1YCYA

Conserved hypothetical protein pfu-1806301-001 from pyrococcus furiosus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
62
Chain Sequence
SLLEKVLKEWKGHKVAVSVGFTGTLEDFDEEVILLKDVVDVIGNRGKQMLIGLEDINWIMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved hypothetical protein
publication title Conserved hypothetical protein Pfu-1806301-001 from Pyrococcus furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
total genus 12
structure length 62
sequence length 66
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ycyA00
4M7AG 3PGGA 4M78D 3HSBA 4M7DG 3EFRA 5LJ3d 3JB9H 1HXDA 4JRIA 5GANe 3L1AA 5GAMf 3AHUA 3EFSA 5GAOr 2RB6A 3QSUA 4XU1A 5GANd 4Y91A 3JCMg 4M7DC 4M7AC 1I81A 3JCMW 3GIBA 5DY9A 4XTXA 3BFMA 1HK9A 4M7AB 2EAYA 4NL3A 4C8QG 1I5LA 4WF2A 4M7AA 4M7DA 4M7DB 3JCMX 2CGHA 2Y90A 4M75D 2DJZA 5GMKm 5GAN6 4V2SA 4PJOD 2RD1A 4NL2A 3JB9I 4M77F 5GAMj 4J6XA 4OP0A 4M78F 3JCMf 5GAMg 4JUVA 3RKYA 4XQ3A 3BY7A 5GMKe 2ZGWA 4M77D 3JCMV 1N9SA 4J5YA 5LJ5j 5LJ5g 2EWNA 3JB9G 4XTYA 4X9DA 1KQ1A 1X01A 4XTZA 3V7SA 5GAN5 5GMKl 1LOJA 2E1HA 4NOYA 4RCCA 5GAN3 3FJPA 4HT8A 4M75F 4PJOF 4JRKA 2DTIA 2VXFA 3V8LA 3INZA 1WNLA 4C92D 4J6WA 3JCMh 4N0AC 1U1SA 4M78E 3L2ZA 5LJ5f 4MMLA 4XU3A 4DQ2A 4EMKB 2YHTA 4N0AA 3RESA 3RKWA 4C8QD 2QTXA 4EMKA 5GANg 3JCMQ 5GANj 3HFNA 3JCMe 4QVCA 4M75B 5GAOq 3BW1A 1U1TA 3V8JA 4F7UF 3JCMc 4XTUA 4RCBA 3RKXA 5GAMh 1M5Q1 3BDUA 1I4K1 2VC8A 5LJ3f 2DEQA 3VU3C 4M75E 3RIRA 1KQ2A 1WQ7A 4PJOE 3JB9J 5GAN7 1TH7A 5GAOp 2EJGA 3RUXA 4C92F 2DXUA 2EJFA 1N9RA 1LNXA 4HA8A 4M77B 4X9CA 4M77A 2YLBA 5GAMe 3V7RA 5LJ5h 3JB9D 2E41A 4M78B 4M7DD 5GANf 4M78A 3FB9A 2DKGA 2DVEA 4EMHA 5GAMd 5GAN4 2FYKA 4M75G 3M4GA 4C8QF 1BIBA 1H641 1WQWA 4M77E 5GAOm 5LJ3j 4EMKC 5GMKj 4F7UE 1LJOA 5LJ3g 4XU2A 5I21A 4M7AD 2RA2A 4C92B 2RM4A 4M75C 2DXTA 4PJOC 2VXEA 4HT9A 3SWNC 2E10A 4QVDA 5GANh 4M75A 4M77G 4PJOB 2FB7A 4A53A 4C92E 4EMGA 4PJOA 4F7UG 4M78G 3SWNB 3JCMb 1WPYA 3JCMd 3SB2A 3SWNA 4M7AF 3JB9F 4PNOA 5GAN8 4M7DF 2DTHA 4XTVA 2JN0A 4C8QE 5GAOl 4M77C 4XU0A 1JRIA 2DZ9A 4M78C 3JCMJ 4C92G 4J6YA 2E65A 4MMKA 4A54A 1D3BB 1M8VA 4F7UB 1D3BA 4F7UA 1I8FA 3V8KA 1Y96B 1Y96A 3QUIA 3QO3A 2DTOA 3HFOA 4PJOG 1YCYA 4C92C 5GAN2 1B34B 2K57A 5LJ5e 2I2LA 1B34A 3RERA 2DZCA 3QHSA 5GAOn 1BIAA 1MGQA 4M7AE 2EJ9A 5LJ3h 3V7CA 4C92A 4C8QC 5GMKh 5LJ5d 2E64A 3JCMP 4M7DE 4XTWA 5GMKi 3FIFA 2HNIA 4C8QB 4JLIA 4C8QA 5CAIA 5LJ3e 2YLCA 1JBMA
chains in the Genus database with same CATH superfamily
3EG9B 3NPFA 3SD4A 2GFAA 2RJCA 1FWZA 1WHKA 1I81A 1HSQA 2HEQA 2PU9B 2ED0A 2JZ2A 2LJ0A 1WDXA 3FC3A 2R57A 4J6XA 4E7KA 2KMTA 2LRQA 3HL8A 1WI7A 2ZGWA 2DPPB 5LJ5g 3M0SA 1M90R 1QWFA 4LDUA 3V7SA 3EG3A 2LCCA 2AZSA 5IHKA 1GFDA 2C0IA 2FHDA 3PMTA 3MJXA 3QXEB 3CC4T 3LLRA 3M55A 4MMLA 5KCOA 5GANj 2RQRA 2D0NA 1QVGP 1Z9ZA 1VQ7A 3UATA 3I9QA 2QYZA 1S72Q 4CRIA 1K8AU 2LQNA 3QZ9B 1WQ7A 5A0DA 4HVWA 1TH7A 1FMVA 2EJGA 1KK7A 2YLBA 3JB9D 1OZ2A 1VIFA 4OB0B 4EMHA 4M75G 1NLOC 3MEAA 3QYHB 4PJNA 4E7LA 1UECA 4C5GA 5CCAA 4IKFA 2GFUA 2DL7A 3OYMA 3DLMA 2KROA 2RI5A 3CCUQ 1X6GA 2CS7A 3CQTA 3SFMA 1AOJA 2D0QB 1RAHB 3M0PA 5GAN8 3G71Q 1Q81U 5D6WA 2GBQA 4XU0A 1JRIA 4M78C 7AT1B 4MMKA 2DBMA 4LE9A 2KRNA 2JMAA 3V8KA 2HL5C 2KBTA 4OMPA 2X9HA 4K11A 1YHQQ 1Y7XA 4C92C 1W2BS 1HYOA 2RMOA 1WHGA 4HVVA 2M1HA 2KT8A 2CUDA 4MDXA 2EFIA 2YRDA 2EKOA 1VQPT 2QK0A 4AFQC 1WJQA 3FLGA 4GLMA 3E19A 1K8AR 3CMAA 5GANd 3P8HA 3JCMg 3F70A 3TQ7P 3CC4A 4XTXA 4JPBW 2ENMA 2EQUA 5L8RE 5GMKm 5CR2A 2CUBA 1X43A 2XDDA 5GAMj 4OP0A 4FYYB 1N8RR 4JUVA 1U5SA 2OTLQ 1RACB 2QQBA 2HMAA 5AYFA 4FM4B 2H3EB 1Q81R 3OYGA 3UF4A 1K9MC 2Y4YA 2KXDA 5ECAA 1WNLA 4C92D 1UB4A 2DEUA 1U1SA 2LP5A 4BI8B 3VS6A 2V8IA 3JCMQ 4QVCA 1IXDA 4RTZA 3PIPA 1VYVA 4RCBA 5FU7C 4FT4A 4FU6A 1Q82C 5LJ3f 4FW2A 5GAOp 4RUGA 1BU1A 4N4GA 2VVKA 2DJQA 2DXBA 1WXTA 2E6ZA 3R6NA 1BIBA 1H641 2X4XA 4ZN3A 4QT7A 1KD1U 2JS0A 2DXTA 1G3YA 1VQPA 1VQ4Q 2G6FX 1TTHB 3CCET 2FPEA 1GCPA 4PJOB 4F7UG 3EFOB 2B86A 2DZ9A 1SRMA 3CCSQ 2E5KA 5I22A 1MMNA 2YUNA 1SHFA 4OMLA 1JU5C 3C0CA 2C0OA 2O01E 4ME7A 3UA6A 3MCAB 2MK5A 2FZCB 4JRIA 5AT1B 1NM7A 3C94A 3EFSA 1BCOA 2LTOA 4MZMA 3MEVA 4M7DC 4YTLA 3M58A 3GOXA 1KC8U 4HCCA 4CC3A 2RHXA 1PCXA 2RD1A 1KD1R 2RHUA 1QKXA 4RTVA 3BY7A 3OYHA 5LJ5j 4BY6C 2FO0A 2BE9B 3EG9A 5GAN5 2BZ8A 1OX8A 4HT8A 3CMEQ 3QWXX 1WA7A 3CCMQ 2FG0A 1K4US 3CCEA 4C0ZA 2XDPA 1WLPB 4BI3A 2NYSA 3EG0A 3NHNA 1M8MA 4J9HA 4QQGA 1X69A 4MZPA 4M77B 4X9CA 3V7RA 4M7DD 2E41A 2HKQB 3QZ5B 3OYKA 1TOVA 2EQMA 2R5MA 2XU8A 4L6V5 5KYXA 3M4GA 1I07A 1WQWA 4QW2A 2A7YA 1RI9A 1M1GA 2MF2A 5LL6S 3FRNA 3H9NA 5GJVB 2C06A 1YJNA 3DKMA 2AKKA 4M78G 3CCLT 4PNOA 4FT2A 2MYSA 3VJPA 2K3YA 3G6EQ 2OTJQ 4C92G 1NPRA 3RMSA 1NG2A 1PG5B 5IXBA 3M54A 4MDWA 4OMMA 1B34A 1XNIA 2DZCA 1SG5A 4M7AE 5LJ5d 1TXQA 3M4YA 5GMKi 3ZEHA 3VS0A 1RAAB 3WVEB 3M56A 4J7FA 1YI2Q 1M1KR 3J7AF 3OSVA 4R56A 3CXCS 4JRPA 2JM8A 2M9UA 4F14A 4C8QG 4KGZB 2CGHA 1PKSA 2JVVA 3PMIA 3X25B 1C0MA 3UWNA 3M0UA 1UFFA 2E4HA 2K3BA 2XI9A 1T3SA 2ROLA 5FU6C 4EPCA 3M53A 4XQ3A 2QG9B 1GCQC 2LT1A 4J5YA 3EGUA 2RHIA 1KQ1A 2QA4T 5KE2A 4ZTFA 3X28B 4KH1B 4R55A 1VQ8A 3EHRA 2KK4A 4M78E 5CKDA 5HK0A 2DNUA 4N0AA 4J9GA 3OA6A 1VQOQ 3G71A 5KCHA 4F16A 1O75A 3S3OA 2DEQA 2HD0A 3RIRA 4A4KA 2DRKA 2L5QA 2DYIA 1ZSGA 2XD0A 2K5FA 1M3BA 2L2PA 2A37A 3LH5A 2CZ1B 4M77E 5CKHA 5HY6A 2GNCA 2W0ZA 4PL6A 3TU4K 2DMOA 2K7AA 3OMGA 1JXMA 4A4GA 4X1VA 1ZSZA 3JCMd 2RNAA 4M7AF 1VQKQ 4E47A 2JN0A 4C8QE 2HQHA 3E9FA 1YJWQ 4J8OA 4L5GA 1KC8C 1D3BA 4OMFB 2V1QA 5FWBA 1LCKA 1WHJA 1BYMA 1OYXA 4AFUC 3LX7A 4GBQA 1OQKA 3ZFJA 3I56A 4C5IA 1NYGA 4JLIA 4X34A 2RO0A 4M7DG 3EFOA 2WSCE 1KG1A 4E7SA 1TS9A 1D0XA 1RLPC 3PE0A 2ZPFB 2P0KA 1YITT 4HVUA 1D0YA 4M7AA 4NL3A 4WF2A 3JCMX 2KI7A 2DJZA 4AMCA 2EQJA 5DM7R 1KHIA 4M78F 3FDRA 2DIGA 4NS5A 2YRCA 2X51A 3ME9A 4PJJA 5GMKe 1MNDA 2O9SA 2EGAA 2RK2A 5CKFA 3KFVA 3R6OA 4RCCA 2A36A 1ABQA 2JW4A 3CD6T 4EIKA 1VQ5Q 4Z8AA 2M0YA 1ZA2B 1N27A 1AD5A 1ZLMA 1YJ9T 5IH2A 1D1BA 9ATCB 4LUDA 2QEXT 2VUBA 1M5Q1 2DA9A 3HRUA 2SEMA 2RQVA 1FXXA 3T9NA 2EYZA 3L2RA 4DBQA 1FX7A 1V76A 2M0OA 5GAMe 2WSFE 3X24B 1PSEA 3OYAA 4M78A 3HRTA 4C8QF 2JT4A 3P8BB 3MP8A 1UEBA 1G3WA 4O6JA 3LWIA 4XU2A 2CZ6B 1WGSA 3L2WA 1UG1A 4B9XA 3JCMb 1YFNA 3G1JA 3A1PA 5KE3A 1Q86U 1TWBA 2ZAEA 2PZ1A 1G3SA 4QVZA 2ZPGB 1Y0MA 1Y96A 2X4YA 4E7HA 4JJBA 2E3HA 2MWOA 4BI4A 3DB4A 3RERA 2JTFA 4WTOB 1V1CA 5LJ3h 5GMKh 2E64A 3I5SA 4E7IA 2P0PA 3KXTA 4C8QA 4LN2A 1J3TA 2YWWA 1VQ7T 4PKCC 1M90U 1SEMA 2RJFA 3CD6A 1N5ZA 2A28A 4OGEA 2DF6A 4C0GA 1MHNA 3OW2S 3BFMA 1YJ9A 3CC7Q 1ZUKA 1NLPC 2DIQA 1X6BA 2QEXA 1Y71A 4RG8A 5D6XA 2CP6A 1WHHA 5FWCA 3RKYA 3M5AA 2DE0X 2CZ7B 1Q86R 5GMKl 3FEOA 2K5IA 3EHQA 2COWA 3FJPA 1P92A 2RHYA 3NFCA 2D8HA 1Q7YU 2CSIA 2EYWA 3CCRT 1PWTA 3RESA 3CCQT 4M75B 5IT9E 3OBYA 2DRMA 3QYGB 4E7ZA 2BZXA 3P8DA 2GQIA 2DFUA 5GAOn 2CDTA 1YCSB 4JJDA 4FIBA 1OULA 1CKAA 5KYXB 4IIOA 3I5RA 5HKCA 3CMAT 2KT1A 1AWJA 1AVZC 3VRYA 2EVRA 4PJOC 4WCIA 4IUTA 3HKSA 1M30A 2F1LA 1R0BG 1OI1A 2LDMA 2L0AA 1NJIR 1RUWA 1QMCA 3CPWS 1YIJT 2QAZA 1D09B 2E12A 1M27C 1UUEA 2K2VA 3CCVT 3QUIA 1QVPA 1Q7YR 1B34B 3H6ZA 3M0QA 2K6DA 2ZPHB 3RMQA 2HDAA 1VQ9T 1N8RU 2L3QA 2P4TA 2K2MA 4J9IA 2RI3A 2YLCA 4DA4A 3J80E 3QJYA 1JJ2S 3JB9H 2CZ0B 1PSFA 1GXIE 3ER0A 1VYTA 3CCRA 1YBYA 5J39A 1VQOA 4KBMB 3CCQA 1YNZA 4PJOD 4DOVA 1WXBA 2RPNA 4IUPA 2BE7D 3OYFA 6AT1B 5HCKA 2CKKA 4GLKA 4R0KA 3CCLQ 1K73C 1B7TA 2JS2A 3CEYA 1N9SA 3CC2A 2BZYA 1IB8A 4II1A 2DTIA 1R77A 4DOWA 4ZTJA 2JOYA 1M4ZA 1UDLA 3LGFA 3UPUA 3JCMe 2FPFA 1VQ6Q 1RAGB 2LNHB 2J6FA 4HCKA 1YIJA 1XTDA 4M75E 2LVMA 1KQ2A 1XQHA 2J05A 3CCVA 1LVKA 3LWHA 1M1FA 1IHVA 2KR3A 4RG2A 2LMJA 5GJWB 1DJ7B 3A98A 3TEEA 5I21A 2RA2A 3G4ST 1VQ9A 3PFSA 3M9QA 4KUDK 3CCJT 2HL3A 4C0DB 1VQMT 4JRQA 4HT9A 5C0MA 1ZSZB 2CSQA 3A8GB 1M90C 2CT3A 4KGVB 1SSHA 3SB2A 3VV0A 4ELZC 4XTVA 2J6KA 1VQLQ 3M59A 3MP6A 1YWOA 1QQJA 2RF0A 1QVFA 3H0FA 2QA4Q 2PUOB 2DD5A 1D3BB 1VQNQ 2LCLA 2I2LA 4EDUA 1T0HA 2XHCA 2YDLA 4BDYA 3UT1A 1FYNA 2D8JA 3I55Q 5KYUA 2V8KA 3CXCA 3VS7A 5L23A 2HSPA 5LJ3d 3Q1JA 1GCQA 1OV3A 5FW9A 4B6MA 5GAMf 3AHUA 1FMKA 2JMCA 2EYXA 1VA7A 3E1SA 3X26B 4M7AB 3OQ5A 1QWEA 3CBOA 5I2SA 4LUEA 2LC4A 3URGA 5CKBA 3EH2A 3LW5E 4F04B 2JNGA 3REBB 1T0JA 2F2WA 1YJNT 3OYDA 3JB9G 1KSWA 4LD9K 4M75F 2PVGB 3OYJA 2H3JA 1QVFP 1QCOA 3G4SA 4LNPA 3CCJA 3L2ZA 3VS4A 3VS5A 2DAQA 1VQMA 4DQ2A 3OYYA 4OB1B 4MZTA 2PQWA 4HCBA 1K8AC 3JCMc 1ACMB 2R5AA 1G3TA 2HBWA 3E2UA 4PJLA 3OYEA 5I11A 3VKIA 3CXCP 2ESWA 2NUZA 4M78B 3I35A 2DD4A 2GF7A 4OMNA 4ANJA 1YITQ 1EX4A 1X6OA 3EGDA 1OOTA 4F7UE 1N8RC 4C92B 1QKWA 4A4HA 1NE8A 5CVIA 4M75A 1Q81C 4EMGA 2ECZA 2V26A 3SWNA 3C95A 1WXUA 1M1KU 3QG1A 2HZYA 1M3AA 3L42A 2RH2A 5A0LA 2K5LA 1I5OB 2LQWA 3BE3A 2QTVA 3ULRB 3OYLA 4TVRA 1Y96B 3VYHB 4JJNK 3HFOA 1GL5A 2JUFA 2SRCA 3MEWA 2KRMA 2QGGA 1VQ8T 2O4XA 5KYNA 2HAXA 1HJDA 3V7CA 4C8QB 2YT6A 1OZ3A 2EPDA 3G71T 3PGGA 3HSBA 4J9BA 2PUKB 4BE0A 1UJ0A 1PM3A 3G7ZA 1H8KA 1BCMA 4C0FA 2E70A 2YUOA 2F5KA 4C5EA 2OAWA 2FRWA 2KSSA 1RLQC 1TUCA 4RMOA 1OPLA 3OYBA 5A2QE 1M3CA 3S3NA 1PD0A 2QI2A 2RQWA 1UGRB 1UHFA 3GLXA 4KT0E 4JRKA 1GBRA 4J6WA 5CIUA 3O8VA 1XJWB 2BTTA 1S72A 4PFOA 2OTLT 1PKTA 4F7UF 1I4K1 1VQ7Q 2IPOB 3I56T 2DL8A 2ZPBB 5GAN7 1K9AA 1GFCA 2FVUA 1N9RA 2D9TA 5IAYA 3FB9A 5GAN4 1ZX6A 1KD1C 5GAOm 2XG8D 3MHXA 4EMKC 3VRZA 2RM4A 2RHZA 1VIEA 3CCUA 2E10A 4C92E 2NLUA 5KYYA 3OYCA 2ZZDA 3JB9F 5J26A 1UGVA 3LH0A 3C4SA 1O9SA 1YHQA 4F7UA 1YCYA 3H41A 2KGTA 3ZL7C 1VQ4T 3TSZA 2EGCA 1KFZA 5FRMA 2P0QA 2K3XA 1UE9A 4KRTA 3TREA 5GANe 3EAEA 3CCST 2VB6A 2DLPA 4BB7A 3JCMW 1OPKA 1VQ6A 1RADB 5DLQE 3CC4Q 2LQ8A 2M51A 2OTLA 2CP7A 4HXJA 3QBYA 3PT9A 2QQRA 2JJ9A 2ZPEB 2HCKA 2AK5A 1MMAA 1KQSS 1AT1B 1YP5A 1KJWA 2EBPA 1G2BA 2LNVA 2DM1A 3J81E 2DL3A 3VS1A 3QDRB 5IHNA 1S1NA 2EQKA 2HKNA 3V8JA 1JQQA 2GCXA 1M1KC 3JAME 2MWPA 2VC8A 1PD1A 3NTHA 2A08A 2KQWA 3RBBB 1C6VX 1RAIB 3RUXA 4C92F 3JB9J 3CMET 4BE2A 3NGPA 2QGFB 2AHJB 3CCMT 2HSEB 1VQ4A 1EFNA 3NTIA 5LJ3g 2VYTA 2A3LA 2ABLA 4PK4A 4ZGDB 2QDYB 2DK3A 2VXEA 3RNJA 5GANh 2AKLA 2E6NA 4CC7A 1VQPQ 2LQKA 2NUTB 2M02A 4AG1C 3CCSA 1CKBA 2F2VA 2MOXA 3JCMJ 2KY9A 4E6RA 1M2OA 3WXMB 3M57A 4OVAA 5GAN2 4FYVB 3TSWA 2EJ9A 4C92A 3JCMP 4Q5WA 1E6HA 2MIOA 2I0NA 2CYZB 4RTUA 4M7DE 2W10A 2JM9A 5KYUB 1PNJA 5FU6B 2YUQA 2CP3A 3MKDA 3G6ET 2MAMA 2OTJT 3ZBDA 2MCNA 3HPWA 1ZUYA 1W2BA 1AZGB 3GIBA 1TG0A 2D1XA 2EAYA 3VUZA 1BI1A 4V2SA 4NL2A 1JXOA 1AWWA 5CK9A 4OB2B 1WJRA 1OU9A 2FZKB 1D1CA 1UGPB 2FZGB 1E6GA 2RI2A 3CMEA 4X9DA 1NEBA 1SHGA 1ZHIA 3CCMA 3X20B 3V8LA 2DYBA 3UA7A 4PJMA 4N0AC 3QKJA 4M4ZA 4N4IA 4JLGA 3OB9A 3CCEQ 3VS3A 2F69A 1VOMA 5GAMh 1NJIU 3A8LB 3IQLA 3OSSC 1Q82U 1G8XA 3O5ZA 1N6AA 2EJFA 1TUDA 2DKGA 3EGDB 2CP2A 1W4SA 4PLLA 4C0DC 1H3ZA 1W2BP 3ASKA 1G5VA 5IHIA 1VQOT 3QWYA 1WX6A 2R58A 2D6FA 3GF5A 3TCJA 1W70A 2ROTA 2F5TX 3SWNB 2GGRA 2B8AA 3G6EA 4M7DF 2OTJA 1XOVA 2Z0WA 4OMOA 1YJNQ 3OS5A 2MPXC 3L2UA 3CC2T 1AWOA 1K9MR 2VWFA 5LJ5e 2O4XB 2RJEA 3QHSA 1MGQA 4KGXB 2YXYA 2QASA 4N4HA 3OYIA 2XK0A 2HNIA 1YI2A 2DXCA 2LZ6B 2LJ3A 2PVOB 5EG2A 1VQKT 1LPLA 2HBPA 3PVQA 1YJWT 3S6WA 1SKUB 1Q82R 1F1BB 4M7AC 2QXFA 2IG0A 1K1ZA 4M7DA 5M9OA 3VUBA 2OX7A 3RDVA 5CQYA 4FCYA 2QDLA 2YSQA 3VYGA 2EWNA 5KH6A 3MP1A 1X01A 3OS0A 4IIMA 1G83A 1JB0E 2C0TA 4IUQA 3LGLA 1NPPA 2HQXA 3C12A 3A8HB 1VQ8Q 1PRMC 2YHTA 3CBMA 3RKWA 2VGMA 2P84A 2G3RA 3N5BB 4RTWA 4FW1A 2VV5A 1R8OB 4CC2A 2X3WD 1MV0B 3U23A 2ZCFB 2DL5A 5CQXA 5GANf 5LJ5h 5FLXE 4M7AD 2EIFA 2DVEA 1VQ5T 1VYUA 1W1FA 1K76A 2QQ9A 5LJ3j 5GMKj 1ZBXA 1UHCA 8AT1B 4J9FA 5IN1A 2QQSA 1VQKA 5EC7A 1AZEA 1E7OA 4A53A 5KYYB 1Q86C 1YJWA 4JS5A 1WPYA 2NUPA 4M77C 3VS2A 4A4EA 4E7JA 4J6YA 2DX1A 4A54A 4F7UB 1NYFA 1NEGA 1RAEB 3QO3A 2DTOA 4BUGA 1U3OA 3BDLA 1W6XA 2KRSA 4AFSC 5KYWA 1U8RA 4C8QC 1QVGS 1UJYA 2OJ2A 1QP3A 2V1RA 1MNEA 3QJ6A 1JBMA 3I56Q 4M78D 1B3QA 2X35A 2RK1A 1HXDA 2KEAA 2NUTA 2OAUA 5GAOr 4XU1A 2PNIA 2DL4A 2KNBB 2KAFA 1H92A 4RTXA 1NJIC 2XDBA 2RQTA 2LJ1A 3MEUA 4RKUE 1PHTA 2DERA 3REAB 3MO8A 4M77D 5A0GA 4XTZA 4AG2C 1Q7YC 2E1HA 4NOYA 1VQ5A 1KIKA 1ZBJA 2L3SA 1ZQ1A 4RTTA 3JCMh 4LDWA 2VKNA 3CC7T 3KBGA 2DVJA 2K9GA 4C8QD 1I1JA 4EMKA 2KYBA 1Y57A 1U1TA 4OB3B 3BDUA 3D7SB 1UTIA 1VUBA 4E2FB 2JTMA 2QQAA 2BKDN 2KYMA 2DXUA 1Q95G 4HA8A 4JZ3A 4JZ4A 5GAMd 4FL6A 1SRLA 2H8HA 4Z02A 3LYIA 2GQVA 4IURA 2EYYA 2GTOA 1M2VB 4IUUA 1V29B 3JSCA 2VGNA 4DEYA 1QCFA 1WHLA 5GAOl 3GBQA 5C6SA 2KE9A 1BI2A 4PJOG 1BI3A 4JS4A 2K57A 4A63B 3E9GA 4FSXA 5FRNA 1RI0A 4O5VA 2K79A 2F2XA 3EGXA 2XMFA 1MMGA 2XKOC 4BACA 1X75C 5D6YA 4BE1A 1S72T 3DLLA 4M7AG 3EFRA 4ATOA 3L1AA 4KH0B 3AT1B 2O31A 1D0ZA 4UC4A 3HP9A 3S3MA 4D8KA 3QSUA 3CC7A 3H8ZA 1WHMA 3CD6Q 1AEYA 1I5LA 2AT1B 3UDCA 3JRZA 1WZOA 5GAN6 4FYWB 2WACA 1YJ9Q 3JB9I 4C5HA 1MV3A 3CCUT 2QEXQ 1KQSA 2DO3A 2L3PA 3OY9A 1IO6A 2L3RA 3JCMV 2DBKA 2J06A 4XTYA 1LOJA 1NZ9A 3META 2LX7A 5CKEA 5GAN3 1BKBA 1AWXA 3WVDB 2VXFA 1QLYA 1T3LA 4PFZA 1YHQT 3KUFA 4AT1B 1EZZB 1KC8R 5LJ5f 4ESRA 2JXBA 1UGSB 2L8DA 2QTXA 3OBWA 5GAOq 2MI6A 5J3BA 3TVTA 4DBFA 2FRYA 1X2QA 4LDYA 3VU3C 5FU7B 2O9VA 4PJOE 1H3HA 4J9EA 2JTEA 4DBHA 2IIMA 1ARKA 2DILA 3RR6A 1I0CA 1QP2A 2YRVA 3M0TA 2FYKA 1QVFS 2EW3A 4OF1A 4CC4B 1LJOA 4ZN1A 3H0HA 1VQ6T 4M77G 2FB7A 2Y4XA 2ATCB 1TU0B 5DLOA 1KQSP 4GY5A 3CPFA 3THKA 4LXCA 3GNFB 1CSKA 2AIRB 1K0SA 1OX9A 2DETA 2LCSA 1IZ6A 3SDZA 1GBQA 2J6OA 1SSFA 3DB3A 1BIAA 4VUBA 2COZA 4XTWA 4Y28E 3FIFA 2A0FB 3A8MB 1A0NB 4Z89A 3EH1A 3PTAA 2V8JA 1VQLT 4J7IA 4ELYC 2VASA 4QKUA 2X4JA 4DEXA 1VQNT 1ZUUA 2RB6A 4D8DA 1AHJB 1RABB 5D7UA 5DY9A 4B9WA 1IHWA 1HK9A 4M7DB 4ORZA 2X4WA 3M0RA 3CCRQ 2RJDA 2BUDA 5CO7A 2KVQG 2WSEE 1TUGB 2FL7A 1KHCA 3CCLA 2FPDA 2ZPIB 3CCQQ 3JCMf 3I55T 4PLIA 1UGQB 3OMCA 2YUPA 2OI3A 2LT4A 3QPHA 4BY6B 2CH4W 1OU8A 3OW2A 4ZGJB 4PJOF 1Z9QA 3CC2Q 2KXCA 3INZA 3CMAQ 1SF9A 2MMPA 1YWPA 4KULA 3CBPA 4LDVA 5GANg 4KUIA 1JO8A 3GPLA 4XTUA 4OMQA 1JEGA 1BBZA 1B07A 2RQUA 1IGUA 4BDZA 2J7IA 3PVLA 1YIJQ 5IXFA 3GP8A 5HK3A 4XAXB 3SHWA 2CH4A 3CCVQ 3FJ5A 4F17A 3JV3A 3QIIA 8ATCB 3L2QA 4J9CA 4M75C 1BB9A 4DBRA 4J9DA 4PFPA 3SWNC 4RTYA 4AFZC 2EGEA 1WJSA 1VQ9Q 4JDSA 1VQLA 4PJOA 4L59A 2QA4A 2NUPB 4Z88A 2RN8A 2X3XD 4XK8E 1VQNA 2O2OA 2EKHA 1I8FA 1IRXA 4HKEA 3EG1A 1OEBA 3OW2P 1QCNA 5KYWB 1IGQA 1YN8A 3GNGA 2IVWA 4FSSA 2COYA 3I55A 3PNWC 1TSFA 3CPWA 4OGCA 3HHTB 4LD6A 1GRIA 5LJ3e 1RL2A 1M2VA 1NBEB 3EG2A 3HTRA 1RAFB 5FROA 1FMWA 4IUVA 1ABOA 4BD3A 4QQ6A 4Y91A 3OYNA 2Y90A 4M75D 2GTJA 2FEIA 2AZVA 2LX9A 3NTKA 4M77F 1PC0A 5GAMg 2O88A 2CT4A 3A5ZB 1MMDA 2XIDA 2KDSA 1JJ2A 2XICA 1MUZA 3SEMA 3L2VA 1K73U 4JJCA 2K4YA 2P4RA 4A4FA 1R0CB 4D6WA 2CP5A 2CREA 2NWMA 4XU3A 1BI0A 4EMKB 2HQEA 3G4SQ 1X2KA 3A8OB 3HFNA 3CCJQ 3BW1A 1EIFA 1VQMQ 2EYQA 2PVDB 4HCZA 3RKXA 1SPKA 1WYXA 1YI2T 3CPWP 2E3IA 1LNXA 1YITA 2ED1A 4M77A 3HRSA 1WFWA 4CI0C 1K9MU 3OS2A 2L89A 5I2MA 3PIOA 3H0IA 2PTKA 4QQDA 1M9SA 2E5QA 1K0XA 1HD3A 4ZNXA 1X27A 4QVDA 3OS1A 2BIVA 1WIEA 2DTHA 1PRLC 1QW1A 4ZGEB 1JJ2P 4J83A 1K73R 4LDXA 2E65A 1M8VA 4P5NA 1IREB 3QDFA 2CP0A 1D1AA 3MPUB 1ZA1B 4FYXB 1QVGA 1BK2A 2M16A 1ZSZC 1C1AA 3EGXB 2EQIA 4Y92A 1U06A 5CAIA 3NMZC 1Y07A
chains in the Genus database with same CATH topology
4X34A 2RO0A 3PGGA 4M78D 3HSBA 3SD4A 4M7DG 2GFAA 2RK1A 2X35A 1HXDA 2PUKB 1FWZA 2RJCA 2WSCE 1KG1A 2OAUA 5GAOr 4BE0A 4XU1A 3G7ZA 2ZPFB 2P0KA 1I81A 4C0FA 2E70A 1YITT 4M7AA 4NL3A 2F5KA 4WF2A 4C5EA 3JCMX 2KSSA 2DJZA 2PU9B 4RMOA 2KAFA 2EQJA 2JZ2A 5DM7R 1NJIC 2XDBA 3FC3A 2R57A 3OYBA 1KHIA 4J6XA 4E7KA 4M78F 3MEUA 2KMTA 5A2QE 3FDRA 2LRQA 2DIGA 4NS5A 3HL8A 4RKUE 3S3NA 3ME9A 5GMKe 3MO8A 2ZGWA 4M77D 2DPPB 5LJ5g 2RK2A 5CKFA 4XTZA 5A0GA 4LDUA 3V7SA 2QI2A 1Q7YC 2E1HA 2LCCA 4NOYA 3R6OA 1UGRB 1VQ5A 4RCCA 3GLXA 4KT0E 4JRKA 3CD6T 1ZQ1A 4J6WA 3JCMh 5CIUA 4LDWA 2FHDA 3PMTA 3CC7T 3QXEB 3O8VA 1N27A 3CC4T 3KBGA 3LLRA 3M55A 4MMLA 1YJ9T 4C8QD 5KCOA 4EMKA 5GANj 1S72A 1VQ7A 2OTLT 1U1TA 4F7UF 4OB3B 2VUBA 2QEXT 1M5Q1 3BDUA 1I4K1 4CRIA 3HRUA 1K8AU 1FXXA 3QZ9B 3T9NA 1VUBA 3I56T 1WQ7A 2ZPBB 5A0DA 2JTMA 3L2RA 1FX7A 1TH7A 5GAN7 2QQAA 2M0OA 2BKDN 2EJGA 2DXUA 2FVUA 1N9RA 2D9TA 2WSFE 4HA8A 5GAMe 3X24B 2YLBA 1PSEA 3JB9D 1OZ2A 1VIFA 5IAYA 3OYAA 4M78A 3FB9A 3HRTA 4OB0B 4EMHA 5GAMd 5GAN4 4FL6A 4M75G 4C8QF 3MEAA 4Z02A 1KD1C 3LYIA 3P8BB 5GAOm 3MP8A 1UEBA 2GQVA 1G3WA 2XG8D 3MHXA 3QYHB 4O6JA 4XU2A 4EMKC 3LWIA 4E7LA 4C5GA 2CZ6B 5CCAA 2RM4A 2RHZA 1VIEA 4IURA 3CCUA 4IKFA 2GFUA 3OYMA 1WGSA 2E10A 3DLMA 3L2WA 2RI5A 2NLUA 4IUUA 4C92E 1V29B 4B9XA 2CS7A 3JCMb 3OYCA 3JSCA 2VGNA 3SFMA 2ZZDA 2D0QB 1Q81U 3JB9F 5GAN8 5KE3A 5D6WA 1Q86U 1G3SA 5J26A 5GAOl 4XU0A 1JRIA 3LH0A 3C4SA 4M78C 1O9SA 4QVZA 5C6SA 1YHQA 2ZPGB 4MMKA 4F7UA 3V8KA 1BI2A 1Y96A 2X4YA 4E7HA 1Y7XA 1BI3A 1YCYA 4PJOG 2MWOA 4BI4A 4C92C 3DB4A 2K57A 4JS4A 2JTFA 1W2BS 3RERA 3E9GA 1VQ4T 4FSXA 5FRNA 1RI0A 5LJ3h 4O5VA 5GMKh 2M1HA 2E64A 4E7IA 2P0PA 2EFIA 4MDXA 2XKOC 4BACA 2EKOA 1X75C 3KXTA 1VQPT 5D6YA 4BE1A 5FRMA 4C8QA 1S72T 1WJQA 2P0QA 3FLGA 3DLLA 1VQ7T 2K3XA 4M7AG 3E19A 4PKCC 3TREA 1M90U 3EFRA 4ATOA 5GANe 2RJFA 3L1AA 3EAEA 3CMAA 3CD6A 3CCST 4UC4A 3S3MA 3HP9A 4OGEA 4BB7A 3P8HA 3JCMg 5GANd 3CC7A 3QSUA 3H8ZA 3F70A 3JCMW 4C0GA 3CC4A 1MHNA 4XTXA 3BFMA 3OW2S 1YJ9A 1I5LA 5L8RE 2EQUA 1VQ6A 3UDCA 3JRZA 5GMKm 5DLQE 5GAN6 2LQ8A 2WACA 2DIQA 2OTLA 5CR2A 3JB9I 2QEXA 2XDDA 1Y71A 5GAMj 3QBYA 4RG8A 4OP0A 3PT9A 2QQRA 5D6XA 4C5HA 4JUVA 3CCUT 3RKYA 1KQSA 2QQBA 2ZPEB 3M5AA 2DO3A 5AYFA 3OY9A 2L3RA 4FM4B 3JCMV 2CZ7B 4XTYA 1KQSS 3OYGA 1K9MC 2Y4YA 5GMKl 1LOJA 1NZ9A 3FEOA 2K5IA 3META 5CKEA 5GAN3 3FJPA 1BKBA 1P92A 2RHYA 3NFCA 2LNVA 3WVDB 1Q7YU 2VXFA 1WNLA 4C92D 1YHQT 1UB4A 3KUFA 1U1SA 3CCRT 4BI8B 5LJ5f 1UGSB 2L8DA 3J81E 3RESA 2QTXA 2V8IA 3OBWA 3JCMQ 3CCQT 3QDRB 5GAOq 4QVCA 2MI6A 4M75B 5IT9E 3OBYA 5J3BA 2EQKA 3PIPA 3V8JA 1M1KC 2GCXA 3JAME 4RCBA 5FU7C 2MWPA 4FT4A 4FU6A 1Q82C 3QYGB 2VC8A 5LJ3f 4LDYA 3VU3C 3NTHA 5FU7B 3P8DA 2KQWA 4PJOE 5GAOp 4N4GA 3RUXA 4C92F 3JB9J 5GAOn 3CMET 2DXBA 4FIBA 4BE2A 1QP2A 2YRVA 2E6ZA 2FYKA 2AHJB 3CCMT 1QVFS 1BIBA 5HKCA 1H641 3CMAT 1VQ4A 2X4XA 4OF1A 4ZN3A 3NTIA 1LJOA 2VYTA 4ZN1A 5LJ3g 2A3LA 1KD1U 4ZGDB 2DXTA 1G3YA 2DK3A 2QDYB 2VXEA 1VQPA 3CCET 4PJOC 4IUTA 1VQ6T 3HKSA 5GANh 4M77G 2E6NA 4PJOB 2FB7A 1OI1A 2LDMA 2Y4XA 4F7UG 2LQKA 3CPWS 1YIJT 2E12A 5DLOA 3CCSA 4GY5A 3CPFA 2DZ9A 3JCMJ 3GNFB 2KY9A 2K2VA 3WXMB 3CCVT 1IZ6A 3M57A 3SDZA 3QUIA 4OVAA 1QVPA 1SSFA 5GAN2 1B34B 3H6ZA 3DB3A 1BIAA 4VUBA 2EJ9A 4C92A 2ZPHB 4Q5WA 3JCMP 3RMQA 4M7DE 2CYZB 4XTWA 1VQ9T 1N8RU 4Y28E 3FIFA 2P4TA 2RI3A 3A8MB 5FU6B 2YLCA 2O01E 4DA4A 3PTAA 2V8JA 1VQLT 4J7IA 4ME7A 3J80E 3QJYA 1JJ2S 3JB9H 2CZ0B 4ELYC 3MCAB 3G6ET 4JRIA 2MAMA 2OTJT 3ZBDA 3C94A 3EFSA 1PSFA 2X4JA 1VQNT 3ER0A 4MZMA 2LTOA 1GXIE 2RB6A 3HPWA 3MEVA 1AHJB 4M7DC 1W2BA 3CCRA 3GIBA 5DY9A 1YBYA 3M58A 4YTLA 5J39A 4B9WA 3GOXA 1HK9A 1VQOA 2EAYA 4KBMB 3VUZA 1KC8U 4HCCA 4M7DB 2X4WA 3CCQA 1BI1A 2RHXA 2RJDA 2BUDA 4V2SA 4PJOD 2RD1A 2KVQG 2WSEE 4NL2A 5CO7A 2FL7A 1KHCA 4DOVA 5CK9A 4OB2B 3CCLA 2ZPIB 4IUPA 1WJRA 3JCMf 2RHUA 3I55T 4PLIA 3OYFA 2CKKA 4GLKA 1K73C 3BY7A 1UGQB 1UGPB 3OMCA 3OYHA 3CEYA 1N9SA 4BY6C 5LJ5j 2RI2A 3CMEA 2LT4A 3QPHA 4X9DA 3CC2A 5GAN5 4II1A 4BY6B 1ZHIA 3CCMA 3X20B 4HT8A 3OW2A 4ZGJB 4PJOF 3V8LA 2DTIA 4DOWA 3INZA 4ZTJA 2JOYA 4N0AC 3QKJA 3CCEA 1M4ZA 3LGFA 2MMPA 4N4IA 3UPUA 4JLGA 3OB9A 4KULA 3CBPA 4LDVA 4C0ZA 3JCMe 2XDPA 5GANg 4KUIA 2F69A 4BI3A 3GPLA 4XTUA 5GAMh 1NJIU 1YIJA 1XTDA 4M75E 2LVMA 1KQ2A 3A8LB 3OSSC 1XQHA 4BDZA 1Q82U 3GP8A 1N6AA 4QQGA 5HK3A 4XAXB 2EJFA 4MZPA 4M77B 4X9CA 3CCVA 3LWHA 1M1FA 3V7RA 4M7DD 2E41A 3OYKA 3QZ5B 2DKGA 2EQMA 2R5MA 2XU8A 4L6V5 4RG2A 3M4GA 1WQWA 1W4SA 1DJ7B 3QIIA 4PLLA 2A7YA 4QW2A 4C0DC 1H3ZA 3ASKA 3TEEA 5I21A 3L2QA 1G5VA 2RA2A 3G4ST 1VQ9A 3PFSA 3M9QA 1M1GA 4M75C 4C0DB 3CCJT 1VQOT 4KUDK 1VQMT 4JRQA 4HT9A 5C0MA 2R58A 2MF2A 5LL6S 3SWNC 2D6FA 3FRNA 3GF5A 3TCJA 2C06A 1WJSA 3A8GB 1YJNA 4JDSA 1M90C 3DKMA 1VQLA 4PJOA 4M78G 2F5TX 3SWNB 3CCLT 3SB2A 2B8AA 3VV0A 4L59A 4FT2A 4PNOA 4ELZC 3G6EA 3VJPA 4M7DF 1XOVA 4XTVA 2QA4A 2OTJA 4XK8E 3OS5A 3M59A 1VQNA 3MP6A 2K3YA 4C92G 1QVFA 3L2UA 2PUOB 1NPRA 2DD5A 1D3BB 3RMSA 1I8FA 2LCLA 3CC2T 3M54A 4HKEA 4MDWA 5LJ5e 2I2LA 1B34A 3GNGA 1XNIA 2DZCA 2O4XB 2RJEA 2IVWA 3QHSA 4EDUA 1MGQA 4M7AE 3I55A 2XHCA 3PNWC 5LJ5d 4BDYA 3UT1A 3M4YA 4N4HA 5GMKi 3ZEHA 3OYIA 2XK0A 2HNIA 1YI2A 3CPWA 2DXCA 3M56A 4OGCA 3WVEB 2PVOB 3HHTB 4LD6A 5EG2A 5LJ3e 2V8KA 1RL2A 3CXCA 1VQKT 4J7FA 2HBPA 1YJWT 3S6WA 5FROA 5LJ3d 3J7AF 3OSVA 4R56A 3Q1JA 4IUVA 3CXCS 5GAMf 3AHUA 4BD3A 4M7AC 4QQ6A 2QXFA 4Y91A 2IG0A 3OYNA 4JRPA 3E1SA 3X26B 4M7AB 3OQ5A 2M9UA 4C8QG 3CBOA 4M7DA 5I2SA 2CGHA 2Y90A 4M75D 2JVVA 5M9OA 2LC4A 3PMIA 3URGA 3VUBA 2LX9A 3NTKA 4M77F 5CKBA 3UWNA 3X25B 5CQYA 5GAMg 3LW5E 2XI9A 3A5ZB 5FU6C 4EPCA 2JNGA 2XIDA 2KDSA 3M53A 4XQ3A 1JJ2A 2XICA 2LT1A 1YJNT 4J5YA 3OYDA 3L2VA 3VYGA 2EWNA 5KH6A 3JB9G 3MP1A 1K73U 2RHIA 1KQ1A 1X01A 4LD9K 2K4YA 3OS0A 5KE2A 2QA4T 4ZTFA 3X28B 4A4FA 1JB0E 2PVGB 4M75F 3OYJA 4D6WA 2H3JA 4R55A 1VQ8A 4IUQA 3LGLA 3G4SA 2KK4A 1NPPA 2HQXA 4M78E 5CKDA 5HK0A 3CCJA 3L2ZA 3C12A 3A8HB 2DAQA 1VQMA 4XU3A 4DQ2A 1BI0A 4EMKB 2HQEA 2YHTA 3CBMA 4N0AA 3RKWA 3OYYA 3A8OB 3HFNA 4OB1B 3OA6A 2VGMA 5KCHA 3BW1A 1EIFA 4MZTA 3G71A 2EYQA 2G3RA 2PQWA 2PVDB 3N5BB 1K8AC 4HCBA 3JCMc 4HCZA 1O75A 2VV5A 2R5AA 3RKXA 1R8OB 3S3OA 1G3TA 2DEQA 2HD0A 3RIRA 4A4KA 2ZCFB 1YI2T 2L5QA 3OYEA 3VKIA 5CQXA 5GANf 1LNXA 5LJ5h 1YITA 2K5FA 4M77A 5FLXE 2XD0A 4M7AD 4M78B 2DD4A 2EIFA 3HRSA 2DVEA 4CI0C 2GF7A 1VQ5T 1K9MU 3OS2A 2L89A 1X6OA 5I2MA 3PIOA 2QQ9A 2CZ1B 4M77E 5CKHA 5LJ3j 5GMKj 4QQDA 4F7UE 1ZBXA 1M9SA 5HY6A 1N8RC 4C92B 4PL6A 2E5QA 3TU4K 4A4HA 3OMGA 1NE8A 5CVIA 2QQSA 5IN1A 4A4GA 4QVDA 1VQKA 4M75A 1Q81C 3OS1A 4A53A 4EMGA 1Q86C 1YJWA 4JS5A 1WPYA 3JCMd 3SWNA 4M7AF 2BIVA 2DTHA 3C95A 2JN0A 1QW1A 4E47A 3QG1A 4C8QE 1M1KU 4M77C 3E9FA 3L42A 4A4EA 4ZGEB 4J8OA 4E7JA 4J83A 2RH2A 5A0LA 2K5LA 4L5GA 1KC8C 4J6YA 2E65A 4LDXA 4A54A 1M8VA 4P5NA 4F7UB 1D3BA 1IREB 4TVRA 3OYLA 1Y96B 4OMFB 3VYHB 4JJNK 3QO3A 2DTOA 3HFOA 4BUGA 3BDLA 2JUFA 3MEWA 1QVGA 1U8RA 1VQ8T 2O4XA 2HAXA 1BYMA 2M16A 3V7CA 4C8QC 1OYXA 1QVGS 3LX7A 1QP3A 3ZFJA 3I56A 4C5IA 4C8QB 4JLIA 5CAIA 1OZ3A 3QJ6A 3G71T 1Y07A 1JBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A G;  3PGG A;  4M78 D;  3HSB A;  4M7D G;  3EFR A;  5LJ3 d;  3JB9 H;  1HXD A;  4JRI A;  5GAN e;  3L1A A;  5GAM f;  3AHU A;  3EFS A;  5GAO r;  2RB6 A;  3QSU A;  4XU1 A;  5GAN d;  4Y91 A;  3JCM g;  4M7D C;  4M7A C;  1I81 A;  3JCM W;  3GIB A;  5DY9 A;  4XTX A;  3BFM A;  1HK9 A;  4M7A B;  2EAY A;  4NL3 A;  4C8Q G;  1I5L A;  4WF2 A;  4M7A A;  4M7D A;  4M7D B;  3JCM X;  2CGH A;  2Y90 A;  4M75 D;  2DJZ A;  5GMK m;  5GAN 6;  4V2S A;  4PJO D;  2RD1 A;  4NL2 A;  3JB9 I;  4M77 F;  5GAM j;  4J6X A;  4OP0 A;  4M78 F;  3JCM f;  5GAM g;  4JUV A;  3RKY A;  4XQ3 A;  3BY7 A;  5GMK e;  2ZGW A;  4M77 D;  3JCM V;  1N9S A;  4J5Y A;  5LJ5 j;  5LJ5 g;  2EWN A;  3JB9 G;  4XTY A;  4X9D A;  1KQ1 A;  1X01 A;  4XTZ A;  3V7S A;  5GAN 5;  5GMK l;  1LOJ A;  2E1H A;  4NOY A;  4RCC A;  5GAN 3;  3FJP A;  4HT8 A;  4M75 F;  4PJO F;  4JRK A;  2DTI A;  2VXF A;  3V8L A;  3INZ A;  1WNL A;  4C92 D;  4J6W A;  3JCM h;  4N0A C;  1U1S A;  4M78 E;  3L2Z A;  5LJ5 f;  4MML A;  4XU3 A;  4DQ2 A;  4EMK B;  2YHT A;  4N0A A;  3RES A;  3RKW A;  4C8Q D;  2QTX A;  4EMK A;  5GAN g;  3JCM Q;  5GAN j;  3HFN A;  3JCM e;  4QVC A;  4M75 B;  5GAO q;  3BW1 A;  1U1T A;  3V8J A;  4F7U F;  3JCM c;  4XTU A;  4RCB A;  3RKX A;  5GAM h;  1M5Q 1;  3BDU A;  1I4K 1;  2VC8 A;  5LJ3 f;  2DEQ A;  3VU3 C;  4M75 E;  3RIR A;  1KQ2 A;  1WQ7 A;  4PJO E;  3JB9 J;  5GAN 7;  1TH7 A;  5GAO p;  2EJG A;  3RUX A;  4C92 F;  2DXU A;  2EJF A;  1N9R A;  1LNX A;  4HA8 A;  4M77 B;  4X9C A;  4M77 A;  2YLB A;  5GAM e;  3V7R A;  5LJ5 h;  3JB9 D;  2E41 A;  4M78 B;  4M7D D;  5GAN f;  4M78 A;  3FB9 A;  2DKG A;  2DVE A;  4EMH A;  5GAM d;  5GAN 4;  2FYK A;  4M75 G;  3M4G A;  4C8Q F;  1BIB A;  1H64 1;  1WQW A;  4M77 E;  5GAO m;  5LJ3 j;  4EMK C;  5GMK j;  4F7U E;  1LJO A;  5LJ3 g;  4XU2 A;  5I21 A;  4M7A D;  2RA2 A;  4C92 B;  2RM4 A;  4M75 C;  2DXT A;  4PJO C;  2VXE A;  4HT9 A;  3SWN C;  2E10 A;  4QVD A;  5GAN h;  4M75 A;  4M77 G;  4PJO B;  2FB7 A;  4A53 A;  4C92 E;  4EMG A;  4PJO A;  4F7U G;  4M78 G;  3SWN B;  3JCM b;  1WPY A;  3JCM d;  3SB2 A;  3SWN A;  4M7A F;  3JB9 F;  4PNO A;  5GAN 8;  4M7D F;  2DTH A;  4XTV A;  2JN0 A;  4C8Q E;  5GAO l;  4M77 C;  4XU0 A;  1JRI A;  2DZ9 A;  4M78 C;  3JCM J;  4C92 G;  4J6Y A;  2E65 A;  4MMK A;  4A54 A;  1D3B B;  1M8V A;  4F7U B;  1D3B A;  4F7U A;  1I8F A;  3V8K A;  1Y96 B;  1Y96 A;  3QUI A;  3QO3 A;  2DTO A;  3HFO A;  4PJO G;  1YCY A;  4C92 C;  5GAN 2;  1B34 B;  2K57 A;  5LJ5 e;  2I2L A;  1B34 A;  3RER A;  2DZC A;  3QHS A;  5GAO n;  1BIA A;  1MGQ A;  4M7A E;  2EJ9 A;  5LJ3 h;  3V7C A;  4C92 A;  4C8Q C;  5GMK h;  5LJ5 d;  2E64 A;  3JCM P;  4M7D E;  4XTW A;  5GMK i;  3FIF A;  2HNI A;  4C8Q B;  4JLI A;  4C8Q A;  5CAI A;  5LJ3 e;  2YLC A;  1JBM A; 
#chains in the Genus database with same CATH topology
 3EG9 B;  3NPF A;  3SD4 A;  2GFA A;  2RJC A;  1FWZ A;  1WHK A;  1I81 A;  1HSQ A;  2HEQ A;  2PU9 B;  2ED0 A;  2JZ2 A;  2LJ0 A;  1WDX A;  3FC3 A;  2R57 A;  4J6X A;  4E7K A;  2KMT A;  2LRQ A;  3HL8 A;  1WI7 A;  2ZGW A;  2DPP B;  5LJ5 g;  3M0S A;  1M90 R;  1QWF A;  4LDU A;  3V7S A;  3EG3 A;  2LCC A;  2AZS A;  5IHK A;  1GFD A;  2C0I A;  2FHD A;  3PMT A;  3MJX A;  3QXE B;  3CC4 T;  3LLR A;  3M55 A;  4MML A;  5KCO A;  5GAN j;  2RQR A;  2D0N A;  1QVG P;  1Z9Z A;  1VQ7 A;  3UAT A;  3I9Q A;  2QYZ A;  1S72 Q;  4CRI A;  1K8A U;  2LQN A;  3QZ9 B;  1WQ7 A;  5A0D A;  4HVW A;  1TH7 A;  1FMV A;  2EJG A;  1KK7 A;  2YLB A;  3JB9 D;  1OZ2 A;  1VIF A;  4OB0 B;  4EMH A;  4M75 G;  1NLO C;  3MEA A;  3QYH B;  4PJN A;  4E7L A;  1UEC A;  4C5G A;  5CCA A;  4IKF A;  2GFU A;  2DL7 A;  3OYM A;  3DLM A;  2KRO A;  2RI5 A;  3CCU Q;  1X6G A;  2CS7 A;  3CQT A;  3SFM A;  1AOJ A;  2D0Q B;  1RAH B;  3M0P A;  5GAN 8;  3G71 Q;  1Q81 U;  5D6W A;  2GBQ A;  4XU0 A;  1JRI A;  4M78 C;  7AT1 B;  4MMK A;  2DBM A;  4LE9 A;  2KRN A;  2JMA A;  3V8K A;  2HL5 C;  2KBT A;  4OMP A;  2X9H A;  4K11 A;  1YHQ Q;  1Y7X A;  4C92 C;  1W2B S;  1HYO A;  2RMO A;  1WHG A;  4HVV A;  2M1H A;  2KT8 A;  2CUD A;  4MDX A;  2EFI A;  2YRD A;  2EKO A;  1VQP T;  2QK0 A;  4AFQ C;  1WJQ A;  3FLG A;  4GLM A;  3E19 A;  1K8A R;  3CMA A;  5GAN d;  3P8H A;  3JCM g;  3F70 A;  3TQ7 P;  3CC4 A;  4XTX A;  4JPB W;  2ENM A;  2EQU A;  5L8R E;  5GMK m;  5CR2 A;  2CUB A;  1X43 A;  2XDD A;  5GAM j;  4OP0 A;  4FYY B;  1N8R R;  4JUV A;  1U5S A;  2OTL Q;  1RAC B;  2QQB A;  2HMA A;  5AYF A;  4FM4 B;  2H3E B;  1Q81 R;  3OYG A;  3UF4 A;  1K9M C;  2Y4Y A;  2KXD A;  5ECA A;  1WNL A;  4C92 D;  1UB4 A;  2DEU A;  1U1S A;  2LP5 A;  4BI8 B;  3VS6 A;  2V8I A;  3JCM Q;  4QVC A;  1IXD A;  4RTZ A;  3PIP A;  1VYV A;  4RCB A;  5FU7 C;  4FT4 A;  4FU6 A;  1Q82 C;  5LJ3 f;  4FW2 A;  5GAO p;  4RUG A;  1BU1 A;  4N4G A;  2VVK A;  2DJQ A;  2DXB A;  1WXT A;  2E6Z A;  3R6N A;  1BIB A;  1H64 1;  2X4X A;  4ZN3 A;  4QT7 A;  1KD1 U;  2JS0 A;  2DXT A;  1G3Y A;  1VQP A;  1VQ4 Q;  2G6F X;  1TTH B;  3CCE T;  2FPE A;  1GCP A;  4PJO B;  4F7U G;  3EFO B;  2B86 A;  2DZ9 A;  1SRM A;  3CCS Q;  2E5K A;  5I22 A;  1MMN A;  2YUN A;  1SHF A;  4OML A;  1JU5 C;  3C0C A;  2C0O A;  2O01 E;  4ME7 A;  3UA6 A;  3MCA B;  2MK5 A;  2FZC B;  4JRI A;  5AT1 B;  1NM7 A;  3C94 A;  3EFS A;  1BCO A;  2LTO A;  4MZM A;  3MEV A;  4M7D C;  4YTL A;  3M58 A;  3GOX A;  1KC8 U;  4HCC A;  4CC3 A;  2RHX A;  1PCX A;  2RD1 A;  1KD1 R;  2RHU A;  1QKX A;  4RTV A;  3BY7 A;  3OYH A;  5LJ5 j;  4BY6 C;  2FO0 A;  2BE9 B;  3EG9 A;  5GAN 5;  2BZ8 A;  1OX8 A;  4HT8 A;  3CME Q;  3QWX X;  1WA7 A;  3CCM Q;  2FG0 A;  1K4U S;  3CCE A;  4C0Z A;  2XDP A;  1WLP B;  4BI3 A;  2NYS A;  3EG0 A;  3NHN A;  1M8M A;  4J9H A;  4QQG A;  1X69 A;  4MZP A;  4M77 B;  4X9C A;  3V7R A;  4M7D D;  2E41 A;  2HKQ B;  3QZ5 B;  3OYK A;  1TOV A;  2EQM A;  2R5M A;  2XU8 A;  4L6V 5;  5KYX A;  3M4G A;  1I07 A;  1WQW A;  4QW2 A;  2A7Y A;  1RI9 A;  1M1G A;  2MF2 A;  5LL6 S;  3FRN A;  3H9N A;  5GJV B;  2C06 A;  1YJN A;  3DKM A;  2AKK A;  4M78 G;  3CCL T;  4PNO A;  4FT2 A;  2MYS A;  3VJP A;  2K3Y A;  3G6E Q;  2OTJ Q;  4C92 G;  1NPR A;  3RMS A;  1NG2 A;  1PG5 B;  5IXB A;  3M54 A;  4MDW A;  4OMM A;  1B34 A;  1XNI A;  2DZC A;  1SG5 A;  4M7A E;  5LJ5 d;  1TXQ A;  3M4Y A;  5GMK i;  3ZEH A;  3VS0 A;  1RAA B;  3WVE B;  3M56 A;  4J7F A;  1YI2 Q;  1M1K R;  3J7A F;  3OSV A;  4R56 A;  3CXC S;  4JRP A;  2JM8 A;  2M9U A;  4F14 A;  4C8Q G;  4KGZ B;  2CGH A;  1PKS A;  2JVV A;  3PMI A;  3X25 B;  1C0M A;  3UWN A;  3M0U A;  1UFF A;  2E4H A;  2K3B A;  2XI9 A;  1T3S A;  2ROL A;  5FU6 C;  4EPC A;  3M53 A;  4XQ3 A;  2QG9 B;  1GCQ C;  2LT1 A;  4J5Y A;  3EGU A;  2RHI A;  1KQ1 A;  2QA4 T;  5KE2 A;  4ZTF A;  3X28 B;  4KH1 B;  4R55 A;  1VQ8 A;  3EHR A;  2KK4 A;  4M78 E;  5CKD A;  5HK0 A;  2DNU A;  4N0A A;  4J9G A;  3OA6 A;  1VQO Q;  3G71 A;  5KCH A;  4F16 A;  1O75 A;  3S3O A;  2DEQ A;  2HD0 A;  3RIR A;  4A4K A;  2DRK A;  2L5Q A;  2DYI A;  1ZSG A;  2XD0 A;  2K5F A;  1M3B A;  2L2P A;  2A37 A;  3LH5 A;  2CZ1 B;  4M77 E;  5CKH A;  5HY6 A;  2GNC A;  2W0Z A;  4PL6 A;  3TU4 K;  2DMO A;  2K7A A;  3OMG A;  1JXM A;  4A4G A;  4X1V A;  1ZSZ A;  3JCM d;  2RNA A;  4M7A F;  1VQK Q;  4E47 A;  2JN0 A;  4C8Q E;  2HQH A;  3E9F A;  1YJW Q;  4J8O A;  4L5G A;  1KC8 C;  1D3B A;  4OMF B;  2V1Q A;  5FWB A;  1LCK A;  1WHJ A;  1BYM A;  1OYX A;  4AFU C;  3LX7 A;  4GBQ A;  1OQK A;  3ZFJ A;  3I56 A;  4C5I A;  1NYG A;  4JLI A;  4X34 A;  2RO0 A;  4M7D G;  3EFO A;  2WSC E;  1KG1 A;  4E7S A;  1TS9 A;  1D0X A;  1RLP C;  3PE0 A;  2ZPF B;  2P0K A;  1YIT T;  4HVU A;  1D0Y A;  4M7A A;  4NL3 A;  4WF2 A;  3JCM X;  2KI7 A;  2DJZ A;  4AMC A;  2EQJ A;  5DM7 R;  1KHI A;  4M78 F;  3FDR A;  2DIG A;  4NS5 A;  2YRC A;  2X51 A;  3ME9 A;  4PJJ A;  5GMK e;  1MND A;  2O9S A;  2EGA A;  2RK2 A;  5CKF A;  3KFV A;  3R6O A;  4RCC A;  2A36 A;  1ABQ A;  2JW4 A;  3CD6 T;  4EIK A;  1VQ5 Q;  4Z8A A;  2M0Y A;  1ZA2 B;  1N27 A;  1AD5 A;  1ZLM A;  1YJ9 T;  5IH2 A;  1D1B A;  9ATC B;  4LUD A;  2QEX T;  2VUB A;  1M5Q 1;  2DA9 A;  3HRU A;  2SEM A;  2RQV A;  1FXX A;  3T9N A;  2EYZ A;  3L2R A;  4DBQ A;  1FX7 A;  1V76 A;  2M0O A;  5GAM e;  2WSF E;  3X24 B;  1PSE A;  3OYA A;  4M78 A;  3HRT A;  4C8Q F;  2JT4 A;  3P8B B;  3MP8 A;  1UEB A;  1G3W A;  4O6J A;  3LWI A;  4XU2 A;  2CZ6 B;  1WGS A;  3L2W A;  1UG1 A;  4B9X A;  3JCM b;  1YFN A;  3G1J A;  3A1P A;  5KE3 A;  1Q86 U;  1TWB A;  2ZAE A;  2PZ1 A;  1G3S A;  4QVZ A;  2ZPG B;  1Y0M A;  1Y96 A;  2X4Y A;  4E7H A;  4JJB A;  2E3H A;  2MWO A;  4BI4 A;  3DB4 A;  3RER A;  2JTF A;  4WTO B;  1V1C A;  5LJ3 h;  5GMK h;  2E64 A;  3I5S A;  4E7I A;  2P0P A;  3KXT A;  4C8Q A;  4LN2 A;  1J3T A;  2YWW A;  1VQ7 T;  4PKC C;  1M90 U;  1SEM A;  2RJF A;  3CD6 A;  1N5Z A;  2A28 A;  4OGE A;  2DF6 A;  4C0G A;  1MHN A;  3OW2 S;  3BFM A;  1YJ9 A;  3CC7 Q;  1ZUK A;  1NLP C;  2DIQ A;  1X6B A;  2QEX A;  1Y71 A;  4RG8 A;  5D6X A;  2CP6 A;  1WHH A;  5FWC A;  3RKY A;  3M5A A;  2DE0 X;  2CZ7 B;  1Q86 R;  5GMK l;  3FEO A;  2K5I A;  3EHQ A;  2COW A;  3FJP A;  1P92 A;  2RHY A;  3NFC A;  2D8H A;  1Q7Y U;  2CSI A;  2EYW A;  3CCR T;  1PWT A;  3RES A;  3CCQ T;  4M75 B;  5IT9 E;  3OBY A;  2DRM A;  3QYG B;  4E7Z A;  2BZX A;  3P8D A;  2GQI A;  2DFU A;  5GAO n;  2CDT A;  1YCS B;  4JJD A;  4FIB A;  1OUL A;  1CKA A;  5KYX B;  4IIO A;  3I5R A;  5HKC A;  3CMA T;  2KT1 A;  1AWJ A;  1AVZ C;  3VRY A;  2EVR A;  4PJO C;  4WCI A;  4IUT A;  3HKS A;  1M30 A;  2F1L A;  1R0B G;  1OI1 A;  2LDM A;  2L0A A;  1NJI R;  1RUW A;  1QMC A;  3CPW S;  1YIJ T;  2QAZ A;  1D09 B;  2E12 A;  1M27 C;  1UUE A;  2K2V A;  3CCV T;  3QUI A;  1QVP A;  1Q7Y R;  1B34 B;  3H6Z A;  3M0Q A;  2K6D A;  2ZPH B;  3RMQ A;  2HDA A;  1VQ9 T;  1N8R U;  2L3Q A;  2P4T A;  2K2M A;  4J9I A;  2RI3 A;  2YLC A;  4DA4 A;  3J80 E;  3QJY A;  1JJ2 S;  3JB9 H;  2CZ0 B;  1PSF A;  1GXI E;  3ER0 A;  1VYT A;  3CCR A;  1YBY A;  5J39 A;  1VQO A;  4KBM B;  3CCQ A;  1YNZ A;  4PJO D;  4DOV A;  1WXB A;  2RPN A;  4IUP A;  2BE7 D;  3OYF A;  6AT1 B;  5HCK A;  2CKK A;  4GLK A;  4R0K A;  3CCL Q;  1K73 C;  1B7T A;  2JS2 A;  3CEY A;  1N9S A;  3CC2 A;  2BZY A;  1IB8 A;  4II1 A;  2DTI A;  1R77 A;  4DOW A;  4ZTJ A;  2JOY A;  1M4Z A;  1UDL A;  3LGF A;  3UPU A;  3JCM e;  2FPF A;  1VQ6 Q;  1RAG B;  2LNH B;  2J6F A;  4HCK A;  1YIJ A;  1XTD A;  4M75 E;  2LVM A;  1KQ2 A;  1XQH A;  2J05 A;  3CCV A;  1LVK A;  3LWH A;  1M1F A;  1IHV A;  2KR3 A;  4RG2 A;  2LMJ A;  5GJW B;  1DJ7 B;  3A98 A;  3TEE A;  5I21 A;  2RA2 A;  3G4S T;  1VQ9 A;  3PFS A;  3M9Q A;  4KUD K;  3CCJ T;  2HL3 A;  4C0D B;  1VQM T;  4JRQ A;  4HT9 A;  5C0M A;  1ZSZ B;  2CSQ A;  3A8G B;  1M90 C;  2CT3 A;  4KGV B;  1SSH A;  3SB2 A;  3VV0 A;  4ELZ C;  4XTV A;  2J6K A;  1VQL Q;  3M59 A;  3MP6 A;  1YWO A;  1QQJ A;  2RF0 A;  1QVF A;  3H0F A;  2QA4 Q;  2PUO B;  2DD5 A;  1D3B B;  1VQN Q;  2LCL A;  2I2L A;  4EDU A;  1T0H A;  2XHC A;  2YDL A;  4BDY A;  3UT1 A;  1FYN A;  2D8J A;  3I55 Q;  5KYU A;  2V8K A;  3CXC A;  3VS7 A;  5L23 A;  2HSP A;  5LJ3 d;  3Q1J A;  1GCQ A;  1OV3 A;  5FW9 A;  4B6M A;  5GAM f;  3AHU A;  1FMK A;  2JMC A;  2EYX A;  1VA7 A;  3E1S A;  3X26 B;  4M7A B;  3OQ5 A;  1QWE A;  3CBO A;  5I2S A;  4LUE A;  2LC4 A;  3URG A;  5CKB A;  3EH2 A;  3LW5 E;  4F04 B;  2JNG A;  3REB B;  1T0J A;  2F2W A;  1YJN T;  3OYD A;  3JB9 G;  1KSW A;  4LD9 K;  4M75 F;  2PVG B;  3OYJ A;  2H3J A;  1QVF P;  1QCO A;  3G4S A;  4LNP A;  3CCJ A;  3L2Z A;  3VS4 A;  3VS5 A;  2DAQ A;  1VQM A;  4DQ2 A;  3OYY A;  4OB1 B;  4MZT A;  2PQW A;  4HCB A;  1K8A C;  3JCM c;  1ACM B;  2R5A A;  1G3T A;  2HBW A;  3E2U A;  4PJL A;  3OYE A;  5I11 A;  3VKI A;  3CXC P;  2ESW A;  2NUZ A;  4M78 B;  3I35 A;  2DD4 A;  2GF7 A;  4OMN A;  4ANJ A;  1YIT Q;  1EX4 A;  1X6O A;  3EGD A;  1OOT A;  4F7U E;  1N8R C;  4C92 B;  1QKW A;  4A4H A;  1NE8 A;  5CVI A;  4M75 A;  1Q81 C;  4EMG A;  2ECZ A;  2V26 A;  3SWN A;  3C95 A;  1WXU A;  1M1K U;  3QG1 A;  2HZY A;  1M3A A;  3L42 A;  2RH2 A;  5A0L A;  2K5L A;  1I5O B;  2LQW A;  3BE3 A;  2QTV A;  3ULR B;  3OYL A;  4TVR A;  1Y96 B;  3VYH B;  4JJN K;  3HFO A;  1GL5 A;  2JUF A;  2SRC A;  3MEW A;  2KRM A;  2QGG A;  1VQ8 T;  2O4X A;  5KYN A;  2HAX A;  1HJD A;  3V7C A;  4C8Q B;  2YT6 A;  1OZ3 A;  2EPD A;  3G71 T;  3PGG A;  3HSB A;  4J9B A;  2PUK B;  4BE0 A;  1UJ0 A;  1PM3 A;  3G7Z A;  1H8K A;  1BCM A;  4C0F A;  2E70 A;  2YUO A;  2F5K A;  4C5E A;  2OAW A;  2FRW A;  2KSS A;  1RLQ C;  1TUC A;  4RMO A;  1OPL A;  3OYB A;  5A2Q E;  1M3C A;  3S3N A;  1PD0 A;  2QI2 A;  2RQW A;  1UGR B;  1UHF A;  3GLX A;  4KT0 E;  4JRK A;  1GBR A;  4J6W A;  5CIU A;  3O8V A;  1XJW B;  2BTT A;  1S72 A;  4PFO A;  2OTL T;  1PKT A;  4F7U F;  1I4K 1;  1VQ7 Q;  2IPO B;  3I56 T;  2DL8 A;  2ZPB B;  5GAN 7;  1K9A A;  1GFC A;  2FVU A;  1N9R A;  2D9T A;  5IAY A;  3FB9 A;  5GAN 4;  1ZX6 A;  1KD1 C;  5GAO m;  2XG8 D;  3MHX A;  4EMK C;  3VRZ A;  2RM4 A;  2RHZ A;  1VIE A;  3CCU A;  2E10 A;  4C92 E;  2NLU A;  5KYY A;  3OYC A;  2ZZD A;  3JB9 F;  5J26 A;  1UGV A;  3LH0 A;  3C4S A;  1O9S A;  1YHQ A;  4F7U A;  1YCY A;  3H41 A;  2KGT A;  3ZL7 C;  1VQ4 T;  3TSZ A;  2EGC A;  1KFZ A;  5FRM A;  2P0Q A;  2K3X A;  1UE9 A;  4KRT A;  3TRE A;  5GAN e;  3EAE A;  3CCS T;  2VB6 A;  2DLP A;  4BB7 A;  3JCM W;  1OPK A;  1VQ6 A;  1RAD B;  5DLQ E;  3CC4 Q;  2LQ8 A;  2M51 A;  2OTL A;  2CP7 A;  4HXJ A;  3QBY A;  3PT9 A;  2QQR A;  2JJ9 A;  2ZPE B;  2HCK A;  2AK5 A;  1MMA A;  1KQS S;  1AT1 B;  1YP5 A;  1KJW A;  2EBP A;  1G2B A;  2LNV A;  2DM1 A;  3J81 E;  2DL3 A;  3VS1 A;  3QDR B;  5IHN A;  1S1N A;  2EQK A;  2HKN A;  3V8J A;  1JQQ A;  2GCX A;  1M1K C;  3JAM E;  2MWP A;  2VC8 A;  1PD1 A;  3NTH A;  2A08 A;  2KQW A;  3RBB B;  1C6V X;  1RAI B;  3RUX A;  4C92 F;  3JB9 J;  3CME T;  4BE2 A;  3NGP A;  2QGF B;  2AHJ B;  3CCM T;  2HSE B;  1VQ4 A;  1EFN A;  3NTI A;  5LJ3 g;  2VYT A;  2A3L A;  2ABL A;  4PK4 A;  4ZGD B;  2QDY B;  2DK3 A;  2VXE A;  3RNJ A;  5GAN h;  2AKL A;  2E6N A;  4CC7 A;  1VQP Q;  2LQK A;  2NUT B;  2M02 A;  4AG1 C;  3CCS A;  1CKB A;  2F2V A;  2MOX A;  3JCM J;  2KY9 A;  4E6R A;  1M2O A;  3WXM B;  3M57 A;  4OVA A;  5GAN 2;  4FYV B;  3TSW A;  2EJ9 A;  4C92 A;  3JCM P;  4Q5W A;  1E6H A;  2MIO A;  2I0N A;  2CYZ B;  4RTU A;  4M7D E;  2W10 A;  2JM9 A;  5KYU B;  1PNJ A;  5FU6 B;  2YUQ A;  2CP3 A;  3MKD A;  3G6E T;  2MAM A;  2OTJ T;  3ZBD A;  2MCN A;  3HPW A;  1ZUY A;  1W2B A;  1AZG B;  3GIB A;  1TG0 A;  2D1X A;  2EAY A;  3VUZ A;  1BI1 A;  4V2S A;  4NL2 A;  1JXO A;  1AWW A;  5CK9 A;  4OB2 B;  1WJR A;  1OU9 A;  2FZK B;  1D1C A;  1UGP B;  2FZG B;  1E6G A;  2RI2 A;  3CME A;  4X9D A;  1NEB A;  1SHG A;  1ZHI A;  3CCM A;  3X20 B;  3V8L A;  2DYB A;  3UA7 A;  4PJM A;  4N0A C;  3QKJ A;  4M4Z A;  4N4I A;  4JLG A;  3OB9 A;  3CCE Q;  3VS3 A;  2F69 A;  1VOM A;  5GAM h;  1NJI U;  3A8L B;  3IQL A;  3OSS C;  1Q82 U;  1G8X A;  3O5Z A;  1N6A A;  2EJF A;  1TUD A;  2DKG A;  3EGD B;  2CP2 A;  1W4S A;  4PLL A;  4C0D C;  1H3Z A;  1W2B P;  3ASK A;  1G5V A;  5IHI A;  1VQO T;  3QWY A;  1WX6 A;  2R58 A;  2D6F A;  3GF5 A;  3TCJ A;  1W70 A;  2ROT A;  2F5T X;  3SWN B;  2GGR A;  2B8A A;  3G6E A;  4M7D F;  2OTJ A;  1XOV A;  2Z0W A;  4OMO A;  1YJN Q;  3OS5 A;  2MPX C;  3L2U A;  3CC2 T;  1AWO A;  1K9M R;  2VWF A;  5LJ5 e;  2O4X B;  2RJE A;  3QHS A;  1MGQ A;  4KGX B;  2YXY A;  2QAS A;  4N4H A;  3OYI A;  2XK0 A;  2HNI A;  1YI2 A;  2DXC A;  2LZ6 B;  2LJ3 A;  2PVO B;  5EG2 A;  1VQK T;  1LPL A;  2HBP A;  3PVQ A;  1YJW T;  3S6W A;  1SKU B;  1Q82 R;  1F1B B;  4M7A C;  2QXF A;  2IG0 A;  1K1Z A;  4M7D A;  5M9O A;  3VUB A;  2OX7 A;  3RDV A;  5CQY A;  4FCY A;  2QDL A;  2YSQ A;  3VYG A;  2EWN A;  5KH6 A;  3MP1 A;  1X01 A;  3OS0 A;  4IIM A;  1G83 A;  1JB0 E;  2C0T A;  4IUQ A;  3LGL A;  1NPP A;  2HQX A;  3C12 A;  3A8H B;  1VQ8 Q;  1PRM C;  2YHT A;  3CBM A;  3RKW A;  2VGM A;  2P84 A;  2G3R A;  3N5B B;  4RTW A;  4FW1 A;  2VV5 A;  1R8O B;  4CC2 A;  2X3W D;  1MV0 B;  3U23 A;  2ZCF B;  2DL5 A;  5CQX A;  5GAN f;  5LJ5 h;  5FLX E;  4M7A D;  2EIF A;  2DVE A;  1VQ5 T;  1VYU A;  1W1F A;  1K76 A;  2QQ9 A;  5LJ3 j;  5GMK j;  1ZBX A;  1UHC A;  8AT1 B;  4J9F A;  5IN1 A;  2QQS A;  1VQK A;  5EC7 A;  1AZE A;  1E7O A;  4A53 A;  5KYY B;  1Q86 C;  1YJW A;  4JS5 A;  1WPY A;  2NUP A;  4M77 C;  3VS2 A;  4A4E A;  4E7J A;  4J6Y A;  2DX1 A;  4A54 A;  4F7U B;  1NYF A;  1NEG A;  1RAE B;  3QO3 A;  2DTO A;  4BUG A;  1U3O A;  3BDL A;  1W6X A;  2KRS A;  4AFS C;  5KYW A;  1U8R A;  4C8Q C;  1QVG S;  1UJY A;  2OJ2 A;  1QP3 A;  2V1R A;  1MNE A;  3QJ6 A;  1JBM A;  3I56 Q;  4M78 D;  1B3Q A;  2X35 A;  2RK1 A;  1HXD A;  2KEA A;  2NUT A;  2OAU A;  5GAO r;  4XU1 A;  2PNI A;  2DL4 A;  2KNB B;  2KAF A;  1H92 A;  4RTX A;  1NJI C;  2XDB A;  2RQT A;  2LJ1 A;  3MEU A;  4RKU E;  1PHT A;  2DER A;  3REA B;  3MO8 A;  4M77 D;  5A0G A;  4XTZ A;  4AG2 C;  1Q7Y C;  2E1H A;  4NOY A;  1VQ5 A;  1KIK A;  1ZBJ A;  2L3S A;  1ZQ1 A;  4RTT A;  3JCM h;  4LDW A;  2VKN A;  3CC7 T;  3KBG A;  2DVJ A;  2K9G A;  4C8Q D;  1I1J A;  4EMK A;  2KYB A;  1Y57 A;  1U1T A;  4OB3 B;  3BDU A;  3D7S B;  1UTI A;  1VUB A;  4E2F B;  2JTM A;  2QQA A;  2BKD N;  2KYM A;  2DXU A;  1Q95 G;  4HA8 A;  4JZ3 A;  4JZ4 A;  5GAM d;  4FL6 A;  1SRL A;  2H8H A;  4Z02 A;  3LYI A;  2GQV A;  4IUR A;  2EYY A;  2GTO A;  1M2V B;  4IUU A;  1V29 B;  3JSC A;  2VGN A;  4DEY A;  1QCF A;  1WHL A;  5GAO l;  3GBQ A;  5C6S A;  2KE9 A;  1BI2 A;  4PJO G;  1BI3 A;  4JS4 A;  2K57 A;  4A63 B;  3E9G A;  4FSX A;  5FRN A;  1RI0 A;  4O5V A;  2K79 A;  2F2X A;  3EGX A;  2XMF A;  1MMG A;  2XKO C;  4BAC A;  1X75 C;  5D6Y A;  4BE1 A;  1S72 T;  3DLL A;  4M7A G;  3EFR A;  4ATO A;  3L1A A;  4KH0 B;  3AT1 B;  2O31 A;  1D0Z A;  4UC4 A;  3HP9 A;  3S3M A;  4D8K A;  3QSU A;  3CC7 A;  3H8Z A;  1WHM A;  3CD6 Q;  1AEY A;  1I5L A;  2AT1 B;  3UDC A;  3JRZ A;  1WZO A;  5GAN 6;  4FYW B;  2WAC A;  1YJ9 Q;  3JB9 I;  4C5H A;  1MV3 A;  3CCU T;  2QEX Q;  1KQS A;  2DO3 A;  2L3P A;  3OY9 A;  1IO6 A;  2L3R A;  3JCM V;  2DBK A;  2J06 A;  4XTY A;  1LOJ A;  1NZ9 A;  3MET A;  2LX7 A;  5CKE A;  5GAN 3;  1BKB A;  1AWX A;  3WVD B;  2VXF A;  1QLY A;  1T3L A;  4PFZ A;  1YHQ T;  3KUF A;  4AT1 B;  1EZZ B;  1KC8 R;  5LJ5 f;  4ESR A;  2JXB A;  1UGS B;  2L8D A;  2QTX A;  3OBW A;  5GAO q;  2MI6 A;  5J3B A;  3TVT A;  4DBF A;  2FRY A;  1X2Q A;  4LDY A;  3VU3 C;  5FU7 B;  2O9V A;  4PJO E;  1H3H A;  4J9E A;  2JTE A;  4DBH A;  2IIM A;  1ARK A;  2DIL A;  3RR6 A;  1I0C A;  1QP2 A;  2YRV A;  3M0T A;  2FYK A;  1QVF S;  2EW3 A;  4OF1 A;  4CC4 B;  1LJO A;  4ZN1 A;  3H0H A;  1VQ6 T;  4M77 G;  2FB7 A;  2Y4X A;  2ATC B;  1TU0 B;  5DLO A;  1KQS P;  4GY5 A;  3CPF A;  3THK A;  4LXC A;  3GNF B;  1CSK A;  2AIR B;  1K0S A;  1OX9 A;  2DET A;  2LCS A;  1IZ6 A;  3SDZ A;  1GBQ A;  2J6O A;  1SSF A;  3DB3 A;  1BIA A;  4VUB A;  2COZ A;  4XTW A;  4Y28 E;  3FIF A;  2A0F B;  3A8M B;  1A0N B;  4Z89 A;  3EH1 A;  3PTA A;  2V8J A;  1VQL T;  4J7I A;  4ELY C;  2VAS A;  4QKU A;  2X4J A;  4DEX A;  1VQN T;  1ZUU A;  2RB6 A;  4D8D A;  1AHJ B;  1RAB B;  5D7U A;  5DY9 A;  4B9W A;  1IHW A;  1HK9 A;  4M7D B;  4ORZ A;  2X4W A;  3M0R A;  3CCR Q;  2RJD A;  2BUD A;  5CO7 A;  2KVQ G;  2WSE E;  1TUG B;  2FL7 A;  1KHC A;  3CCL A;  2FPD A;  2ZPI B;  3CCQ Q;  3JCM f;  3I55 T;  4PLI A;  1UGQ B;  3OMC A;  2YUP A;  2OI3 A;  2LT4 A;  3QPH A;  4BY6 B;  2CH4 W;  1OU8 A;  3OW2 A;  4ZGJ B;  4PJO F;  1Z9Q A;  3CC2 Q;  2KXC A;  3INZ A;  3CMA Q;  1SF9 A;  2MMP A;  1YWP A;  4KUL A;  3CBP A;  4LDV A;  5GAN g;  4KUI A;  1JO8 A;  3GPL A;  4XTU A;  4OMQ A;  1JEG A;  1BBZ A;  1B07 A;  2RQU A;  1IGU A;  4BDZ A;  2J7I A;  3PVL A;  1YIJ Q;  5IXF A;  3GP8 A;  5HK3 A;  4XAX B;  3SHW A;  2CH4 A;  3CCV Q;  3FJ5 A;  4F17 A;  3JV3 A;  3QII A;  8ATC B;  3L2Q A;  4J9C A;  4M75 C;  1BB9 A;  4DBR A;  4J9D A;  4PFP A;  3SWN C;  4RTY A;  4AFZ C;  2EGE A;  1WJS A;  1VQ9 Q;  4JDS A;  1VQL A;  4PJO A;  4L59 A;  2QA4 A;  2NUP B;  4Z88 A;  2RN8 A;  2X3X D;  4XK8 E;  1VQN A;  2O2O A;  2EKH A;  1I8F A;  1IRX A;  4HKE A;  3EG1 A;  1OEB A;  3OW2 P;  1QCN A;  5KYW B;  1IGQ A;  1YN8 A;  3GNG A;  2IVW A;  4FSS A;  2COY A;  3I55 A;  3PNW C;  1TSF A;  3CPW A;  4OGC A;  3HHT B;  4LD6 A;  1GRI A;  5LJ3 e;  1RL2 A;  1M2V A;  1NBE B;  3EG2 A;  3HTR A;  1RAF B;  5FRO A;  1FMW A;  4IUV A;  1ABO A;  4BD3 A;  4QQ6 A;  4Y91 A;  3OYN A;  2Y90 A;  4M75 D;  2GTJ A;  2FEI A;  2AZV A;  2LX9 A;  3NTK A;  4M77 F;  1PC0 A;  5GAM g;  2O88 A;  2CT4 A;  3A5Z B;  1MMD A;  2XID A;  2KDS A;  1JJ2 A;  2XIC A;  1MUZ A;  3SEM A;  3L2V A;  1K73 U;  4JJC A;  2K4Y A;  2P4R A;  4A4F A;  1R0C B;  4D6W A;  2CP5 A;  2CRE A;  2NWM A;  4XU3 A;  1BI0 A;  4EMK B;  2HQE A;  3G4S Q;  1X2K A;  3A8O B;  3HFN A;  3CCJ Q;  3BW1 A;  1EIF A;  1VQM Q;  2EYQ A;  2PVD B;  4HCZ A;  3RKX A;  1SPK A;  1WYX A;  1YI2 T;  3CPW P;  2E3I A;  1LNX A;  1YIT A;  2ED1 A;  4M77 A;  3HRS A;  1WFW A;  4CI0 C;  1K9M U;  3OS2 A;  2L89 A;  5I2M A;  3PIO A;  3H0I A;  2PTK A;  4QQD A;  1M9S A;  2E5Q A;  1K0X A;  1HD3 A;  4ZNX A;  1X27 A;  4QVD A;  3OS1 A;  2BIV A;  1WIE A;  2DTH A;  1PRL C;  1QW1 A;  4ZGE B;  1JJ2 P;  4J83 A;  1K73 R;  4LDX A;  2E65 A;  1M8V A;  4P5N A;  1IRE B;  3QDF A;  2CP0 A;  1D1A A;  3MPU B;  1ZA1 B;  4FYX B;  1QVG A;  1BK2 A;  2M16 A;  1ZSZ C;  1C1A A;  3EGX B;  2EQI A;  4Y92 A;  1U06 A;  5CAI A;  3NMZ C;  1Y07 A; 
#chains in the Genus database with same CATH homology
 4X34 A;  2RO0 A;  3PGG A;  4M78 D;  3HSB A;  3SD4 A;  4M7D G;  2GFA A;  2RK1 A;  2X35 A;  1HXD A;  2PUK B;  1FWZ A;  2RJC A;  2WSC E;  1KG1 A;  2OAU A;  5GAO r;  4BE0 A;  4XU1 A;  3G7Z A;  2ZPF B;  2P0K A;  1I81 A;  4C0F A;  2E70 A;  1YIT T;  4M7A A;  4NL3 A;  2F5K A;  4WF2 A;  4C5E A;  3JCM X;  2KSS A;  2DJZ A;  2PU9 B;  4RMO A;  2KAF A;  2EQJ A;  2JZ2 A;  5DM7 R;  1NJI C;  2XDB A;  3FC3 A;  2R57 A;  3OYB A;  1KHI A;  4J6X A;  4E7K A;  4M78 F;  3MEU A;  2KMT A;  5A2Q E;  3FDR A;  2LRQ A;  2DIG A;  4NS5 A;  3HL8 A;  4RKU E;  3S3N A;  3ME9 A;  5GMK e;  3MO8 A;  2ZGW A;  4M77 D;  2DPP B;  5LJ5 g;  2RK2 A;  5CKF A;  4XTZ A;  5A0G A;  4LDU A;  3V7S A;  2QI2 A;  1Q7Y C;  2E1H A;  2LCC A;  4NOY A;  3R6O A;  1UGR B;  1VQ5 A;  4RCC A;  3GLX A;  4KT0 E;  4JRK A;  3CD6 T;  1ZQ1 A;  4J6W A;  3JCM h;  5CIU A;  4LDW A;  2FHD A;  3PMT A;  3CC7 T;  3QXE B;  3O8V A;  1N27 A;  3CC4 T;  3KBG A;  3LLR A;  3M55 A;  4MML A;  1YJ9 T;  4C8Q D;  5KCO A;  4EMK A;  5GAN j;  1S72 A;  1VQ7 A;  2OTL T;  1U1T A;  4F7U F;  4OB3 B;  2VUB A;  2QEX T;  1M5Q 1;  3BDU A;  1I4K 1;  4CRI A;  3HRU A;  1K8A U;  1FXX A;  3QZ9 B;  3T9N A;  1VUB A;  3I56 T;  1WQ7 A;  2ZPB B;  5A0D A;  2JTM A;  3L2R A;  1FX7 A;  1TH7 A;  5GAN 7;  2QQA A;  2M0O A;  2BKD N;  2EJG A;  2DXU A;  2FVU A;  1N9R A;  2D9T A;  2WSF E;  4HA8 A;  5GAM e;  3X24 B;  2YLB A;  1PSE A;  3JB9 D;  1OZ2 A;  1VIF A;  5IAY A;  3OYA A;  4M78 A;  3FB9 A;  3HRT A;  4OB0 B;  4EMH A;  5GAM d;  5GAN 4;  4FL6 A;  4M75 G;  4C8Q F;  3MEA A;  4Z02 A;  1KD1 C;  3LYI A;  3P8B B;  5GAO m;  3MP8 A;  1UEB A;  2GQV A;  1G3W A;  2XG8 D;  3MHX A;  3QYH B;  4O6J A;  4XU2 A;  4EMK C;  3LWI A;  4E7L A;  4C5G A;  2CZ6 B;  5CCA A;  2RM4 A;  2RHZ A;  1VIE A;  4IUR A;  3CCU A;  4IKF A;  2GFU A;  3OYM A;  1WGS A;  2E10 A;  3DLM A;  3L2W A;  2RI5 A;  2NLU A;  4IUU A;  4C92 E;  1V29 B;  4B9X A;  2CS7 A;  3JCM b;  3OYC A;  3JSC A;  2VGN A;  3SFM A;  2ZZD A;  2D0Q B;  1Q81 U;  3JB9 F;  5GAN 8;  5KE3 A;  5D6W A;  1Q86 U;  1G3S A;  5J26 A;  5GAO l;  4XU0 A;  1JRI A;  3LH0 A;  3C4S A;  4M78 C;  1O9S A;  4QVZ A;  5C6S A;  1YHQ A;  2ZPG B;  4MMK A;  4F7U A;  3V8K A;  1BI2 A;  1Y96 A;  2X4Y A;  4E7H A;  1Y7X A;  1BI3 A;  1YCY A;  4PJO G;  2MWO A;  4BI4 A;  4C92 C;  3DB4 A;  2K57 A;  4JS4 A;  2JTF A;  1W2B S;  3RER A;  3E9G A;  1VQ4 T;  4FSX A;  5FRN A;  1RI0 A;  5LJ3 h;  4O5V A;  5GMK h;  2M1H A;  2E64 A;  4E7I A;  2P0P A;  2EFI A;  4MDX A;  2XKO C;  4BAC A;  2EKO A;  1X75 C;  3KXT A;  1VQP T;  5D6Y A;  4BE1 A;  5FRM A;  4C8Q A;  1S72 T;  1WJQ A;  2P0Q A;  3FLG A;  3DLL A;  1VQ7 T;  2K3X A;  4M7A G;  3E19 A;  4PKC C;  3TRE A;  1M90 U;  3EFR A;  4ATO A;  5GAN e;  2RJF A;  3L1A A;  3EAE A;  3CMA A;  3CD6 A;  3CCS T;  4UC4 A;  3S3M A;  3HP9 A;  4OGE A;  4BB7 A;  3P8H A;  3JCM g;  5GAN d;  3CC7 A;  3QSU A;  3H8Z A;  3F70 A;  3JCM W;  4C0G A;  3CC4 A;  1MHN A;  4XTX A;  3BFM A;  3OW2 S;  1YJ9 A;  1I5L A;  5L8R E;  2EQU A;  1VQ6 A;  3UDC A;  3JRZ A;  5GMK m;  5DLQ E;  5GAN 6;  2LQ8 A;  2WAC A;  2DIQ A;  2OTL A;  5CR2 A;  3JB9 I;  2QEX A;  2XDD A;  1Y71 A;  5GAM j;  3QBY A;  4RG8 A;  4OP0 A;  3PT9 A;  2QQR A;  5D6X A;  4C5H A;  4JUV A;  3CCU T;  3RKY A;  1KQS A;  2QQB A;  2ZPE B;  3M5A A;  2DO3 A;  5AYF A;  3OY9 A;  2L3R A;  4FM4 B;  3JCM V;  2CZ7 B;  4XTY A;  1KQS S;  3OYG A;  1K9M C;  2Y4Y A;  5GMK l;  1LOJ A;  1NZ9 A;  3FEO A;  2K5I A;  3MET A;  5CKE A;  5GAN 3;  3FJP A;  1BKB A;  1P92 A;  2RHY A;  3NFC A;  2LNV A;  3WVD B;  1Q7Y U;  2VXF A;  1WNL A;  4C92 D;  1YHQ T;  1UB4 A;  3KUF A;  1U1S A;  3CCR T;  4BI8 B;  5LJ5 f;  1UGS B;  2L8D A;  3J81 E;  3RES A;  2QTX A;  2V8I A;  3OBW A;  3JCM Q;  3CCQ T;  3QDR B;  5GAO q;  4QVC A;  2MI6 A;  4M75 B;  5IT9 E;  3OBY A;  5J3B A;  2EQK A;  3PIP A;  3V8J A;  1M1K C;  2GCX A;  3JAM E;  4RCB A;  5FU7 C;  2MWP A;  4FT4 A;  4FU6 A;  1Q82 C;  3QYG B;  2VC8 A;  5LJ3 f;  4LDY A;  3VU3 C;  3NTH A;  5FU7 B;  3P8D A;  2KQW A;  4PJO E;  5GAO p;  4N4G A;  3RUX A;  4C92 F;  3JB9 J;  5GAO n;  3CME T;  2DXB A;  4FIB A;  4BE2 A;  1QP2 A;  2YRV A;  2E6Z A;  2FYK A;  2AHJ B;  3CCM T;  1QVF S;  1BIB A;  5HKC A;  1H64 1;  3CMA T;  1VQ4 A;  2X4X A;  4OF1 A;  4ZN3 A;  3NTI A;  1LJO A;  2VYT A;  4ZN1 A;  5LJ3 g;  2A3L A;  1KD1 U;  4ZGD B;  2DXT A;  1G3Y A;  2DK3 A;  2QDY B;  2VXE A;  1VQP A;  3CCE T;  4PJO C;  4IUT A;  1VQ6 T;  3HKS A;  5GAN h;  4M77 G;  2E6N A;  4PJO B;  2FB7 A;  1OI1 A;  2LDM A;  2Y4X A;  4F7U G;  2LQK A;  3CPW S;  1YIJ T;  2E12 A;  5DLO A;  3CCS A;  4GY5 A;  3CPF A;  2DZ9 A;  3JCM J;  3GNF B;  2KY9 A;  2K2V A;  3WXM B;  3CCV T;  1IZ6 A;  3M57 A;  3SDZ A;  3QUI A;  4OVA A;  1QVP A;  1SSF A;  5GAN 2;  1B34 B;  3H6Z A;  3DB3 A;  1BIA A;  4VUB A;  2EJ9 A;  4C92 A;  2ZPH B;  4Q5W A;  3JCM P;  3RMQ A;  4M7D E;  2CYZ B;  4XTW A;  1VQ9 T;  1N8R U;  4Y28 E;  3FIF A;  2P4T A;  2RI3 A;  3A8M B;  5FU6 B;  2YLC A;  2O01 E;  4DA4 A;  3PTA A;  2V8J A;  1VQL T;  4J7I A;  4ME7 A;  3J80 E;  3QJY A;  1JJ2 S;  3JB9 H;  2CZ0 B;  4ELY C;  3MCA B;  3G6E T;  4JRI A;  2MAM A;  2OTJ T;  3ZBD A;  3C94 A;  3EFS A;  1PSF A;  2X4J A;  1VQN T;  3ER0 A;  4MZM A;  2LTO A;  1GXI E;  2RB6 A;  3HPW A;  3MEV A;  1AHJ B;  4M7D C;  1W2B A;  3CCR A;  3GIB A;  5DY9 A;  1YBY A;  3M58 A;  4YTL A;  5J39 A;  4B9W A;  3GOX A;  1HK9 A;  1VQO A;  2EAY A;  4KBM B;  3VUZ A;  1KC8 U;  4HCC A;  4M7D B;  2X4W A;  3CCQ A;  1BI1 A;  2RHX A;  2RJD A;  2BUD A;  4V2S A;  4PJO D;  2RD1 A;  2KVQ G;  2WSE E;  4NL2 A;  5CO7 A;  2FL7 A;  1KHC A;  4DOV A;  5CK9 A;  4OB2 B;  3CCL A;  2ZPI B;  4IUP A;  1WJR A;  3JCM f;  2RHU A;  3I55 T;  4PLI A;  3OYF A;  2CKK A;  4GLK A;  1K73 C;  3BY7 A;  1UGQ B;  1UGP B;  3OMC A;  3OYH A;  3CEY A;  1N9S A;  4BY6 C;  5LJ5 j;  2RI2 A;  3CME A;  2LT4 A;  3QPH A;  4X9D A;  3CC2 A;  5GAN 5;  4II1 A;  4BY6 B;  1ZHI A;  3CCM A;  3X20 B;  4HT8 A;  3OW2 A;  4ZGJ B;  4PJO F;  3V8L A;  2DTI A;  4DOW A;  3INZ A;  4ZTJ A;  2JOY A;  4N0A C;  3QKJ A;  3CCE A;  1M4Z A;  3LGF A;  2MMP A;  4N4I A;  3UPU A;  4JLG A;  3OB9 A;  4KUL A;  3CBP A;  4LDV A;  4C0Z A;  3JCM e;  2XDP A;  5GAN g;  4KUI A;  2F69 A;  4BI3 A;  3GPL A;  4XTU A;  5GAM h;  1NJI U;  1YIJ A;  1XTD A;  4M75 E;  2LVM A;  1KQ2 A;  3A8L B;  3OSS C;  1XQH A;  4BDZ A;  1Q82 U;  3GP8 A;  1N6A A;  4QQG A;  5HK3 A;  4XAX B;  2EJF A;  4MZP A;  4M77 B;  4X9C A;  3CCV A;  3LWH A;  1M1F A;  3V7R A;  4M7D D;  2E41 A;  3OYK A;  3QZ5 B;  2DKG A;  2EQM A;  2R5M A;  2XU8 A;  4L6V 5;  4RG2 A;  3M4G A;  1WQW A;  1W4S A;  1DJ7 B;  3QII A;  4PLL A;  2A7Y A;  4QW2 A;  4C0D C;  1H3Z A;  3ASK A;  3TEE A;  5I21 A;  3L2Q A;  1G5V A;  2RA2 A;  3G4S T;  1VQ9 A;  3PFS A;  3M9Q A;  1M1G A;  4M75 C;  4C0D B;  3CCJ T;  1VQO T;  4KUD K;  1VQM T;  4JRQ A;  4HT9 A;  5C0M A;  2R58 A;  2MF2 A;  5LL6 S;  3SWN C;  2D6F A;  3FRN A;  3GF5 A;  3TCJ A;  2C06 A;  1WJS A;  3A8G B;  1YJN A;  4JDS A;  1M90 C;  3DKM A;  1VQL A;  4PJO A;  4M78 G;  2F5T X;  3SWN B;  3CCL T;  3SB2 A;  2B8A A;  3VV0 A;  4L59 A;  4FT2 A;  4PNO A;  4ELZ C;  3G6E A;  3VJP A;  4M7D F;  1XOV A;  4XTV A;  2QA4 A;  2OTJ A;  4XK8 E;  3OS5 A;  3M59 A;  1VQN A;  3MP6 A;  2K3Y A;  4C92 G;  1QVF A;  3L2U A;  2PUO B;  1NPR A;  2DD5 A;  1D3B B;  3RMS A;  1I8F A;  2LCL A;  3CC2 T;  3M54 A;  4HKE A;  4MDW A;  5LJ5 e;  2I2L A;  1B34 A;  3GNG A;  1XNI A;  2DZC A;  2O4X B;  2RJE A;  2IVW A;  3QHS A;  4EDU A;  1MGQ A;  4M7A E;  3I55 A;  2XHC A;  3PNW C;  5LJ5 d;  4BDY A;  3UT1 A;  3M4Y A;  4N4H A;  5GMK i;  3ZEH A;  3OYI A;  2XK0 A;  2HNI A;  1YI2 A;  3CPW A;  2DXC A;  3M56 A;  4OGC A;  3WVE B;  2PVO B;  3HHT B;  4LD6 A;  5EG2 A;  5LJ3 e;  2V8K A;  1RL2 A;  3CXC A;  1VQK T;  4J7F A;  2HBP A;  1YJW T;  3S6W A;  5FRO A;  5LJ3 d;  3J7A F;  3OSV A;  4R56 A;  3Q1J A;  4IUV A;  3CXC S;  5GAM f;  3AHU A;  4BD3 A;  4M7A C;  4QQ6 A;  2QXF A;  4Y91 A;  2IG0 A;  3OYN A;  4JRP A;  3E1S A;  3X26 B;  4M7A B;  3OQ5 A;  2M9U A;  4C8Q G;  3CBO A;  4M7D A;  5I2S A;  2CGH A;  2Y90 A;  4M75 D;  2JVV A;  5M9O A;  2LC4 A;  3PMI A;  3URG A;  3VUB A;  2LX9 A;  3NTK A;  4M77 F;  5CKB A;  3UWN A;  3X25 B;  5CQY A;  5GAM g;  3LW5 E;  2XI9 A;  3A5Z B;  5FU6 C;  4EPC A;  2JNG A;  2XID A;  2KDS A;  3M53 A;  4XQ3 A;  1JJ2 A;  2XIC A;  2LT1 A;  1YJN T;  4J5Y A;  3OYD A;  3L2V A;  3VYG A;  2EWN A;  5KH6 A;  3JB9 G;  3MP1 A;  1K73 U;  2RHI A;  1KQ1 A;  1X01 A;  4LD9 K;  2K4Y A;  3OS0 A;  5KE2 A;  2QA4 T;  4ZTF A;  3X28 B;  4A4F A;  1JB0 E;  2PVG B;  4M75 F;  3OYJ A;  4D6W A;  2H3J A;  4R55 A;  1VQ8 A;  4IUQ A;  3LGL A;  3G4S A;  2KK4 A;  1NPP A;  2HQX A;  4M78 E;  5CKD A;  5HK0 A;  3CCJ A;  3L2Z A;  3C12 A;  3A8H B;  2DAQ A;  1VQM A;  4XU3 A;  4DQ2 A;  1BI0 A;  4EMK B;  2HQE A;  2YHT A;  3CBM A;  4N0A A;  3RKW A;  3OYY A;  3A8O B;  3HFN A;  4OB1 B;  3OA6 A;  2VGM A;  5KCH A;  3BW1 A;  1EIF A;  4MZT A;  3G71 A;  2EYQ A;  2G3R A;  2PQW A;  2PVD B;  3N5B B;  1K8A C;  4HCB A;  3JCM c;  4HCZ A;  1O75 A;  2VV5 A;  2R5A A;  3RKX A;  1R8O B;  3S3O A;  1G3T A;  2DEQ A;  2HD0 A;  3RIR A;  4A4K A;  2ZCF B;  1YI2 T;  2L5Q A;  3OYE A;  3VKI A;  5CQX A;  5GAN f;  1LNX A;  5LJ5 h;  1YIT A;  2K5F A;  4M77 A;  5FLX E;  2XD0 A;  4M7A D;  4M78 B;  2DD4 A;  2EIF A;  3HRS A;  2DVE A;  4CI0 C;  2GF7 A;  1VQ5 T;  1K9M U;  3OS2 A;  2L89 A;  1X6O A;  5I2M A;  3PIO A;  2QQ9 A;  2CZ1 B;  4M77 E;  5CKH A;  5LJ3 j;  5GMK j;  4QQD A;  4F7U E;  1ZBX A;  1M9S A;  5HY6 A;  1N8R C;  4C92 B;  4PL6 A;  2E5Q A;  3TU4 K;  4A4H A;  3OMG A;  1NE8 A;  5CVI A;  2QQS A;  5IN1 A;  4A4G A;  4QVD A;  1VQK A;  4M75 A;  1Q81 C;  3OS1 A;  4A53 A;  4EMG A;  1Q86 C;  1YJW A;  4JS5 A;  1WPY A;  3JCM d;  3SWN A;  4M7A F;  2BIV A;  2DTH A;  3C95 A;  2JN0 A;  1QW1 A;  4E47 A;  3QG1 A;  4C8Q E;  1M1K U;  4M77 C;  3E9F A;  3L42 A;  4A4E A;  4ZGE B;  4J8O A;  4E7J A;  4J83 A;  2RH2 A;  5A0L A;  2K5L A;  4L5G A;  1KC8 C;  4J6Y A;  2E65 A;  4LDX A;  4A54 A;  1M8V A;  4P5N A;  4F7U B;  1D3B A;  1IRE B;  4TVR A;  3OYL A;  1Y96 B;  4OMF B;  3VYH B;  4JJN K;  3QO3 A;  2DTO A;  3HFO A;  4BUG A;  3BDL A;  2JUF A;  3MEW A;  1QVG A;  1U8R A;  1VQ8 T;  2O4X A;  2HAX A;  1BYM A;  2M16 A;  3V7C A;  4C8Q C;  1OYX A;  1QVG S;  3LX7 A;  1QP3 A;  3ZFJ A;  3I56 A;  4C5I A;  4C8Q B;  4JLI A;  5CAI A;  1OZ3 A;  3QJ6 A;  3G71 T;  1Y07 A;  1JBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...