1YCYA

Conserved hypothetical protein pfu-1806301-001 from pyrococcus furiosus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
62
Chain Sequence
SLLEKVLKEWKGHKVAVSVGFTGTLEDFDEEVILLKDVVDVIGNRGKQMLIGLEDINWIMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved hypothetical protein Pfu-1806301-001 from Pyrococcus furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
molecule keywords Conserved hypothetical protein
total genus 12
structure length 62
sequence length 66
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ycyA00
5GANe 2RM4A 4HA8A 3PGGA 4M77B 5LJ5j 2HNIA 3JB9H 3VU3C 2YHTA 3SB2A 4M75G 5GAOr 4M7DB 2RD1A 4RCBA 3RIRA 4HT8A 4RCCA 4XU3A 4JLIA 4NL3A 3JCMc 3RKWA 2VXEA 4M75C 3QSUA 2I2LA 2E41A 1HK9A 3AHUA 1HXDA 2QTXA 3QUIA 3JB9J 3BDUA 1WPYA 4M77D 4M77A 3FJPA 4NOYA 4XU2A 4C8QE 5GANf 4M7DG 3L1AA 4PJOC 5GAN7 1KQ2A 2DXTA 2DXUA 2VC8A 4V2SA 4M75B 5GMKe 3V7RA 4M7DC 4XTZA 5GAMd 5GANj 3FB9A 2K57A 5LJ5g 2YLBA 3JB9I 5GAOm 4M7AA 4XTVA 3JCMh 3EFRA 1U1SA 1U1TA 4JRKA 4WF2A 4F7UE 1LOJA 5GAN8 2JN0A 3BW1A 4J5YA 4A54A 4C92G 2Y90A 2VXFA 1B34A 2DEQA 4M75D 5LJ5d 2EJGA 2CGHA 3QO3A 2DKGA 1YCYA 2EJ9A 1WQWA 5LJ3f 4JRIA 1JBMA 3JCMe 4J6YA 4N0AA 3SWNA 5GAN4 4M78B 3JB9D 3BFMA 4Y91A 4C92B 5LJ5h 4C8QF 5LJ3d 5GANg 5GMKm 3HFNA 4J6XA 3V8LA 4M7DA 4M78F 4DQ2A 5I21A 3RESA 3V7SA 4C8QC 3JCMb 2DJZA 2DZ9A 2FB7A 4M77G 5LJ5e 4M7DD 3SWNB 5GAN5 1I8FA 1D3BB 4M78D 1BIBA 5GANd 2YLCA 4EMKB 5GMKi 2E10A 4XQ3A 4C92E 4M77C 4M78E 1M8VA 3RKYA 5GAMf 5LJ3j 5GAMg 5GANh 1X01A 4M75A 3SWNC 5GAOn 2DTIA 3JCMP 4M75F 3JCMJ 4PJOE 2RA2A 1N9RA 3JCMV 3BY7A 5GAOp 3JCMQ 3JCMW 5GMKj 1B34B 5DY9A 1WNLA 3M4GA 1BIAA 4PJOA 4MMLA 4N0AC 4EMHA 4M7DF 3L2ZA 4F7UF 3JB9G 1LNXA 5GMKl 4M75E 1KQ1A 2EJFA 5LJ3g 5GAMj 4J6WA 4A53A 4QVDA 1TH7A 2ZGWA 4C92A 3JCMX 4M7AC 2RB6A 3INZA 2DTHA 4C8QD 4PJOD 3FIFA 4F7UG 3JB9F 2FYKA 4M7AF 2E1HA 4C8QG 4M7AG 4PJOG 4PJOF 1I5LA 2DVEA 4XTXA 2EWNA 4M7AB 4OP0A 1Y96A 2EAYA 5GAN6 5LJ5f 4PNOA 1WQ7A 4NL2A 5GAN3 4F7UB 5GAOq 3GIBA 1JRIA 4QVCA 4JUVA 4EMKA 5LJ3h 3RUXA 5GAN2 4X9DA 1LJOA 5GAMe 5CAIA 4C92F 2DTOA 2E65A 3HFOA 4XU1A 4HT9A 4EMKC 4XTUA 1Y96B 4C92C 4M78A 5LJ3e 5GAOl 4XTYA 4XU0A 4F7UA 2DZCA 5GMKh 4C8QB 3V8KA 3RKXA 4M77F 4PJOB 3JCMd 4X9CA 4M7AE 1M5Q1 4M78G 3HSBA 4M7AD 1H641 1I81A 1N9SA 4M78C 5GAMh 1D3BA 4MMKA 3JCMf 3QHSA 4M7DE 3RERA 4C8QA 3V8JA 4M77E 1I4K1 3EFSA 4C92D 3JCMg 4XTWA 1MGQA 2E64A 3V7CA 4EMGA
chains in the Genus database with same CATH superfamily
2IIMA 3H41A 2J6KA 4MDXA 4WCIA 2DNUA 2P4TA 2WSCE 4ORZA 3OW2A 2X4YA 1SRMA 3CCSA 1GXIE 3HPWA 4XAXB 3CCVQ 2DERA 3NTHA 4V2SA 4KT0E 3LYIA 2RQUA 3UA6A 2JS0A 1JB0E 1X6GA 4AFSC 1U1TA 2C0IA 2FZCB 4C92G 4BE2A 1C1AA 1WZOA 1TU0B 1Y0MA 1QMCA 1YCYA 3TU4K 3SD4A 3M4YA 4J6YA 3REAB 2QXFA 3M56A 4DBQA 1IB8A 3M55A 3GBQA 4OMLA 3CC4Q 1D0ZA 3EFOA 3NPFA 4M77G 2KAFA 2V1RA 3NTKA 2KK4A 2L3SA 1KHCA 2RHIA 3ZFJA 3CCMA 4JJCA 3ASKA 3QXEB 4J8OA 4J9HA 4J6WA 3CCUA 1YITQ 3HL8A 1Q7YR 3OYCA 5HY6A 4M7AG 1T3LA 2KXDA 5GAN6 1WQ7A 5A2QE 4AFQC 2MOXA 2O31A 2XD0A 4A4FA 3O8VA 1Q86C 3CCSQ 2CREA 2YSQA 4XTUA 1VQ8Q 4OB0B 4ZGEB 2QK0A 3VS1A 1OU9A 1I81A 4RG8A 1D3BA 1BI1A 2K6DA 4ZGDB 3CCJA 1QVPA 1K0SA 3OQ5A 3M9QA 5GANe 1VQ6A 5LJ5j 5DLQE 2W10A 5KCHA 5KYYB 2JMCA 3L2QA 1YIJT 1VQ9A 4J9GA 3RIRA 4NL3A 1ZX6A 3MJXA 2JNGA 1YITT 1QWEA 4M7DG 4GLKA 1WGSA 4C8QE 4Z89A 1QVFP 2K57A 3CCJT 2XI9A 4QVZA 2CZ1B 3A5ZB 3BW1A 1QVGS 1QVFA 4J83A 3OS2A 3JCMe 1JXMA 4F17A 2KY9A 4AG2C 3BFMA 1WJRA 2HQEA 1BK2A 3H0IA 4M78F 4OB2B 2A3LA 1EIFA 4RTTA 1LPLA 2X35A 3MKDA 1JEGA 1FX7A 2ED1A 4KBMB 1WDXA 1UGPB 3G6EA 4JZ4A 4FW1A 3CCUT 1M3AA 3MEUA 3T9NA 1RUWA 2DLPA 4RUGA 1VQ8A 1M3BA 2NYSA 2ESWA 1RAHB 4PJOA 3OW2P 4N0AC 2YUOA 3KXTA 3M0TA 3PMTA 4A53A 1TH7A 5CIUA 1QKXA 2MIOA 4M7AF 2LT1A 4PFOA 1FMVA 1G8XA 2BTTA 4F7UB 1M1KR 4QVCA 2JW4A 3TSWA 1YHQT 3G6ET 1DJ7B 1LJOA 4C0ZA 3HFOA 3GP8A 3CC7T 2DXBA 3J7AF 1GCPA 2DIQA 4B6MA 5GAOl 4ATOA 3G71T 1ZQ1A 3VS2A 1IREB 2B86A 3M0UA 4J9BA 3M0RA 1AWJA 2EVRA 1Q95G 4M78C 1PD0A 1FWZA 1WHGA 2QQSA 3C0CA 3EGUA 3DB3A 2GNCA 2K3YA 2RD1A 4HVVA 2ECZA 3HRSA 1BI0A 3E1SA 2YRDA 4IKFA 1YITA 4AT1B 2KQWA 4CC3A 2E3HA 1BI2A 2DX1A 2NUZA 3I56T 2FRYA 3EFRA 5KYUA 3MO8A 1JU5C 5C0MA 1O75A 5LJ5d 1N27A 1FXXA 3G4SQ 2EKHA 3KUFA 1B3QA 3M57A 4C8QC 2OTJQ 4CI0C 5KYWB 2HKQB 3CD6T 5LJ5e 2FPEA 1MMNA 1UJ0A 1NJIC 2OTJT 4OMFB 2CP0A 2HCKA 3JCMP 2X4WA 2Y4YA 1I5OB 3C94A 3S3OA 2FPFA 3A8LB 3M0PA 1G2BA 4F7UF 3VUZA 1T3SA 4FYXB 2X3XD 2J6OA 3VRZA 4HKEA 4LDVA 1KD1R 3P8BB 1K73C 1E6HA 2L8DA 3CXCS 2BE7D 3VS4A 4J9CA 3QYHB 5DM7R 2ZPBB 4PJOG 4BY6C 2KVQG 4M4ZA 4IUTA 4BACA 1C6VX 3M58A 5GAOq 1JRIA 4DBHA 1LVKA 3HKSA 1D1BA 2YRCA 2GFAA 5IXBA 4QKUA 3QJYA 2DRMA 2ZPEB 2K2MA 1KD1U 2RPNA 1Y57A 1FMWA 3OYHA 5FU7C 3H0HA 2RN8A 2RF0A 3PVLA 1VQ5T 3NTIA 1SSFA 2YWWA 1PRMC 1MGQA 4QW2A 4OMQA 1YJWA 3QZ9B 4HA8A 3PGGA 2HEQA 3BE3A 3VU3C 3I56A 1IGQA 3RKWA 3QSUA 3AHUA 1K76A 3G4ST 1QQJA 2RI5A 3JB9J 2M51A 5A0LA 4Y92A 1YBYA 3FJPA 4NOYA 4XU2A 2XK0A 2D8JA 1H92A 4A4GA 4GBQA 3MEWA 2YXYA 2Z0WA 2F2WA 1VYVA 1RABB 2O88A 3OYMA 5GAOm 3G1JA 1UG1A 3I9QA 4D8KA 4J9DA 2WSEE 4M75D 1M3CA 3M59A 1VQ7A 3OYJA 2OX7A 4JRQA 2C0OA 2EYXA 2KROA 4IUVA 4FT4A 4D6WA 2YDLA 3OSSC 4PLLA 1VQKQ 1D3BB 4BE1A 2O9VA 1VQLA 1I1JA 4VUBA 2FRWA 1AVZC 1X2QA 3DLLA 4P5NA 3L2VA 4E7LA 1RAIB 2R5MA 3CCRT 4HCCA 3QWYA 4M75F 4BE0A 1P92A 4IUQA 3JCMV 4LDXA 2VASA 3F70A 3RDVA 1WHJA 4OMNA 1UJYA 4C8QD 2VYTA 5GJWB 1YIJA 1W2BS 1UGVA 3BDLA 4EMKA 4L6V5 3FDRA 2LVMA 2D8HA 1EX4A 2CP2A 1YFNA 1VQKT 4F7UA 1AEYA 2EYWA 2BZXA 1M5Q1 2CT4A 3UA7A 4LDWA 2K3BA 2NUPA 1R0BG 2CS7A 1W4SA 1UGRB 1BYMA 5AYFA 4E7JA 2CZ6B 2KR3A 3HHTB 8AT1B 4ELYC 3OYKA 1UB4A 4AG1C 1S72A 5FWCA 3I5SA 4IIMA 4KULA 4M7DB 3CCMT 3JCMc 1D1CA 4M75C 1HJDA 3X25B 2BZ8A 1K8AU 1D1AA 2DXUA 1MNEA 4EDUA 1M1GA 1TWBA 1ZBXA 4E7IA 2DJQA 2GCXA 4F14A 5HKCA 1IGUA 4MDWA 2JN0A 1WHKA 2VXFA 4UC4A 2X4JA 2EJGA 2XDPA 3VYGA 1SPKA 2RK2A 5GAN4 2K9GA 1R8OB 1WIEA 3CQTA 3EH1A 4EIKA 4DEXA 3JCMb 3E2UA 1I0CA 4FIBA 4IUUA 2RI3A 1WFWA 4EMKB 4BY6B 4HCKA 5IT9E 1XQHA 3LX7A 1X69A 1KD1C 3NHNA 3SDZA 2F2XA 1D0YA 4RKUE 4L59A 5GAMj 4KGXB 3LGFA 2XICA 3JCMX 1U5SA 1AOJA 1HSQA 4J9FA 1ZSGA 3HTRA 3ZBDA 2EYQA 1N8RR 2FYKA 2L0AA 4MZMA 2QAZA 2EIFA 4M7AB 1AD5A 2CSQA 2ZZDA 4JS5A 4X9DA 1M8MA 3PFSA 2CUBA 2E5QA 1J3TA 4FYVB 2M0YA 4M77F 2X4XA 1NZ9A 3QHSA 1X43A 4M77E 5IAYA 3M5AA 4EMHA 1VYTA 2MMPA 2LC4A 4ANJA 2GBQA 4IURA 4PKCC 3CCLT 5CK9A 4C0DB 2KDSA 1Z9QA 4O6JA 2QTXA 5EC7A 1H8KA 2CP3A 4LNPA 2VC8A 3PIOA 2A36A 5GMKe 1MNDA 5FU6C 3JB9I 5CCAA 5I2MA 1YHQQ 2P0QA 2HQHA 4RG2A 4J5YA 1PG5B 2Y90A 3OS0A 4QQGA 3L2UA 3GPLA 1OZ2A 1WQWA 3H6ZA 1RI9A 1PKTA 1VQOA 4A4EA 2KMTA 4QQDA 3WVEB 1PC0A 3WVDB 3RESA 2O2OA 4CC4B 2QEXT 3MCAB 1B07A 3SWNB 4M78D 4Z02A 1MV3A 2KT8A 4OMOA 5GAMf 1Q81R 1K8AC 4LD6A 1VQPA 2E6NA 1A0NB 4QQ6A 2EQKA 3JCMW 5IN1A 1VQMT 1JXOA 1Q7YU 5DY9A 3M4GA 1VQ9Q 4J7FA 2EJFA 3CBMA 3VV0A 4AFZC 2ZGWA 4JZ3A 4C5GA 1VQ9T 5HCKA 1W70A 1QLYA 2KYMA 3EG9A 4XK8E 5D7UA 3VS0A 3OMGA 5GAN3 4IIOA 3LH5A 3MPUB 2JTFA 2LX9A 2DTOA 2K79A 3HP9A 4JDSA 2PVGB 1BCMA 4XU0A 3M54A 5KE3A 4YTLA 3C12A 3QWXX 4AFUC 3THKA 3OYYA 1YJ9A 2QA4T 3OB9A 2O9SA 1CKAA 2RH2A 3CC2Q 3NMZC 2YHTA 5GAOr 3EGXB 1AWWA 1I07A 2HL5C 2J05A 1KG1A 1HXDA 2FZKB 5GANf 5GAN7 1KQ2A 1UGSB 2LQWA 3NGPA 1YJ9T 4LD9K 1OV3A 1NBEB 4ZNXA 2RQRA 3UWNA 2DM1A 4JS4A 4Y91A 2FEIA 2A0FB 4OMPA 4DA4A 6AT1B 2K5IA 2DRKA 2BZYA 4M7DD 1I8FA 1RAFB 5GANd 5GMKi 4XQ3A 2DFUA 3LGLA 5GANh 1ARKA 2DYBA 2KRNA 4DEYA 5I2SA 3LWHA 2ZPHB 2JMAA 2M1HA 2P0PA 2WACA 2DEUA 3A1PA 2P84A 4HVUA 2CP6A 2XDDA 2B8AA 3EGDB 1YJNQ 1NM7A 3I55Q 3TSZA 3OW2S 2RHYA 2NUTB 1JJ2A 2EQMA 4PNOA 4J9EA 3RBBB 1RACB 4JRPA 3GNFB 4FT2A 2JTMA 3R6OA 4E47A 5CVIA 2JXBA 3CMAQ 5DLOA 1NJIR 5M9OA 1YCSB 1MMAA 3EFOB 3CC2A 3HRUA 1WX6A 2V1QA 4C5HA 3UPUA 3JCMg 2E64A 1VIEA 4EMGA 2JTEA 1ZUKA 3X24B 3CD6Q 1WLPB 1KSWA 2BIVA 4CC7A 3OBYA 3I55T 1OOTA 3OS5A 5IHNA 3QUIA 4FSSA 1WPYA 2RHZA 5KYYA 2QASA 1PKSA 1Q82U 3JRZA 5LJ5g 2YUNA 5AT1B 1T0JA 2QQRA 2COZA 4M7AA 1SG5A 1QCFA 3UT1A 2LQKA 3DKMA 1VQ4A 5IH2A 5GAN5 2PU9B 3CMAT 1TTHB 4JRIA 1M2VA 3JB9D 4C92B 5LJ3d 1VQ7T 1VOMA 4DQ2A 2HMAA 2FO0A 5J3BA 2RJEA 2LJ3A 1RAAB 2YLCA 2CYZB 2RI2A 4KRTA 1WA7A 2COWA 2EBPA 1VUBA 3ULRB 4HCBA 1ZHIA 5A0DA 3I55A 3JCMQ 1B34B 2DAQA 3I56Q 5I11A 2PUKB 1YJWT 2J7IA 4QVDA 2OAWA 2XDBA 1K9AA 3FC3A 2LX7A 3CC7Q 1WHMA 1KHIA 4PFPA 2NWMA 3RR6A 4ELZC 9ATCB 2E65A 3QDRB 3FLGA 5IHIA 1SHGA 3VKIA 4XTYA 3L2WA 3CCMQ 1X75C 3CCET 3M0QA 1GL5A 2ZAEA 4FL6A 5GAMh 3I5RA 1ZSZC 1GCQA 5KYXA 5CO7A 2JT4A 4M77B 2QI2A 1Q7YC 2DL5A 2OTLT 1W1FA 2ED0A 1HD3A 4RCBA 5D6XA 1T0HA 3LLRA 1CSKA 1S72T 2KYBA 1WHLA 1K0XA 2LT4A 3EG3A 2AK5A 3RMQA 2DXTA 4M75B 1AT1B 1MMGA 1ZA2B 2D1XA 1ZUYA 1M2VB 4ME7A 4KGZB 4BI3A 2DEQA 5KYWA 2MPXC 3CMEA 2KSSA 2EJ9A 1JBMA 4Z8AA 2EPDA 1G83A 2F5TX 3CD6A 2MAMA 2O4XB 3V7SA 3OYDA 4BD3A 2HQXA 1YIJQ 1FYNA 4F04B 1BIBA 1M90R 1G3TA 2EQJA 4OGEA 2A08A 2LNHB 2CSIA 2GQVA 3RKYA 1E6GA 1C0MA 2LJ1A 1UUEA 3N5BB 2OTLQ 4KUDK 4CRIA 1SF9A 2LJ0A 2HZYA 3O5ZA 2FZGB 1N8RU 2LRQA 3G6EQ 2H3JA 4JPBW 1K9MC 5KH6A 1YI2Q 1KQ1A 4A4HA 5LJ3g 3CCRA 1R77A 2HAXA 3FRNA 3JB9F 5HK3A 2E70A 5GJVB 1VQLT 3PT9A 4PJOF 2DVEA 3EAEA 5L23A 3VYHB 3CCEA 3OYBA 3G71A 3RUXA 1UE9A 5GAN2 3TCJA 1X2KA 1S1NA 5EG2A 3CMEQ 4F16A 3CC7A 4M78A 2J06A 4OMMA 1U06A 2HDAA 1OULA 1UEBA 3CBPA 1YHQA 3CBOA 2VB6A 4M78G 2MK5A 2HL3A 3S3MA 4AMCA 4M7DE 2OJ2A 3JSCA 4XTWA 1YJNT 3V7CA 3FJ5A 3KFVA 3TQ7P 1QP3A 1WJQA 3G4SA 2X3WD 5KYNA 3CC4T 3TEEA 3EG0A 1Y07A 2CKKA 1HK9A 2E41A 3UF4A 3A98A 3VS6A 5IHKA 3L1AA 1K73U 2L3PA 2W0ZA 2EGAA 2L2PA 1PSFA 3QPHA 2JJ9A 1PD1A 8ATCB 3CPWP 1VQ8T 2CUDA 2DBKA 3PTAA 4XTVA 1K1ZA 4II1A 2E6ZA 1M1KU 7AT1B 1GBRA 1IO6A 1YN8A 2DKGA 4GY5A 2PVDB 1ZLMA 4RTYA 4PLIA 5GMKm 2KEAA 4J6XA 3Q1JA 4M7DA 2LZ6B 4B9WA 2DL3A 2R5AA 3EGXA 3VS7A 1TOVA 4FU6A 1K73R 1YP5A 2DPPB 2G3RA 5CR2A 4EPCA 3GF5A 4M78E 3MEAA 1UHCA 4E7HA 3CCQQ 5GAOn 4C5IA 3UDCA 1VQ4T 1M30A 3DB4A 2HD0A 2RNAA 2RA2A 4X1VA 1N9RA 1GFCA 2XHCA 2C06A 3J81E 1K4US 4M7DF 4O5VA 2O4XA 2FPDA 2DTHA 1OZ3A 4C0FA 2JOYA 1K9MU 2E1HA 4C8QG 4LN2A 3JAME 2V8IA 2LCLA 2EWNA 4OP0A 2DL7A 2EAYA 4LUDA 1W2BP 2DXCA 1G5VA 4KGVB 5FLXE 2RK1A 2LCCA 1ABOA 2DE0X 1Y96B 2VGNA 4C92C 3CCJQ 1AZEA 1OI1A 1V76A 1V1CA 3OS1A 4FM4B 1ZUUA 5CQYA 1BB9A 2KRMA 5CKHA 1E7OA 3CCRQ 1K9MR 3OMCA 3A8MB 4C8QA 5FRNA 2DMOA 1IRXA 1WHHA 1SEMA 2ABLA 4FCYA 3SB2A 3URGA 4HT8A 1F1BB 4RCCA 1BU1A 2GQIA 2VXEA 4IUPA 2CZ7B 3C95A 3X20B 1Y71A 2DL4A 1G3SA 1G3YA 3CCUQ 4E7KA 3CPWA 2E3IA 2SRCA 4M7DC 3FB9A 2KGTA 4J9IA 2CDTA 1OEBA 2MCNA 2COYA 4A63B 3CCEQ 4Y28E 4JJNK 2BE9B 1YJ9Q 3QO3A 1W2BA 4PJMA 3EGDA 2V8KA 1VQ6Q 1U3OA 4M78B 1Q81U 3HFNA 3V8LA 3OY9A 4PFZA 1QW1A 1UTIA 3MEVA 2IPOB 4D8DA 2K2VA 5I22A 5LJ3j 2X9HA 2EYZA 3SWNC 2DTIA 1CKBA 4QT7A 4ESRA 4PJOE 1YWPA 3VS5A 3M53A 5GAOp 2RHUA 5GMKj 1N5ZA 1Q81C 4MMLA 2DA9A 2JS2A 1GBQA 5IXFA 1VA7A 1O9SA 4C92A 5FROA 1QVGA 1QVGP 2QA4A 4F7UG 1JQQA 2AIRB 4DOWA 2KT1A 3EHQA 1JJ2S 3CPWS 3QZ5B 1OPLA 1VQMQ 2YT6A 4PK4A 5CKBA 2KNBB 1VQ7Q 3S3NA 3MHXA 2L3RA 2GGRA 2VV5A 3MP1A 2AZSA 2HKNA 2YUPA 3H8ZA 4DOVA 2RQVA 2RQTA 4X9CA 1M1KC 2E5KA 4J7IA 1PM3A 4NS5A 4PL6A 1KQSA 1UHFA 2JUFA 1NEBA 1WXBA 1ACMB 4C92D 2BUDA 1H3ZA 2QDLA 5CAIA 2DYIA 4Q5WA 1ABQA 1W6XA 2A28A 1VQ6T 4R55A 4M77A 4M77D 2MWPA 2GF7A 1BBZA 1TXQA 2R58A 4XTZA 2G6FX 1VQNA 2DETA 1X6OA 1QKWA 1OYXA 1D0XA 4R0KA 3U23A 1VQPT 2RO0A 4F7UE 4N4GA 1LOJA 1QCOA 1XNIA 2QEXA 2QDYB 2CGHA 2VGMA 3P8HA 4OVAA 5LJ3f 3SWNA 1VQOT 1GRIA 3S6WA 2CH4W 5GANg 1OPKA 1MHNA 2HBPA 1RADB 4E7ZA 2PTKA 4JJDA 2DZ9A 4RTXA 3E9GA 1AHJB 3CXCP 4L5GA 2IVWA 3CPFA 3EG1A 2DK3A 4HVWA 1KQSP 2EFIA 4PJLA 3R6NA 1QWFA 1KQSS 3BY7A 2DD5A 2EGCA 3A8GB 2XMFA 1WNLA 1VQNT 1KC8C 1KC8R 2DD4A 2XKOC 1LNXA 5GMKl 4M75E 2NUPB 2XG8D 2F2VA 1R0CB 3OYFA 4LUEA 4M7AC 1HYOA 1Q86U 4E2FB 1M1FA 1AZGB 3CC4A 2DBMA 1YI2A 2CZ0B 2EQUA 1VIFA 1YJWQ 2EYYA 1X27A 4NL2A 1YJNA 3PE0A 3GIBA 4LDYA 4C92F 2CT3A 5CQXA 1WJSA 1U8RA 4Z88A 1PCXA 1KC8U 2JM8A 5LJ3e 2DZCA 4C8QB 3MP6A 3QG1A 5L8RE 3V8KA 5ECAA 2HBWA 3TVTA 3ZL7C 2ROLA 1Q86R 3D7SB 3CMAA 3V8JA 1RAEB 3EFSA 1NLOC 2C0TA 2VUBA 4OGCA 3EH2A 4C0DC 3H9NA 5FW9A 2OI3A 2ATCB 3BDUA 2PQWA 3HRTA 4OF1A 2JZ2A 1VQLQ 3FEOA 4ZTFA 1NEGA 2QA4Q 2WSFE 2DVJA 2P0KA 1NYGA 2RJFA 4GLMA 1EFNA 2IG0A 1JJ2P 4E7SA 1SHFA 2QQ9A 1VQKA 2K4YA 1TUCA 1M90U 2BKDN 1M4ZA 5LJ5h 4C8QF 4HCZA 3CMET 2M9UA 2F1LA 3CCLQ 1GCQC 2E10A 1UFFA 1BKBA 4HXJA 4C92E 3QIIA 2PZ1A 1X01A 4M75A 1WXUA 3GOXA 3QJ6A 3JCMJ 2MWOA 4ZTJA 2V26A 2PNIA 4BI8B 3OYLA 3L2ZA 3JB9G 3OSVA 4BDYA 4TVRA 1YNZA 2OAUA 4LDUA 2RB6A 1N8RC 3INZA 2LCSA 4PJOD 2FG0A 3FIFA 3E9FA 1FMKA 5LJ5f 2KE9A 1AWXA 4JLGA 2GTJA 5GAMe 3OYNA 2NUTA 1D09B 4RTUA 5J39A 4XU1A 2GTOA 3LWIA 3WXMB 3A8HB 4M7AE 3M0SA 4N4HA 4DBFA 3SHWA 4M7AD 3X28B 1N9SA 2RJCA 3J80E 1TSFA 2KXCA 3CCQT 3JCMf 4DBRA 1PRLC 2ZPGB 1WYXA 2QGFB 2EKOA 1H3HA 1KFZA 3RNJA 1PSEA 2K7AA 1ZSZB 1TUGB 1WXTA 1NPPA 2DIGA 1TUDA 3L42A 1MUZA 3C4SA 4PJOC 5GANj 5GAMd 2EQIA 2OTLA 4PJJA 1NG2A 1M2OA 3JCMh 3G7ZA 2K5FA 4WF2A 1QVFS 5HK0A 2KI7A 4A54A 1OQKA 2K3XA 2RJDA 5KCOA 1RLQC 1M9SA 1M27C 2EW3A 1JO8A 3OA6A 2CP5A 2J6FA 1UECA 2L3QA 3LW5E 2ZPFB 2FB7A 4KH0B 1RI0A 1KIKA 1N6AA 4M77C 2L89A 1M8VA 4MZTA 2JVVA 4FSXA 2H3EB 1IZ6A 1KK7A 1RLPC 4MZPA 2I0NA 1OX9A 3E19A 2XU8A 3H0FA 2ZPIB 3PMIA 3CCVA 1V29B 4ZN1A 2QTVA 2DF6A 4C0GA 3L2RA 2GFUA 1Q82C 1VQ5A 2F5KA 4B9XA 3OBWA 3TREA 3A8OB 3ZEHA 3DLMA 4JUVA 1QP2A 5LJ3h 4C5EA 2R57A 4EMKC 3CCQA 2JM9A 3CC2T 5GMKh 2X51A 3RKXA 4PJOB 2QQAA 1NPRA 2LMJA 2QYZA 1ZSZA 1LCKA 3OYGA 3VRYA 1I4K1 3SFMA 2D0QB 5D6WA 4FW2A 4A4KA 2O01E 2D0NA 5J26A 2FHDA 5CKFA 1VYUA 3RMSA 5A0GA 1PNJA 4XU3A 5CKDA 2QGGA 2I2LA 3ER0A 3VS3A 5CKEA 3VJPA 3CEYA 3V7RA 4R56A 2ZCFB 2KRSA 2YLBA 2CP7A 2VVKA 2LNVA 2LP5A 3PIPA 1ZBJA 1VQOQ 2CH4A 4ZN3A 5FU7B 4JRKA 5GAN8 1B34A 5D6YA 4N0AA 1XJWB 2EGEA 4OB3B 1BCOA 2DO3A 4BUGA 4K11A 4ZGJB 4BDZA 1NJIU 3SEMA 3UATA 4E6RA 2M02A 2RHXA 1PWTA 2LDMA 5GAMg 1VQNQ 4KH1B 5C6SA 1WI7A 2XIDA 4LE9A 3CCVT 1PHTA 2ROTA 1QCNA 3GNGA 4FYWB 3PNWC 1S72Q 4OB1B 2QEXQ 4WTOB 1KJWA 1VQ5Q 3VUBA 3CXCA 1B7TA 2PUOB 3EG9B 1MMDA 5FWBA 3OYIA 1NLPC 4RMOA 2KBTA 2F69A 5KE2A 2ENMA 1M90C 1UDLA 2H8HA 1X6BA 4RTWA 1IHWA 1OX8A 4BI4A 5FRMA 2DL8A 1VQPQ 2MI6A 3AT1B 4HT9A 1ZA1B 2FL7A 2Y4XA 2NLUA 3I35A 1BI3A 1SSHA 2MYSA 2QQBA 4MMKA 3PVQA 3QDFA 1AWOA 1GFDA 3EG2A 2RM4A 3OYEA 2HNIA 3JB9H 3GLXA 1YI2T 4FYYB 4M75G 3QKJA 4JLIA 1VQMA 5KYXB 3JV3A 2A7YA 4BB7A 2AKKA 3CCST 3META 2AHJB 2SEMA 3QBYA 2RQWA 3X26B 1U1SA 2AKLA 1Y7XA 2VKNA 1K8AR 2DILA 4LXCA 3QYGB 1NE8A 1XOVA 2PVOB 2RMOA 2D6FA 2L5QA 4X34A 1OU8A 4PJNA 5I21A 1UGQB 2HSPA 3MP8A 2DJZA 3P8DA 1TG0A 4RTZA 3OYAA 2V8JA 2LQNA 4JJBA 2K5LA 2LTOA 1TS9A 1SKUB 2D9TA 1MV0B 5LL6S 4RTVA 1BIAA 1IHVA 1SRLA 3REBB 2MF2A 3KBGA 2P4RA 2E4HA 1Q82R 2OTJA 3G71Q 1Z9ZA 2YUQA 1RL2A 3CCLA 1IXDA 1XTDA 1I5LA 4XTXA 1Y96A 2AZVA 5KYUB 3LH0A 1NYFA 2FVUA 2AT1B 2LQ8A 2M16A 2YRVA 2A37A 5FU6B 3NFCA 3EHRA 4KUIA 2M0OA 3JCMd 1YWOA 2E12A 3HSBA 1H641 3IQLA 1EZZB 2HSEB 1VQ4Q 3RERA 1G3WA 1RAGB 3ME9A 2VWFA 4CC2A 2QG9B 4N4IA
chains in the Genus database with same CATH topology
3OYKA 4M77B 1UB4A 2VUBA 1S72A 4MDXA 2QI2A 4OGCA 1Q7YC 2OTLT 4KULA 2P4TA 3CCMT 4RCBA 4M7DB 2WSCE 4C0DC 5D6XA 3JCMc 3OW2A 2X4YA 4M75C 3LLRA 3CCSA 3X25B 1S72T 1GXIE 1K8AU 3BDUA 3HPWA 2PQWA 4XAXB 3HRTA 4OF1A 2JZ2A 2LT4A 3FEOA 4ZTFA 3RMQA 2DXTA 2DXUA 3NTHA 4V2SA 4M75B 4EDUA 4KT0E 1M1GA 1ZBXA 2WSFE 3LYIA 2P0KA 1JB0E 4E7IA 4ME7A 2GCXA 5HKCA 4BI3A 1U1TA 2RJFA 4MDWA 2IG0A 2JN0A 4C92G 4BE2A 2VXFA 2DEQA 2X4JA 4UC4A 2EJGA 2QQ9A 3CMEA 2KSSA 1YCYA 2EJ9A 2K4YA 2XDPA 3SD4A 1JBMA 3VYGA 3M4YA 4J6YA 3TU4K 2RK2A 1M90U 5GAN4 2BKDN 2QXFA 1M4ZA 2F5TX 5LJ5h 4C8QF 3M56A 4HCZA 1R8OB 3CD6A 2MAMA 2O4XB 3CMET 3V7SA 3OYDA 3JCMb 4BD3A 2M9UA 3M55A 2HQXA 4FIBA 4M77G 4IUUA 1BIBA 2RI3A 1G3TA 2EQJA 4EMKB 4OGEA 2KAFA 2E10A 4BY6B 1BKBA 4C92E 2GQVA 3RKYA 3QIIA 1X01A 3N5BB 4M75A 5IT9E 3NTKA 4KUDK 3GOXA 4CRIA 3QJ6A 1XQHA 2KK4A 3LX7A 3JCMJ 1KD1C 2MWOA 1KHCA 2RHIA 3SDZA 4ZTJA 1N8RU 3ZFJA 2LRQA 3CCMA 3ASKA 3QXEB 2H3JA 4RKUE 4BI8B 3OYLA 3L2ZA 5KH6A 3JB9G 1K9MC 3OSVA 4J8OA 4BDYA 4L59A 1KQ1A 4A4HA 4TVRA 5LJ3g 5GAMj 4J6WA 2OAUA 3LGFA 3G4ST 3CCRA 2XICA 3CCUA 3JCMX 2HAXA 4LDUA 2RB6A 3FRNA 1N8RC 3INZA 4PJOD 3FIFA 2EYQA 3E9FA 3HL8A 2FYKA 2E70A 5HY6A 3ZBDA 5HK3A 3OYCA 1VQLT 4M7AG 3PT9A 4MZMA 4PJOF 2DVEA 2EIFA 4M7AB 3EAEA 5GAN6 5LJ5f 3VYHB 1WQ7A 5A2QE 3CCEA 2ZZDA 4JLGA 3OYBA 4JS5A 3G71A 3RUXA 4A4FA 5GAN2 4X9DA 5GAMe 3TCJA 3OYNA 2XD0A 3O8VA 5EG2A 5J39A 1Q86C 4XU1A 3PFSA 3CC7A 4XTUA 4M78A 2E5QA 3LWIA 3WXMB 4OB0B 1UEBA 3CBPA 4M77F 1YHQA 2X4XA 3A8HB 3CBOA 4M7AE 4M78G 1NZ9A 4R55A 4N4HA 4ZGEB 3S3MA 4M7AD 3X28B 1I81A 1N9SA 2RJCA 4RG8A 3J80E 1D3BA 1BI1A 3JCMf 3QHSA 4ZGDB 3CCJA 1QVPA 3CCQT 4M7DE 2ZPGB 4M77E 3OQ5A 5IAYA 3JSCA 2EKOA 3M5AA 3M9QA 4XTWA 3V7CA 4EMHA 1YJNT 1PSEA 5GANe 1QP3A 1WJQA 3G4SA 1VQ6A 5LJ5j 2MMPA 2LC4A 5DLQE 5KCHA 4IURA 4PKCC 3L2QA 1NPPA 3TEEA 5CK9A 3CC4T 3CCLT 1YIJT 3RIRA 1VQ9A 2DIGA 4NL3A 4C0DB 2KDSA 1Y07A 3L42A 2CKKA 1HK9A 2E41A 2JNGA 4O6JA 1YITT 2QTXA 3C4SA 4M7DG 4PJOC 4GLKA 1WGSA 4C8QE 3L1AA 1K73U 2VC8A 3PIOA 5GMKe 5GANj 5GAMd 2K57A 1PSFA 3QPHA 5FU6C 3JB9I 3CCJT 1VQ8T 5CCAA 5I2MA 2OTLA 2XI9A 3PTAA 4XTVA 4QVZA 3JCMh 2P0QA 4II1A 3G7ZA 2K5FA 2CZ1B 3A5ZB 4WF2A 2E6ZA 1QVFS 4RG2A 3BW1A 4J5YA 4A54A 5HK0A 2Y90A 3OS0A 1QVGS 4QQGA 2K3XA 3L2UA 2RJDA 4J83A 1QVFA 3OS2A 1OZ2A 3GPLA 5KCOA 2DKGA 4GY5A 1WQWA 1M9SA 3H6ZA 3JCMe 1VQKA 2PVDB 2KY9A 1VQOA 3BFMA 2KMTA 4A4EA 4QQDA 1WJRA 2HQEA 4PLIA 3WVEB 5GMKm 3OA6A 4J6XA 3Q1JA 4M7DA 4M78F 3WVDB 4OB2B 3RESA 3LW5E 2QEXT 4B9WA 2A3LA 2ZPFB 2R5AA 3MCAB 1EIFA 2X35A 1VQ6T 2FB7A 4FU6A 1FX7A 1RI0A 3SWNB 4KBMB 4M78D 4Z02A 2DPPB 1N6AA 2G3RA 5CR2A 4EPCA 3GF5A 2L89A 4M78E 4M77C 3MEAA 5GAMf 1M8VA 1UGPB 4E7HA 4MZTA 3G6EA 1K8AC 2JVVA 3CCUT 4FSXA 4LD6A 5GAOn 1KQSS 4C5IA 1IZ6A 3MEUA 3UDCA 1VQ4T 2E6NA 1VQPA 3DB4A 4MZPA 4QQ6A 2HD0A 3T9NA 2RA2A 1N9RA 2XHCA 2EQKA 2C06A 3JCMW 1VQ8A 5IN1A 3J81E 1VQMT 1Q7YU 5DY9A 3E19A 3M4GA 4PJOA 2XU8A 4J7FA 4N0AC 4M7DF 2ZPIB 3PMIA 4O5VA 2EJFA 3CBMA 3VV0A 3KXTA 3CCVA 2O4XA 1V29B 3PMTA 4A53A 1TH7A 2ZGWA 4ZN1A 3JB9F 5CIUA 4C0GA 3JB9J 3L2RA 2DTHA 1OZ3A 2GFUA 4C5GA 1Q82C 1VQ9T 4C0FA 2JOYA 1K9MU 2E1HA 1VQ5A 2F5KA 4C8QG 4M7AF 4B9XA 3JAME 2V8IA 2LT1A 2LCLA 3OBWA 2EWNA 4OP0A 4XK8E 3TREA 2EAYA 3A8OB 3OMGA 3ZEHA 2DXCA 5GAN3 4F7UB 4QVCA 1YHQT 3DLMA 4JUVA 1QP2A 5LJ3h 1G5VA 3G6ET 1DJ7B 2JTFA 5FLXE 1LJOA 2LX9A 2RK1A 4C5EA 2DTOA 2LCCA 2R57A 3HFOA 4C0ZA 3GP8A 4EMKC 3CC7T 2DXBA 3CCQA 3J7AF 1Y96B 2VGNA 3HP9A 4JDSA 4C92C 2PVGB 3CC2T 2DIQA 5GAOl 1OI1A 3M54A 4XU0A 5KE3A 5GMKh 3G71T 4ATOA 1ZQ1A 3RKXA 4PJOB 2QQAA 1IREB 1NPRA 4YTLA 3OS1A 4FM4B 3C12A 5CQYA 5CKHA 4M78C 3OYGA 3OYYA 3OMCA 1YJ9A 3A8MB 2QA4T 1FWZA 4C8QA 2QQSA 1I4K1 3SFMA 2D0QB 5FRNA 3OB9A 3DB3A 5D6WA 2RH2A 4A4KA 2O01E 2YHTA 5J26A 2FHDA 3SB2A 5CKFA 3URGA 5GAOr 1M1KU 2K3YA 2RD1A 3RMSA 4RCCA 5A0GA 4XU3A 5CKDA 4HT8A 2VXEA 3HRSA 4IUPA 1KG1A 2I2LA 2CZ7B 3C95A 1HXDA 3X20B 1Y71A 3ER0A 1BI0A 3E1SA 1G3SA 1G3YA 5CKEA 5GANf 4IKFA 3VJPA 4E7KA 1YITA 3CPWA 5GAN7 1KQ2A 3CEYA 1UGSB 2KQWA 3V7RA 2ZCFB 4R56A 4M7DC 3FB9A 1YJ9T 2YLBA 1BI2A 4LD9K 3I56T 2LNVA 3PIPA 3EFRA 4ZN3A 5FU7B 4JRKA 3MO8A 5GAN8 5C0MA 4Y28E 1O75A 1B34A 5LJ5d 4JJNK 3QO3A 1W2BA 1N27A 1FXXA 5D6YA 3UWNA 4N0AA 2V8KA 4JS4A 4OB3B 4M78B 4Y91A 1Q81U 2DO3A 3KUFA 4BUGA 3HFNA 3M57A 3V8LA 3OY9A 4DA4A 4C8QC 2K5IA 4ZGJB 1QW1A 4BDZA 4CI0C 1NJIU 3CD6T 3MEVA 5LJ5e 4M7DD 1I8FA 5GANd 2RHXA 2LDMA 5GMKi 2K2VA 4XQ3A 5LJ3j 5GAMg 3LGLA 2OTJT 1NJIC 5GANh 5C6SA 2XIDA 4OMFB 3SWNC 5I2SA 3LWHA 2DTIA 3CCVT 3JCMP 2X4WA 2ZPHB 4PJOE 3GNGA 2Y4YA 3M53A 2M1HA 2P0PA 2RHUA 3PNWC 5GMKj 5GAOp 4OB1B 3C94A 1Q81C 2WACA 4MMLA 3A8LB 3S3OA 4F7UF 3VUZA 3VUBA 3CXCA 2PUOB 2XDDA 4HKEA 4LDVA 2B8AA 3P8BB 1K73C 3CXCS 2L8DA 1O9SA 4C92A 3OYIA 5FROA 3OW2S 1QVGA 2QA4A 3QYHB 4F7UG 2RHYA 5DM7R 2ZPBB 1JJ2A 2EQMA 4DOWA 4RMOA 4PJOG 4BY6C 2F69A 1JJ2S 5KE2A 1M90C 2KVQG 3CPWS 3QZ5B 4IUTA 4PNOA 4BACA 3M58A 5GAOq 1JRIA 5CKBA 4BI4A 5FRMA 4JRPA 3S3NA 3HKSA 2MI6A 3GNFB 4FT2A 4HT9A 3MHXA 2JTMA 3R6OA 4E47A 2L3RA 2GFAA 5CVIA 2VV5A 3MP1A 3H8ZA 4DOVA 2FL7A 3QJYA 5DLOA 5M9OA 2ZPEB 2Y4XA 1KD1U 4X9CA 2NLUA 1M1KC 3OYHA 1BI3A 4J7IA 3CC2A 2QQBA 5FU7C 4NS5A 4PL6A 4MMKA 3HRUA 1VQ5T 1KQSA 2JUFA 3NTIA 4C5HA 1SSFA 3UPUA 4C92D 2BUDA 3JCMg 1H3ZA 1MGQA 2E64A 5CAIA 1VIEA 4EMGA 4QW2A 1YJWA 2RM4A 3QZ9B 4HA8A 3PGGA 3OYEA 2HNIA 3JB9H 3VU3C 3GLXA 3I56A 1YI2T 4M75G 3X24B 4Q5WA 3QKJA 2BIVA 4JLIA 1VQMA 3OBYA 3RKWA 3I55T 3QSUA 3AHUA 2A7YA 3OS5A 2RI5A 3QUIA 4BB7A 1WPYA 4M77D 4M77A 1YBYA 2MWPA 3FJPA 4NOYA 4XU2A 5A0LA 2XK0A 2RHZA 2GF7A 3CCST 3META 4A4GA 2R58A 1Q82U 4XTZA 3JRZA 3MEWA 2AHJB 1VQNA 1X6OA 5LJ5g 1OYXA 3OYMA 2QQRA 3QBYA 5GAOm 4M7AA 3X26B 3UT1A 1U1SA 2LQKA 3DKMA 1Y7XA 1VQ4A 2RO0A 4F7UE 4N4GA 1LOJA 2PU9B 5GAN5 1XNIA 2WSEE 1VQPT 4M75D 2QEXA 3QYGB 2QDYB 2CGHA 2VGMA 3M59A 3CMAT 3P8HA 4OVAA 4JRIA 5LJ3f 1VQ7A 1NE8A 3OYJA 1XOVA 3SWNA 3JB9D 2PVOB 1VQOT 3S6WA 4C92B 5GANg 5LJ3d 1VQ7T 2L5QA 2D6FA 4X34A 1MHNA 2HBPA 4DQ2A 5I21A 4JRQA 1UGQB 3MP8A 4IUVA 4FT4A 2DJZA 4D6WA 2DZ9A 3OSSC 4PLLA 5J3BA 3P8DA 2RJEA 1D3BB 3E9GA 1AHJB 4BE1A 4L5GA 2YLCA 3OYAA 1VQLA 2CYZB 2IVWA 2RI2A 2V8JA 3CPFA 4VUBA 2K5LA 2LTOA 3DLLA 2DK3A 4P5NA 3L2VA 4E7LA 2R5MA 3CCRT 4HCCA 4M75F 1VUBA 2EFIA 4BE0A 4HCBA 1P92A 4IUQA 1ZHIA 2D9TA 2DD5A 3BY7A 3JCMV 3A8GB 5LL6S 5A0DA 3JCMQ 3I55A 1B34B 2DAQA 4LDXA 1WNLA 1VQNT 1KC8C 1BIAA 2DD4A 3F70A 2XKOC 1LNXA 5GMKl 4M75E 2PUKB 1YJWT 2XG8D 2MF2A 4QVDA 3KBGA 3OYFA 2XDBA 4M7AC 2OTJA 4C8QD 2VYTA 1Q86U 1M1FA 3FC3A 1RL2A 1YIJA 3CC4A 3CCLA 1XTDA 2CZ0B 1YI2A 1W2BS 1I5LA 2EQUA 1VIFA 4XTXA 1KHIA 1Y96A 3LH0A 2FVUA 4NL2A 1YJNA 3GIBA 2LQ8A 3BDLA 2M16A 4EMKA 4L6V5 3FDRA 4LDYA 2LVMA 2YRVA 4ELZC 4C92F 2E65A 5CQXA 1WJSA 3FLGA 3QDRB 5FU6B 1U8RA 3NFCA 3VKIA 4KUIA 1KC8U 2M0OA 1VQKT 5LJ3e 4XTYA 4F7UA 2DZCA 4C8QB 3MP6A 3QG1A 5L8RE 3V8KA 3L2WA 3JCMd 1X75C 3CCET 1M5Q1 2E12A 4LDWA 3HSBA 2CS7A 4FL6A 1H641 5GAMh 1W4SA 1UGRB 1BYMA 5AYFA 3CMAA 1G3WA 4E7JA 2CZ6B 3ME9A 3RERA 3V8JA 3HHTB 3EFSA 4ELYC 4N4IA 5CO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN e;  2RM4 A;  4HA8 A;  3PGG A;  4M77 B;  5LJ5 j;  2HNI A;  3JB9 H;  3VU3 C;  2YHT A;  3SB2 A;  4M75 G;  5GAO r;  4M7D B;  2RD1 A;  4RCB A;  3RIR A;  4HT8 A;  4RCC A;  4XU3 A;  4JLI A;  4NL3 A;  3JCM c;  3RKW A;  2VXE A;  4M75 C;  3QSU A;  2I2L A;  2E41 A;  1HK9 A;  3AHU A;  1HXD A;  2QTX A;  3QUI A;  3JB9 J;  3BDU A;  1WPY A;  4M77 D;  4M77 A;  3FJP A;  4NOY A;  4XU2 A;  4C8Q E;  5GAN f;  4M7D G;  3L1A A;  4PJO C;  5GAN 7;  1KQ2 A;  2DXT A;  2DXU A;  2VC8 A;  4V2S A;  4M75 B;  5GMK e;  3V7R A;  4M7D C;  4XTZ A;  5GAM d;  5GAN j;  3FB9 A;  2K57 A;  5LJ5 g;  2YLB A;  3JB9 I;  5GAO m;  4M7A A;  4XTV A;  3JCM h;  3EFR A;  1U1S A;  1U1T A;  4JRK A;  4WF2 A;  4F7U E;  1LOJ A;  5GAN 8;  2JN0 A;  3BW1 A;  4J5Y A;  4A54 A;  4C92 G;  2Y90 A;  2VXF A;  1B34 A;  2DEQ A;  4M75 D;  5LJ5 d;  2EJG A;  2CGH A;  3QO3 A;  2DKG A;  1YCY A;  2EJ9 A;  1WQW A;  5LJ3 f;  4JRI A;  1JBM A;  3JCM e;  4J6Y A;  4N0A A;  3SWN A;  5GAN 4;  4M78 B;  3JB9 D;  3BFM A;  4Y91 A;  4C92 B;  5LJ5 h;  4C8Q F;  5LJ3 d;  5GAN g;  5GMK m;  3HFN A;  4J6X A;  3V8L A;  4M7D A;  4M78 F;  4DQ2 A;  5I21 A;  3RES A;  3V7S A;  4C8Q C;  3JCM b;  2DJZ A;  2DZ9 A;  2FB7 A;  4M77 G;  5LJ5 e;  4M7D D;  3SWN B;  5GAN 5;  1I8F A;  1D3B B;  4M78 D;  1BIB A;  5GAN d;  2YLC A;  4EMK B;  5GMK i;  2E10 A;  4XQ3 A;  4C92 E;  4M77 C;  4M78 E;  1M8V A;  3RKY A;  5GAM f;  5LJ3 j;  5GAM g;  5GAN h;  1X01 A;  4M75 A;  3SWN C;  5GAO n;  2DTI A;  3JCM P;  4M75 F;  3JCM J;  4PJO E;  2RA2 A;  1N9R A;  3JCM V;  3BY7 A;  5GAO p;  3JCM Q;  3JCM W;  5GMK j;  1B34 B;  5DY9 A;  1WNL A;  3M4G A;  1BIA A;  4PJO A;  4MML A;  4N0A C;  4EMH A;  4M7D F;  3L2Z A;  4F7U F;  3JB9 G;  1LNX A;  5GMK l;  4M75 E;  1KQ1 A;  2EJF A;  5LJ3 g;  5GAM j;  4J6W A;  4A53 A;  4QVD A;  1TH7 A;  2ZGW A;  4C92 A;  3JCM X;  4M7A C;  2RB6 A;  3INZ A;  2DTH A;  4C8Q D;  4PJO D;  3FIF A;  4F7U G;  3JB9 F;  2FYK A;  4M7A F;  2E1H A;  4C8Q G;  4M7A G;  4PJO G;  4PJO F;  1I5L A;  2DVE A;  4XTX A;  2EWN A;  4M7A B;  4OP0 A;  1Y96 A;  2EAY A;  5GAN 6;  5LJ5 f;  4PNO A;  1WQ7 A;  4NL2 A;  5GAN 3;  4F7U B;  5GAO q;  3GIB A;  1JRI A;  4QVC A;  4JUV A;  4EMK A;  5LJ3 h;  3RUX A;  5GAN 2;  4X9D A;  1LJO A;  5GAM e;  5CAI A;  4C92 F;  2DTO A;  2E65 A;  3HFO A;  4XU1 A;  4HT9 A;  4EMK C;  4XTU A;  1Y96 B;  4C92 C;  4M78 A;  5LJ3 e;  5GAO l;  4XTY A;  4XU0 A;  4F7U A;  2DZC A;  5GMK h;  4C8Q B;  3V8K A;  3RKX A;  4M77 F;  4PJO B;  3JCM d;  4X9C A;  4M7A E;  1M5Q 1;  4M78 G;  3HSB A;  4M7A D;  1H64 1;  1I81 A;  1N9S A;  4M78 C;  5GAM h;  1D3B A;  4MMK A;  3JCM f;  3QHS A;  4M7D E;  3RER A;  4C8Q A;  3V8J A;  4M77 E;  1I4K 1;  3EFS A;  4C92 D;  3JCM g;  4XTW A;  1MGQ A;  2E64 A;  3V7C A;  4EMG A; 
#chains in the Genus database with same CATH topology
 2IIM A;  3H41 A;  2J6K A;  4MDX A;  4WCI A;  2DNU A;  2P4T A;  2WSC E;  4ORZ A;  3OW2 A;  2X4Y A;  1SRM A;  3CCS A;  1GXI E;  3HPW A;  4XAX B;  3CCV Q;  2DER A;  3NTH A;  4V2S A;  4KT0 E;  3LYI A;  2RQU A;  3UA6 A;  2JS0 A;  1JB0 E;  1X6G A;  4AFS C;  1U1T A;  2C0I A;  2FZC B;  4C92 G;  4BE2 A;  1C1A A;  1WZO A;  1TU0 B;  1Y0M A;  1QMC A;  1YCY A;  3TU4 K;  3SD4 A;  3M4Y A;  4J6Y A;  3REA B;  2QXF A;  3M56 A;  4DBQ A;  1IB8 A;  3M55 A;  3GBQ A;  4OML A;  3CC4 Q;  1D0Z A;  3EFO A;  3NPF A;  4M77 G;  2KAF A;  2V1R A;  3NTK A;  2KK4 A;  2L3S A;  1KHC A;  2RHI A;  3ZFJ A;  3CCM A;  4JJC A;  3ASK A;  3QXE B;  4J8O A;  4J9H A;  4J6W A;  3CCU A;  1YIT Q;  3HL8 A;  1Q7Y R;  3OYC A;  5HY6 A;  4M7A G;  1T3L A;  2KXD A;  5GAN 6;  1WQ7 A;  5A2Q E;  4AFQ C;  2MOX A;  2O31 A;  2XD0 A;  4A4F A;  3O8V A;  1Q86 C;  3CCS Q;  2CRE A;  2YSQ A;  4XTU A;  1VQ8 Q;  4OB0 B;  4ZGE B;  2QK0 A;  3VS1 A;  1OU9 A;  1I81 A;  4RG8 A;  1D3B A;  1BI1 A;  2K6D A;  4ZGD B;  3CCJ A;  1QVP A;  1K0S A;  3OQ5 A;  3M9Q A;  5GAN e;  1VQ6 A;  5LJ5 j;  5DLQ E;  2W10 A;  5KCH A;  5KYY B;  2JMC A;  3L2Q A;  1YIJ T;  1VQ9 A;  4J9G A;  3RIR A;  4NL3 A;  1ZX6 A;  3MJX A;  2JNG A;  1YIT T;  1QWE A;  4M7D G;  4GLK A;  1WGS A;  4C8Q E;  4Z89 A;  1QVF P;  2K57 A;  3CCJ T;  2XI9 A;  4QVZ A;  2CZ1 B;  3A5Z B;  3BW1 A;  1QVG S;  1QVF A;  4J83 A;  3OS2 A;  3JCM e;  1JXM A;  4F17 A;  2KY9 A;  4AG2 C;  3BFM A;  1WJR A;  2HQE A;  1BK2 A;  3H0I A;  4M78 F;  4OB2 B;  2A3L A;  1EIF A;  4RTT A;  1LPL A;  2X35 A;  3MKD A;  1JEG A;  1FX7 A;  2ED1 A;  4KBM B;  1WDX A;  1UGP B;  3G6E A;  4JZ4 A;  4FW1 A;  3CCU T;  1M3A A;  3MEU A;  3T9N A;  1RUW A;  2DLP A;  4RUG A;  1VQ8 A;  1M3B A;  2NYS A;  2ESW A;  1RAH B;  4PJO A;  3OW2 P;  4N0A C;  2YUO A;  3KXT A;  3M0T A;  3PMT A;  4A53 A;  1TH7 A;  5CIU A;  1QKX A;  2MIO A;  4M7A F;  2LT1 A;  4PFO A;  1FMV A;  1G8X A;  2BTT A;  4F7U B;  1M1K R;  4QVC A;  2JW4 A;  3TSW A;  1YHQ T;  3G6E T;  1DJ7 B;  1LJO A;  4C0Z A;  3HFO A;  3GP8 A;  3CC7 T;  2DXB A;  3J7A F;  1GCP A;  2DIQ A;  4B6M A;  5GAO l;  4ATO A;  3G71 T;  1ZQ1 A;  3VS2 A;  1IRE B;  2B86 A;  3M0U A;  4J9B A;  3M0R A;  1AWJ A;  2EVR A;  1Q95 G;  4M78 C;  1PD0 A;  1FWZ A;  1WHG A;  2QQS A;  3C0C A;  3EGU A;  3DB3 A;  2GNC A;  2K3Y A;  2RD1 A;  4HVV A;  2ECZ A;  3HRS A;  1BI0 A;  3E1S A;  2YRD A;  4IKF A;  1YIT A;  4AT1 B;  2KQW A;  4CC3 A;  2E3H A;  1BI2 A;  2DX1 A;  2NUZ A;  3I56 T;  2FRY A;  3EFR A;  5KYU A;  3MO8 A;  1JU5 C;  5C0M A;  1O75 A;  5LJ5 d;  1N27 A;  1FXX A;  3G4S Q;  2EKH A;  3KUF A;  1B3Q A;  3M57 A;  4C8Q C;  2OTJ Q;  4CI0 C;  5KYW B;  2HKQ B;  3CD6 T;  5LJ5 e;  2FPE A;  1MMN A;  1UJ0 A;  1NJI C;  2OTJ T;  4OMF B;  2CP0 A;  2HCK A;  3JCM P;  2X4W A;  2Y4Y A;  1I5O B;  3C94 A;  3S3O A;  2FPF A;  3A8L B;  3M0P A;  1G2B A;  4F7U F;  3VUZ A;  1T3S A;  4FYX B;  2X3X D;  2J6O A;  3VRZ A;  4HKE A;  4LDV A;  1KD1 R;  3P8B B;  1K73 C;  1E6H A;  2L8D A;  3CXC S;  2BE7 D;  3VS4 A;  4J9C A;  3QYH B;  5DM7 R;  2ZPB B;  4PJO G;  4BY6 C;  2KVQ G;  4M4Z A;  4IUT A;  4BAC A;  1C6V X;  3M58 A;  5GAO q;  1JRI A;  4DBH A;  1LVK A;  3HKS A;  1D1B A;  2YRC A;  2GFA A;  5IXB A;  4QKU A;  3QJY A;  2DRM A;  2ZPE B;  2K2M A;  1KD1 U;  2RPN A;  1Y57 A;  1FMW A;  3OYH A;  5FU7 C;  3H0H A;  2RN8 A;  2RF0 A;  3PVL A;  1VQ5 T;  3NTI A;  1SSF A;  2YWW A;  1PRM C;  1MGQ A;  4QW2 A;  4OMQ A;  1YJW A;  3QZ9 B;  4HA8 A;  3PGG A;  2HEQ A;  3BE3 A;  3VU3 C;  3I56 A;  1IGQ A;  3RKW A;  3QSU A;  3AHU A;  1K76 A;  3G4S T;  1QQJ A;  2RI5 A;  3JB9 J;  2M51 A;  5A0L A;  4Y92 A;  1YBY A;  3FJP A;  4NOY A;  4XU2 A;  2XK0 A;  2D8J A;  1H92 A;  4A4G A;  4GBQ A;  3MEW A;  2YXY A;  2Z0W A;  2F2W A;  1VYV A;  1RAB B;  2O88 A;  3OYM A;  5GAO m;  3G1J A;  1UG1 A;  3I9Q A;  4D8K A;  4J9D A;  2WSE E;  4M75 D;  1M3C A;  3M59 A;  1VQ7 A;  3OYJ A;  2OX7 A;  4JRQ A;  2C0O A;  2EYX A;  2KRO A;  4IUV A;  4FT4 A;  4D6W A;  2YDL A;  3OSS C;  4PLL A;  1VQK Q;  1D3B B;  4BE1 A;  2O9V A;  1VQL A;  1I1J A;  4VUB A;  2FRW A;  1AVZ C;  1X2Q A;  3DLL A;  4P5N A;  3L2V A;  4E7L A;  1RAI B;  2R5M A;  3CCR T;  4HCC A;  3QWY A;  4M75 F;  4BE0 A;  1P92 A;  4IUQ A;  3JCM V;  4LDX A;  2VAS A;  3F70 A;  3RDV A;  1WHJ A;  4OMN A;  1UJY A;  4C8Q D;  2VYT A;  5GJW B;  1YIJ A;  1W2B S;  1UGV A;  3BDL A;  4EMK A;  4L6V 5;  3FDR A;  2LVM A;  2D8H A;  1EX4 A;  2CP2 A;  1YFN A;  1VQK T;  4F7U A;  1AEY A;  2EYW A;  2BZX A;  1M5Q 1;  2CT4 A;  3UA7 A;  4LDW A;  2K3B A;  2NUP A;  1R0B G;  2CS7 A;  1W4S A;  1UGR B;  1BYM A;  5AYF A;  4E7J A;  2CZ6 B;  2KR3 A;  3HHT B;  8AT1 B;  4ELY C;  3OYK A;  1UB4 A;  4AG1 C;  1S72 A;  5FWC A;  3I5S A;  4IIM A;  4KUL A;  4M7D B;  3CCM T;  3JCM c;  1D1C A;  4M75 C;  1HJD A;  3X25 B;  2BZ8 A;  1K8A U;  1D1A A;  2DXU A;  1MNE A;  4EDU A;  1M1G A;  1TWB A;  1ZBX A;  4E7I A;  2DJQ A;  2GCX A;  4F14 A;  5HKC A;  1IGU A;  4MDW A;  2JN0 A;  1WHK A;  2VXF A;  4UC4 A;  2X4J A;  2EJG A;  2XDP A;  3VYG A;  1SPK A;  2RK2 A;  5GAN 4;  2K9G A;  1R8O B;  1WIE A;  3CQT A;  3EH1 A;  4EIK A;  4DEX A;  3JCM b;  3E2U A;  1I0C A;  4FIB A;  4IUU A;  2RI3 A;  1WFW A;  4EMK B;  4BY6 B;  4HCK A;  5IT9 E;  1XQH A;  3LX7 A;  1X69 A;  1KD1 C;  3NHN A;  3SDZ A;  2F2X A;  1D0Y A;  4RKU E;  4L59 A;  5GAM j;  4KGX B;  3LGF A;  2XIC A;  3JCM X;  1U5S A;  1AOJ A;  1HSQ A;  4J9F A;  1ZSG A;  3HTR A;  3ZBD A;  2EYQ A;  1N8R R;  2FYK A;  2L0A A;  4MZM A;  2QAZ A;  2EIF A;  4M7A B;  1AD5 A;  2CSQ A;  2ZZD A;  4JS5 A;  4X9D A;  1M8M A;  3PFS A;  2CUB A;  2E5Q A;  1J3T A;  4FYV B;  2M0Y A;  4M77 F;  2X4X A;  1NZ9 A;  3QHS A;  1X43 A;  4M77 E;  5IAY A;  3M5A A;  4EMH A;  1VYT A;  2MMP A;  2LC4 A;  4ANJ A;  2GBQ A;  4IUR A;  4PKC C;  3CCL T;  5CK9 A;  4C0D B;  2KDS A;  1Z9Q A;  4O6J A;  2QTX A;  5EC7 A;  1H8K A;  2CP3 A;  4LNP A;  2VC8 A;  3PIO A;  2A36 A;  5GMK e;  1MND A;  5FU6 C;  3JB9 I;  5CCA A;  5I2M A;  1YHQ Q;  2P0Q A;  2HQH A;  4RG2 A;  4J5Y A;  1PG5 B;  2Y90 A;  3OS0 A;  4QQG A;  3L2U A;  3GPL A;  1OZ2 A;  1WQW A;  3H6Z A;  1RI9 A;  1PKT A;  1VQO A;  4A4E A;  2KMT A;  4QQD A;  3WVE B;  1PC0 A;  3WVD B;  3RES A;  2O2O A;  4CC4 B;  2QEX T;  3MCA B;  1B07 A;  3SWN B;  4M78 D;  4Z02 A;  1MV3 A;  2KT8 A;  4OMO A;  5GAM f;  1Q81 R;  1K8A C;  4LD6 A;  1VQP A;  2E6N A;  1A0N B;  4QQ6 A;  2EQK A;  3JCM W;  5IN1 A;  1VQM T;  1JXO A;  1Q7Y U;  5DY9 A;  3M4G A;  1VQ9 Q;  4J7F A;  2EJF A;  3CBM A;  3VV0 A;  4AFZ C;  2ZGW A;  4JZ3 A;  4C5G A;  1VQ9 T;  5HCK A;  1W70 A;  1QLY A;  2KYM A;  3EG9 A;  4XK8 E;  5D7U A;  3VS0 A;  3OMG A;  5GAN 3;  4IIO A;  3LH5 A;  3MPU B;  2JTF A;  2LX9 A;  2DTO A;  2K79 A;  3HP9 A;  4JDS A;  2PVG B;  1BCM A;  4XU0 A;  3M54 A;  5KE3 A;  4YTL A;  3C12 A;  3QWX X;  4AFU C;  3THK A;  3OYY A;  1YJ9 A;  2QA4 T;  3OB9 A;  2O9S A;  1CKA A;  2RH2 A;  3CC2 Q;  3NMZ C;  2YHT A;  5GAO r;  3EGX B;  1AWW A;  1I07 A;  2HL5 C;  2J05 A;  1KG1 A;  1HXD A;  2FZK B;  5GAN f;  5GAN 7;  1KQ2 A;  1UGS B;  2LQW A;  3NGP A;  1YJ9 T;  4LD9 K;  1OV3 A;  1NBE B;  4ZNX A;  2RQR A;  3UWN A;  2DM1 A;  4JS4 A;  4Y91 A;  2FEI A;  2A0F B;  4OMP A;  4DA4 A;  6AT1 B;  2K5I A;  2DRK A;  2BZY A;  4M7D D;  1I8F A;  1RAF B;  5GAN d;  5GMK i;  4XQ3 A;  2DFU A;  3LGL A;  5GAN h;  1ARK A;  2DYB A;  2KRN A;  4DEY A;  5I2S A;  3LWH A;  2ZPH B;  2JMA A;  2M1H A;  2P0P A;  2WAC A;  2DEU A;  3A1P A;  2P84 A;  4HVU A;  2CP6 A;  2XDD A;  2B8A A;  3EGD B;  1YJN Q;  1NM7 A;  3I55 Q;  3TSZ A;  3OW2 S;  2RHY A;  2NUT B;  1JJ2 A;  2EQM A;  4PNO A;  4J9E A;  3RBB B;  1RAC B;  4JRP A;  3GNF B;  4FT2 A;  2JTM A;  3R6O A;  4E47 A;  5CVI A;  2JXB A;  3CMA Q;  5DLO A;  1NJI R;  5M9O A;  1YCS B;  1MMA A;  3EFO B;  3CC2 A;  3HRU A;  1WX6 A;  2V1Q A;  4C5H A;  3UPU A;  3JCM g;  2E64 A;  1VIE A;  4EMG A;  2JTE A;  1ZUK A;  3X24 B;  3CD6 Q;  1WLP B;  1KSW A;  2BIV A;  4CC7 A;  3OBY A;  3I55 T;  1OOT A;  3OS5 A;  5IHN A;  3QUI A;  4FSS A;  1WPY A;  2RHZ A;  5KYY A;  2QAS A;  1PKS A;  1Q82 U;  3JRZ A;  5LJ5 g;  2YUN A;  5AT1 B;  1T0J A;  2QQR A;  2COZ A;  4M7A A;  1SG5 A;  1QCF A;  3UT1 A;  2LQK A;  3DKM A;  1VQ4 A;  5IH2 A;  5GAN 5;  2PU9 B;  3CMA T;  1TTH B;  4JRI A;  1M2V A;  3JB9 D;  4C92 B;  5LJ3 d;  1VQ7 T;  1VOM A;  4DQ2 A;  2HMA A;  2FO0 A;  5J3B A;  2RJE A;  2LJ3 A;  1RAA B;  2YLC A;  2CYZ B;  2RI2 A;  4KRT A;  1WA7 A;  2COW A;  2EBP A;  1VUB A;  3ULR B;  4HCB A;  1ZHI A;  5A0D A;  3I55 A;  3JCM Q;  1B34 B;  2DAQ A;  3I56 Q;  5I11 A;  2PUK B;  1YJW T;  2J7I A;  4QVD A;  2OAW A;  2XDB A;  1K9A A;  3FC3 A;  2LX7 A;  3CC7 Q;  1WHM A;  1KHI A;  4PFP A;  2NWM A;  3RR6 A;  4ELZ C;  9ATC B;  2E65 A;  3QDR B;  3FLG A;  5IHI A;  1SHG A;  3VKI A;  4XTY A;  3L2W A;  3CCM Q;  1X75 C;  3CCE T;  3M0Q A;  1GL5 A;  2ZAE A;  4FL6 A;  5GAM h;  3I5R A;  1ZSZ C;  1GCQ A;  5KYX A;  5CO7 A;  2JT4 A;  4M77 B;  2QI2 A;  1Q7Y C;  2DL5 A;  2OTL T;  1W1F A;  2ED0 A;  1HD3 A;  4RCB A;  5D6X A;  1T0H A;  3LLR A;  1CSK A;  1S72 T;  2KYB A;  1WHL A;  1K0X A;  2LT4 A;  3EG3 A;  2AK5 A;  3RMQ A;  2DXT A;  4M75 B;  1AT1 B;  1MMG A;  1ZA2 B;  2D1X A;  1ZUY A;  1M2V B;  4ME7 A;  4KGZ B;  4BI3 A;  2DEQ A;  5KYW A;  2MPX C;  3CME A;  2KSS A;  2EJ9 A;  1JBM A;  4Z8A A;  2EPD A;  1G83 A;  2F5T X;  3CD6 A;  2MAM A;  2O4X B;  3V7S A;  3OYD A;  4BD3 A;  2HQX A;  1YIJ Q;  1FYN A;  4F04 B;  1BIB A;  1M90 R;  1G3T A;  2EQJ A;  4OGE A;  2A08 A;  2LNH B;  2CSI A;  2GQV A;  3RKY A;  1E6G A;  1C0M A;  2LJ1 A;  1UUE A;  3N5B B;  2OTL Q;  4KUD K;  4CRI A;  1SF9 A;  2LJ0 A;  2HZY A;  3O5Z A;  2FZG B;  1N8R U;  2LRQ A;  3G6E Q;  2H3J A;  4JPB W;  1K9M C;  5KH6 A;  1YI2 Q;  1KQ1 A;  4A4H A;  5LJ3 g;  3CCR A;  1R77 A;  2HAX A;  3FRN A;  3JB9 F;  5HK3 A;  2E70 A;  5GJV B;  1VQL T;  3PT9 A;  4PJO F;  2DVE A;  3EAE A;  5L23 A;  3VYH B;  3CCE A;  3OYB A;  3G71 A;  3RUX A;  1UE9 A;  5GAN 2;  3TCJ A;  1X2K A;  1S1N A;  5EG2 A;  3CME Q;  4F16 A;  3CC7 A;  4M78 A;  2J06 A;  4OMM A;  1U06 A;  2HDA A;  1OUL A;  1UEB A;  3CBP A;  1YHQ A;  3CBO A;  2VB6 A;  4M78 G;  2MK5 A;  2HL3 A;  3S3M A;  4AMC A;  4M7D E;  2OJ2 A;  3JSC A;  4XTW A;  1YJN T;  3V7C A;  3FJ5 A;  3KFV A;  3TQ7 P;  1QP3 A;  1WJQ A;  3G4S A;  2X3W D;  5KYN A;  3CC4 T;  3TEE A;  3EG0 A;  1Y07 A;  2CKK A;  1HK9 A;  2E41 A;  3UF4 A;  3A98 A;  3VS6 A;  5IHK A;  3L1A A;  1K73 U;  2L3P A;  2W0Z A;  2EGA A;  2L2P A;  1PSF A;  3QPH A;  2JJ9 A;  1PD1 A;  8ATC B;  3CPW P;  1VQ8 T;  2CUD A;  2DBK A;  3PTA A;  4XTV A;  1K1Z A;  4II1 A;  2E6Z A;  1M1K U;  7AT1 B;  1GBR A;  1IO6 A;  1YN8 A;  2DKG A;  4GY5 A;  2PVD B;  1ZLM A;  4RTY A;  4PLI A;  5GMK m;  2KEA A;  4J6X A;  3Q1J A;  4M7D A;  2LZ6 B;  4B9W A;  2DL3 A;  2R5A A;  3EGX A;  3VS7 A;  1TOV A;  4FU6 A;  1K73 R;  1YP5 A;  2DPP B;  2G3R A;  5CR2 A;  4EPC A;  3GF5 A;  4M78 E;  3MEA A;  1UHC A;  4E7H A;  3CCQ Q;  5GAO n;  4C5I A;  3UDC A;  1VQ4 T;  1M30 A;  3DB4 A;  2HD0 A;  2RNA A;  2RA2 A;  4X1V A;  1N9R A;  1GFC A;  2XHC A;  2C06 A;  3J81 E;  1K4U S;  4M7D F;  4O5V A;  2O4X A;  2FPD A;  2DTH A;  1OZ3 A;  4C0F A;  2JOY A;  1K9M U;  2E1H A;  4C8Q G;  4LN2 A;  3JAM E;  2V8I A;  2LCL A;  2EWN A;  4OP0 A;  2DL7 A;  2EAY A;  4LUD A;  1W2B P;  2DXC A;  1G5V A;  4KGV B;  5FLX E;  2RK1 A;  2LCC A;  1ABO A;  2DE0 X;  1Y96 B;  2VGN A;  4C92 C;  3CCJ Q;  1AZE A;  1OI1 A;  1V76 A;  1V1C A;  3OS1 A;  4FM4 B;  1ZUU A;  5CQY A;  1BB9 A;  2KRM A;  5CKH A;  1E7O A;  3CCR Q;  1K9M R;  3OMC A;  3A8M B;  4C8Q A;  5FRN A;  2DMO A;  1IRX A;  1WHH A;  1SEM A;  2ABL A;  4FCY A;  3SB2 A;  3URG A;  4HT8 A;  1F1B B;  4RCC A;  1BU1 A;  2GQI A;  2VXE A;  4IUP A;  2CZ7 B;  3C95 A;  3X20 B;  1Y71 A;  2DL4 A;  1G3S A;  1G3Y A;  3CCU Q;  4E7K A;  3CPW A;  2E3I A;  2SRC A;  4M7D C;  3FB9 A;  2KGT A;  4J9I A;  2CDT A;  1OEB A;  2MCN A;  2COY A;  4A63 B;  3CCE Q;  4Y28 E;  4JJN K;  2BE9 B;  1YJ9 Q;  3QO3 A;  1W2B A;  4PJM A;  3EGD A;  2V8K A;  1VQ6 Q;  1U3O A;  4M78 B;  1Q81 U;  3HFN A;  3V8L A;  3OY9 A;  4PFZ A;  1QW1 A;  1UTI A;  3MEV A;  2IPO B;  4D8D A;  2K2V A;  5I22 A;  5LJ3 j;  2X9H A;  2EYZ A;  3SWN C;  2DTI A;  1CKB A;  4QT7 A;  4ESR A;  4PJO E;  1YWP A;  3VS5 A;  3M53 A;  5GAO p;  2RHU A;  5GMK j;  1N5Z A;  1Q81 C;  4MML A;  2DA9 A;  2JS2 A;  1GBQ A;  5IXF A;  1VA7 A;  1O9S A;  4C92 A;  5FRO A;  1QVG A;  1QVG P;  2QA4 A;  4F7U G;  1JQQ A;  2AIR B;  4DOW A;  2KT1 A;  3EHQ A;  1JJ2 S;  3CPW S;  3QZ5 B;  1OPL A;  1VQM Q;  2YT6 A;  4PK4 A;  5CKB A;  2KNB B;  1VQ7 Q;  3S3N A;  3MHX A;  2L3R A;  2GGR A;  2VV5 A;  3MP1 A;  2AZS A;  2HKN A;  2YUP A;  3H8Z A;  4DOV A;  2RQV A;  2RQT A;  4X9C A;  1M1K C;  2E5K A;  4J7I A;  1PM3 A;  4NS5 A;  4PL6 A;  1KQS A;  1UHF A;  2JUF A;  1NEB A;  1WXB A;  1ACM B;  4C92 D;  2BUD A;  1H3Z A;  2QDL A;  5CAI A;  2DYI A;  4Q5W A;  1ABQ A;  1W6X A;  2A28 A;  1VQ6 T;  4R55 A;  4M77 A;  4M77 D;  2MWP A;  2GF7 A;  1BBZ A;  1TXQ A;  2R58 A;  4XTZ A;  2G6F X;  1VQN A;  2DET A;  1X6O A;  1QKW A;  1OYX A;  1D0X A;  4R0K A;  3U23 A;  1VQP T;  2RO0 A;  4F7U E;  4N4G A;  1LOJ A;  1QCO A;  1XNI A;  2QEX A;  2QDY B;  2CGH A;  2VGM A;  3P8H A;  4OVA A;  5LJ3 f;  3SWN A;  1VQO T;  1GRI A;  3S6W A;  2CH4 W;  5GAN g;  1OPK A;  1MHN A;  2HBP A;  1RAD B;  4E7Z A;  2PTK A;  4JJD A;  2DZ9 A;  4RTX A;  3E9G A;  1AHJ B;  3CXC P;  4L5G A;  2IVW A;  3CPF A;  3EG1 A;  2DK3 A;  4HVW A;  1KQS P;  2EFI A;  4PJL A;  3R6N A;  1QWF A;  1KQS S;  3BY7 A;  2DD5 A;  2EGC A;  3A8G B;  2XMF A;  1WNL A;  1VQN T;  1KC8 C;  1KC8 R;  2DD4 A;  2XKO C;  1LNX A;  5GMK l;  4M75 E;  2NUP B;  2XG8 D;  2F2V A;  1R0C B;  3OYF A;  4LUE A;  4M7A C;  1HYO A;  1Q86 U;  4E2F B;  1M1F A;  1AZG B;  3CC4 A;  2DBM A;  1YI2 A;  2CZ0 B;  2EQU A;  1VIF A;  1YJW Q;  2EYY A;  1X27 A;  4NL2 A;  1YJN A;  3PE0 A;  3GIB A;  4LDY A;  4C92 F;  2CT3 A;  5CQX A;  1WJS A;  1U8R A;  4Z88 A;  1PCX A;  1KC8 U;  2JM8 A;  5LJ3 e;  2DZC A;  4C8Q B;  3MP6 A;  3QG1 A;  5L8R E;  3V8K A;  5ECA A;  2HBW A;  3TVT A;  3ZL7 C;  2ROL A;  1Q86 R;  3D7S B;  3CMA A;  3V8J A;  1RAE B;  3EFS A;  1NLO C;  2C0T A;  2VUB A;  4OGC A;  3EH2 A;  4C0D C;  3H9N A;  5FW9 A;  2OI3 A;  2ATC B;  3BDU A;  2PQW A;  3HRT A;  4OF1 A;  2JZ2 A;  1VQL Q;  3FEO A;  4ZTF A;  1NEG A;  2QA4 Q;  2WSF E;  2DVJ A;  2P0K A;  1NYG A;  2RJF A;  4GLM A;  1EFN A;  2IG0 A;  1JJ2 P;  4E7S A;  1SHF A;  2QQ9 A;  1VQK A;  2K4Y A;  1TUC A;  1M90 U;  2BKD N;  1M4Z A;  5LJ5 h;  4C8Q F;  4HCZ A;  3CME T;  2M9U A;  2F1L A;  3CCL Q;  1GCQ C;  2E10 A;  1UFF A;  1BKB A;  4HXJ A;  4C92 E;  3QII A;  2PZ1 A;  1X01 A;  4M75 A;  1WXU A;  3GOX A;  3QJ6 A;  3JCM J;  2MWO A;  4ZTJ A;  2V26 A;  2PNI A;  4BI8 B;  3OYL A;  3L2Z A;  3JB9 G;  3OSV A;  4BDY A;  4TVR A;  1YNZ A;  2OAU A;  4LDU A;  2RB6 A;  1N8R C;  3INZ A;  2LCS A;  4PJO D;  2FG0 A;  3FIF A;  3E9F A;  1FMK A;  5LJ5 f;  2KE9 A;  1AWX A;  4JLG A;  2GTJ A;  5GAM e;  3OYN A;  2NUT A;  1D09 B;  4RTU A;  5J39 A;  4XU1 A;  2GTO A;  3LWI A;  3WXM B;  3A8H B;  4M7A E;  3M0S A;  4N4H A;  4DBF A;  3SHW A;  4M7A D;  3X28 B;  1N9S A;  2RJC A;  3J80 E;  1TSF A;  2KXC A;  3CCQ T;  3JCM f;  4DBR A;  1PRL C;  2ZPG B;  1WYX A;  2QGF B;  2EKO A;  1H3H A;  1KFZ A;  3RNJ A;  1PSE A;  2K7A A;  1ZSZ B;  1TUG B;  1WXT A;  1NPP A;  2DIG A;  1TUD A;  3L42 A;  1MUZ A;  3C4S A;  4PJO C;  5GAN j;  5GAM d;  2EQI A;  2OTL A;  4PJJ A;  1NG2 A;  1M2O A;  3JCM h;  3G7Z A;  2K5F A;  4WF2 A;  1QVF S;  5HK0 A;  2KI7 A;  4A54 A;  1OQK A;  2K3X A;  2RJD A;  5KCO A;  1RLQ C;  1M9S A;  1M27 C;  2EW3 A;  1JO8 A;  3OA6 A;  2CP5 A;  2J6F A;  1UEC A;  2L3Q A;  3LW5 E;  2ZPF B;  2FB7 A;  4KH0 B;  1RI0 A;  1KIK A;  1N6A A;  4M77 C;  2L89 A;  1M8V A;  4MZT A;  2JVV A;  4FSX A;  2H3E B;  1IZ6 A;  1KK7 A;  1RLP C;  4MZP A;  2I0N A;  1OX9 A;  3E19 A;  2XU8 A;  3H0F A;  2ZPI B;  3PMI A;  3CCV A;  1V29 B;  4ZN1 A;  2QTV A;  2DF6 A;  4C0G A;  3L2R A;  2GFU A;  1Q82 C;  1VQ5 A;  2F5K A;  4B9X A;  3OBW A;  3TRE A;  3A8O B;  3ZEH A;  3DLM A;  4JUV A;  1QP2 A;  5LJ3 h;  4C5E A;  2R57 A;  4EMK C;  3CCQ A;  2JM9 A;  3CC2 T;  5GMK h;  2X51 A;  3RKX A;  4PJO B;  2QQA A;  1NPR A;  2LMJ A;  2QYZ A;  1ZSZ A;  1LCK A;  3OYG A;  3VRY A;  1I4K 1;  3SFM A;  2D0Q B;  5D6W A;  4FW2 A;  4A4K A;  2O01 E;  2D0N A;  5J26 A;  2FHD A;  5CKF A;  1VYU A;  3RMS A;  5A0G A;  1PNJ A;  4XU3 A;  5CKD A;  2QGG A;  2I2L A;  3ER0 A;  3VS3 A;  5CKE A;  3VJP A;  3CEY A;  3V7R A;  4R56 A;  2ZCF B;  2KRS A;  2YLB A;  2CP7 A;  2VVK A;  2LNV A;  2LP5 A;  3PIP A;  1ZBJ A;  1VQO Q;  2CH4 A;  4ZN3 A;  5FU7 B;  4JRK A;  5GAN 8;  1B34 A;  5D6Y A;  4N0A A;  1XJW B;  2EGE A;  4OB3 B;  1BCO A;  2DO3 A;  4BUG A;  4K11 A;  4ZGJ B;  4BDZ A;  1NJI U;  3SEM A;  3UAT A;  4E6R A;  2M02 A;  2RHX A;  1PWT A;  2LDM A;  5GAM g;  1VQN Q;  4KH1 B;  5C6S A;  1WI7 A;  2XID A;  4LE9 A;  3CCV T;  1PHT A;  2ROT A;  1QCN A;  3GNG A;  4FYW B;  3PNW C;  1S72 Q;  4OB1 B;  2QEX Q;  4WTO B;  1KJW A;  1VQ5 Q;  3VUB A;  3CXC A;  1B7T A;  2PUO B;  3EG9 B;  1MMD A;  5FWB A;  3OYI A;  1NLP C;  4RMO A;  2KBT A;  2F69 A;  5KE2 A;  2ENM A;  1M90 C;  1UDL A;  2H8H A;  1X6B A;  4RTW A;  1IHW A;  1OX8 A;  4BI4 A;  5FRM A;  2DL8 A;  1VQP Q;  2MI6 A;  3AT1 B;  4HT9 A;  1ZA1 B;  2FL7 A;  2Y4X A;  2NLU A;  3I35 A;  1BI3 A;  1SSH A;  2MYS A;  2QQB A;  4MMK A;  3PVQ A;  3QDF A;  1AWO A;  1GFD A;  3EG2 A;  2RM4 A;  3OYE A;  2HNI A;  3JB9 H;  3GLX A;  1YI2 T;  4FYY B;  4M75 G;  3QKJ A;  4JLI A;  1VQM A;  5KYX B;  3JV3 A;  2A7Y A;  4BB7 A;  2AKK A;  3CCS T;  3MET A;  2AHJ B;  2SEM A;  3QBY A;  2RQW A;  3X26 B;  1U1S A;  2AKL A;  1Y7X A;  2VKN A;  1K8A R;  2DIL A;  4LXC A;  3QYG B;  1NE8 A;  1XOV A;  2PVO B;  2RMO A;  2D6F A;  2L5Q A;  4X34 A;  1OU8 A;  4PJN A;  5I21 A;  1UGQ B;  2HSP A;  3MP8 A;  2DJZ A;  3P8D A;  1TG0 A;  4RTZ A;  3OYA A;  2V8J A;  2LQN A;  4JJB A;  2K5L A;  2LTO A;  1TS9 A;  1SKU B;  2D9T A;  1MV0 B;  5LL6 S;  4RTV A;  1BIA A;  1IHV A;  1SRL A;  3REB B;  2MF2 A;  3KBG A;  2P4R A;  2E4H A;  1Q82 R;  2OTJ A;  3G71 Q;  1Z9Z A;  2YUQ A;  1RL2 A;  3CCL A;  1IXD A;  1XTD A;  1I5L A;  4XTX A;  1Y96 A;  2AZV A;  5KYU B;  3LH0 A;  1NYF A;  2FVU A;  2AT1 B;  2LQ8 A;  2M16 A;  2YRV A;  2A37 A;  5FU6 B;  3NFC A;  3EHR A;  4KUI A;  2M0O A;  3JCM d;  1YWO A;  2E12 A;  3HSB A;  1H64 1;  3IQL A;  1EZZ B;  2HSE B;  1VQ4 Q;  3RER A;  1G3W A;  1RAG B;  3ME9 A;  2VWF A;  4CC2 A;  2QG9 B;  4N4I A; 
#chains in the Genus database with same CATH homology
 3OYK A;  4M77 B;  1UB4 A;  2VUB A;  1S72 A;  4MDX A;  2QI2 A;  4OGC A;  1Q7Y C;  2OTL T;  4KUL A;  2P4T A;  3CCM T;  4RCB A;  4M7D B;  2WSC E;  4C0D C;  5D6X A;  3JCM c;  3OW2 A;  2X4Y A;  4M75 C;  3LLR A;  3CCS A;  3X25 B;  1S72 T;  1GXI E;  1K8A U;  3BDU A;  3HPW A;  2PQW A;  4XAX B;  3HRT A;  4OF1 A;  2JZ2 A;  2LT4 A;  3FEO A;  4ZTF A;  3RMQ A;  2DXT A;  2DXU A;  3NTH A;  4V2S A;  4M75 B;  4EDU A;  4KT0 E;  1M1G A;  1ZBX A;  2WSF E;  3LYI A;  2P0K A;  1JB0 E;  4E7I A;  4ME7 A;  2GCX A;  5HKC A;  4BI3 A;  1U1T A;  2RJF A;  4MDW A;  2IG0 A;  2JN0 A;  4C92 G;  4BE2 A;  2VXF A;  2DEQ A;  2X4J A;  4UC4 A;  2EJG A;  2QQ9 A;  3CME A;  2KSS A;  1YCY A;  2EJ9 A;  2K4Y A;  2XDP A;  3SD4 A;  1JBM A;  3VYG A;  3M4Y A;  4J6Y A;  3TU4 K;  2RK2 A;  1M90 U;  5GAN 4;  2BKD N;  2QXF A;  1M4Z A;  2F5T X;  5LJ5 h;  4C8Q F;  3M56 A;  4HCZ A;  1R8O B;  3CD6 A;  2MAM A;  2O4X B;  3CME T;  3V7S A;  3OYD A;  3JCM b;  4BD3 A;  2M9U A;  3M55 A;  2HQX A;  4FIB A;  4M77 G;  4IUU A;  1BIB A;  2RI3 A;  1G3T A;  2EQJ A;  4EMK B;  4OGE A;  2KAF A;  2E10 A;  4BY6 B;  1BKB A;  4C92 E;  2GQV A;  3RKY A;  3QII A;  1X01 A;  3N5B B;  4M75 A;  5IT9 E;  3NTK A;  4KUD K;  3GOX A;  4CRI A;  3QJ6 A;  1XQH A;  2KK4 A;  3LX7 A;  3JCM J;  1KD1 C;  2MWO A;  1KHC A;  2RHI A;  3SDZ A;  4ZTJ A;  1N8R U;  3ZFJ A;  2LRQ A;  3CCM A;  3ASK A;  3QXE B;  2H3J A;  4RKU E;  4BI8 B;  3OYL A;  3L2Z A;  5KH6 A;  3JB9 G;  1K9M C;  3OSV A;  4J8O A;  4BDY A;  4L59 A;  1KQ1 A;  4A4H A;  4TVR A;  5LJ3 g;  5GAM j;  4J6W A;  2OAU A;  3LGF A;  3G4S T;  3CCR A;  2XIC A;  3CCU A;  3JCM X;  2HAX A;  4LDU A;  2RB6 A;  3FRN A;  1N8R C;  3INZ A;  4PJO D;  3FIF A;  2EYQ A;  3E9F A;  3HL8 A;  2FYK A;  2E70 A;  5HY6 A;  3ZBD A;  5HK3 A;  3OYC A;  1VQL T;  4M7A G;  3PT9 A;  4MZM A;  4PJO F;  2DVE A;  2EIF A;  4M7A B;  3EAE A;  5GAN 6;  5LJ5 f;  3VYH B;  1WQ7 A;  5A2Q E;  3CCE A;  2ZZD A;  4JLG A;  3OYB A;  4JS5 A;  3G71 A;  3RUX A;  4A4F A;  5GAN 2;  4X9D A;  5GAM e;  3TCJ A;  3OYN A;  2XD0 A;  3O8V A;  5EG2 A;  5J39 A;  1Q86 C;  4XU1 A;  3PFS A;  3CC7 A;  4XTU A;  4M78 A;  2E5Q A;  3LWI A;  3WXM B;  4OB0 B;  1UEB A;  3CBP A;  4M77 F;  1YHQ A;  2X4X A;  3A8H B;  3CBO A;  4M7A E;  4M78 G;  1NZ9 A;  4R55 A;  4N4H A;  4ZGE B;  3S3M A;  4M7A D;  3X28 B;  1I81 A;  1N9S A;  2RJC A;  4RG8 A;  3J80 E;  1D3B A;  1BI1 A;  3JCM f;  3QHS A;  4ZGD B;  3CCJ A;  1QVP A;  3CCQ T;  4M7D E;  2ZPG B;  4M77 E;  3OQ5 A;  5IAY A;  3JSC A;  2EKO A;  3M5A A;  3M9Q A;  4XTW A;  3V7C A;  4EMH A;  1YJN T;  1PSE A;  5GAN e;  1QP3 A;  1WJQ A;  3G4S A;  1VQ6 A;  5LJ5 j;  2MMP A;  2LC4 A;  5DLQ E;  5KCH A;  4IUR A;  4PKC C;  3L2Q A;  1NPP A;  3TEE A;  5CK9 A;  3CC4 T;  3CCL T;  1YIJ T;  3RIR A;  1VQ9 A;  2DIG A;  4NL3 A;  4C0D B;  2KDS A;  1Y07 A;  3L42 A;  2CKK A;  1HK9 A;  2E41 A;  2JNG A;  4O6J A;  1YIT T;  2QTX A;  3C4S A;  4M7D G;  4PJO C;  4GLK A;  1WGS A;  4C8Q E;  3L1A A;  1K73 U;  2VC8 A;  3PIO A;  5GMK e;  5GAN j;  5GAM d;  2K57 A;  1PSF A;  3QPH A;  5FU6 C;  3JB9 I;  3CCJ T;  1VQ8 T;  5CCA A;  5I2M A;  2OTL A;  2XI9 A;  3PTA A;  4XTV A;  4QVZ A;  3JCM h;  2P0Q A;  4II1 A;  3G7Z A;  2K5F A;  2CZ1 B;  3A5Z B;  4WF2 A;  2E6Z A;  1QVF S;  4RG2 A;  3BW1 A;  4J5Y A;  4A54 A;  5HK0 A;  2Y90 A;  3OS0 A;  1QVG S;  4QQG A;  2K3X A;  3L2U A;  2RJD A;  4J83 A;  1QVF A;  3OS2 A;  1OZ2 A;  3GPL A;  5KCO A;  2DKG A;  4GY5 A;  1WQW A;  1M9S A;  3H6Z A;  3JCM e;  1VQK A;  2PVD B;  2KY9 A;  1VQO A;  3BFM A;  2KMT A;  4A4E A;  4QQD A;  1WJR A;  2HQE A;  4PLI A;  3WVE B;  5GMK m;  3OA6 A;  4J6X A;  3Q1J A;  4M7D A;  4M78 F;  3WVD B;  4OB2 B;  3RES A;  3LW5 E;  2QEX T;  4B9W A;  2A3L A;  2ZPF B;  2R5A A;  3MCA B;  1EIF A;  2X35 A;  1VQ6 T;  2FB7 A;  4FU6 A;  1FX7 A;  1RI0 A;  3SWN B;  4KBM B;  4M78 D;  4Z02 A;  2DPP B;  1N6A A;  2G3R A;  5CR2 A;  4EPC A;  3GF5 A;  2L89 A;  4M78 E;  4M77 C;  3MEA A;  5GAM f;  1M8V A;  1UGP B;  4E7H A;  4MZT A;  3G6E A;  1K8A C;  2JVV A;  3CCU T;  4FSX A;  4LD6 A;  5GAO n;  1KQS S;  4C5I A;  1IZ6 A;  3MEU A;  3UDC A;  1VQ4 T;  2E6N A;  1VQP A;  3DB4 A;  4MZP A;  4QQ6 A;  2HD0 A;  3T9N A;  2RA2 A;  1N9R A;  2XHC A;  2EQK A;  2C06 A;  3JCM W;  1VQ8 A;  5IN1 A;  3J81 E;  1VQM T;  1Q7Y U;  5DY9 A;  3E19 A;  3M4G A;  4PJO A;  2XU8 A;  4J7F A;  4N0A C;  4M7D F;  2ZPI B;  3PMI A;  4O5V A;  2EJF A;  3CBM A;  3VV0 A;  3KXT A;  3CCV A;  2O4X A;  1V29 B;  3PMT A;  4A53 A;  1TH7 A;  2ZGW A;  4ZN1 A;  3JB9 F;  5CIU A;  4C0G A;  3JB9 J;  3L2R A;  2DTH A;  1OZ3 A;  2GFU A;  4C5G A;  1Q82 C;  1VQ9 T;  4C0F A;  2JOY A;  1K9M U;  2E1H A;  1VQ5 A;  2F5K A;  4C8Q G;  4M7A F;  4B9X A;  3JAM E;  2V8I A;  2LT1 A;  2LCL A;  3OBW A;  2EWN A;  4OP0 A;  4XK8 E;  3TRE A;  2EAY A;  3A8O B;  3OMG A;  3ZEH A;  2DXC A;  5GAN 3;  4F7U B;  4QVC A;  1YHQ T;  3DLM A;  4JUV A;  1QP2 A;  5LJ3 h;  1G5V A;  3G6E T;  1DJ7 B;  2JTF A;  5FLX E;  1LJO A;  2LX9 A;  2RK1 A;  4C5E A;  2DTO A;  2LCC A;  2R57 A;  3HFO A;  4C0Z A;  3GP8 A;  4EMK C;  3CC7 T;  2DXB A;  3CCQ A;  3J7A F;  1Y96 B;  2VGN A;  3HP9 A;  4JDS A;  4C92 C;  2PVG B;  3CC2 T;  2DIQ A;  5GAO l;  1OI1 A;  3M54 A;  4XU0 A;  5KE3 A;  5GMK h;  3G71 T;  4ATO A;  1ZQ1 A;  3RKX A;  4PJO B;  2QQA A;  1IRE B;  1NPR A;  4YTL A;  3OS1 A;  4FM4 B;  3C12 A;  5CQY A;  5CKH A;  4M78 C;  3OYG A;  3OYY A;  3OMC A;  1YJ9 A;  3A8M B;  2QA4 T;  1FWZ A;  4C8Q A;  2QQS A;  1I4K 1;  3SFM A;  2D0Q B;  5FRN A;  3OB9 A;  3DB3 A;  5D6W A;  2RH2 A;  4A4K A;  2O01 E;  2YHT A;  5J26 A;  2FHD A;  3SB2 A;  5CKF A;  3URG A;  5GAO r;  1M1K U;  2K3Y A;  2RD1 A;  3RMS A;  4RCC A;  5A0G A;  4XU3 A;  5CKD A;  4HT8 A;  2VXE A;  3HRS A;  4IUP A;  1KG1 A;  2I2L A;  2CZ7 B;  3C95 A;  1HXD A;  3X20 B;  1Y71 A;  3ER0 A;  1BI0 A;  3E1S A;  1G3S A;  1G3Y A;  5CKE A;  5GAN f;  4IKF A;  3VJP A;  4E7K A;  1YIT A;  3CPW A;  5GAN 7;  1KQ2 A;  3CEY A;  1UGS B;  2KQW A;  3V7R A;  2ZCF B;  4R56 A;  4M7D C;  3FB9 A;  1YJ9 T;  2YLB A;  1BI2 A;  4LD9 K;  3I56 T;  2LNV A;  3PIP A;  3EFR A;  4ZN3 A;  5FU7 B;  4JRK A;  3MO8 A;  5GAN 8;  5C0M A;  4Y28 E;  1O75 A;  1B34 A;  5LJ5 d;  4JJN K;  3QO3 A;  1W2B A;  1N27 A;  1FXX A;  5D6Y A;  3UWN A;  4N0A A;  2V8K A;  4JS4 A;  4OB3 B;  4M78 B;  4Y91 A;  1Q81 U;  2DO3 A;  3KUF A;  4BUG A;  3HFN A;  3M57 A;  3V8L A;  3OY9 A;  4DA4 A;  4C8Q C;  2K5I A;  4ZGJ B;  1QW1 A;  4BDZ A;  4CI0 C;  1NJI U;  3CD6 T;  3MEV A;  5LJ5 e;  4M7D D;  1I8F A;  5GAN d;  2RHX A;  2LDM A;  5GMK i;  2K2V A;  4XQ3 A;  5LJ3 j;  5GAM g;  3LGL A;  2OTJ T;  1NJI C;  5GAN h;  5C6S A;  2XID A;  4OMF B;  3SWN C;  5I2S A;  3LWH A;  2DTI A;  3CCV T;  3JCM P;  2X4W A;  2ZPH B;  4PJO E;  3GNG A;  2Y4Y A;  3M53 A;  2M1H A;  2P0P A;  2RHU A;  3PNW C;  5GMK j;  5GAO p;  4OB1 B;  3C94 A;  1Q81 C;  2WAC A;  4MML A;  3A8L B;  3S3O A;  4F7U F;  3VUZ A;  3VUB A;  3CXC A;  2PUO B;  2XDD A;  4HKE A;  4LDV A;  2B8A A;  3P8B B;  1K73 C;  3CXC S;  2L8D A;  1O9S A;  4C92 A;  3OYI A;  5FRO A;  3OW2 S;  1QVG A;  2QA4 A;  3QYH B;  4F7U G;  2RHY A;  5DM7 R;  2ZPB B;  1JJ2 A;  2EQM A;  4DOW A;  4RMO A;  4PJO G;  4BY6 C;  2F69 A;  1JJ2 S;  5KE2 A;  1M90 C;  2KVQ G;  3CPW S;  3QZ5 B;  4IUT A;  4PNO A;  4BAC A;  3M58 A;  5GAO q;  1JRI A;  5CKB A;  4BI4 A;  5FRM A;  4JRP A;  3S3N A;  3HKS A;  2MI6 A;  3GNF B;  4FT2 A;  4HT9 A;  3MHX A;  2JTM A;  3R6O A;  4E47 A;  2L3R A;  2GFA A;  5CVI A;  2VV5 A;  3MP1 A;  3H8Z A;  4DOV A;  2FL7 A;  3QJY A;  5DLO A;  5M9O A;  2ZPE B;  2Y4X A;  1KD1 U;  4X9C A;  2NLU A;  1M1K C;  3OYH A;  1BI3 A;  4J7I A;  3CC2 A;  2QQB A;  5FU7 C;  4NS5 A;  4PL6 A;  4MMK A;  3HRU A;  1VQ5 T;  1KQS A;  2JUF A;  3NTI A;  4C5H A;  1SSF A;  3UPU A;  4C92 D;  2BUD A;  3JCM g;  1H3Z A;  1MGQ A;  2E64 A;  5CAI A;  1VIE A;  4EMG A;  4QW2 A;  1YJW A;  2RM4 A;  3QZ9 B;  4HA8 A;  3PGG A;  3OYE A;  2HNI A;  3JB9 H;  3VU3 C;  3GLX A;  3I56 A;  1YI2 T;  4M75 G;  3X24 B;  4Q5W A;  3QKJ A;  2BIV A;  4JLI A;  1VQM A;  3OBY A;  3RKW A;  3I55 T;  3QSU A;  3AHU A;  2A7Y A;  3OS5 A;  2RI5 A;  3QUI A;  4BB7 A;  1WPY A;  4M77 D;  4M77 A;  1YBY A;  2MWP A;  3FJP A;  4NOY A;  4XU2 A;  5A0L A;  2XK0 A;  2RHZ A;  2GF7 A;  3CCS T;  3MET A;  4A4G A;  2R58 A;  1Q82 U;  4XTZ A;  3JRZ A;  3MEW A;  2AHJ B;  1VQN A;  1X6O A;  5LJ5 g;  1OYX A;  3OYM A;  2QQR A;  3QBY A;  5GAO m;  4M7A A;  3X26 B;  3UT1 A;  1U1S A;  2LQK A;  3DKM A;  1Y7X A;  1VQ4 A;  2RO0 A;  4F7U E;  4N4G A;  1LOJ A;  2PU9 B;  5GAN 5;  1XNI A;  2WSE E;  1VQP T;  4M75 D;  2QEX A;  3QYG B;  2QDY B;  2CGH A;  2VGM A;  3M59 A;  3CMA T;  3P8H A;  4OVA A;  4JRI A;  5LJ3 f;  1VQ7 A;  1NE8 A;  3OYJ A;  1XOV A;  3SWN A;  3JB9 D;  2PVO B;  1VQO T;  3S6W A;  4C92 B;  5GAN g;  5LJ3 d;  1VQ7 T;  2L5Q A;  2D6F A;  4X34 A;  1MHN A;  2HBP A;  4DQ2 A;  5I21 A;  4JRQ A;  1UGQ B;  3MP8 A;  4IUV A;  4FT4 A;  2DJZ A;  4D6W A;  2DZ9 A;  3OSS C;  4PLL A;  5J3B A;  3P8D A;  2RJE A;  1D3B B;  3E9G A;  1AHJ B;  4BE1 A;  4L5G A;  2YLC A;  3OYA A;  1VQL A;  2CYZ B;  2IVW A;  2RI2 A;  2V8J A;  3CPF A;  4VUB A;  2K5L A;  2LTO A;  3DLL A;  2DK3 A;  4P5N A;  3L2V A;  4E7L A;  2R5M A;  3CCR T;  4HCC A;  4M75 F;  1VUB A;  2EFI A;  4BE0 A;  4HCB A;  1P92 A;  4IUQ A;  1ZHI A;  2D9T A;  2DD5 A;  3BY7 A;  3JCM V;  3A8G B;  5LL6 S;  5A0D A;  3JCM Q;  3I55 A;  1B34 B;  2DAQ A;  4LDX A;  1WNL A;  1VQN T;  1KC8 C;  1BIA A;  2DD4 A;  3F70 A;  2XKO C;  1LNX A;  5GMK l;  4M75 E;  2PUK B;  1YJW T;  2XG8 D;  2MF2 A;  4QVD A;  3KBG A;  3OYF A;  2XDB A;  4M7A C;  2OTJ A;  4C8Q D;  2VYT A;  1Q86 U;  1M1F A;  3FC3 A;  1RL2 A;  1YIJ A;  3CC4 A;  3CCL A;  1XTD A;  2CZ0 B;  1YI2 A;  1W2B S;  1I5L A;  2EQU A;  1VIF A;  4XTX A;  1KHI A;  1Y96 A;  3LH0 A;  2FVU A;  4NL2 A;  1YJN A;  3GIB A;  2LQ8 A;  3BDL A;  2M16 A;  4EMK A;  4L6V 5;  3FDR A;  4LDY A;  2LVM A;  2YRV A;  4ELZ C;  4C92 F;  2E65 A;  5CQX A;  1WJS A;  3FLG A;  3QDR B;  5FU6 B;  1U8R A;  3NFC A;  3VKI A;  4KUI A;  1KC8 U;  2M0O A;  1VQK T;  5LJ3 e;  4XTY A;  4F7U A;  2DZC A;  4C8Q B;  3MP6 A;  3QG1 A;  5L8R E;  3V8K A;  3L2W A;  3JCM d;  1X75 C;  3CCE T;  1M5Q 1;  2E12 A;  4LDW A;  3HSB A;  2CS7 A;  4FL6 A;  1H64 1;  5GAM h;  1W4S A;  1UGR B;  1BYM A;  5AYF A;  3CMA A;  1G3W A;  4E7J A;  2CZ6 B;  3ME9 A;  3RER A;  3V8J A;  3HHT B;  3EFS A;  4ELY C;  4N4I A;  5CO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...