1YCYA

Conserved hypothetical protein pfu-1806301-001 from pyrococcus furiosus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
62
Chain Sequence
b'SLLEKVLKEWKGHKVAVSVGFTGTLEDFDEEVILLKDVVDVIGNRGKQMLIGLEDINWIMLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved hypothetical protein
publication title Conserved hypothetical protein Pfu-1806301-001 from Pyrococcus furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
total genus 12
structure length 62
sequence length 66
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ycyA00
1JRIA 2ZGWA 2EJ9A 4EMKC 5CAIA 3BFMA 5LJ5d 3JCMQ 5GANh 4M77C 4J6XA 5GAN3 1WQ7A 3JCMh 3QHSA 4M7DC 1BIAA 2E64A 2EJFA 2VC8A 4M78C 4A53A 1I8FA 4JLIA 4M77D 4PJOB 2RM4A 4NL2A 3V8JA 2DJZA 4M7DD 4M78D 3V8KA 3FJPA 5I21A 5GMKi 2E1HA 5GANg 4M77G 5GMKm 3PGGA 4M7DG 5GANf 4HA8A 4M78G 4XTUA 5GAMh 1KQ1A 1U1TA 4RCCA 3JCMf 2E65A 4F7UG 5GAN6 3RIRA 1I4K1 3EFSA 4M7DE 4PJOC 4M78E 1LOJA 4JRIA 1H641 1JBMA 5GAMg 1B34B 5LJ3d 4QVDA 2RA2A 1B34A 2CGHA 2DTHA 4PJOD 5GMKj 5GAMf 5GMKe 5LJ5j 4XTXA 4C92B 5LJ5e 4C92A 4V2SA 4C8QB 4PJOG 4Y91A 4C8QA 1KQ2A 1I5LA 1I81A 1WNLA 3RKWA 3HFNA 2DXTA 4M75A 3QO3A 3BY7A 1LNXA 3SWNA 4PJOE 2EAYA 1WQWA 3HSBA 2DZCA 1YCYA 1N9SA 1M5Q1 2E10A 3JCMg 4C92F 4WF2A 4XTVA 4C8QF 4XTWA 2DXUA 4M7AB 2I2LA 2E41A 1TH7A 3L2ZA 5GAN7 4M7AA 4XTYA 4JRKA 3JB9F 2YLBA 5LJ3j 3V7RA 1Y96B 5LJ3e 3JCMJ 1LJOA 5LJ5f 1Y96A 3GIBA 2DVEA 3JB9J 3JB9H 3EFRA 5GAN4 4MMKA 1X01A 2DTIA 3RKXA 2YHTA 4M7AC 4M7AF 4J5YA 1N9RA 4JUVA 2DTOA 3FIFA 3JCMX 3V7SA 5LJ3h 4M75B 2VXEA 2QTXA 3QUIA 4M7AD 3QSUA 2JN0A 3SWNB 5DY9A 5GAOn 4HT9A 3HFOA 4XU0A 4EMKA 5GMKh 4M7AG 2RB6A 4XU1A 5LJ5h 3RERA 5GAOm 4M77B 4C92C 5GANj 5GANe 4M77A 4A54A 5GAOl 2RD1A 4C8QC 3RESA 3JCMV 5GANd 5GAOq 4M78A 3JB9I 3JCMd 4HT8A 4M7DA 4F7UB 4M7AE 4C92D 4F7UA 5LJ3f 5GAN2 1BIBA 3RUXA 4M75C 2FB7A 4C8QD 4M75F 3SWNC 5LJ5g 4J6WA 3RKYA 4XTZA 4XU2A 2VXFA 4C92G 3INZA 4NL3A 3AHUA 4J6YA 2DEQA 4M75D 1D3BB 4C8QG 3JCMb 5GAMj 5GAN8 1D3BA 4M77F 5GAMe 3JB9D 3BW1A 5GAMd 3V8LA 2K57A 4M7DF 4M78F 4M75G 4PNOA 4RCBA 1WPYA 4X9CA 4NOYA 4XU3A 4C92E 4F7UF 2Y90A 4C8QE 5GAOp 3JB9G 4PJOA 2DKGA 5GAN5 4DQ2A 4EMGA 4X9DA 4QVCA 1HK9A 3M4GA 4N0AA 4M75E 4MMLA 2HNIA 3FB9A 3L1AA 4XQ3A 4EMKB 5GMKl 3JCMW 3SB2A 2YLCA 3V7CA 1U1SA 3JCMc 1HXDA 4EMHA 4M77E 2EWNA 1M8VA 4M7DB 2EJGA 4M78B 4OP0A 3JCMe 5GAOr 1MGQA 4PJOF 3VU3C 5LJ3g 3JCMP 4F7UE 2DZ9A 4N0AC 3BDUA 2FYKA
chains in the Genus database with same CATH superfamily
1VQMA 2K4YA 1MNDA 4OMOA 2VGMA 3JCMQ 2FPEA 3SD4A 3FC3A 1JJ2A 3LW5E 1KJWA 2EQIA 2LJ1A 5GMKi 5I21A 2PNIA 4M7DG 4FU6A 2E6NA 2EYXA 4X1VA 1NLOC 4F7UG 4E7KA 1QWEA 3QKJA 3CCMT 1TWBA 1X43A 1Q81U 3CC2T 1VIFA 1PCXA 3U23A 1MMAA 1VQ6Q 2CYZB 4JRQA 2DXTA 3P8BB 2E10A 4C92F 3OYYA 5LL6S 4M7AB 2B8AA 1ABOA 4M7AA 2CT4A 1N27A 3R6OA 2VUBA 4LDUA 1ZBJA 2PVOB 5L8RE 1WDXA 1QVGP 3CCEQ 1N9RA 1G3SA 2JTMA 3SFMA 3MCAB 1RAFB 2K5FA 4OF1A 3JCMV 3CC4Q 5GAOq 1WJSA 2AIRB 1BIBA 2NUTB 3RUXA 2EIFA 2NUTA 4HCCA 3QXEB 2K3XA 2VXFA 2L3SA 4LDYA 1ZQ1A 4RCBA 4B9WA 4C92E 3MJXA 2DILA 1YJWT 1VOMA 4N4GA 3KUFA 2KQWA 3LGFA 4OMQA 4MZTA 4QQDA 4LE9A 2KSSA 4P5NA 2HNIA 3G6ET 2JMAA 1BCMA 1Q95G 2RQRA 2VGNA 4CC2A 2CS7A 2DLPA 1HYOA 1M1KU 3OY9A 2EJ9A 2LJ3A 2CP7A 2M16A 2R5AA 3DKMA 5IXFA 2V8IA 4L5GA 2JM9A 4PLLA 1QW1A 2HCKA 1RAIB 3FJPA 1Q7YR 4J9FA 1CSKA 2AK5A 1GFCA 1TOVA 2RJCA 3M0QA 3UATA 3M54A 1QVGA 3OYBA 1WHLA 5FROA 4PJOD 2YT6A 2F1LA 2QTVA 3JRZA 4PLIA 1OULA 2AKKA 4A4FA 1VYTA 1R0CB 2HAXA 3MHXA 1N6AA 3CC7Q 1O75A 3M9QA 1KD1R 1QCNA 4ZTJA 4JPBW 2LMJA 1GXIE 2LQKA 2RN8A 1M1GA 2RJFA 3CCLQ 1BBZA 2FZGB 3VKIA 2HQHA 5CQYA 5KYYB 3CCMA 3WVEB 5KYYA 2VXEA 2QGFB 3LGLA 2OJ2A 3R6NA 3CCSQ 3OS5A 1LCKA 6AT1B 3LLRA 2HKNA 3EFOB 1D3BB 5GAMj 4J9DA 1D3BA 5D7UA 3C94A 4KGVB 4M75G 1VQPQ 1Y07A 3CCQA 3DLLA 5GAN5 4DQ2A 1OEBA 3BDLA 2O2OA 1VQ9T 1U1SA 1GCPA 3VUBA 2EWNA 1M8VA 4OP0A 3JCMe 1A0NB 3GBQA 3RBBB 1G5VA 2K9GA 1C6VX 1WXUA 2CT3A 3BFMA 3CMEQ 1ZUKA 4JS4A 4J9BA 2GFUA 1WHHA 1VQNQ 3RR6A 2E1HA 2EW3A 3HRTA 3VS4A 5KYUA 2AHJB 2XDPA 2ZPFB 2A3LA 1FWZA 1B34B 2HDAA 1B34A 5GMKj 5FWCA 3LH0A 3G6EA 2E4HA 1K76A 1AZEA 2FRYA 1D1BA 1WQWA 1KC8R 3DB4A 2DXBA 2FVUA 1M5Q1 2FEIA 4B9XA 3VYHB 3X24B 3ZEHA 2LRQA 2L3RA 4BI3A 1LJOA 2CKKA 2KE9A 3GIBA 4PFPA 2E5QA 1BYMA 2L3QA 2M0YA 3CCVQ 2YHTA 4RKUE 1K1ZA 2BE7D 2QA4T 4M7AD 1VQKT 3QSUA 2JN0A 2QG9B 2E3IA 2JW4A 2YUQA 1H92A 1WYXA 5GAOm 5GAOl 4C8QC 1BCOA 1KHIA 2K6DA 2ZZDA 3A8LB 4AFZC 3VV0A 1N8RC 4NS5A 2JXBA 3SWNC 1BB9A 2OAWA 1YJNT 3INZA 2DEQA 3JCMb 3JB9D 4J9IA 3G71T 4M7DF 3OW2S 1JXOA 4F7UF 2Y90A 2FZCB 1ZHIA 4Q5WA 2NLUA 1YFNA 3C0CA 3GLXA 2BUDA 4FSSA 2D8JA 2KVQG 3EG2A 3OYLA 4DBFA 1YNZA 2QGGA 3GP8A 2CZ0B 5KYWB 5KYWA 3CC4A 2JZ2A 2PZ1A 1Z9ZA 4FW1A 1WJQA 4QQGA 3FLGA 4M77C 1QCOA 2EGEA 3QHSA 2LJ0A 4M78C 3EG3A 4C5HA 2ZPHB 3PNWC 2Z0WA 2KMTA 4RCCA 1K8AC 3ZBDA 3RMSA 3I55Q 1VQ5T 1H3HA 1I4K1 1RABB 4M7DE 4GLMA 2VYTA 1PRMC 3WXMB 2GGRA 2RHZA 1XTDA 5GAMf 4C92B 3P8HA 2KT8A 4QVZA 4AG1C 4C92A 2IVWA 1VQ9A 2D8HA 2NWMA 1UGVA 1AVZC 3BY7A 1X27A 1QMCA 4KBMB 1OQKA 1T3SA 2MIOA 3M0RA 1EX4A 4A4EA 4XTWA 4HCBA 1IB8A 1MNEA 2KXCA 5GAN7 3PMIA 3OYCA 4XTYA 4JRKA 4Z8AA 1VA7A 2QASA 3S3OA 5HCKA 2DIGA 2RK1A 3OS2A 2O01E 2M51A 1ZX6A 1TSFA 3V7SA 3VS7A 2L3PA 5KH6A 2XDBA 1BI0A 1UGPB 2DD4A 4HT8A 5D6YA 2X4JA 3CCJT 1MV0B 3QZ9B 2LCSA 2QQBA 2L8DA 2ZPIB 4ZGDB 3A1PA 4X9CA 5GAOp 3HPWA 2MK5A 4OVAA 1YHQQ 1VQMT 2RK2A 2O9VA 1VQ7Q 3CCSA 1C0MA 3M4YA 4HVWA 2QA4A 4AFSC 3H41A 5IT9E 1ZA1B 1JEGA 1YJ9Q 2QYZA 3H9NA 1EIFA 4F04B 2E3HA 1YIJQ 5CQXA 3SDZA 3JSCA 4TVRA 2ED1A 3RDVA 3G71A 2RJDA 2QDLA 2GFAA 1Q7YU 4C5IA 1TUCA 1V29B 1JBMA 3KBGA 1DJ7B 4KH1B 3NMZC 2L0AA 4BE0A 2HZYA 4PJOG 1NZ9A 1MMGA 1WNLA 2DIQA 3E1SA 1M27C 2RQVA 2K3YA 1VQ8A 1ZLMA 1KFZA 5IN1A 1LPLA 4WF2A 3CBPA 4FYYB 1VQNA 2QI2A 2C0OA 3M59A 2X3WD 4KUIA 3UF4A 3TEEA 2GTOA 1Y96B 3A8HB 3E9FA 1Y96A 5FU6C 1SRMA 2ZPGB 2XU8A 2OTLQ 2O9SA 3FIFA 1KD1U 4KUDK 3ZFJA 4E7LA 3SWNB 1K73U 1Q82U 3OYFA 3BE3A 4MZMA 5FWBA 2A36A 4ZGJB 3CPWS 4E7ZA 2DL7A 2OX7A 3EAEA 4FM4B 2K5IA 2KNBB 1X75C 3MO8A 4J6WA 4LDVA 1K0SA 2G6FX 3AHUA 1GBQA 2RO0A 1PWTA 4LD6A 2BTTA 3I5SA 4L59A 4CC7A 2VB6A 3D7SB 1WPYA 4JJCA 4RMOA 1E6GA 5CVIA 2P4RA 1FYNA 1TS9A 4M75E 3O5ZA 3QZ5B 3A8OB 1D0XA 2LTOA 2JVVA 2KR3A 2YUNA 4BD3A 4M78B 2C06A 2FL7A 2CDTA 4IURA 2LDMA 5KCHA 3CD6Q 3C4SA 2A28A 2CZ1B 2X9HA 3PVQA 1OZ2A 2E64A 5IAYA 2ATCB 3CCJA 2P0PA 1G8XA 4PK4A 1U06A 4F16A 5A2QE 2QK0A 5GAMh 2JTFA 1KC8C 4JJNK 3MEVA 4MDWA 5AYFA 4JDSA 1H641 2R57A 3SHWA 3TCJA 4BUGA 1FMKA 4QVDA 2ZCFB 3X28B 1PHTA 1YWOA 4OGEA 1VQ4T 1GCQC 1RI0A 3GNGA 2AT1B 3REAB 1GL5A 1X2QA 1KK7A 2K2MA 5CR2A 2NYSA 3F70A 4DBQA 3VRYA 1SSHA 2XIDA 1M90R 3L2UA 1KC8U 4PJJA 5LJ5f 4RTYA 3OBWA 2NUZA 1OPKA 4GLKA 1Y71A 4XAXB 4C0ZA 2MI6A 5C6SA 1XOVA 4A4KA 1K8AR 4HT9A 3G4SQ 4M7AG 5GMKh 2RB6A 1WHMA 2CUDA 4BDYA 4M7DA 5HY6A 2RNAA 4F7UB 4F7UA 1UHCA 5LJ3f 3ULRB 3CCQT 2F5TX 3CCRQ 2A37A 4XTZA 3M58A 1QKXA 4Y28E 2D0NA 4VUBA 5GAMe 2CP5A 1QVPA 3JB9G 2DMOA 3JAME 2DBMA 1JJ2S 4MMLA 2RJEA 1FMWA 3HHTB 3EGDB 5HK0A 3OYNA 3EGDA 2G3RA 2HL5C 4PFZA 3I9QA 2AZSA 4HVUA 3A8MB 3META 4N0AC 1NBEB 3CMAT 2V8KA 3ZL7C 1E6HA 2WSCE 1YITT 1RLPC 2CZ6B 1QCFA 4JLIA 4JZ3A 2PUKB 5GANg 3J80E 2DE0X 3EG0A 3CCUQ 2GTJA 3GF5A 1BI1A 2E65A 2KAFA 3H0IA 4A4GA 1VQ7A 1GRIA 2BKDN 4JZ4A 1H3ZA 3A98A 2RI2A 5GMKe 1IZ6A 4AFUC 2EGCA 1I5LA 4HXJA 1SF9A 3RKWA 1AWXA 2B86A 3EHRA 3HFNA 3QJYA 4Y92A 2EQJA 3PIOA 3UA6A 1W1FA 5FU6B 2YUOA 1RACB 4ZGEB 4YTLA 2DXUA 1TH7A 3PTAA 1PNJA 1VQLQ 2E12A 3JCMJ 2KBTA 1AWJA 2LX9A 1VQ6T 5M9OA 3QIIA 2CH4A 4KH0B 2H3JA 2X3XD 4RTVA 1MMNA 4FSXA 1EZZB 3QPHA 1Q86R 4AG2C 4C92C 2KGTA 3RESA 1VQ4A 2MAMA 4J9CA 1PSFA 4C8QD 5LJ5g 4Z88A 3CCET 4R56A 3NHNA 1M4ZA 2OTJQ 4J9EA 1WXBA 2KT1A 1IHWA 3DLMA 4DA4A 3CC4T 5FU7C 3FB9A 4XK8E 2OTLA 3JCMW 4D8DA 3V7CA 3L42A 5LJ3g 4PJOF 1MUZA 3JCMP 1T0JA 1VYVA 1M2OA 3MP1A 1JRIA 2P0QA 3OQ5A 1M2VA 2COWA 2RPNA 1AD5A 1QVGS 4EPCA 2DF6A 2JUFA 2EJFA 2EQKA 3E2UA 1UG1A 1W70A 1YWPA 4M77D 5D6WA 1UTIA 4M78D 2A7YA 5FRMA 1VQKQ 4O6JA 3ER0A 1Y7XA 3MKDA 1GCQA 2PTKA 2AZVA 3EFSA 3KXTA 1I5OB 4JRIA 5IH2A 1UGQB 3X26B 3EGXA 3L2WA 1KQSA 4JS5A 2DRKA 2MOXA 1QVFA 3HRSA 3OB9A 2XDDA 4Y91A 2KYMA 2DM1A 2V1RA 4M75A 3EG1A 4PJOE 3CMAA 4DEXA 2EYYA 2K7AA 3OYAA 5KYUB 2DRMA 4C5GA 3L2VA 1YITA 4LUDA 3CEYA 3ME9A 3TREA 1K9MR 1WHKA 4DEYA 4DOVA 2RQWA 3PT9A 2EPDA 1KG1A 3FRNA 2RH2A 4BY6B 1RLQC 1BI3A 5LJ3h 2QTXA 4J7FA 3OMGA 3OYKA 3DB3A 1QP2A 4EMKA 4ZNXA 1HD3A 4A54A 3L2QA 3OBYA 4RTWA 2J06A 2JM8A 2F2WA 3RKYA 1VQ5Q 3CCLT 2EVRA 5GAN8 1QLYA 1R77A 2BZ8A 1YI2Q 2J6KA 4PJNA 3CCST 2DO3A 2MYSA 4ELYC 4N0AA 3G7ZA 3QDFA 4IUQA 1VQ6A 2YLCA 4M77E 3M0UA 3G4SA 5GAOr 3CXCA 2I0NA 3EG9B 3EG9A 3OYIA 1NJIC 2KDSA 1VQPT 2D1XA 3CCRA 5CCAA 1U5SA 4C5EA 5CKEA 2F2XA 3VYGA 4IUPA 1WX6A 5IHNA 1WZOA 3CCEA 5IXBA 3LWIA 5EC7A 2FG0A 3MP8A 2PVDB 2ROTA 2LNVA 3CMET 3QJ6A 2H3EB 1VQ8T 2LQNA 2DL3A 1M90C 1N8RU 4HKEA 1W2BP 1VQNT 2M1HA 1VQOQ 2H8HA 2LT1A 1ZUYA 1AWOA 3QDRB 1PRLC 3QO3A 4PFOA 2DZCA 5DLOA 1ZSZA 2RQUA 2VVKA 1ZA2B 2XICA 4ZTFA 2COYA 2E6ZA 1J3TA 3JB9F 3HTRA 1AOJA 1YBYA 2M0OA 3EFRA 3OMCA 3I56Q 2KRSA 2DTIA 4ORZA 2RHIA 5CIUA 2WSFE 3OA6A 2HMAA 2EKHA 3OYMA 1UB4A 3MPUB 2EYZA 4ANJA 5GAOn 1M1KR 3OYJA 4XU0A 5I22A 1KHCA 5GANj 2GQIA 2J6FA 2M02A 3FDRA 3RMQA 4M7AE 1M8MA 1K8AU 3CCVT 2PVGB 4JJBA 1JU5C 4NL3A 5FU7B 1FX7A 2KY9A 1VQLA 1X69A 5GAMd 2QXFA 4X34A 2E5KA 1MHNA 4EMGA 1B3QA 5KYNA 2P4TA 2IPOB 2JS0A 2VWFA 4BE1A 4R55A 1G83A 5A0DA 3O8VA 1FXXA 1W6XA 3JCMc 2CZ7B 1W2BA 1MGQA 2HQXA 4E2FB 5KYXA 1CKBA 4C0GA 4EDUA 5J39A 1D1CA 3CC7A 2ZPBB 3TVTA 3OSSC 2YRVA 4II1A 1UGRB 1WQ7A 4M7DC 1SPKA 4A53A 3V8JA 2DJZA 2MMPA 2EQMA 3CCLA 4JLGA 4HA8A 1X2KA 5J26A 2XKOC 3LH5A 4JJDA 1S72Q 4LXCA 4IIOA 5LJ5j 2PU9B 3NGPA 1VIEA 2F69A 1PG5B 1UE9A 1BK2A 1SHFA 1V76A 1TXQA 3I55T 1VQPA 2QEXQ 3OYDA 2GF7A 1Q86C 2DL4A 2KROA 2LQWA 3FJ5A 2QQSA 4FCYA 5LJ3j 1OX8A 3JB9H 1ZUUA 1RL2A 2RQTA 3RKXA 4EIKA 2CUBA 4JUVA 3UWNA 2NUPB 2NUPA 3E9GA 2HD0A 2FPDA 4LUEA 3VS1A 3CMEA 1AZGB 5C0MA 1NG2A 4M75F 2MCNA 1WFWA 3C95A 4C8QG 3CBOA 2JOYA 4BI8B 2V26A 2VV5A 1AWWA 4D8KA 3S6WA 5ECAA 3VRZA 2GNCA 4PJOA 1D1AA 2DKGA 2DX1A 5CKHA 1QP3A 4QW2A 1P92A 5GMKl 4BB7A 3VS0A 2QDYB 2M9UA 2V1QA 1ZSGA 3H0FA 1G3WA 3VU3C 4FYVB 1WJRA 3VS6A 3J7AF 2CGHA 1PM3A 2FYKA 2ROLA 3CCMQ 2J05A 1U8RA 2XD0A 4J6XA 3EH1A 3M57A 3CC2Q 1UJ0A 2RM4A 2O31A 1UHFA 1VQ7T 2CP2A 4PJMA 1WHJA 3CCVA 1YI2A 3KFVA 4M77G 1XJWB 5GANf 4M78G 1KQ1A 4C0FA 3JCMf 3RIRA 2DBKA 4ELZC 3THKA 2YRDA 1YJ9T 3SEMA 3NTHA 5I2MA 2W0ZA 1K9MC 2V8JA 1QQJA 2YXYA 2DA9A 4XTXA 5FLXE 5IHKA 2JMCA 1YIJT 1BI2A 5CO7A 2R58A 3VJPA 3S3NA 2YSQA 3NTIA 3HSBA 1D0ZA 1G3YA 4XTVA 1ABQA 2EKOA 1NJIR 2DERA 1Y57A 1RI9A 2YLBA 3UPUA 3LX7A 2DYBA 2P84A 3QYGB 1G3TA 3WVDB 4IUTA 2ECZA 1VQOA 4E7HA 1GBRA 1X6OA 1YJWQ 2EBPA 3VS5A 2FZKB 1QWFA 2HKQB 4OMPA 1M3BA 2DETA 2OAUA 2DYIA 1I07A 1O9SA 3G6EQ 4C92D 2BZYA 4ZN3A 4M75C 4KGZB 2K3BA 1GFDA 3I55A 4J6YA 2OTLT 4F17A 2SRCA 3TSZA 3GNFB 4NOYA 4XU3A 1BU1A 3I56A 1OU9A 3OS1A 3TU4K 3M0TA 2R5MA 4IUUA 4K11A 2DVJA 2XHCA 2LNHB 2DEUA 4BE2A 4M7DB 5I11A 3QBYA 4BY6C 1WHGA 3CBMA 3X20B 5A0LA 3S3MA 1AEYA 4EMKC 1G2BA 5LJ5d 4ATOA 2LC4A 3MEUA 2RI3A 5FRNA 2D6FA 1IREB 2CH4W 3V8KA 2J6OA 3PGGA 2X4WA 4XTUA 1NLPC 2P0KA 5EG2A 1LOJA 3CD6T 5LJ3d 4MDXA 2FRWA 3I5RA 3M0PA 1KQ2A 2J7IA 1WGSA 4O5VA 4J8OA 1R8OB 1OPLA 2XI9A 2FO0A 2L5QA 5J3BA 2CP3A 3JCMg 2KYBA 2F2VA 1M1KC 1YHQA 7AT1B 1Y0MA 4OMLA 4JRPA 2ABLA 2AKLA 2JJ9A 1S72A 5DM7R 4J5YA 2X4XA 1W4SA 2HQEA 1UEBA 3L2RA 1YJ9A 3MEWA 2K79A 2CP0A 2DD5A 3M53A 4GY5A 1NEGA 2JNGA 4F14A 1YIJA 4ZN1A 1VQ9Q 2QEXA 5DLQE 3LWHA 4XU2A 4LNPA 2A08A 1ZSZC 1K4US 4KT0E 2X35A 1AT1B 1HSQA 4OB0B 3V8LA 1SRLA 4PNOA 3G4ST 2EYQA 4RTZA 1KQSP 1QVFP 1U3OA 2HBWA 3M4GA 1X6GA 4XQ3A 3FEOA 3EHQA 1TG0A 3HL8A 3CCRT 4RTUA 2DZ9A 4BACA 2LVMA 1CKAA 4AMCA 1YCSB 2RF0A 1RAAB 5GANh 3JCMh 2C0IA 4WCIA 1BIAA 2EYWA 1I0CA 2ZAEA 1IGQA 2MWOA 1R0BG 1FMVA 4IKFA 2LP5A 4CC3A 4L6V5 4N4HA 1U1TA 2GQVA 1JB0E 1OX9A 1NPPA 2QAZA 3E19A 4R0KA 1T0HA 1M9SA 2RMOA 1K73R 2DTHA 1Q82R 1M2VB 1IO6A 1B07A 4AFQC 4V2SA 4WTOB 1TU0B 1OV3A 3CCUT 1PD1A 2HL3A 2X4YA 3OW2P 5HK3A 4RG2A 1VYUA 1RAGB 1C1AA 1N9SA 3NFCA 2FPFA 3CC2A 2YUPA 4J83A 2KXDA 2QA4Q 4C8QF 3QYHB 2JTEA 2KI7A 2E41A 4RTXA 2A0FB 2DK3A 3H0HA 3EFOA 3V7RA 3EGXB 1M30A 1I1JA 1OOTA 1YJNQ 3CXCP 4RTTA 1MMDA 3M55A 3JCMX 3G71Q 4M75B 3CD6A 1NYGA 5DY9A 4CI0C 1YP5A 3HFOA 2LQ8A 4RG8A 1MV3A 5LJ5h 3PFSA 1VQLT 5GANe 1Z9QA 2RHXA 2RD1A 3MEAA 3OYEA 4KULA 4E7JA 3I35A 2FB7A 5KE3A 4M77F 3VS2A 3EGUA 4IUVA 3BW1A 1VQ8Q 4M78F 2MWPA 1ZBXA 4KGXB 2W10A 5AT1B 4C8QE 2L2PA 4X9DA 2BE9B 1SG5A 4QVCA 4Z89A 3HP9A 3CC7T 4EMKB 2LZ6B 3NTKA 4QKUA 3RNJA 4EMHA 1UJYA 1VUBA 4HCKA 1YJWA 1PC0A 2DNUA 2JS2A 3UA7A 3HKSA 2OTJT 3OSVA 2X51A 1ARKA 3OW2A 1OI1A 3MP6A 2OI3A 1IRXA 5GAN3 4MZPA 1SEMA 1KQSS 1QVFS 2KRNA 5IHIA 4FYXB 2MF2A 2ED0A 4M7DD 3N5BB 1D0YA 1QKWA 3UDCA 1Q81R 2XMFA 4LD9K 4PJOC 4M78E 3OYHA 2HEQA 2RA2A 2RHUA 4QT7A 1EFNA 1F1BB 2QQRA 5LJ5e 1K9AA 4AT1B 3AT1B 2HSEB 8AT1B 2COZA 4FIBA 1BKBA 1KIKA 1XQHA 1LNXA 1JO8A 2DFUA 1TUDA 1TTHB 3REBB 2LX7A 1N5ZA 4ESRA 2LT4A 1E7OA 4E7IA 5LJ3e 3QWXX 4BDZA 2DVEA 5GJWB 4J7IA 3CCJQ 1B7TA 5GAN4 1X01A 1SKUB 4CC4B 1NJIU 4M7AF 4M4ZA 2DTOA 3CPFA 2YDLA 4XU1A 1ZSZB 4PJLA 2ENMA 2KRMA 1VQMQ 3JB9I 5I2SA 1IGUA 2DJQA 3CCUA 2DL8A 5CKFA 4FT4A 3PVLA 1RADB 3G1JA 4C92G 2WACA 3C12A 4OGCA 5HKCA 3CXCS 2CSIA 2RI5A 4RUGA 4HVVA 1M90U 4J9HA 1PD0A 3L1AA 2YRCA 4LDXA 1HJDA 3SB2A 1RAEB 1HXDA 2IIMA 5KCOA 2DPPB 3QG1A 3H6ZA 4F7UE 2CSQA 4B6MA 4C0DC 1YI2T 1JQQA 2ZGWA 5CK9A 2E70A 3M0SA 1NPRA 2VC8A 4N4IA 1I8FA 4J9GA 1NYFA 4NL2A 5KE2A 1M3CA 3TQ7P 2QQAA 4OB3B 2IG0A 4D6WA 2BIVA 2FHDA 4PKCC 2ZPEB 3CPWP 2EQUA 2L89A 5KYXB 4HCZA 3X25B 3VUZA 2XG8D 5GJVB 3PMTA 1PKTA 2Y4YA 2PQWA 3EH2A 1NM7A 1I81A 1K0XA 2VASA 2OTJA 2EAYA 4E6RA 1PSEA 3A5ZB 3Q1JA 1WA7A 1XNIA 2CREA 2WSEE 4DOWA 1AHJB 1NEBA 2C0TA 2LCCA 1T3LA 1VQOT 1OYXA 2F5KA 2K5LA 4MMKA 3A8GB 2SEMA 4M7AC 1RAHB 2D9TA 5A0GA 5L23A 2CP6A 4FYWB 3TSWA 4OB2B 3RERA 1Q7YC 4FL6A 1WLPB 4LDWA 1TUGB 2GBQA 2HBPA 3I56T 2O4XB 2O4XA 1VQKA 1H8KA 1S1NA 1OZ3A 1W2BS 3NPFA 4M75D 3UT1A 4OB1B 2K57A 1M3AA 2GCXA 4IIMA 3CPWA 3T9NA 5CKBA 1D09B 4QQ6A 1YJNA 2DAQA 3OS0A 2PUOB 2EGAA 5D6XA 1UUEA 1OU8A 2D0QB 3URGA 2XK0A 3JV3A 2DL5A 4A4HA 1V1CA 3PIPA 1Q86U 1UGSB 5CAIA 1KD1C 1UECA 1K73C 4PL6A 4OMNA 1Q82C 1LVKA 2KEAA 1RUWA 4PJOB 1VQ4Q 5CKDA 3VS3A 4A63B 5GMKm 2VKNA 4E7SA 5GAN6 4Z02A 1WI7A 4FW2A 2DXCA 1IXDA 5FW9A 2MPXC 3CQTA 4LN2A 5GAMg 1KSWA 3GPLA 4DBRA 4C8QB 4C8QA 1YHQT 1VQ5A 1WIEA 1YN8A 3SWNA 3LYIA 1YCYA 2K2VA 1UDLA 1ACMB 3M56A 3M5AA 4ME7A 1JJ2P 1SSFA 1S72T 3OYGA 3HRUA 9ATCB 2I2LA 3L2ZA 1X6BA 2O88A 1PKSA 3JB9J 1JXMA 4OMFB 1NE8A 4E47A 3CCQQ 4OMMA 3QUIA 2QEXT 4UC4A 2ESWA 1M1FA 4M77B 2HSPA 4FT2A 4M77A 2QQ9A 5GANd 4M78A 3JCMd 3QWYA 3J81E 5GAN2 4BI4A 1WXTA 3GOXA 3P8DA 2YWWA 4DBHA 2Y4XA 3H8ZA 1IHVA 3CMAQ 2BZXA 4CRIA 1K9MU 4KRTA 1YITQ 4C0DB 3IQLA 1HK9A 8ATCB 3ASKA 2LCLA 2JT4A 2RHYA 3PE0A 1N8RR 1UFFA 4GBQA 2EJGA 1SHGA 2EFIA 1Q81C 2KK4A 3BDUA
chains in the Genus database with same CATH topology
4BACA 2K4YA 1VQMA 2KDSA 2LVMA 5IT9E 1VQPT 2VGMA 3JCMQ 5GANh 3SD4A 3JCMh 5CCAA 3FC3A 3CCRA 1JJ2A 1BIAA 3LW5E 4C5EA 5CKEA 3VYGA 4IUPA 2MWOA 5GMKi 5I21A 1EIFA 3CCEA 4IKFA 5CQXA 3SDZA 3JSCA 4FU6A 4L6V5 4M7DG 4N4HA 4TVRA 2E6NA 1U1TA 3LWIA 2GQVA 4F7UG 1JB0E 3G71A 4E7KA 3MP8A 2PVDB 2RJDA 1NPPA 3QKJA 3CCMT 2GFAA 1Q7YU 2LNVA 3E19A 4C5IA 1NJIC 1V29B 1JBMA 3KBGA 3CMET 1DJ7B 1M9SA 3QJ6A 1VQ8T 2DTHA 1M90C 1Q81U 4BE0A 3CC2T 1VIFA 4HKEA 1N8RU 4V2SA 1VQNT 4PJOG 2M1HA 1NZ9A 2LT1A 3CCUT 1WNLA 2CYZB 4JRQA 2DIQA 2X4YA 3QDRB 2DXTA 3E1SA 3QO3A 5HK3A 4RG2A 2DZCA 2K3YA 1VQ8A 5DLOA 3P8BB 1N9SA 3NFCA 2E10A 4C92F 3CC2A 3OYYA 4J83A 5IN1A 4WF2A 3CBPA 4C8QF 5LL6S 1VQNA 2QI2A 2B8AA 3QYHB 2E41A 4M7AB 4M7AA 2XICA 3M59A 2DK3A 4ZTFA 1N27A 4KUIA 3R6OA 2E6ZA 2VUBA 3JB9F 3TEEA 4LDUA 3A8HB 1Y96B 3V7RA 3E9FA 1Y96A 1YBYA 2M0OA 2PVOB 3EFRA 5FU6C 3OMCA 2ZPGB 2DTIA 5CIUA 2RHIA 5L8RE 2WSFE 3OA6A 1N9RA 2XU8A 3OYMA 3FIFA 1UB4A 3M55A 1KD1U 1G3SA 2JTMA 3ZFJA 3JCMX 3SFMA 4M75B 3MCAB 4E7LA 4KUDK 3CD6A 3SWNB 1K73U 5DY9A 4CI0C 5GAOn 1Q82U 2K5FA 3OYJA 3HFOA 4XU0A 2LQ8A 3OYFA 1KHCA 4MZMA 4RG8A 5LJ5h 3PFSA 5GANj 1VQLT 4OF1A 5GANe 2RHXA 2RD1A 3JCMV 4ZGJB 3FDRA 3MEAA 3RMQA 5GAOq 3OYEA 3OYIA 3CPWS 4KULA 4E7JA 4M7AE 1WJSA 3EAEA 4FM4B 2K5IA 1BIBA 3RUXA 2EIFA 1X75C 2FB7A 1K8AU 3MO8A 3CCVT 2PVGB 4HCCA 3QXEB 4J6WA 4LDVA 2K3XA 2VXFA 4NL3A 5KE3A 3AHUA 5FU7B 2RO0A 4LD6A 1FX7A 4L59A 2KY9A 4M77F 1VQLA 4IUVA 4LDYA 3BW1A 5GAMd 4HCBA 1ZQ1A 2QXFA 4M78F 4RCBA 4B9WA 4C92E 1WPYA 4X34A 2MWPA 4RMOA 1YJWT 1ZBXA 4C8QE 4N4GA 3KUFA 1MHNA 5CVIA 2KQWA 3LGFA 4EMGA 4X9DA 4MZTA 4QVCA 2P4TA 4QQDA 4M75E 2KSSA 4P5NA 2HNIA 3HP9A 3QZ5B 4R55A 3A8OB 4EMKB 3G6ET 4BE1A 3CC7T 5A0DA 2LTOA 3O8VA 2JVVA 1FXXA 1Q81C 3NTKA 3JCMc 2VGNA 4EMHA 2CZ7B 4BD3A 1W2BA 1VUBA 4M78B 2C06A 2CS7A 1YJWA 1MGQA 2FL7A 2HQXA 3HKSA 2OTJT 3OSVA 4C0GA 4EDUA 3OW2A 1M1KU 5J39A 4IURA 1OI1A 3OY9A 2LDMA 3CC7A 2EJ9A 5KCHA 2ZPBB 3MP6A 3C4SA 2M16A 3OSSC 2YRVA 4II1A 1UGRB 1WQ7A 2CZ1B 4MZPA 5GAN3 4M7DC 2R5AA 1OZ2A 2E64A 3DKMA 4A53A 2V8IA 4L5GA 5IAYA 1KQSS 1QVFS 3CCJA 4PLLA 1QW1A 2MF2A 2DJZA 2P0PA 3V8JA 4M7DD 3FJPA 2MMPA 2EQMA 5A2QE 3CCLA 4JLGA 4HA8A 5GAMh 3N5BB 3UDCA 2JTFA 2RJCA 4JJNK 3MEVA 4MDWA 1KC8C 3M54A 5AYFA 4LD9K 1QVGA 5J26A 2XKOC 4PJOC 4M78E 4JDSA 3OYHA 3OYBA 1H641 2R57A 3TCJA 4BUGA 4QVDA 2RA2A 2RHUA 2ZCFB 5FROA 3X28B 4PJOD 5LJ5j 2QQRA 5LJ5e 2PU9B 1VIEA 2F69A 4OGEA 1VQ4T 3JRZA 4FIBA 1BKBA 1RI0A 1XQHA 3GNGA 4PLIA 1LNXA 4A4FA 3I55T 1VQPA 3OYDA 3MHXA 2HAXA 1N6AA 2GF7A 2LT4A 5CR2A 1Q86C 3F70A 1O75A 3M9QA 2QQSA 2XIDA 3L2UA 1KC8U 5LJ3j 4E7IA 5LJ3e 3JB9H 5LJ5f 4BDZA 2DVEA 4ZTJA 4J7IA 1GXIE 3OBWA 1RL2A 5GAN4 1X01A 2LQKA 1M1GA 2RJFA 3RKXA 1NJIU 4M7AF 4JUVA 4GLKA 1Y71A 4XAXB 3UWNA 4C0ZA 3VKIA 2DTOA 5CQYA 3CCMA 2MI6A 5C6SA 3CPFA 3WVEB 1XOVA 2VXEA 3LGLA 4A4KA 3E9GA 2HD0A 3CMEA 4HT9A 4M7AG 5GMKh 2RB6A 4XU1A 4BDYA 3OS5A 4M7DA 5HY6A 3JB9I 5C0MA 5I2SA 4F7UB 3LLRA 4F7UA 3CCUA 5LJ3f 5CKFA 3CCQT 4FT4A 2F5TX 4M75F 4C92G 4XTZA 3M58A 2WACA 3C12A 3C95A 4Y28E 3CBOA 4C8QG 1D3BB 4OGCA 2JOYA 4VUBA 5HKCA 1D3BA 4BI8B 5GAMe 3C94A 1QVPA 5GAMj 3CXCS 2VV5A 2RI5A 4M75G 3S6WA 3JB9G 1Y07A 4PJOA 1M90U 2DKGA 3CCQA 3DLLA 5CKHA 4DQ2A 5GAN5 1QP3A 4QW2A 3JAME 1P92A 1JJ2S 3BDLA 4MMLA 3L1AA 5GMKl 4BB7A 2RJEA 4LDXA 3SB2A 3HHTB 2QDYB 2M9UA 5HK0A 1U1SA 3OYNA 1VQ9T 1HXDA 2G3RA 3VUBA 2EWNA 1M8VA 4OP0A 5KCOA 3JCMe 1G3WA 2DPPB 3QG1A 3VU3C 1WJRA 1G5VA 3H6ZA 3A8MB 3META 4F7UE 3J7AF 2CGHA 4N0AC 2FYKA 4C0DC 3CMAT 1YI2T 2ZGWA 5CK9A 2V8KA 1U8RA 2XD0A 3BFMA 2E70A 2WSCE 1YITT 4J6XA 1NPRA 2VC8A 2CZ6B 4JS4A 3M57A 4N4IA 1I8FA 4JLIA 2RM4A 4NL2A 2GFUA 5KE2A 2PUKB 1VQ7T 1YI2A 2E1HA 5GANg 3J80E 3CCVA 4M77G 2QQAA 4OB3B 3HRTA 3GF5A 4M78G 5GANf 2IG0A 1KQ1A 4C0FA 1BI1A 3JCMf 2E65A 2KAFA 4D6WA 3RIRA 2BIVA 2FHDA 4PKCC 2ZPEB 2AHJB 2EQUA 2XDPA 2L89A 2A3LA 2ZPFB 4ELZC 1YJ9T 4HCZA 3X25B 3VUZA 1FWZA 2XG8D 4A4GA 1VQ7A 1B34B 3NTHA 2BKDN 3PMTA 5I2MA 1B34A 1K9MC 5GMKj 2V8JA 1H3ZA 5GMKe 2RI2A 3LH0A 4XTXA 3G6EA 1IZ6A 5FLXE 2Y4YA 2PQWA 1YIJT 1BI2A 5CO7A 2R58A 3VJPA 1I5LA 1I81A 3RKWA 3HFNA 3QJYA 3S3NA 2EQJA 2OTJA 3NTIA 2EAYA 1WQWA 3HSBA 3PIOA 3DB4A 1PSEA 3A5ZB 2DXBA 3Q1JA 2FVUA 5FU6B 1M5Q1 4B9XA 1XNIA 2WSEE 4ZGEB 1G3YA 4XTVA 4DOWA 4YTLA 2DXUA 3VYHB 3X24B 3ZEHA 1TH7A 3PTAA 1AHJB 2EKOA 2LCCA 2LRQA 3UPUA 2YLBA 2L3RA 2E12A 3LX7A 4BI3A 1VQOT 3JCMJ 1LJOA 2CKKA 1OYXA 3GIBA 2F5KA 2LX9A 1VQ6T 5M9OA 2K5LA 3QIIA 4MMKA 2E5QA 1BYMA 3A8GB 2YHTA 3QYGB 4RKUE 4M7AC 1G3TA 2H3JA 2D9TA 5A0GA 3WVDB 2QA4T 4FSXA 4M7AD 4IUTA 1VQKT 3QSUA 2JN0A 1VQOA 4E7HA 1X6OA 4OB2B 3QPHA 3RERA 1Q7YC 5GAOm 4C92C 5GAOl 2OAUA 4FL6A 3RESA 4C8QC 1VQ4A 1KHIA 2ZZDA 1O9SA 3A8LB 4LDWA 2MAMA 2HBPA 3VV0A 4C92D 4ZN3A 3I56T 1PSFA 1N8RC 2O4XB 4M75C 4NS5A 4C8QD 2O4XA 1VQKA 3SWNC 5LJ5g 3CCET 4R56A 1YJNT 1OZ3A 3INZA 3I55A 4J6YA 2DEQA 4M75D 3JCMb 1W2BS 3JB9D 2OTLT 3UT1A 1M4ZA 3G71T 4OB1B 2K57A 4M7DF 3OW2S 3GNFB 4NOYA 4XU3A 4F7UF 2Y90A 3I56A 2GCXA 3OS1A 3TU4K 1ZHIA 2R5MA 3CPWA 3DLMA 4Q5WA 4QQ6A 5CKBA 3T9NA 3CC4T 4IUUA 4DA4A 1YJNA 2DAQA 5FU7C 3FB9A 2NLUA 4XK8E 2OTLA 3OS0A 3JCMW 2PUOB 2XHCA 3GLXA 2BUDA 5D6XA 3V7CA 3L42A 2D0QB 4BE2A 3URGA 2XK0A 4M7DB 2KVQG 3QBYA 4PJOF 4BY6C 3CBMA 3X20B 5LJ3g 3OYLA 3JCMP 3GP8A 2CZ0B 4A4HA 3MP1A 5A0LA 3PIPA 1JRIA 3S3MA 3CC4A 2P0QA 2JZ2A 3OQ5A 1Q86U 1UGSB 4EMKC 5CAIA 1KD1C 1WJQA 4QQGA 3FLGA 5LJ5d 1QVGS 4M77C 4ATOA 4EPCA 1K73C 4PL6A 2JUFA 2LC4A 3QHSA 2EJFA 4M78C 1Q82C 3MEUA 2EQKA 2RI3A 5FRNA 4C5HA 4M77D 2ZPHB 5D6WA 2D6FA 1IREB 4PJOB 4M78D 3V8KA 5CKDA 2A7YA 3PGGA 3PNWC 5GMKm 2X4WA 4XTUA 2KMTA 5FRMA 4RCCA 4O6JA 1K8AC 3ZBDA 3ER0A 1Y7XA 4Z02A 5GAN6 3RMSA 2DXCA 2P0KA 1I4K1 5EG2A 1VQ5T 3EFSA 3KXTA 4M7DE 1LOJA 4JRIA 2VYTA 3CD6T 1UGQB 3X26B 3WXMB 3L2WA 5GAMg 2RHZA 5LJ3d 4JS5A 1KQSA 1QVFA 4MDXA 1XTDA 3GPLA 5GAMf 4C92B 3HRSA 3P8HA 3OB9A 4QVZA 4C92A 4C8QB 2IVWA 4Y91A 4C8QA 2XDDA 1YHQT 1VQ9A 1KQ2A 1VQ5A 1WGSA 4O5VA 4J8OA 1R8OB 4M75A 3BY7A 3SWNA 2XI9A 3LYIA 4PJOE 1YCYA 2K2VA 2L5QA 5J3BA 4KBMB 3M56A 3CMAA 3M5AA 4ME7A 3JCMg 4A4EA 3OYAA 1SSFA 1S72T 4XTWA 1M1KC 3OYGA 3HRUA 4C5GA 2I2LA 3L2ZA 3L2VA 5GAN7 1YITA 3PMIA 1YHQA 3CEYA 3ME9A 3TREA 3OYCA 4XTYA 4JRKA 4DOVA 4JRPA 3JB9J 3PT9A 3S3OA 4OMFB 1NE8A 1KG1A 4E47A 3FRNA 1S72A 2DIGA 2RK1A 5DM7R 2RH2A 4J5YA 2X4XA 1W4SA 4BY6B 2HQEA 2O01E 3OS2A 1UEBA 3L2RA 1BI3A 3V7SA 5LJ3h 2QTXA 3QUIA 3OMGA 4J7FA 4UC4A 3OYKA 2QEXT 3DB3A 1QP2A 1YJ9A 3MEWA 1M1FA 4EMKA 2DD5A 3M53A 4M77B 5KH6A 4GY5A 2XDBA 1BI0A 2JNGA 4FT2A 1UGPB 2QQ9A 4M77A 4A54A 2DD4A 5GANd 3L2QA 4HT8A 3OBYA 4M78A 3JCMd 5D6YA 2X4JA 3CCJT 1YIJA 3J81E 5GAN2 4BI4A 4ZN1A 3GOXA 2QEXA 5DLQE 3QZ9B 3RKYA 3LWHA 4XU2A 3CCLT 3P8DA 2QQBA 2L8DA 5GAN8 2Y4XA 2ZPIB 4KT0E 2X35A 3H8ZA 4OB0B 4ZGDB 3V8LA 4PNOA 4X9CA 4CRIA 5GAOp 3G4ST 2EYQA 3CCST 1K9MU 3HPWA 4OVAA 2DO3A 4ELYC 4C0DB 1VQMT 1HK9A 3M4GA 4N0AA 3ASKA 4XQ3A 3G7ZA 3FEOA 4IUQA 2LCLA 1VQ6A 2RK2A 3HL8A 2RHYA 2YLCA 3CCRT 4M77E 2EJGA 3G4SA 5GAOr 3CXCA 2EFIA 3CCSA 3M4YA 2KK4A 2DZ9A 3BDUA 2QA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRI A;  2ZGW A;  2EJ9 A;  4EMK C;  5CAI A;  3BFM A;  5LJ5 d;  3JCM Q;  5GAN h;  4M77 C;  4J6X A;  5GAN 3;  1WQ7 A;  3JCM h;  3QHS A;  4M7D C;  1BIA A;  2E64 A;  2EJF A;  2VC8 A;  4M78 C;  4A53 A;  1I8F A;  4JLI A;  4M77 D;  4PJO B;  2RM4 A;  4NL2 A;  3V8J A;  2DJZ A;  4M7D D;  4M78 D;  3V8K A;  3FJP A;  5I21 A;  5GMK i;  2E1H A;  5GAN g;  4M77 G;  5GMK m;  3PGG A;  4M7D G;  5GAN f;  4HA8 A;  4M78 G;  4XTU A;  5GAM h;  1KQ1 A;  1U1T A;  4RCC A;  3JCM f;  2E65 A;  4F7U G;  5GAN 6;  3RIR A;  1I4K 1;  3EFS A;  4M7D E;  4PJO C;  4M78 E;  1LOJ A;  4JRI A;  1H64 1;  1JBM A;  5GAM g;  1B34 B;  5LJ3 d;  4QVD A;  2RA2 A;  1B34 A;  2CGH A;  2DTH A;  4PJO D;  5GMK j;  5GAM f;  5GMK e;  5LJ5 j;  4XTX A;  4C92 B;  5LJ5 e;  4C92 A;  4V2S A;  4C8Q B;  4PJO G;  4Y91 A;  4C8Q A;  1KQ2 A;  1I5L A;  1I81 A;  1WNL A;  3RKW A;  3HFN A;  2DXT A;  4M75 A;  3QO3 A;  3BY7 A;  1LNX A;  3SWN A;  4PJO E;  2EAY A;  1WQW A;  3HSB A;  2DZC A;  1YCY A;  1N9S A;  1M5Q 1;  2E10 A;  3JCM g;  4C92 F;  4WF2 A;  4XTV A;  4C8Q F;  4XTW A;  2DXU A;  4M7A B;  2I2L A;  2E41 A;  1TH7 A;  3L2Z A;  5GAN 7;  4M7A A;  4XTY A;  4JRK A;  3JB9 F;  2YLB A;  5LJ3 j;  3V7R A;  1Y96 B;  5LJ3 e;  3JCM J;  1LJO A;  5LJ5 f;  1Y96 A;  3GIB A;  2DVE A;  3JB9 J;  3JB9 H;  3EFR A;  5GAN 4;  4MMK A;  1X01 A;  2DTI A;  3RKX A;  2YHT A;  4M7A C;  4M7A F;  4J5Y A;  1N9R A;  4JUV A;  2DTO A;  3FIF A;  3JCM X;  3V7S A;  5LJ3 h;  4M75 B;  2VXE A;  2QTX A;  3QUI A;  4M7A D;  3QSU A;  2JN0 A;  3SWN B;  5DY9 A;  5GAO n;  4HT9 A;  3HFO A;  4XU0 A;  4EMK A;  5GMK h;  4M7A G;  2RB6 A;  4XU1 A;  5LJ5 h;  3RER A;  5GAO m;  4M77 B;  4C92 C;  5GAN j;  5GAN e;  4M77 A;  4A54 A;  5GAO l;  2RD1 A;  4C8Q C;  3RES A;  3JCM V;  5GAN d;  5GAO q;  4M78 A;  3JB9 I;  3JCM d;  4HT8 A;  4M7D A;  4F7U B;  4M7A E;  4C92 D;  4F7U A;  5LJ3 f;  5GAN 2;  1BIB A;  3RUX A;  4M75 C;  2FB7 A;  4C8Q D;  4M75 F;  3SWN C;  5LJ5 g;  4J6W A;  3RKY A;  4XTZ A;  4XU2 A;  2VXF A;  4C92 G;  3INZ A;  4NL3 A;  3AHU A;  4J6Y A;  2DEQ A;  4M75 D;  1D3B B;  4C8Q G;  3JCM b;  5GAM j;  5GAN 8;  1D3B A;  4M77 F;  5GAM e;  3JB9 D;  3BW1 A;  5GAM d;  3V8L A;  2K57 A;  4M7D F;  4M78 F;  4M75 G;  4PNO A;  4RCB A;  1WPY A;  4X9C A;  4NOY A;  4XU3 A;  4C92 E;  4F7U F;  2Y90 A;  4C8Q E;  5GAO p;  3JB9 G;  4PJO A;  2DKG A;  5GAN 5;  4DQ2 A;  4EMG A;  4X9D A;  4QVC A;  1HK9 A;  3M4G A;  4N0A A;  4M75 E;  4MML A;  2HNI A;  3FB9 A;  3L1A A;  4XQ3 A;  4EMK B;  5GMK l;  3JCM W;  3SB2 A;  2YLC A;  3V7C A;  1U1S A;  3JCM c;  1HXD A;  4EMH A;  4M77 E;  2EWN A;  1M8V A;  4M7D B;  2EJG A;  4M78 B;  4OP0 A;  3JCM e;  5GAO r;  1MGQ A;  4PJO F;  3VU3 C;  5LJ3 g;  3JCM P;  4F7U E;  2DZ9 A;  4N0A C;  3BDU A;  2FYK A; 
#chains in the Genus database with same CATH topology
 1VQM A;  2K4Y A;  1MND A;  4OMO A;  2VGM A;  3JCM Q;  2FPE A;  3SD4 A;  3FC3 A;  1JJ2 A;  3LW5 E;  1KJW A;  2EQI A;  2LJ1 A;  5GMK i;  5I21 A;  2PNI A;  4M7D G;  4FU6 A;  2E6N A;  2EYX A;  4X1V A;  1NLO C;  4F7U G;  4E7K A;  1QWE A;  3QKJ A;  3CCM T;  1TWB A;  1X43 A;  1Q81 U;  3CC2 T;  1VIF A;  1PCX A;  3U23 A;  1MMA A;  1VQ6 Q;  2CYZ B;  4JRQ A;  2DXT A;  3P8B B;  2E10 A;  4C92 F;  3OYY A;  5LL6 S;  4M7A B;  2B8A A;  1ABO A;  4M7A A;  2CT4 A;  1N27 A;  3R6O A;  2VUB A;  4LDU A;  1ZBJ A;  2PVO B;  5L8R E;  1WDX A;  1QVG P;  3CCE Q;  1N9R A;  1G3S A;  2JTM A;  3SFM A;  3MCA B;  1RAF B;  2K5F A;  4OF1 A;  3JCM V;  3CC4 Q;  5GAO q;  1WJS A;  2AIR B;  1BIB A;  2NUT B;  3RUX A;  2EIF A;  2NUT A;  4HCC A;  3QXE B;  2K3X A;  2VXF A;  2L3S A;  4LDY A;  1ZQ1 A;  4RCB A;  4B9W A;  4C92 E;  3MJX A;  2DIL A;  1YJW T;  1VOM A;  4N4G A;  3KUF A;  2KQW A;  3LGF A;  4OMQ A;  4MZT A;  4QQD A;  4LE9 A;  2KSS A;  4P5N A;  2HNI A;  3G6E T;  2JMA A;  1BCM A;  1Q95 G;  2RQR A;  2VGN A;  4CC2 A;  2CS7 A;  2DLP A;  1HYO A;  1M1K U;  3OY9 A;  2EJ9 A;  2LJ3 A;  2CP7 A;  2M16 A;  2R5A A;  3DKM A;  5IXF A;  2V8I A;  4L5G A;  2JM9 A;  4PLL A;  1QW1 A;  2HCK A;  1RAI B;  3FJP A;  1Q7Y R;  4J9F A;  1CSK A;  2AK5 A;  1GFC A;  1TOV A;  2RJC A;  3M0Q A;  3UAT A;  3M54 A;  1QVG A;  3OYB A;  1WHL A;  5FRO A;  4PJO D;  2YT6 A;  2F1L A;  2QTV A;  3JRZ A;  4PLI A;  1OUL A;  2AKK A;  4A4F A;  1VYT A;  1R0C B;  2HAX A;  3MHX A;  1N6A A;  3CC7 Q;  1O75 A;  3M9Q A;  1KD1 R;  1QCN A;  4ZTJ A;  4JPB W;  2LMJ A;  1GXI E;  2LQK A;  2RN8 A;  1M1G A;  2RJF A;  3CCL Q;  1BBZ A;  2FZG B;  3VKI A;  2HQH A;  5CQY A;  5KYY B;  3CCM A;  3WVE B;  5KYY A;  2VXE A;  2QGF B;  3LGL A;  2OJ2 A;  3R6N A;  3CCS Q;  3OS5 A;  1LCK A;  6AT1 B;  3LLR A;  2HKN A;  3EFO B;  1D3B B;  5GAM j;  4J9D A;  1D3B A;  5D7U A;  3C94 A;  4KGV B;  4M75 G;  1VQP Q;  1Y07 A;  3CCQ A;  3DLL A;  5GAN 5;  4DQ2 A;  1OEB A;  3BDL A;  2O2O A;  1VQ9 T;  1U1S A;  1GCP A;  3VUB A;  2EWN A;  1M8V A;  4OP0 A;  3JCM e;  1A0N B;  3GBQ A;  3RBB B;  1G5V A;  2K9G A;  1C6V X;  1WXU A;  2CT3 A;  3BFM A;  3CME Q;  1ZUK A;  4JS4 A;  4J9B A;  2GFU A;  1WHH A;  1VQN Q;  3RR6 A;  2E1H A;  2EW3 A;  3HRT A;  3VS4 A;  5KYU A;  2AHJ B;  2XDP A;  2ZPF B;  2A3L A;  1FWZ A;  1B34 B;  2HDA A;  1B34 A;  5GMK j;  5FWC A;  3LH0 A;  3G6E A;  2E4H A;  1K76 A;  1AZE A;  2FRY A;  1D1B A;  1WQW A;  1KC8 R;  3DB4 A;  2DXB A;  2FVU A;  1M5Q 1;  2FEI A;  4B9X A;  3VYH B;  3X24 B;  3ZEH A;  2LRQ A;  2L3R A;  4BI3 A;  1LJO A;  2CKK A;  2KE9 A;  3GIB A;  4PFP A;  2E5Q A;  1BYM A;  2L3Q A;  2M0Y A;  3CCV Q;  2YHT A;  4RKU E;  1K1Z A;  2BE7 D;  2QA4 T;  4M7A D;  1VQK T;  3QSU A;  2JN0 A;  2QG9 B;  2E3I A;  2JW4 A;  2YUQ A;  1H92 A;  1WYX A;  5GAO m;  5GAO l;  4C8Q C;  1BCO A;  1KHI A;  2K6D A;  2ZZD A;  3A8L B;  4AFZ C;  3VV0 A;  1N8R C;  4NS5 A;  2JXB A;  3SWN C;  1BB9 A;  2OAW A;  1YJN T;  3INZ A;  2DEQ A;  3JCM b;  3JB9 D;  4J9I A;  3G71 T;  4M7D F;  3OW2 S;  1JXO A;  4F7U F;  2Y90 A;  2FZC B;  1ZHI A;  4Q5W A;  2NLU A;  1YFN A;  3C0C A;  3GLX A;  2BUD A;  4FSS A;  2D8J A;  2KVQ G;  3EG2 A;  3OYL A;  4DBF A;  1YNZ A;  2QGG A;  3GP8 A;  2CZ0 B;  5KYW B;  5KYW A;  3CC4 A;  2JZ2 A;  2PZ1 A;  1Z9Z A;  4FW1 A;  1WJQ A;  4QQG A;  3FLG A;  4M77 C;  1QCO A;  2EGE A;  3QHS A;  2LJ0 A;  4M78 C;  3EG3 A;  4C5H A;  2ZPH B;  3PNW C;  2Z0W A;  2KMT A;  4RCC A;  1K8A C;  3ZBD A;  3RMS A;  3I55 Q;  1VQ5 T;  1H3H A;  1I4K 1;  1RAB B;  4M7D E;  4GLM A;  2VYT A;  1PRM C;  3WXM B;  2GGR A;  2RHZ A;  1XTD A;  5GAM f;  4C92 B;  3P8H A;  2KT8 A;  4QVZ A;  4AG1 C;  4C92 A;  2IVW A;  1VQ9 A;  2D8H A;  2NWM A;  1UGV A;  1AVZ C;  3BY7 A;  1X27 A;  1QMC A;  4KBM B;  1OQK A;  1T3S A;  2MIO A;  3M0R A;  1EX4 A;  4A4E A;  4XTW A;  4HCB A;  1IB8 A;  1MNE A;  2KXC A;  5GAN 7;  3PMI A;  3OYC A;  4XTY A;  4JRK A;  4Z8A A;  1VA7 A;  2QAS A;  3S3O A;  5HCK A;  2DIG A;  2RK1 A;  3OS2 A;  2O01 E;  2M51 A;  1ZX6 A;  1TSF A;  3V7S A;  3VS7 A;  2L3P A;  5KH6 A;  2XDB A;  1BI0 A;  1UGP B;  2DD4 A;  4HT8 A;  5D6Y A;  2X4J A;  3CCJ T;  1MV0 B;  3QZ9 B;  2LCS A;  2QQB A;  2L8D A;  2ZPI B;  4ZGD B;  3A1P A;  4X9C A;  5GAO p;  3HPW A;  2MK5 A;  4OVA A;  1YHQ Q;  1VQM T;  2RK2 A;  2O9V A;  1VQ7 Q;  3CCS A;  1C0M A;  3M4Y A;  4HVW A;  2QA4 A;  4AFS C;  3H41 A;  5IT9 E;  1ZA1 B;  1JEG A;  1YJ9 Q;  2QYZ A;  3H9N A;  1EIF A;  4F04 B;  2E3H A;  1YIJ Q;  5CQX A;  3SDZ A;  3JSC A;  4TVR A;  2ED1 A;  3RDV A;  3G71 A;  2RJD A;  2QDL A;  2GFA A;  1Q7Y U;  4C5I A;  1TUC A;  1V29 B;  1JBM A;  3KBG A;  1DJ7 B;  4KH1 B;  3NMZ C;  2L0A A;  4BE0 A;  2HZY A;  4PJO G;  1NZ9 A;  1MMG A;  1WNL A;  2DIQ A;  3E1S A;  1M27 C;  2RQV A;  2K3Y A;  1VQ8 A;  1ZLM A;  1KFZ A;  5IN1 A;  1LPL A;  4WF2 A;  3CBP A;  4FYY B;  1VQN A;  2QI2 A;  2C0O A;  3M59 A;  2X3W D;  4KUI A;  3UF4 A;  3TEE A;  2GTO A;  1Y96 B;  3A8H B;  3E9F A;  1Y96 A;  5FU6 C;  1SRM A;  2ZPG B;  2XU8 A;  2OTL Q;  2O9S A;  3FIF A;  1KD1 U;  4KUD K;  3ZFJ A;  4E7L A;  3SWN B;  1K73 U;  1Q82 U;  3OYF A;  3BE3 A;  4MZM A;  5FWB A;  2A36 A;  4ZGJ B;  3CPW S;  4E7Z A;  2DL7 A;  2OX7 A;  3EAE A;  4FM4 B;  2K5I A;  2KNB B;  1X75 C;  3MO8 A;  4J6W A;  4LDV A;  1K0S A;  2G6F X;  3AHU A;  1GBQ A;  2RO0 A;  1PWT A;  4LD6 A;  2BTT A;  3I5S A;  4L59 A;  4CC7 A;  2VB6 A;  3D7S B;  1WPY A;  4JJC A;  4RMO A;  1E6G A;  5CVI A;  2P4R A;  1FYN A;  1TS9 A;  4M75 E;  3O5Z A;  3QZ5 B;  3A8O B;  1D0X A;  2LTO A;  2JVV A;  2KR3 A;  2YUN A;  4BD3 A;  4M78 B;  2C06 A;  2FL7 A;  2CDT A;  4IUR A;  2LDM A;  5KCH A;  3CD6 Q;  3C4S A;  2A28 A;  2CZ1 B;  2X9H A;  3PVQ A;  1OZ2 A;  2E64 A;  5IAY A;  2ATC B;  3CCJ A;  2P0P A;  1G8X A;  4PK4 A;  1U06 A;  4F16 A;  5A2Q E;  2QK0 A;  5GAM h;  2JTF A;  1KC8 C;  4JJN K;  3MEV A;  4MDW A;  5AYF A;  4JDS A;  1H64 1;  2R57 A;  3SHW A;  3TCJ A;  4BUG A;  1FMK A;  4QVD A;  2ZCF B;  3X28 B;  1PHT A;  1YWO A;  4OGE A;  1VQ4 T;  1GCQ C;  1RI0 A;  3GNG A;  2AT1 B;  3REA B;  1GL5 A;  1X2Q A;  1KK7 A;  2K2M A;  5CR2 A;  2NYS A;  3F70 A;  4DBQ A;  3VRY A;  1SSH A;  2XID A;  1M90 R;  3L2U A;  1KC8 U;  4PJJ A;  5LJ5 f;  4RTY A;  3OBW A;  2NUZ A;  1OPK A;  4GLK A;  1Y71 A;  4XAX B;  4C0Z A;  2MI6 A;  5C6S A;  1XOV A;  4A4K A;  1K8A R;  4HT9 A;  3G4S Q;  4M7A G;  5GMK h;  2RB6 A;  1WHM A;  2CUD A;  4BDY A;  4M7D A;  5HY6 A;  2RNA A;  4F7U B;  4F7U A;  1UHC A;  5LJ3 f;  3ULR B;  3CCQ T;  2F5T X;  3CCR Q;  2A37 A;  4XTZ A;  3M58 A;  1QKX A;  4Y28 E;  2D0N A;  4VUB A;  5GAM e;  2CP5 A;  1QVP A;  3JB9 G;  2DMO A;  3JAM E;  2DBM A;  1JJ2 S;  4MML A;  2RJE A;  1FMW A;  3HHT B;  3EGD B;  5HK0 A;  3OYN A;  3EGD A;  2G3R A;  2HL5 C;  4PFZ A;  3I9Q A;  2AZS A;  4HVU A;  3A8M B;  3MET A;  4N0A C;  1NBE B;  3CMA T;  2V8K A;  3ZL7 C;  1E6H A;  2WSC E;  1YIT T;  1RLP C;  2CZ6 B;  1QCF A;  4JLI A;  4JZ3 A;  2PUK B;  5GAN g;  3J80 E;  2DE0 X;  3EG0 A;  3CCU Q;  2GTJ A;  3GF5 A;  1BI1 A;  2E65 A;  2KAF A;  3H0I A;  4A4G A;  1VQ7 A;  1GRI A;  2BKD N;  4JZ4 A;  1H3Z A;  3A98 A;  2RI2 A;  5GMK e;  1IZ6 A;  4AFU C;  2EGC A;  1I5L A;  4HXJ A;  1SF9 A;  3RKW A;  1AWX A;  2B86 A;  3EHR A;  3HFN A;  3QJY A;  4Y92 A;  2EQJ A;  3PIO A;  3UA6 A;  1W1F A;  5FU6 B;  2YUO A;  1RAC B;  4ZGE B;  4YTL A;  2DXU A;  1TH7 A;  3PTA A;  1PNJ A;  1VQL Q;  2E12 A;  3JCM J;  2KBT A;  1AWJ A;  2LX9 A;  1VQ6 T;  5M9O A;  3QII A;  2CH4 A;  4KH0 B;  2H3J A;  2X3X D;  4RTV A;  1MMN A;  4FSX A;  1EZZ B;  3QPH A;  1Q86 R;  4AG2 C;  4C92 C;  2KGT A;  3RES A;  1VQ4 A;  2MAM A;  4J9C A;  1PSF A;  4C8Q D;  5LJ5 g;  4Z88 A;  3CCE T;  4R56 A;  3NHN A;  1M4Z A;  2OTJ Q;  4J9E A;  1WXB A;  2KT1 A;  1IHW A;  3DLM A;  4DA4 A;  3CC4 T;  5FU7 C;  3FB9 A;  4XK8 E;  2OTL A;  3JCM W;  4D8D A;  3V7C A;  3L42 A;  5LJ3 g;  4PJO F;  1MUZ A;  3JCM P;  1T0J A;  1VYV A;  1M2O A;  3MP1 A;  1JRI A;  2P0Q A;  3OQ5 A;  1M2V A;  2COW A;  2RPN A;  1AD5 A;  1QVG S;  4EPC A;  2DF6 A;  2JUF A;  2EJF A;  2EQK A;  3E2U A;  1UG1 A;  1W70 A;  1YWP A;  4M77 D;  5D6W A;  1UTI A;  4M78 D;  2A7Y A;  5FRM A;  1VQK Q;  4O6J A;  3ER0 A;  1Y7X A;  3MKD A;  1GCQ A;  2PTK A;  2AZV A;  3EFS A;  3KXT A;  1I5O B;  4JRI A;  5IH2 A;  1UGQ B;  3X26 B;  3EGX A;  3L2W A;  1KQS A;  4JS5 A;  2DRK A;  2MOX A;  1QVF A;  3HRS A;  3OB9 A;  2XDD A;  4Y91 A;  2KYM A;  2DM1 A;  2V1R A;  4M75 A;  3EG1 A;  4PJO E;  3CMA A;  4DEX A;  2EYY A;  2K7A A;  3OYA A;  5KYU B;  2DRM A;  4C5G A;  3L2V A;  1YIT A;  4LUD A;  3CEY A;  3ME9 A;  3TRE A;  1K9M R;  1WHK A;  4DEY A;  4DOV A;  2RQW A;  3PT9 A;  2EPD A;  1KG1 A;  3FRN A;  2RH2 A;  4BY6 B;  1RLQ C;  1BI3 A;  5LJ3 h;  2QTX A;  4J7F A;  3OMG A;  3OYK A;  3DB3 A;  1QP2 A;  4EMK A;  4ZNX A;  1HD3 A;  4A54 A;  3L2Q A;  3OBY A;  4RTW A;  2J06 A;  2JM8 A;  2F2W A;  3RKY A;  1VQ5 Q;  3CCL T;  2EVR A;  5GAN 8;  1QLY A;  1R77 A;  2BZ8 A;  1YI2 Q;  2J6K A;  4PJN A;  3CCS T;  2DO3 A;  2MYS A;  4ELY C;  4N0A A;  3G7Z A;  3QDF A;  4IUQ A;  1VQ6 A;  2YLC A;  4M77 E;  3M0U A;  3G4S A;  5GAO r;  3CXC A;  2I0N A;  3EG9 B;  3EG9 A;  3OYI A;  1NJI C;  2KDS A;  1VQP T;  2D1X A;  3CCR A;  5CCA A;  1U5S A;  4C5E A;  5CKE A;  2F2X A;  3VYG A;  4IUP A;  1WX6 A;  5IHN A;  1WZO A;  3CCE A;  5IXB A;  3LWI A;  5EC7 A;  2FG0 A;  3MP8 A;  2PVD B;  2ROT A;  2LNV A;  3CME T;  3QJ6 A;  2H3E B;  1VQ8 T;  2LQN A;  2DL3 A;  1M90 C;  1N8R U;  4HKE A;  1W2B P;  1VQN T;  2M1H A;  1VQO Q;  2H8H A;  2LT1 A;  1ZUY A;  1AWO A;  3QDR B;  1PRL C;  3QO3 A;  4PFO A;  2DZC A;  5DLO A;  1ZSZ A;  2RQU A;  2VVK A;  1ZA2 B;  2XIC A;  4ZTF A;  2COY A;  2E6Z A;  1J3T A;  3JB9 F;  3HTR A;  1AOJ A;  1YBY A;  2M0O A;  3EFR A;  3OMC A;  3I56 Q;  2KRS A;  2DTI A;  4ORZ A;  2RHI A;  5CIU A;  2WSF E;  3OA6 A;  2HMA A;  2EKH A;  3OYM A;  1UB4 A;  3MPU B;  2EYZ A;  4ANJ A;  5GAO n;  1M1K R;  3OYJ A;  4XU0 A;  5I22 A;  1KHC A;  5GAN j;  2GQI A;  2J6F A;  2M02 A;  3FDR A;  3RMQ A;  4M7A E;  1M8M A;  1K8A U;  3CCV T;  2PVG B;  4JJB A;  1JU5 C;  4NL3 A;  5FU7 B;  1FX7 A;  2KY9 A;  1VQL A;  1X69 A;  5GAM d;  2QXF A;  4X34 A;  2E5K A;  1MHN A;  4EMG A;  1B3Q A;  5KYN A;  2P4T A;  2IPO B;  2JS0 A;  2VWF A;  4BE1 A;  4R55 A;  1G83 A;  5A0D A;  3O8V A;  1FXX A;  1W6X A;  3JCM c;  2CZ7 B;  1W2B A;  1MGQ A;  2HQX A;  4E2F B;  5KYX A;  1CKB A;  4C0G A;  4EDU A;  5J39 A;  1D1C A;  3CC7 A;  2ZPB B;  3TVT A;  3OSS C;  2YRV A;  4II1 A;  1UGR B;  1WQ7 A;  4M7D C;  1SPK A;  4A53 A;  3V8J A;  2DJZ A;  2MMP A;  2EQM A;  3CCL A;  4JLG A;  4HA8 A;  1X2K A;  5J26 A;  2XKO C;  3LH5 A;  4JJD A;  1S72 Q;  4LXC A;  4IIO A;  5LJ5 j;  2PU9 B;  3NGP A;  1VIE A;  2F69 A;  1PG5 B;  1UE9 A;  1BK2 A;  1SHF A;  1V76 A;  1TXQ A;  3I55 T;  1VQP A;  2QEX Q;  3OYD A;  2GF7 A;  1Q86 C;  2DL4 A;  2KRO A;  2LQW A;  3FJ5 A;  2QQS A;  4FCY A;  5LJ3 j;  1OX8 A;  3JB9 H;  1ZUU A;  1RL2 A;  2RQT A;  3RKX A;  4EIK A;  2CUB A;  4JUV A;  3UWN A;  2NUP B;  2NUP A;  3E9G A;  2HD0 A;  2FPD A;  4LUE A;  3VS1 A;  3CME A;  1AZG B;  5C0M A;  1NG2 A;  4M75 F;  2MCN A;  1WFW A;  3C95 A;  4C8Q G;  3CBO A;  2JOY A;  4BI8 B;  2V26 A;  2VV5 A;  1AWW A;  4D8K A;  3S6W A;  5ECA A;  3VRZ A;  2GNC A;  4PJO A;  1D1A A;  2DKG A;  2DX1 A;  5CKH A;  1QP3 A;  4QW2 A;  1P92 A;  5GMK l;  4BB7 A;  3VS0 A;  2QDY B;  2M9U A;  2V1Q A;  1ZSG A;  3H0F A;  1G3W A;  3VU3 C;  4FYV B;  1WJR A;  3VS6 A;  3J7A F;  2CGH A;  1PM3 A;  2FYK A;  2ROL A;  3CCM Q;  2J05 A;  1U8R A;  2XD0 A;  4J6X A;  3EH1 A;  3M57 A;  3CC2 Q;  1UJ0 A;  2RM4 A;  2O31 A;  1UHF A;  1VQ7 T;  2CP2 A;  4PJM A;  1WHJ A;  3CCV A;  1YI2 A;  3KFV A;  4M77 G;  1XJW B;  5GAN f;  4M78 G;  1KQ1 A;  4C0F A;  3JCM f;  3RIR A;  2DBK A;  4ELZ C;  3THK A;  2YRD A;  1YJ9 T;  3SEM A;  3NTH A;  5I2M A;  2W0Z A;  1K9M C;  2V8J A;  1QQJ A;  2YXY A;  2DA9 A;  4XTX A;  5FLX E;  5IHK A;  2JMC A;  1YIJ T;  1BI2 A;  5CO7 A;  2R58 A;  3VJP A;  3S3N A;  2YSQ A;  3NTI A;  3HSB A;  1D0Z A;  1G3Y A;  4XTV A;  1ABQ A;  2EKO A;  1NJI R;  2DER A;  1Y57 A;  1RI9 A;  2YLB A;  3UPU A;  3LX7 A;  2DYB A;  2P84 A;  3QYG B;  1G3T A;  3WVD B;  4IUT A;  2ECZ A;  1VQO A;  4E7H A;  1GBR A;  1X6O A;  1YJW Q;  2EBP A;  3VS5 A;  2FZK B;  1QWF A;  2HKQ B;  4OMP A;  1M3B A;  2DET A;  2OAU A;  2DYI A;  1I07 A;  1O9S A;  3G6E Q;  4C92 D;  2BZY A;  4ZN3 A;  4M75 C;  4KGZ B;  2K3B A;  1GFD A;  3I55 A;  4J6Y A;  2OTL T;  4F17 A;  2SRC A;  3TSZ A;  3GNF B;  4NOY A;  4XU3 A;  1BU1 A;  3I56 A;  1OU9 A;  3OS1 A;  3TU4 K;  3M0T A;  2R5M A;  4IUU A;  4K11 A;  2DVJ A;  2XHC A;  2LNH B;  2DEU A;  4BE2 A;  4M7D B;  5I11 A;  3QBY A;  4BY6 C;  1WHG A;  3CBM A;  3X20 B;  5A0L A;  3S3M A;  1AEY A;  4EMK C;  1G2B A;  5LJ5 d;  4ATO A;  2LC4 A;  3MEU A;  2RI3 A;  5FRN A;  2D6F A;  1IRE B;  2CH4 W;  3V8K A;  2J6O A;  3PGG A;  2X4W A;  4XTU A;  1NLP C;  2P0K A;  5EG2 A;  1LOJ A;  3CD6 T;  5LJ3 d;  4MDX A;  2FRW A;  3I5R A;  3M0P A;  1KQ2 A;  2J7I A;  1WGS A;  4O5V A;  4J8O A;  1R8O B;  1OPL A;  2XI9 A;  2FO0 A;  2L5Q A;  5J3B A;  2CP3 A;  3JCM g;  2KYB A;  2F2V A;  1M1K C;  1YHQ A;  7AT1 B;  1Y0M A;  4OML A;  4JRP A;  2ABL A;  2AKL A;  2JJ9 A;  1S72 A;  5DM7 R;  4J5Y A;  2X4X A;  1W4S A;  2HQE A;  1UEB A;  3L2R A;  1YJ9 A;  3MEW A;  2K79 A;  2CP0 A;  2DD5 A;  3M53 A;  4GY5 A;  1NEG A;  2JNG A;  4F14 A;  1YIJ A;  4ZN1 A;  1VQ9 Q;  2QEX A;  5DLQ E;  3LWH A;  4XU2 A;  4LNP A;  2A08 A;  1ZSZ C;  1K4U S;  4KT0 E;  2X35 A;  1AT1 B;  1HSQ A;  4OB0 B;  3V8L A;  1SRL A;  4PNO A;  3G4S T;  2EYQ A;  4RTZ A;  1KQS P;  1QVF P;  1U3O A;  2HBW A;  3M4G A;  1X6G A;  4XQ3 A;  3FEO A;  3EHQ A;  1TG0 A;  3HL8 A;  3CCR T;  4RTU A;  2DZ9 A;  4BAC A;  2LVM A;  1CKA A;  4AMC A;  1YCS B;  2RF0 A;  1RAA B;  5GAN h;  3JCM h;  2C0I A;  4WCI A;  1BIA A;  2EYW A;  1I0C A;  2ZAE A;  1IGQ A;  2MWO A;  1R0B G;  1FMV A;  4IKF A;  2LP5 A;  4CC3 A;  4L6V 5;  4N4H A;  1U1T A;  2GQV A;  1JB0 E;  1OX9 A;  1NPP A;  2QAZ A;  3E19 A;  4R0K A;  1T0H A;  1M9S A;  2RMO A;  1K73 R;  2DTH A;  1Q82 R;  1M2V B;  1IO6 A;  1B07 A;  4AFQ C;  4V2S A;  4WTO B;  1TU0 B;  1OV3 A;  3CCU T;  1PD1 A;  2HL3 A;  2X4Y A;  3OW2 P;  5HK3 A;  4RG2 A;  1VYU A;  1RAG B;  1C1A A;  1N9S A;  3NFC A;  2FPF A;  3CC2 A;  2YUP A;  4J83 A;  2KXD A;  2QA4 Q;  4C8Q F;  3QYH B;  2JTE A;  2KI7 A;  2E41 A;  4RTX A;  2A0F B;  2DK3 A;  3H0H A;  3EFO A;  3V7R A;  3EGX B;  1M30 A;  1I1J A;  1OOT A;  1YJN Q;  3CXC P;  4RTT A;  1MMD A;  3M55 A;  3JCM X;  3G71 Q;  4M75 B;  3CD6 A;  1NYG A;  5DY9 A;  4CI0 C;  1YP5 A;  3HFO A;  2LQ8 A;  4RG8 A;  1MV3 A;  5LJ5 h;  3PFS A;  1VQL T;  5GAN e;  1Z9Q A;  2RHX A;  2RD1 A;  3MEA A;  3OYE A;  4KUL A;  4E7J A;  3I35 A;  2FB7 A;  5KE3 A;  4M77 F;  3VS2 A;  3EGU A;  4IUV A;  3BW1 A;  1VQ8 Q;  4M78 F;  2MWP A;  1ZBX A;  4KGX B;  2W10 A;  5AT1 B;  4C8Q E;  2L2P A;  4X9D A;  2BE9 B;  1SG5 A;  4QVC A;  4Z89 A;  3HP9 A;  3CC7 T;  4EMK B;  2LZ6 B;  3NTK A;  4QKU A;  3RNJ A;  4EMH A;  1UJY A;  1VUB A;  4HCK A;  1YJW A;  1PC0 A;  2DNU A;  2JS2 A;  3UA7 A;  3HKS A;  2OTJ T;  3OSV A;  2X51 A;  1ARK A;  3OW2 A;  1OI1 A;  3MP6 A;  2OI3 A;  1IRX A;  5GAN 3;  4MZP A;  1SEM A;  1KQS S;  1QVF S;  2KRN A;  5IHI A;  4FYX B;  2MF2 A;  2ED0 A;  4M7D D;  3N5B B;  1D0Y A;  1QKW A;  3UDC A;  1Q81 R;  2XMF A;  4LD9 K;  4PJO C;  4M78 E;  3OYH A;  2HEQ A;  2RA2 A;  2RHU A;  4QT7 A;  1EFN A;  1F1B B;  2QQR A;  5LJ5 e;  1K9A A;  4AT1 B;  3AT1 B;  2HSE B;  8AT1 B;  2COZ A;  4FIB A;  1BKB A;  1KIK A;  1XQH A;  1LNX A;  1JO8 A;  2DFU A;  1TUD A;  1TTH B;  3REB B;  2LX7 A;  1N5Z A;  4ESR A;  2LT4 A;  1E7O A;  4E7I A;  5LJ3 e;  3QWX X;  4BDZ A;  2DVE A;  5GJW B;  4J7I A;  3CCJ Q;  1B7T A;  5GAN 4;  1X01 A;  1SKU B;  4CC4 B;  1NJI U;  4M7A F;  4M4Z A;  2DTO A;  3CPF A;  2YDL A;  4XU1 A;  1ZSZ B;  4PJL A;  2ENM A;  2KRM A;  1VQM Q;  3JB9 I;  5I2S A;  1IGU A;  2DJQ A;  3CCU A;  2DL8 A;  5CKF A;  4FT4 A;  3PVL A;  1RAD B;  3G1J A;  4C92 G;  2WAC A;  3C12 A;  4OGC A;  5HKC A;  3CXC S;  2CSI A;  2RI5 A;  4RUG A;  4HVV A;  1M90 U;  4J9H A;  1PD0 A;  3L1A A;  2YRC A;  4LDX A;  1HJD A;  3SB2 A;  1RAE B;  1HXD A;  2IIM A;  5KCO A;  2DPP B;  3QG1 A;  3H6Z A;  4F7U E;  2CSQ A;  4B6M A;  4C0D C;  1YI2 T;  1JQQ A;  2ZGW A;  5CK9 A;  2E70 A;  3M0S A;  1NPR A;  2VC8 A;  4N4I A;  1I8F A;  4J9G A;  1NYF A;  4NL2 A;  5KE2 A;  1M3C A;  3TQ7 P;  2QQA A;  4OB3 B;  2IG0 A;  4D6W A;  2BIV A;  2FHD A;  4PKC C;  2ZPE B;  3CPW P;  2EQU A;  2L89 A;  5KYX B;  4HCZ A;  3X25 B;  3VUZ A;  2XG8 D;  5GJV B;  3PMT A;  1PKT A;  2Y4Y A;  2PQW A;  3EH2 A;  1NM7 A;  1I81 A;  1K0X A;  2VAS A;  2OTJ A;  2EAY A;  4E6R A;  1PSE A;  3A5Z B;  3Q1J A;  1WA7 A;  1XNI A;  2CRE A;  2WSE E;  4DOW A;  1AHJ B;  1NEB A;  2C0T A;  2LCC A;  1T3L A;  1VQO T;  1OYX A;  2F5K A;  2K5L A;  4MMK A;  3A8G B;  2SEM A;  4M7A C;  1RAH B;  2D9T A;  5A0G A;  5L23 A;  2CP6 A;  4FYW B;  3TSW A;  4OB2 B;  3RER A;  1Q7Y C;  4FL6 A;  1WLP B;  4LDW A;  1TUG B;  2GBQ A;  2HBP A;  3I56 T;  2O4X B;  2O4X A;  1VQK A;  1H8K A;  1S1N A;  1OZ3 A;  1W2B S;  3NPF A;  4M75 D;  3UT1 A;  4OB1 B;  2K57 A;  1M3A A;  2GCX A;  4IIM A;  3CPW A;  3T9N A;  5CKB A;  1D09 B;  4QQ6 A;  1YJN A;  2DAQ A;  3OS0 A;  2PUO B;  2EGA A;  5D6X A;  1UUE A;  1OU8 A;  2D0Q B;  3URG A;  2XK0 A;  3JV3 A;  2DL5 A;  4A4H A;  1V1C A;  3PIP A;  1Q86 U;  1UGS B;  5CAI A;  1KD1 C;  1UEC A;  1K73 C;  4PL6 A;  4OMN A;  1Q82 C;  1LVK A;  2KEA A;  1RUW A;  4PJO B;  1VQ4 Q;  5CKD A;  3VS3 A;  4A63 B;  5GMK m;  2VKN A;  4E7S A;  5GAN 6;  4Z02 A;  1WI7 A;  4FW2 A;  2DXC A;  1IXD A;  5FW9 A;  2MPX C;  3CQT A;  4LN2 A;  5GAM g;  1KSW A;  3GPL A;  4DBR A;  4C8Q B;  4C8Q A;  1YHQ T;  1VQ5 A;  1WIE A;  1YN8 A;  3SWN A;  3LYI A;  1YCY A;  2K2V A;  1UDL A;  1ACM B;  3M56 A;  3M5A A;  4ME7 A;  1JJ2 P;  1SSF A;  1S72 T;  3OYG A;  3HRU A;  9ATC B;  2I2L A;  3L2Z A;  1X6B A;  2O88 A;  1PKS A;  3JB9 J;  1JXM A;  4OMF B;  1NE8 A;  4E47 A;  3CCQ Q;  4OMM A;  3QUI A;  2QEX T;  4UC4 A;  2ESW A;  1M1F A;  4M77 B;  2HSP A;  4FT2 A;  4M77 A;  2QQ9 A;  5GAN d;  4M78 A;  3JCM d;  3QWY A;  3J81 E;  5GAN 2;  4BI4 A;  1WXT A;  3GOX A;  3P8D A;  2YWW A;  4DBH A;  2Y4X A;  3H8Z A;  1IHV A;  3CMA Q;  2BZX A;  4CRI A;  1K9M U;  4KRT A;  1YIT Q;  4C0D B;  3IQL A;  1HK9 A;  8ATC B;  3ASK A;  2LCL A;  2JT4 A;  2RHY A;  3PE0 A;  1N8R R;  1UFF A;  4GBQ A;  2EJG A;  1SHG A;  2EFI A;  1Q81 C;  2KK4 A;  3BDU A; 
#chains in the Genus database with same CATH homology
 4BAC A;  2K4Y A;  1VQM A;  2KDS A;  2LVM A;  5IT9 E;  1VQP T;  2VGM A;  3JCM Q;  5GAN h;  3SD4 A;  3JCM h;  5CCA A;  3FC3 A;  3CCR A;  1JJ2 A;  1BIA A;  3LW5 E;  4C5E A;  5CKE A;  3VYG A;  4IUP A;  2MWO A;  5GMK i;  5I21 A;  1EIF A;  3CCE A;  4IKF A;  5CQX A;  3SDZ A;  3JSC A;  4FU6 A;  4L6V 5;  4M7D G;  4N4H A;  4TVR A;  2E6N A;  1U1T A;  3LWI A;  2GQV A;  4F7U G;  1JB0 E;  3G71 A;  4E7K A;  3MP8 A;  2PVD B;  2RJD A;  1NPP A;  3QKJ A;  3CCM T;  2GFA A;  1Q7Y U;  2LNV A;  3E19 A;  4C5I A;  1NJI C;  1V29 B;  1JBM A;  3KBG A;  3CME T;  1DJ7 B;  1M9S A;  3QJ6 A;  1VQ8 T;  2DTH A;  1M90 C;  1Q81 U;  4BE0 A;  3CC2 T;  1VIF A;  4HKE A;  1N8R U;  4V2S A;  1VQN T;  4PJO G;  2M1H A;  1NZ9 A;  2LT1 A;  3CCU T;  1WNL A;  2CYZ B;  4JRQ A;  2DIQ A;  2X4Y A;  3QDR B;  2DXT A;  3E1S A;  3QO3 A;  5HK3 A;  4RG2 A;  2DZC A;  2K3Y A;  1VQ8 A;  5DLO A;  3P8B B;  1N9S A;  3NFC A;  2E10 A;  4C92 F;  3CC2 A;  3OYY A;  4J83 A;  5IN1 A;  4WF2 A;  3CBP A;  4C8Q F;  5LL6 S;  1VQN A;  2QI2 A;  2B8A A;  3QYH B;  2E41 A;  4M7A B;  4M7A A;  2XIC A;  3M59 A;  2DK3 A;  4ZTF A;  1N27 A;  4KUI A;  3R6O A;  2E6Z A;  2VUB A;  3JB9 F;  3TEE A;  4LDU A;  3A8H B;  1Y96 B;  3V7R A;  3E9F A;  1Y96 A;  1YBY A;  2M0O A;  2PVO B;  3EFR A;  5FU6 C;  3OMC A;  2ZPG B;  2DTI A;  5CIU A;  2RHI A;  5L8R E;  2WSF E;  3OA6 A;  1N9R A;  2XU8 A;  3OYM A;  3FIF A;  1UB4 A;  3M55 A;  1KD1 U;  1G3S A;  2JTM A;  3ZFJ A;  3JCM X;  3SFM A;  4M75 B;  3MCA B;  4E7L A;  4KUD K;  3CD6 A;  3SWN B;  1K73 U;  5DY9 A;  4CI0 C;  5GAO n;  1Q82 U;  2K5F A;  3OYJ A;  3HFO A;  4XU0 A;  2LQ8 A;  3OYF A;  1KHC A;  4MZM A;  4RG8 A;  5LJ5 h;  3PFS A;  5GAN j;  1VQL T;  4OF1 A;  5GAN e;  2RHX A;  2RD1 A;  3JCM V;  4ZGJ B;  3FDR A;  3MEA A;  3RMQ A;  5GAO q;  3OYE A;  3OYI A;  3CPW S;  4KUL A;  4E7J A;  4M7A E;  1WJS A;  3EAE A;  4FM4 B;  2K5I A;  1BIB A;  3RUX A;  2EIF A;  1X75 C;  2FB7 A;  1K8A U;  3MO8 A;  3CCV T;  2PVG B;  4HCC A;  3QXE B;  4J6W A;  4LDV A;  2K3X A;  2VXF A;  4NL3 A;  5KE3 A;  3AHU A;  5FU7 B;  2RO0 A;  4LD6 A;  1FX7 A;  4L59 A;  2KY9 A;  4M77 F;  1VQL A;  4IUV A;  4LDY A;  3BW1 A;  5GAM d;  4HCB A;  1ZQ1 A;  2QXF A;  4M78 F;  4RCB A;  4B9W A;  4C92 E;  1WPY A;  4X34 A;  2MWP A;  4RMO A;  1YJW T;  1ZBX A;  4C8Q E;  4N4G A;  3KUF A;  1MHN A;  5CVI A;  2KQW A;  3LGF A;  4EMG A;  4X9D A;  4MZT A;  4QVC A;  2P4T A;  4QQD A;  4M75 E;  2KSS A;  4P5N A;  2HNI A;  3HP9 A;  3QZ5 B;  4R55 A;  3A8O B;  4EMK B;  3G6E T;  4BE1 A;  3CC7 T;  5A0D A;  2LTO A;  3O8V A;  2JVV A;  1FXX A;  1Q81 C;  3NTK A;  3JCM c;  2VGN A;  4EMH A;  2CZ7 B;  4BD3 A;  1W2B A;  1VUB A;  4M78 B;  2C06 A;  2CS7 A;  1YJW A;  1MGQ A;  2FL7 A;  2HQX A;  3HKS A;  2OTJ T;  3OSV A;  4C0G A;  4EDU A;  3OW2 A;  1M1K U;  5J39 A;  4IUR A;  1OI1 A;  3OY9 A;  2LDM A;  3CC7 A;  2EJ9 A;  5KCH A;  2ZPB B;  3MP6 A;  3C4S A;  2M16 A;  3OSS C;  2YRV A;  4II1 A;  1UGR B;  1WQ7 A;  2CZ1 B;  4MZP A;  5GAN 3;  4M7D C;  2R5A A;  1OZ2 A;  2E64 A;  3DKM A;  4A53 A;  2V8I A;  4L5G A;  5IAY A;  1KQS S;  1QVF S;  3CCJ A;  4PLL A;  1QW1 A;  2MF2 A;  2DJZ A;  2P0P A;  3V8J A;  4M7D D;  3FJP A;  2MMP A;  2EQM A;  5A2Q E;  3CCL A;  4JLG A;  4HA8 A;  5GAM h;  3N5B B;  3UDC A;  2JTF A;  2RJC A;  4JJN K;  3MEV A;  4MDW A;  1KC8 C;  3M54 A;  5AYF A;  4LD9 K;  1QVG A;  5J26 A;  2XKO C;  4PJO C;  4M78 E;  4JDS A;  3OYH A;  3OYB A;  1H64 1;  2R57 A;  3TCJ A;  4BUG A;  4QVD A;  2RA2 A;  2RHU A;  2ZCF B;  5FRO A;  3X28 B;  4PJO D;  5LJ5 j;  2QQR A;  5LJ5 e;  2PU9 B;  1VIE A;  2F69 A;  4OGE A;  1VQ4 T;  3JRZ A;  4FIB A;  1BKB A;  1RI0 A;  1XQH A;  3GNG A;  4PLI A;  1LNX A;  4A4F A;  3I55 T;  1VQP A;  3OYD A;  3MHX A;  2HAX A;  1N6A A;  2GF7 A;  2LT4 A;  5CR2 A;  1Q86 C;  3F70 A;  1O75 A;  3M9Q A;  2QQS A;  2XID A;  3L2U A;  1KC8 U;  5LJ3 j;  4E7I A;  5LJ3 e;  3JB9 H;  5LJ5 f;  4BDZ A;  2DVE A;  4ZTJ A;  4J7I A;  1GXI E;  3OBW A;  1RL2 A;  5GAN 4;  1X01 A;  2LQK A;  1M1G A;  2RJF A;  3RKX A;  1NJI U;  4M7A F;  4JUV A;  4GLK A;  1Y71 A;  4XAX B;  3UWN A;  4C0Z A;  3VKI A;  2DTO A;  5CQY A;  3CCM A;  2MI6 A;  5C6S A;  3CPF A;  3WVE B;  1XOV A;  2VXE A;  3LGL A;  4A4K A;  3E9G A;  2HD0 A;  3CME A;  4HT9 A;  4M7A G;  5GMK h;  2RB6 A;  4XU1 A;  4BDY A;  3OS5 A;  4M7D A;  5HY6 A;  3JB9 I;  5C0M A;  5I2S A;  4F7U B;  3LLR A;  4F7U A;  3CCU A;  5LJ3 f;  5CKF A;  3CCQ T;  4FT4 A;  2F5T X;  4M75 F;  4C92 G;  4XTZ A;  3M58 A;  2WAC A;  3C12 A;  3C95 A;  4Y28 E;  3CBO A;  4C8Q G;  1D3B B;  4OGC A;  2JOY A;  4VUB A;  5HKC A;  1D3B A;  4BI8 B;  5GAM e;  3C94 A;  1QVP A;  5GAM j;  3CXC S;  2VV5 A;  2RI5 A;  4M75 G;  3S6W A;  3JB9 G;  1Y07 A;  4PJO A;  1M90 U;  2DKG A;  3CCQ A;  3DLL A;  5CKH A;  4DQ2 A;  5GAN 5;  1QP3 A;  4QW2 A;  3JAM E;  1P92 A;  1JJ2 S;  3BDL A;  4MML A;  3L1A A;  5GMK l;  4BB7 A;  2RJE A;  4LDX A;  3SB2 A;  3HHT B;  2QDY B;  2M9U A;  5HK0 A;  1U1S A;  3OYN A;  1VQ9 T;  1HXD A;  2G3R A;  3VUB A;  2EWN A;  1M8V A;  4OP0 A;  5KCO A;  3JCM e;  1G3W A;  2DPP B;  3QG1 A;  3VU3 C;  1WJR A;  1G5V A;  3H6Z A;  3A8M B;  3MET A;  4F7U E;  3J7A F;  2CGH A;  4N0A C;  2FYK A;  4C0D C;  3CMA T;  1YI2 T;  2ZGW A;  5CK9 A;  2V8K A;  1U8R A;  2XD0 A;  3BFM A;  2E70 A;  2WSC E;  1YIT T;  4J6X A;  1NPR A;  2VC8 A;  2CZ6 B;  4JS4 A;  3M57 A;  4N4I A;  1I8F A;  4JLI A;  2RM4 A;  4NL2 A;  2GFU A;  5KE2 A;  2PUK B;  1VQ7 T;  1YI2 A;  2E1H A;  5GAN g;  3J80 E;  3CCV A;  4M77 G;  2QQA A;  4OB3 B;  3HRT A;  3GF5 A;  4M78 G;  5GAN f;  2IG0 A;  1KQ1 A;  4C0F A;  1BI1 A;  3JCM f;  2E65 A;  2KAF A;  4D6W A;  3RIR A;  2BIV A;  2FHD A;  4PKC C;  2ZPE B;  2AHJ B;  2EQU A;  2XDP A;  2L89 A;  2A3L A;  2ZPF B;  4ELZ C;  1YJ9 T;  4HCZ A;  3X25 B;  3VUZ A;  1FWZ A;  2XG8 D;  4A4G A;  1VQ7 A;  1B34 B;  3NTH A;  2BKD N;  3PMT A;  5I2M A;  1B34 A;  1K9M C;  5GMK j;  2V8J A;  1H3Z A;  5GMK e;  2RI2 A;  3LH0 A;  4XTX A;  3G6E A;  1IZ6 A;  5FLX E;  2Y4Y A;  2PQW A;  1YIJ T;  1BI2 A;  5CO7 A;  2R58 A;  3VJP A;  1I5L A;  1I81 A;  3RKW A;  3HFN A;  3QJY A;  3S3N A;  2EQJ A;  2OTJ A;  3NTI A;  2EAY A;  1WQW A;  3HSB A;  3PIO A;  3DB4 A;  1PSE A;  3A5Z B;  2DXB A;  3Q1J A;  2FVU A;  5FU6 B;  1M5Q 1;  4B9X A;  1XNI A;  2WSE E;  4ZGE B;  1G3Y A;  4XTV A;  4DOW A;  4YTL A;  2DXU A;  3VYH B;  3X24 B;  3ZEH A;  1TH7 A;  3PTA A;  1AHJ B;  2EKO A;  2LCC A;  2LRQ A;  3UPU A;  2YLB A;  2L3R A;  2E12 A;  3LX7 A;  4BI3 A;  1VQO T;  3JCM J;  1LJO A;  2CKK A;  1OYX A;  3GIB A;  2F5K A;  2LX9 A;  1VQ6 T;  5M9O A;  2K5L A;  3QII A;  4MMK A;  2E5Q A;  1BYM A;  3A8G B;  2YHT A;  3QYG B;  4RKU E;  4M7A C;  1G3T A;  2H3J A;  2D9T A;  5A0G A;  3WVD B;  2QA4 T;  4FSX A;  4M7A D;  4IUT A;  1VQK T;  3QSU A;  2JN0 A;  1VQO A;  4E7H A;  1X6O A;  4OB2 B;  3QPH A;  3RER A;  1Q7Y C;  5GAO m;  4C92 C;  5GAO l;  2OAU A;  4FL6 A;  3RES A;  4C8Q C;  1VQ4 A;  1KHI A;  2ZZD A;  1O9S A;  3A8L B;  4LDW A;  2MAM A;  2HBP A;  3VV0 A;  4C92 D;  4ZN3 A;  3I56 T;  1PSF A;  1N8R C;  2O4X B;  4M75 C;  4NS5 A;  4C8Q D;  2O4X A;  1VQK A;  3SWN C;  5LJ5 g;  3CCE T;  4R56 A;  1YJN T;  1OZ3 A;  3INZ A;  3I55 A;  4J6Y A;  2DEQ A;  4M75 D;  3JCM b;  1W2B S;  3JB9 D;  2OTL T;  3UT1 A;  1M4Z A;  3G71 T;  4OB1 B;  2K57 A;  4M7D F;  3OW2 S;  3GNF B;  4NOY A;  4XU3 A;  4F7U F;  2Y90 A;  3I56 A;  2GCX A;  3OS1 A;  3TU4 K;  1ZHI A;  2R5M A;  3CPW A;  3DLM A;  4Q5W A;  4QQ6 A;  5CKB A;  3T9N A;  3CC4 T;  4IUU A;  4DA4 A;  1YJN A;  2DAQ A;  5FU7 C;  3FB9 A;  2NLU A;  4XK8 E;  2OTL A;  3OS0 A;  3JCM W;  2PUO B;  2XHC A;  3GLX A;  2BUD A;  5D6X A;  3V7C A;  3L42 A;  2D0Q B;  4BE2 A;  3URG A;  2XK0 A;  4M7D B;  2KVQ G;  3QBY A;  4PJO F;  4BY6 C;  3CBM A;  3X20 B;  5LJ3 g;  3OYL A;  3JCM P;  3GP8 A;  2CZ0 B;  4A4H A;  3MP1 A;  5A0L A;  3PIP A;  1JRI A;  3S3M A;  3CC4 A;  2P0Q A;  2JZ2 A;  3OQ5 A;  1Q86 U;  1UGS B;  4EMK C;  5CAI A;  1KD1 C;  1WJQ A;  4QQG A;  3FLG A;  5LJ5 d;  1QVG S;  4M77 C;  4ATO A;  4EPC A;  1K73 C;  4PL6 A;  2JUF A;  2LC4 A;  3QHS A;  2EJF A;  4M78 C;  1Q82 C;  3MEU A;  2EQK A;  2RI3 A;  5FRN A;  4C5H A;  4M77 D;  2ZPH B;  5D6W A;  2D6F A;  1IRE B;  4PJO B;  4M78 D;  3V8K A;  5CKD A;  2A7Y A;  3PGG A;  3PNW C;  5GMK m;  2X4W A;  4XTU A;  2KMT A;  5FRM A;  4RCC A;  4O6J A;  1K8A C;  3ZBD A;  3ER0 A;  1Y7X A;  4Z02 A;  5GAN 6;  3RMS A;  2DXC A;  2P0K A;  1I4K 1;  5EG2 A;  1VQ5 T;  3EFS A;  3KXT A;  4M7D E;  1LOJ A;  4JRI A;  2VYT A;  3CD6 T;  1UGQ B;  3X26 B;  3WXM B;  3L2W A;  5GAM g;  2RHZ A;  5LJ3 d;  4JS5 A;  1KQS A;  1QVF A;  4MDX A;  1XTD A;  3GPL A;  5GAM f;  4C92 B;  3HRS A;  3P8H A;  3OB9 A;  4QVZ A;  4C92 A;  4C8Q B;  2IVW A;  4Y91 A;  4C8Q A;  2XDD A;  1YHQ T;  1VQ9 A;  1KQ2 A;  1VQ5 A;  1WGS A;  4O5V A;  4J8O A;  1R8O B;  4M75 A;  3BY7 A;  3SWN A;  2XI9 A;  3LYI A;  4PJO E;  1YCY A;  2K2V A;  2L5Q A;  5J3B A;  4KBM B;  3M56 A;  3CMA A;  3M5A A;  4ME7 A;  3JCM g;  4A4E A;  3OYA A;  1SSF A;  1S72 T;  4XTW A;  1M1K C;  3OYG A;  3HRU A;  4C5G A;  2I2L A;  3L2Z A;  3L2V A;  5GAN 7;  1YIT A;  3PMI A;  1YHQ A;  3CEY A;  3ME9 A;  3TRE A;  3OYC A;  4XTY A;  4JRK A;  4DOV A;  4JRP A;  3JB9 J;  3PT9 A;  3S3O A;  4OMF B;  1NE8 A;  1KG1 A;  4E47 A;  3FRN A;  1S72 A;  2DIG A;  2RK1 A;  5DM7 R;  2RH2 A;  4J5Y A;  2X4X A;  1W4S A;  4BY6 B;  2HQE A;  2O01 E;  3OS2 A;  1UEB A;  3L2R A;  1BI3 A;  3V7S A;  5LJ3 h;  2QTX A;  3QUI A;  3OMG A;  4J7F A;  4UC4 A;  3OYK A;  2QEX T;  3DB3 A;  1QP2 A;  1YJ9 A;  3MEW A;  1M1F A;  4EMK A;  2DD5 A;  3M53 A;  4M77 B;  5KH6 A;  4GY5 A;  2XDB A;  1BI0 A;  2JNG A;  4FT2 A;  1UGP B;  2QQ9 A;  4M77 A;  4A54 A;  2DD4 A;  5GAN d;  3L2Q A;  4HT8 A;  3OBY A;  4M78 A;  3JCM d;  5D6Y A;  2X4J A;  3CCJ T;  1YIJ A;  3J81 E;  5GAN 2;  4BI4 A;  4ZN1 A;  3GOX A;  2QEX A;  5DLQ E;  3QZ9 B;  3RKY A;  3LWH A;  4XU2 A;  3CCL T;  3P8D A;  2QQB A;  2L8D A;  5GAN 8;  2Y4X A;  2ZPI B;  4KT0 E;  2X35 A;  3H8Z A;  4OB0 B;  4ZGD B;  3V8L A;  4PNO A;  4X9C A;  4CRI A;  5GAO p;  3G4S T;  2EYQ A;  3CCS T;  1K9M U;  3HPW A;  4OVA A;  2DO3 A;  4ELY C;  4C0D B;  1VQM T;  1HK9 A;  3M4G A;  4N0A A;  3ASK A;  4XQ3 A;  3G7Z A;  3FEO A;  4IUQ A;  2LCL A;  1VQ6 A;  2RK2 A;  3HL8 A;  2RHY A;  2YLC A;  3CCR T;  4M77 E;  2EJG A;  3G4S A;  5GAO r;  3CXC A;  2EFI A;  3CCS A;  3M4Y A;  2KK4 A;  2DZ9 A;  3BDU A;  2QA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...