1CLEA 1A4UA 4R41A 2PZGA 3PFGA 5AJWA 4DVGA 4IMJB 5THKA 3DOOA 2JCGA 3BK7A 5EXDA 3ZD9A 3W5JA 4GBED 3PIDA 1BDJA 1RYNA 3T99A 4KWTA 2CBXA 2IHYA 5LP6C 1C2TA 2XQVA 2OBBA 4YP0A 4HUQB 1Z8FA 3IT1A 4QXAA 4LNAA 4PR3A 4ZICA 1C4KA 4L5JA 3JRWA 2F8LA 4EZIA 1TIKA 5HH5A 3LD9A 4S0XA 4U6NA 3U3DA 5JCJD 1XNQB 5CFRA 1K2WA 1JFSA 2KW5A 3R9XB 1VE6A 2F43B 1ORIA 1TLLA 3HUFA 4NJEB 1DL5A 4Y2RA 2RHGB 3AHJA 3VH3A 4W5OA 5AK6A 3O8NA 5HVNA 4HX5A 1CUXA 1V9CA 4ALJA 4EGSA 1FTSA 3FNEA 1E1RD 4Z5ZA 2JFGA 2AEEA 5GADl 3R0QA 4F8JA 4F71A 1XF1A 1OPXA 1FDVA 2R6GA 2O2JA 1T2AA 2ZBGA 3KJXA 4RZHA 1O6CA 4HWPA 3DQPA 2A86A 4LRUA 3EY4A 1XU9A 2Y71A 2GPNA 4QBIA 3GRZA 3AR5A 1SCDA 4II2A 4EG6A 2QAGC 3OEED 3WGNA 4E1VA 5AVTA 5ILQA 5EL0A 4RWZA 5HZKA 2EFYA 3K0CC 2SKEA 3CEMA 3FFTA 1AZLA 1Y1TA 2CZGA 5TGZA 4OHRA 1MJNA 4WWHA 3PNOA 4KXLA 1VG9B 4KMMA 1QIMA 3ER8A 2BCGY 3WFIA 3MMPA 1AXEA 1EWYA 1U3CA 5BSUA 2JJ8A 3VOAA 1ZH4A 2G4CA 3PC3A 5KNCH 1SUWA 3P9IA 4FGUA 2WWYA 3IURA 2AD1A 1XNHA 1QUEA 1BOFA 2A7XA 4UOZA 4RSGA 2JL1A 4RA9A 2YCBA 3I2YX 4RULA 1PKEA 2CUKA 3F8WA 4LDPA 5JAQA 3CUVA 3WMXA 2IV7A 2JGEA 4YRFA 1OXSC 3IDFA 3R09A 4B6GA 1MDFA 4Z7RA 1EFPA 5AJHA 2BSQA 3P0RA 2CFRA 3QWFA 4WXYB 1RU3A 1JAIA 2I65A 1P1FA 2ZJFA 2GXUA 2Q4RA 2CDBA 3DXYA 4URVR 1A2KC 4X1IA 2JFWA 2XE4A 4QJ4A 1E0SA 2FX5A 4HX9A 1H2RS 4JB2A 3AFGA 5DTJA 3H9GA 3DE1X 5J1TB 2R62A 5EUCA 4KAJA 4TMTA 2GDZA 1TF5A 2ZJAA 3N5KA 5ALLA 2ZUWA 3QEKA 1QVZA 2Z9DA 3IPYA 4O33A 5I51A 3ADCA 4GSLA 4QQNA 1SZDA 1BU5A 4QPNA 3KQNA 3RYTC 5JCZA 4D8TA 2CDCA 2GN9A 3PF9A 2RHHA 3WGUA 4E31A 4MV4A 2FI1A 5AVXA 3ZDYB 4Z8XA 4PZCA 5KUTA 5C7IO 2B4TO 3DBHA 1F2DA 2CL6X 1XRJA 3A58B 1FLDA 2FJUA 2JLBA 5JRJA 5AI0A 5DTMA 4PTLA 4H7HA 3CM0A 3GLUA 3KXLA 4YJ2A 1FFSA 4BLWA 3IB6A 4F72A 4IIXA 5JJKA 4ZMRA 1WHSA 1DT3A 2NU8A 4P93A 1ZLXA 5KTOA 1A5AB 1KJWA 3MCAA 1V96A 4Q4AB 2V1UA 3O3MB 3A05A 1XHFA 3L18A 1N6NA 1PEYA 2OQRA 3FCUB 3HDGA 3B6MA 4AFNA 2I9PA 4BX3A 5F98A 1KBZA 1P29A 5BURA 1W1IA 3KJGA 4YT8A 1JA9A 1XHEA 1O9BA 4G23A 4MQ5A 5EHGA 5FYQA 3T94A 3SVLA 3C3XA 1FTYA 4UOEA 5TPWB 3JQRA 4KX5A 4DLPA 2ZCUA 3IUPA 3FYCA 4UW9A 3O84A 3OJXA 3B6ZA 4MLPA 3WIVA 3C3YA 3RRMA 3L46A 2VUHB 4DRZA 5T5QA 5PNTA 2ZAGA 5LC1A 2OK7A 2QTTA 4I9NA 4M0MA 1Z18A 2H1RA 5EWJA 2ZJ4A 3TL6A 2EHJA 3EC2A 4UKDA 2DLCX 3LUKA 5C7OO 4DADA 2V6GA 1QP8A 2TMKA 4BEVA 3BHJA 1AH2A 1OF1A 1HL7A 2DAPA 3U44B 4UWSB 2QYHA 3DULA 4BZPA 5A04A 3P9NA 4XH9B 4KVAA 3T9EA 3OTWA 4YJDA 3TJMA 3UJDA 3DPIA 3FPKA 4WFQA 2JFBA 2HTFA 2IKQA 3KB2A 4HWKA 4IY1A 5CH5A 4MHSA 1EFDN 2G70A 2E7YA 1GL6A 2W98A 4DIBA 5IEJA 4C0XA 3B20A 2ID7A 4GF5A 2YQ5A 3WMGA 5A5FA 5TQJA 5JAZA 4K9RA 3SX0A 1AKMA 1BD3A 1L5OA 1ZI8A 2QTCA 1EWQA 3CRRA 1TUBA 4LF9B 5KBYA 3FSGD 1DKQA 4O2RA 5BSFA 1XKLA 1T9AA 3H6HA 5D3ZA 1ID8A 3K4PA 1GCIA 1OHHA 3DE2X 4Q3LA 1DE0A 2Z8YM 1IM5A 2G07A 2DX7A 1L6IA 3D4LA 4HGQA 3U09A 2WUWE 5JQGF 3UT0A 1RIIA 3UK1A 3NAQA 2R48A 4LVNA 4FEAA 3EWSA 3PGKA 1K06A 4TV9A 2WWHA 1A96A 2IZ6A 4GZ6A 3LZ6A 1CY7A 3MK31 3Q85A 1ULUA 1IHYA 4RL2A 3TECE 3H2JA 2V9ZA 2GHIA 2O6HA 3IALA 2W2PA 3E82A 1FXWF 3BQNB 2QIPA 3ZKWB 3BD9A 3OE7A 2OCLA 5U1PA 1F2TB 1T2UA 4R9NA 1E0KA 4HDAA 4G07A 4CFZA 1A69A 1YB1A 1IHDA 2G28A 4LX8A 4UAUA 1IXYA 1KK3A 3OE5A 2BL4A 5CM2Z 1FNNA 3SI7A 4EEZA 3Q8MA 1KO4A 5DYYA 1YTLA 2REQB 3EGWA 3NV7A 1DMSA 4FOOA 1N5OX 4Q9NA 2OAEA 3RCBA 2ZKLA 5K8VA 1G3QA 2NNWB 3TPFA 4RM5A 2DKFA 4YSKA 1HDGO 1XOIA 1ACMA 3O4RA 3ES9A 5FAKA 2WIDA 4TKVA 1G8KA 1NY5A 3EIOA 3EIHA 3EXIB 3GFVA 3EDYA 1FTWA 1QRAA 3IKMB 4PLGA 5CVUA 5D00A 5LXTF 2B4AA 3IQZA 3C8UA 3LNCA 2OOSA 3CEAA 4WX2B 1GL9B 2Z3WA 3KKLA 3RS9A 3FOZA 1D8TA 4M3NA 1U80A 2RCYA 3TPZA 4K0RA 4ZI2A 2XOKD 2F9FA 1LNZA 3DQZA 3F6PA 4TXJA 3ZUGA 2GAAA 4TTJA 1SUBA 2ZQ5A 1C30A 3UCXA 3FCYA 4CMJA 4W9NC 4GKJB 1Q2XA 1LTKA 3P0IA 1OGJA 3RREA 2HJWA 4MPDA 1E63A 2WP0A 2FN4A 5B1EA 2JFFA 1M7GA 3I8OA 4D4MA 3L9XA 4J7AA 2E55A 2CHUA 3AJRA 4DEXA 1AJEA 2LZ0A 2PYIA 3PUIA 1HO3A 5TQ0A 1UM8A 2QTVA 3PD7A 1CQPA 4ZN6A 1TEHA 5ACSA 2FRDC 4DR2B 3CNNA 2H7CA 2GI4A 2Y1OA 3L0PA 2QJWA 2AI3A 2ZB2A 2QJOA 3E4DA 4CMHA 1RHUA 3O8OA 4KH0A 1ES9A 2PT5A 3KSMA 3AMVA 4NBVA 4E2WA 2QJTA 3PP8A 3LTNC 2JGJA 1T8TA 2JK1A 1G42A 4KYVA 3OOHA 1PI3A 4CM5A 4LV6A 4IXMA 1WD7A 4JVLA 4X3OA 5HCNA 4G24A 1T2CA 4B71A 3A04A 3OPMA 4OFWA 4XAQA 1VL6A 2E3JA 3DLHA 3AF2A 5IXJA 1C30B 4OEHA 4C4RA 1QE3A 4U2FA 4D9IA 4EGFA 3LCCA 2GZ3A 3NTXA 2KLHA 3L6OO 3R44A 2YZMA 4P54A 1NGSA 3B6KA 4RH0A 4F85A 3AJDA 1TLFA 2HF7A 2QW8A 1AN9A 1DKUA 4P86A 1TYBE 1NQUA 5LQKA 1NC1A 3TKAA 1QR6A 3BIOA 4MVJE 2BM1A 4MOWA 1CUAA 5ALOA 2WJ3A 3VZQA 4E1AA 1DC3A 1TJYA 3R1IA 5K0FA 3MT8A 1DFHA 1JIXA 1UKZA 2XTMA 4A8JA 1YAHA 1G4HA 5AM5A 2DUJA 4CG3A 4YJ2F 1AKTA 3OUTA 2JDIA 1H2XA 3GH3A 1VCNA 5TF4A 2C5LA 2P30A 4MW0A 4R2IA 1XMXA 5ALJA 3KKNA 3AW9A 2A9QA 3GUVA 2R65A 2NXEA 4F60A 1CQIB 4P4UA 2Q5EA 2VYNA 5JSFA 5LMZA 1R4ZA 1A9XB 5I6DA 2BZSA 3OWXA 2ZRPA 5KX5A 4QYMA 4QBGB 2HA6A 2VOJA 1J4AA 1E6WA 1ZZGA 3MLAA 4DTCA 5A6VA 3R2UA 4BAZA 2BYTA 3PICA 4NCJA 2SCUB 4C30A 3EAQA 1YULA 1ZNZA 4TWJA 2C4NA 3HZZA 4MULA 2PVSA 3O4VA 2XR1A 3K92A 4CR8A 1DBSA 1YL7A 1AK2A 4KXUA 2W6JD 1CR2A 3NDPA 4FC7A 4OJTA 3F96A 1E3LA 1MO3A 2CUNA 4J4BA 4B3BA 2COUA 4L9SA 3R7WB 3RVPA 4CNBA 1CUUA 3TGPA 1N1DA 3VDQA 1EE9A 1VC2A 1KZ4A 1NUPA 4OH1A 5IT9A 4JEHA 1BO6A 1FU8A 4KRGA 5ICGA 3U7GA 1AK9A 1SN7A 1Y3AA 5E6RB 5FRDA 1I2AA 5IVIA 2O7QA 4QG3A 1YHYA 4JXJA 3GPCA 3C74A 3ZWDA 4DWWA 1YV9A 1GUDA 4ILEA 2W93A 4A5OA 3ICQB 5IS2A 3OU2A 4DA4A 4WK4B 1JU4A 1C50A 3RHSA 2MWMA 3ROQA 2AZXA 2XDWA 2P1EA 2QE7D 4BL5A 1BROA 2YC2C 4RWEA 3THWA 1GTG1 3AR7A 4KJZA 4EI2A 1RPNA 4C5AA 1V3QE 5ER6A 1UOEA 3FUTA 2Z1DA 3GT3A 3VYUB 4BNZA 1S9DA 4CLOB 4NBKA 2N42A 5CA1A 1N2GA 1P0IA 1RP1A 4NEGA 3V4LA 5JBNA 3QZUA 4FR7A 1J2TA 2J87A 2WK1A 5JVDA 1ZXXA 3JWHA 4IYRA 1XCMA 1OT5A 3CNLA 4W6ZA 2UZ1B 2OD2A 3LY7A 2OG2A 3AT1A 4I9FA 1EX9A 1OX5A 3EHEA 5AW9A 3HEMA 3AONB 5BUCA 2AEJA 4A82A 2AOXA 1RNLA 3LO8A 3ZCPA 2QZZA 1DAHA 3HA2A 4IJWA 4X6XA 2D2EA 3HKCA 5CX1A 5LS3A 4Y0AA 3VR2A 3H19A 4FYJA 3ZJUA 2C9ZA 2H51A 3OZGA 3Q9SA 2ID4A 1ZJJA 1VTKA 1N25A 1ZC4A 1XLTA 1VG0B 2V03A 4ZHQF 5AIAA 4TUYF 3TSOA 5HISA 4JVNA 2VK1A 1ZD1A 4J0DA 1OLXA 2IUSA 1KR5A 2QT1A 1RHRA 3FB4A 3OEYA 1EWRA 4G5OA 4U7WA 5DYGA 3QI7A 3WQQA 5CA0B 1QLJA 3E9YA 1ZUNA 1WXGA 3JRNA 4C29A 3K0BA 3LXXA 2P68A 3C8MA 2IHVA 3P20A 3X3HA 1ZDMA 2YHAA 1SUPA 1WOMA 1VM6A 4M0CA 1PG0A 2AN1A 4UATA 3UHFA 4AWYB 1QPGA 4N0PA 2PANA 4WGGA 1EVQA 2H63A 3E58A 4YJ3A 1XF9A 4HBZA 4I4TA 1AA6A 1MVNA 1E7SA 2MU1A 3E5NA 2XMGA 2ZAMA 4EUHA 4H6PA 2RBEA 3LUHA 4MINA 2VDUE 4P7BA 3RSCA 3E9MA 3JAWA 1CQIA 1QFMA 3I4LA 4PYIA 1Y4SA 1CHNA 3KZXA 1LVGA 2PNFA 1VE3A 3ZEIA 5ACTA 3NX4A 4BQEA 3OLZA 2ZYUX 5JRZA 4KE9A 3VYWA 1Y3FE 2CNBA 4YR9A 3KPUA 3L3BA 1FX0B 2FHXA 1Z83A 4U2DA 3C7CB 3A1EA 1VJGA 3X2EA 1GO2A 4YMWA 2CVQA 3DC7A 4MA4A 3EZGA 3W2TA 4ZVKA 2R8XA 1ZNQO 1AKNA 1C3XA 2PX5A 2AGVA 4I4TB 3O2SB 4E5SA 2ZI9A 4Z1OA 4C4PA 1E5XA 1C9YA 2AKAB 4U7TB 3RRFA 4XDZA 1I7QB 4DMLA 1DTWA 2YV3A 1LB1B 2ZGVA 1CIVA 4JBHA 4JIGA 4B73A 1QANA 1VHQA 2PUCA 4BZ3A 3V8EA 2RMKA 1G5IA 1XC7A 1TO6A 1PZXA 1CS4C 4HB0A 2Z5FA 1YVDA 4WH0A 3UUWA 4Y2JA 4R71A 5C37A 1H2EA 3RAGA 2JLVA 3FB1A 4Q1BA 4YONB 4EY2A 3QLEA 2DM6A 4ENSA 3R7AA 2BEUA 4HWSA 5GVSA 4F96A 5LFAA 2QBYA 4LYEA 3G5UA 4DT1B 3DEJA 3KLPX 1V3TA 2ZAYA 1RR6A 1QOQB 2FWIA 3G0GA 3OCXA 1NY6A 4IQ8A 3O3OB 4LEIA 4S0ZA 9LDTA 1DCKA 1QO9A 2OP0A 3LUCA 1SCUB 3UUGA 4TKZA 4C0HA 1KC3A 4FT4A 1T6XA 4BNUA 4UHDA 3KL7A 2BZGA 2OO5C 2QORA 3DMFA 4KPUB 2BDUA 2EWWA 5JXWA 1PJTA 2IC5A 5A23A 1AN0A 4H7JA 1TFRA 3PXEA 1QQ6A 2QTFA 1YJAA 1UKEA 2D0IA 2LR0A 2BI7A 3IC5A 3FKSD 3L1KA 4BIMA 4PY2A 2W6JA 1KFBB 4P3PA 1TVKB 4GLLA 4B46A 4IVNA 4KIUA 4KQFA 1JEQA 4ARSA 1HEYA 3C98A 1M34B 3VSEA 2UVPB 4MWGA 3D5QA 3WLAA 3ZYCA 2ZUBA 1BCRB 3ZJ4A 1FRFS 2H48A 3DOUA 1GT91 1Q6YA 1VB3A 4X1KA 1M6EX 4QKQA 4ETMA 3RSSA 2R87A 1GVNB 4LQ4A 4BMNA 3E9DA 6ADHA 1DXKA 1YVRA 2G09A 4KWHA 3GUUA 2IV3A 5KJCA 3HO1A 5AHXA 3FOFC 1TJ3A 3VJKA 2FU5C 2GBPA 1N2CA 1QGDA 1SKBA 4V38A 2ODEA 3T8YA 1SHLA 3KQHA 1MOQA 2ZRKA 3OPYB 5BW6B 4DR5B 3BQMB 2H2GA 4W9MC 2GCIA 2A2ZA 3K1AB 1FNMA 1P0MA 3QE2A 4GLJA 2VWHA 1I7DA 3UHOA 4EVSA 1D6MA 3C6MA 3IIJA 2VDWB 9ATCA 3E9QA 4Q1FA 4S2UA 5HJ2A 1QIHA 3QOYA 5HFNA 2IY9A 3FDZB 3I2FA 1NYTA 3SIWA 3IV9A 2ZP1A 3NIWA 2OHGA 4FMBB 2G36A 2VUSA 4PX9A 3SJZA 2IPOA 1LLUA 1DDOA 3TF5A 2J45A 4AKSA 2RH4A 3AEQA 1G9XA 4QBHA 3QX7A 2XE8A 2YWEA 3HBNA 1MB9A 5BOSA 1ZJWA 4UCFA 3BBLA 4INOA 3V8BA 2LD4A 4DE5A 1UBMS 1FMLA 5CR9A 1P8AA 3K32A 3L7IA 5KPJA 1RVV1 1IHUA 3P9RA 5K4AA 2WYMC 1M9NA 4WNCA 4PXAA 4XFDA 3UHAA 3OQJA 1DZIA 1DDKA 1MQ9A 4LTMA 4RFSB 1NP7A 1E58A 1XHLA 3OOEA 3G2KA 4PAQA 1NG1A 5AEBA 1N7JA 5FOSA 3ZVRA 3KYCB 3RDPA 2PLFA 1FPMA 3LV8A 4KHZA 4YMSA 3SS8A 4AICA 4B6QA 4Y9RA 5ESRA 1NTOA 3NVKI 1VKZA 4AECA 1H8HD 1XXHB 4GWKA 5JI2E 3RQIA 5DBEX 1CHDA 4JU8A 2YWDA 5I5EA 1I3NA 3VKHA 4FLFA 3PHCA 4JLSA 1PIWA 3GJ6A 5TE9A 4JI7B 4HBGA 1LKZA 2L18A 3C1UA 2EF0A 3STTA 4YXFA 3DHAA 1HORA 2YV1A 4OI0A 5M5BA 5G53C 5AJUA 4TLBA 1T29A 2Y1KA 2AFHE 4M7WA 1PFUA 3DLIA 3DNMA 3QEOA 4Y2YA 2I6UA 4HNVA 4LF8B 4C1HA 4D4IA 5IKEA 2BG8A 2OBXA 5FLYA 2QXYA 3FTNA 2VPPA 4MWTA 5B3JA 4MUHA 1M2GA 1QLWA 3RYFB 4F4UA 3CCFA 1WB5A 4OD0A 4JKIA 5L4LA 1MXHA 4BZWA 1Y44A 1I6WA 2GAIA 2FW1A 1Z0UA 4PRKA 1D1SA 3PEEA 2Q5HA 4ROSA 1OXKB 1QYIA 3RKRA 4B81A 4DQ0A 2PM8A 2WQZA 3N8HA 1ZGGA 3EEIA 2ZS8A 1HDCA 2D1QA 1B2RA 1J99A 1G4AE 3DCYA 3HYTA 3CRW1 4J1TC 5AIJA 3LKDA 1XDGA 1NVKA 1JR3E 1TM3E 3LGAA 3VHLB 2QQGA 1JEYB 2AXQA 2QV7A 2PX2A 1EYZA 1YDEA 1X7ZB 1XL1A 2Y0CA 3JVDA 1JFVA 2VSYA 3B3JA 4QTTB 2OTCA 2O19A 3HHEA 3CLRD 4PLCA 2RGGA 2QHXA 4TZ6A 3GN2A 4IDCA 5AHWA 4BQFA 3SQNA 1KO3A 4UHHA 2PYZA 3QTTA 5LCXA 4CMAA 2NYPA 1Z6AA 4KGVA 4GEGA 5K0BA 4HC4A 4NI5A 5AI9A 3VOTA 5BR8B 3WYFA 2W00A 4KWIA 1V9SA 3H5VA 4CGZA 3H9EO 2IOYA 1W4ZA 3F9IA 4N7RA 4L3VA 3BN3A 5I7OA 1D2CA 3KXKA 3RWOA 1P75A 3GMDA 2F8MA 3SFPA 4M0LA 4Z2AA 5JC1A 3BGVA 3AFMA 3DBOB 4V0MA 1N2CE 4GM0A 5FYDA 3CE6A 4XWWA 1KAMA 1W581 2CLIB 2VT6A 2C1EA 2XHZA 2ZOSA 4K3VA 3SIPA 3TE7A 4P53A 4ZQHA 7AT1A 1GTJ1 4CF3A 2V6JA 3U60B 3KQSA 2PZKA 4FFMA 4RMIA 5A9TA 3THRA 4EAQA 5CB8A 1V9LA 1W9HA 2X0EA 5CG2A 2Z8YA 3OFJA 5CVTA 1XPRA 3ENKA 4HWGA 1ZG3A 3D7RA 1YQGA 1Z6YA 3EZ9A 2JBAB 2O4UX 2ESRA 4KBFA 3VR6A 1FFDA 1QF9A 4BFUA 3IPAA 3KQYA 5FL7D 1HT3A 1H0HA 1XMQB 2X7XA 1WABA 4IO1A 3NKFA 1W59A 2ST1A 3OESA 4XLZA 3T7TA 4A8TA 1UJ6A 3ICWA 3IEIA 2PKQP 3DYIA 1I1QB 3D8NA 4TT8A 1H94A 4W5RA 1SXJD 5TARA 3PC6A 1KJQA 3TLBA 4JFAA 3GJRA 1YTUA 1OW3B 4BZQA 2Z9BA 4NPCA 5BNWA 1KWKA 2NXWA 3OZSA 1N6KA 3ISJA 5D7BA 1M1YB 2GCNA 3CF0A 3WJ7A 4E22A 3S27A 2NVOA 4FN5A 4LXUA 4X85A 4QNRA 2VNKA 4ED9A 2AFHB 3ELYA 1NE2A 3H9BA 1B4DA 1MF7A 3CR3C 4X7MA 4NV1A 1BOOA 1O96A 2E4UA 1CIJA 2NO7A 3HV2A 3O2JA 4YI3A 2JFZA 2WPDD 5K01A 4MVJA 5SV2A 4CMBA 5LDDC 1YFZA 3FGZA 4B3GA 1I24A 4IGAA 4RGBA 2GKOA 3IJPA 4X63A 1CJCA 3K5HA 2VXBA 5H1YA 4V1CB 3UPTA 3N05A 1CUWA 2QMUA 4K46A 1UJ5A 3LC7O 4AP9A 2Y9MB 4EKYA 4AW9A 2XIQA 4C4TA 2ZANA 5KTTA 4P0PB 1EFCA 5L6MB 1YQUA 4U00A 2Z8XA 3HB0A 4GMFA 4P34A 5HS6A 1W30A 1VBKA 4XUDA 5EXSA 3BICA 2QDXA 2Q9CA 5COQA 3SM3A 1LBTA 1HZZC 3HUUA 2CWDA 2EGGA 1M1XB 1RCTE 1VE9A 2ZQYA 1C8LA 1YUNA 3C1AA 3NHZA 1UZNA 4MQFB 2FV8A 5LIRA 2C42A 1V3VA 1VE5A 3D81A 1LJ8A 2J3EA 2HQBA 1I9GA 3HCEA 1XBTA 4P8RA 4E46A 2X1LA 1G1MA 1UC9A 4Q3DA 4UUAA 3ZJ5A 5HKBA 1MLDA 2O1WA 3CGWA 2HA5A 4P2GA 1R6TA 5I5GA 5L3ZA 3N9IA 5BOSB 3OJLA 1ZWLA 1WL8A 1Q14A 1HPLA 1ZOPA 4KDFA 3G7NA 4DMKA 3X1KA 1SBQA 3KVYA 4K9OA 4QATA 4FJ0A 4XVCA 3G13A 3WO1A 3OECA 2AJ8A 4HPJB 1DI0A 4I55F 1HT2E 4AZSA 3ERCA 1L7NA 2QTZA 3VJRA 3H8WA 3ZTTA 4FB5A 3A6LA 3A31A 3OPYI 3WGTA 3ZNBA 3ET5A 1L2TA 1X70A 1PV2A 2P7HA 4R3UC 1TC2A 5NULA 3S55A 4AIIA 1JFFA 1QIDA 1RSZA 3X2ZA 2BAGA 1RI5A 2J48A 1JKXA 5SZJA 1E2EA 4XYLA 1SWVA 2PV0A 1QAOA 3LDGA 3ZQKA 3EW7A 5EJ9A 1P5RA 2YZ2A 2QSYA 5SY6A 3AF0A 2CFIA 4BBAA 2ZIUB 3ZCRA 3QV1A 1E2IA 2PJRA 4OKIA 5T4EA 1ZCZA 3E9EA 4U3JA 4NONA 4NJEA 4QU9A 1WUYA 3C6QA 2IEAA 4JQOA 5DHQA 1X7WA 4LHWA 4WBNA 4H0FA 4IV5A 5JDCA 1XDWA 1H9CA 2X9GA 3JVVA 4EK9A 3ZE8A 4BRZA 4P4TA 4WHMA 4QJ5A 5F78A 3DFKA 4G0UA 4DHWA 1NU6A 3M5WA 1X39A 1TPZA 4XPZA 4D9FA 3Q1KA 3P97A 4TKUB 1GUAA 4I1UA 3VTZA 4P2BA 4YV2A 3A28A 1ZOSA 1Y6FA 3B70A 5JV5A 4L5AA 4HXGA 5JNRA 3QHQA 2JNWA 1CDOA 4CMIB 5CCDA 1WF6A 2Y77A 2B1QA 3HO8A 4KO4S 4BWVA 2B99A 4BNWA 3TGLA 5CDGA 4YRNA 2W6ZA 3EFOB 4G0PA 4HNSA 4UU0A 3TIXB 1Y7LA 3D1JA 1Z45A 2P7IA 2OESA 3A1VA 4Y18A 4UBJA 4WLFA 3A06A 3PZRA 1MHTA 3VVLA 3LP5A 2QLMA 4CKCA 3OU7A 4FMCB 4XA8A 2HDOA 3BSSA 5AJXA 2LCQA 1L7OA 1X7DA 2ZRLA 3T7EA 5FOWA 3P2MA 1IY1A 1KJ9A 1PWEA 1KZ6A 1NKVA 2XITA 3STYA 4JXZA 2O8FB 1KSJA 1NG9A 3QIVA 3ABQB 3JTEA 1S9HA 4TV8F 4UM5A 2FN9A 2B6NA 4POAA 4W8HA 1M0TA 3VR5D 4BDSA 4DMRA 6GPBA 1SXIA 1T5DX 1FMFA 1HLPA 5J23A 2ZRHA 2VJMB 5LOVA 3L0IB 4D26A 2P2NA 1RI1A 3A4LA 2QSUA 1MX5A 4C7MA 3MBIA 4YS6A 1R8XA 3IUQA 1OB5A 4QDXA 1MX9A 1SCBA 3ICPA 4E07A 4KPFC 3CSDA 3FWNA</