1YDEA

Crystal structure of human retinal short-chain dehydrogenase/reductase 3
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
250
structure length
250
Chain Sequence
GTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRASIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Retinal dehydrogenase/reductase 3
publication title Structural and biochemical characterization of human orphan DHRS10 reveals a novel cytosolic enzyme with steroid dehydrogenase activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 93
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ydeA00
5L7YA 2XAAA 4AFNA 3K9QO 3Q1LA 1ONNA 4PCVA 3KUXA 4MKXA 3BZUA 2JHGA 1HDZA 3QA9A 3Q6IA 2AQIA 4DUPA 3G17A 1UZLA 3G1UA 4LCJA 5DULA 3PRJA 3NDIA 4NR0A 4MVJM 1NBOA 3WBFA 1DJNA 1MXFA 1I3MA 5C7LO 2VHZA 3KYCB 4XQGA 2B5VA 2I5PO 4M8SA 5TGDA 1XSEA 4GSKA 1B15A 2GZ3A 4R1TA 4ESOA 5DZSA 4RDIA 3DEYX 4NBVA 3ZWNA 1R0LA 2FPGA 1DJQA 2O3QA 3L77A 1JVSA 1NXQA 4Z9YA 3SLKA 1ULUA 3EY4A 3JCZA 3DAPA 1XHLA 3E03A 3E18A 2J5RA 1BXGA 5JC8A 1XKQA 3QWAA 5B4UA 2NM0A 2NTNA 4WCFB 4UVDA 3C8MA 4GLOA 4FFOA 3ROQA 4FOSA 4BNHA 1R0KA 3PQFA 4CMKA 1H0KA 1B14A 4BHTA 5DCUA 3Q0EA 1NQ5A 3FCOA 5ADHA 2WYWA 1A9ZA 1QMGA 2HKIA 1J0XO 5H83A 1BDMA 4GAEA 1QG6A 1QYCA 5C3MA 4WGGA 1U28A 1N1GA 3OQBA 5GZ3A 5AVOA 4N54A 3ICCA 5BSEA 6LDHA 5U9CA 1RM5A 1HLPA 2VOJA 1WZEA 4GX5A 4IS2A 3GMDA 2J3IA 4ID9A 1IZ9A 2HO5A 2PV7A 2IYOA 3GEDA 3V1TC 2YHIB 1DRVA 4W82A 1A72A 2PGLA 1CRWG 3INGA 1HXHA 4CODB 2Y1DA 1B3BA 3WYEA 3WWZA 1O5IA 1HYGA 4TZTA 1Y8RA 2O3RA 5H82A 1M66A 4XRRA 3PLRA 3HN2A 3JV7A 5H81A 2UUPA 4DREA 1N1EA 5EMHA 3Q3CA 5ITVA 2IDZA 1Z82A 3LU1A 3I83A 3KB6A 4XGNA 3LT1A 3BMOB 1RM0A 3AY6A 4RPGA 3ZW9A 1UXHA 4BMSA 2OORA 3ONFA 4CM1A 4GLLA 4UVGA 1GZ3A 5DBGA 1YOVA 4PLTA 4B4UA 3WMWA 4PLGA 1V6AA 3F5QA 4PVDA 2BHLA 3RAJA 4CLRB 4M1QA 4F3YA 1NYTA 2Q2VA 4YT5A 1P3DA 3RSHA 1I01A 4J6FA 4UEJA 4RF3A 4NQZA 3X2EA 3ZNOA 3NKLA 2DKNA 2AQKA 2P9CA 4NH4A 1EDZA 3GH3A 2VWGA 5JO0A 1WAMA 2BGLA 3S8MA 1ZCJA 4BO4A 2Y1EA 4ALJA 3PDUA 4DLAA 1NQAO 4OOEA 5IFLA 2NVWA 4W7HA 1SC6A 4PN3A 4TKLA 3KLMX 5LDGA 2YYYA 3F3SA 4I5EA 3D3WB 4FJ0A 5JW6A 4DPKA 3GY0A 2E49A 3NT4A 3CH6A 1H6BA 2GO1A 4Z6KA 2PZMA 2F1KA 1WW8A 3VH2A 2QRJA 4KQXA 3CSDA 2GN9A 1Y81A 2XOXA 2Q3EA 5JMWA 3PEFA 3AM4A 5G0UA 2EF1A 4BO2A 1MG5A 3JD4A 3DWFA 4DWVA 4B8ZA 3OJLA 3TJRA 5IF3A 2A35A 4O5OA 1GFSA 3ZWBA 4HWKA 4UUOA 3H4VA 1NFQA 2NVUB 1DFHA 3GVXA 1JKIA 3I52A 1PGQA 4XD2A 3DTYA 2E6UX 5JCXA 1ZW1A 2QYSA 7MDHA 2JL1A 1Y5MA 3BYZA 4CMCA 5THQA 4BIIA 5A9RA 2W2LD 4GVXA 4GX0A 1B8UA 1Z7EA 1NP3A 3H5RA 3R3JA 4MP8A 1KC3A 1UZMA 1LRKA 1DRUA 4ZU3A 1LRJA 1U4SA 2AE1A 1PSDA 4IZIA 1DC4A 4A2CA 2VHXA 2P5UA 4ZHSA 1A7AA 4NNJA 4RLHA 4J3FA 1BHSA 4J7CA 2X0IA 3Q9NA 4EJMA 4RL6A 2PD4A 2VQ3A 1E7YA 2QW8A 1U3WA 4LK3A 3LC2O 3JD1A 2HMUA 2V6MA 3D4PA 4YJGA 2R6JA 2RHCA 3BTVA 1LSOA 3DZJA 4D46A 3HHPA 2IEDA 1PJSA 3GK3A 4GQAA 1DFGA 2FY8A 4OKIA 5IJZA 5JE8A 2IXBA 4JN6B 3VZSA 1HDYA 3ZV4A 3ZNNA 5CDSA 9LDBA 2SCUA 3K2BA 3X2FA 1Y6JA 1KERA 4AJ1A 4RJTA 4RQTA 1ZJZA 2G0TA 4KWIA 1XYGA 5TC4A 2GD1O 2WTBA 2OP0A 2EXXA 4WNCA 2VTEA 5THKA 2XXJA 3TSCA 5JY1A 4BL5A 2OBNA 1D8AA 9LDTA 1I2ZA 3N58A 3F47A 4CR6A 2E82A 1JKJA 3T7EA 4C7KA 2DLDA 2WD8A 3PFWO 4JQCA 3RC2A 1GD1O 1TT7A 1DC3A 3S55A 4YQZA 1QSGA 4CMAA 4PG8A 5B1YA 5L4NA 4UUPA 4PG6A 4J49A 4GGOA 2X0NA 3ZWPA 2HJRA 2QRLA 2Q99A 3VVCA 2C2YA 3NTQA 2VT2A 5DF1A 2CFCA 3EDMA 4IDCA 3TOXA 4NFHA 1Y9EA 1JAYA 3LC1O 1ENPA 4Q9NA 3PHIA 1G0OA 3ZW8A 5GZ6A 3FD8A 2DVMA 3GHYA 4WLNA 1OAAA 1W8DA 5COBA 1LDNA 2X6TA 1DIHA 1O9BA 2J3HA 2Y99A 2W98A 4BQRA 2PKQO 1WMBA 3CMMA 1O95A 4GPD1 3KVOA 3F6YA 1P33A 1Z75A 3EUWA 5BSGA 4IGEA 2FN7A 4OH1A 3SX2A 1EBUA 2GR9A 3HUDA 3U4CA 4XR9A 2VYVA 4QFCA 4GWKA 2YY7A 2EW2A 1YE3A 3SJ7A 1IPFA 3FF4A 3AW9A 2R00A 3SLGA 1VE9A 5DN9A 4XQ9A 2YV1A 3GFGA 3CZMA 4D79A 3ZWVA 1LDMA 1Q0QA 5F1KA 4WPGA 4B3JA 3OHSX 8LDHA 3QWFA 4JP3A 4GMFA 2Y1CA 5HA5A 3I9NA 1PJLA 2NTVA 3OSUA 3DFZA 4B4OA 4EUHA 2W4QA 1B3RA 4NK5A 3ZWAA 2FPPA 1NPTO 3OP4A 3INRA 4M54A 3R6DA 4ND5A 2EEZA 3DAFA 5B4TA 1U2GA 1DAOA 2DBVO 2P2SA 4FOOA 5DBFA 3CTMA 1BXGB 3ENKA 4PIVA 5A9SA 1UXJA 4WOJA 1WXDA 2AHRA 4RPKA 1C1XA 1EE2A 3WBBA 2ZTLA 2Y0CA 2EGHA 3E9QA 3MCVA 2X5KO 1C0PA 4PZCA 1HYHA 3SC6A 3I9KA 2ZQYA 3P2OA 3FNGA 1SB8A 4D45A 1OC2A 1T1SA 1I2BA 2W2KB 2Y1FA 1RKXA 4L0QA 4L4RA 3H8VA 4R3WA 4MP3A 1XU7A 2X4GA 2I99A 3WTBA 2JD2A 4BKQA 5KJ6A 2CSUA 4JBHA 2IE0A 2PD6A 3ZHXA 4QT0A 4BNZA 3BHIA 4IDBA 1B8PA 3VPXA 2RIRA 1ENYA 2DFDA 4M49A 4XX0A 4CJXA 3AFMA 4CQMA 4CLXA 3S2IA 2JD1A 4PLFA 3GZNA 4PLHA 3WGQA 4E2WA 3KTDA 5TJ9A 3FNEA 1XLTA 3A14A 3RJ9A 1QXSA 2X7HA 3U49A 1W0CA 3DTTA 2A9FA 5IZCC 4L76A 1X1TA 5JXWA 4PG7A 2EJWA 1XWFA 1G6KA 3OJEA 4S1VA 4I5FA 4I1IA 4RPLA 1Y8RB 4F6CA 1UP4A 1KC1A 4OXYA 2Q1UA 5FEUA 3ONEA 1GUZA 1H2BA 3JQ6A 3QWBA 2H63A 4TSKA 5BR7A 4YQYA 3BMNA 2PLAA 3GVCA 4ZQEA 3PPIA 5C7IO 4MDHA 2ZCVA 3UCXA 2BFPA 4B3IA 2D3TA 2Z5LA 3F1LA 5T8KC 1LTHR 3FPCA 3ITDA 4E3ZA 4KUHA 1YOVB 5JDIA 3AU9A 4UVEA 2UVDA 5AXCA 3U5TA 4KOAA 2UUOA 2RH8A 1Q7CA 3DZIA 3RVDA 3IS3A 2IZZA 1Y8QA 1XR3A 4EEXA 4PLWA 4BGEA 2J3JA 1U3TA 2Y68A 1JQBA 3TFOA 1VSUA 4QECA 2Q50A 1SNYA 4J0FA 4FFPA 5ENVA 3PTZA 4I9UA 2VUSA 1O0SA 1EQUA 3DZHA 3W6ZA 3DONA 3PYMA 4CM8A 1ZMOA 3WSVA 4LMRA 1GDHA 3AI1A 4R68A 2CVZA 2Q1WA 1T25A 4O6VA 3PJEA 4OXKA 4BNMA 3PYLA 2EW8A 2GDZA 4L73A 4X54A 5G4LA 1X14A 5KJ1A 1W73A 3E5RA 2BFOA 1U1IA 1P1IA 2PFGA 3GR6A 3C7AA 1YONA 4OQYA 1I33A 1EBFA 1GEEA 1PS9A 3N74A 4GKVA 5L53A 2B4TO 3MOGA 1X7DA 2GRAA 1BGVA 2JFFA 1QORA 1UDBA 3RC9A 3UCEA 4BKOA 1L7DA 1K6IA 4H16A 4GL4A 3OM9A 5AXDA 4NZ9A 3W8FA 2EP7A 4CQLA 3G1TA 3M2PA 4FBGA 3O8QA 4FS3A 1GYPA 4MVJA 5DOZA 1WZIA 2HMVA 1BWSA 4IDAA 4DA9A 2VRBA 3WR5A 1LQTA 4PLZA 5J23A 3NV9A 4NFSA 4YT4A 1PZFA 1S6YA 2CDAA 5KVSA 1Q7GA 1QLHA 3PI7A 3DHEA 4MO2A 5DP1A 5ENDA 3T4EA 4RZHA 1AN9A 4XB2A 1JWAB 1XGKA 3F5SA 3G49A 3K96A 2V6GA 2W90A 4ZQBA 1M6WA 2WM3A 1JTVA 4MOWA 3D5QA 1HETA 3ABIA 1ZKMA 1KVSA 1LNQA 4FR5A 4Q3DA 2UV8A 2X9GA 1ADBA 4EUFA 3QVSA 4E5PA 4A27A 3DXFA 3KV3O 3DL2A 2HQ1A 3OETA 5LC1A 3DBRB 2QX7A 1A5ZA 2IYPA 3A9WA 1E3WA 2JCVA 1IL0A 3PLNA 1PGNA 2C07A 2NU9A 3ASUA 4XCVA 1LDGA 2EERA 4YJGB 4HADA 4WLEA 3MJSA 2W8ZA 4G81A 3VZQA 1TT5B 4B4VA 4DBVO 1R0SA 1K6XA 5IDQA 4WASA 1DHTA 5LCXA 1HE3A 3FI9A 4EJ0A 3ONDA 4JXKA 4HP8A 4ZD6A 4YBZA 1MFZA 1MX3A 1A4IA 2O4UX 1NPDA 5L51A 4IGFA 5TLSA 1VJTA 2DPGA 2X22A 4HFJA 1ISFA 2NWQA 3UH1A 1P77A 1YB1A 3FPLA 1I32A 1P0FA 3PFFA 4JNKA 4BKRA 3H7AA 2WE8A 1VRWA 1XEAA 4Y67A 1NHWA 4Z0PA 1IPEA 1GEGA 4Y98A 5JMPA 4JJFA 1NVGA 1ORRA 1ZK4A 5JAIA 4H15A 3WNVA 4CMBA 4YVFA 5JYDA 4CV3A 3AUAA 1E3EA 3WJ7A 4PLCA 4Y6PA 3V8BA 2CVOA 2PGDA 4PLVA 1BVRA 1PQWA 1Z7BA 2BH9A 2Q1SA 3DO5A 1TB4A 2P9GA 3VDRA 4CMJA 3GPDG 4H3VA 4QEDA 3JQFA 1ONPA 1YJQA 2DFVA 4NDNE 4F45A 3TZHA 3WFJA 3UXYA 1GZ6A 2YFQA 5CHEA 4K9DA 3GHHA 4RVHA 5DOVA 4R16A 1KOLA 5ER9A 1M6HA 3VH1A 4CM7A 3JQ7A 4OHUA 2EV9A 3TNLA 3AJRA 1K89A 2AE2A 1LI4A 4AJ2A 3EVTA 1VL0A 3VVBA 2R2GA 3EK2A 4JBIA 1D1TA 2ET6A 4AJIA 3AM3A 1U5CA 3L9WA 1HE2A 1FF9A 3TN7A 1IYZA 4B79A 3ZHBA 4BO0A 4LCEA 3WOHA 1HT0A 1C1DA 4CM4A 3GAFA 4NBRA 5F1OA 2DTDA 2VZ8A 3I9JA 1AGNA 3MJCA 4A5OA 3L6OO 5K9ZA 3JQAA 4QO8A 4JLWA 3HB5X 1CETA 2GZ2A 2NNLD 3DQPA 1JA9A 4Y9DA 5BNTA 1ONOA 4GI2A 3HADA 3Q9UA 1WDLA 2C2XA 3LQFA 3L0DA 1R4MA 5CDUA 1XQ1A 2ZB3A 3GVHA 4K28A 1TA4A 3C1AA 4IXTA 3GAZA 3ZWXA 4NU5A 1QYDA 2D2IA 2EP5A 4XEHA 3DMTC 1PS0A 2P4QA 5A9SB 1AE1A 3NAQA 4Y8VA 1ISHA 1U8XX 2AEFA 3RCBA 1MP0A 1RJWA 4KUGA 2Y05A 3DMTA 3WGYA 5EJ2A 5IXYA 3OH8A 3H9GA 3P7MA 3H3FA 3DOJA 3WYBA 5KTKA 4EI2A 1GYRA 3HJAA 1LXCA 1VM6A 2H5LA 4OQZA 1K6JA 1X0XA 4WLVA 4LVUA 4AJHA 1EVIA 5L40A 2VHYA 1D3AA 5A02A 4W7IA 3ROKA 1GUFA 4ZRNA 3WMXA 3BMQB 3DZBA 3ZI0A 2DC1A 2O2YA 3TL3A 1F8FA 2UYYA 3QHAA 3JQ8B 1HDRA 1F14A 1DLJA 1KS9A 3TRIA 5TSDA 1F12A 4CQMB 1AXGA 2ZB7A 1N7HA 4FC7A 1UP6A 3GZNB 3CIFA 4CV1A 1CWUA 4B7XA 2VNAA 2X1HA 5TS3A 3K2EA 1O94A 5A5FA 4WLUA 3C7DB 4L4SA 4BUCA 2PZJA 4NJMA 3M2TA 2AA3A 3F9IA 4C4OA 1DO8A 1P0CA 4CQMD 2GERA 5FYDA 5A05A 2EWMA 3GOHA 4YRDA 3BMNB 4UEKA 1TVEA 2X23A 3WS7A 2O23A 3KEQA 4OAQA 4N7RA 3IIEA 3ZU4A 3D64A 1Q1NA 4YXFA 4UUMA 1GZ4A 1I3LA 4HNGA 4AJ4A 1PL8A 2O7QA 3H9EO 5AYVA 2EHDA 5JAQA 4R69A 2D8AA 3L9XA 3K73O 5DCWA 5TRTA 5AXBA 4QQRA 3CUKA 5A06A 3DFUA 1GR0A 4R1UA 3EHEA 4CUJA 1ZBQA 3LLVA 1NNUA 3CMCO 3GGOA 1NWHA 3LVFO 2GLXA 2B83A 1JKFA 3TOZA 4R01A 2X5OA 3QV1A 1CEQA 1KVTA 1E0DA 2C20A 4LRSB 3VHRA 3B6ZA 1BDBA 3AUSA 4DQVA 1X7HA 2Z1MA 3L6DA 5CEEA 4IDEA 4OM8A 3NYWA 1UP7A 2PY6A 4W9NC 4DQUA 3GVIA 4OOFA 4O59O 4FN4A 4B3HA 2NLOA 3OICA 1PL7A 3AUUA 4N5NA 1GQYA 1HKUA 4DMMA 3NTRA 1E1NA 3AY3A 3JQGA 3F4LA 3UFXA 2CUKA 5JC1A 3F4BA 4Z9FA 3SBOA 2JD0A 4IQ0A 3HFSA 5KWEA 4GVLA 1T2EA 4WECA 1N9GA 4I8XA 4NFYA 5HBRA 1HSZA 1EE9A 2WDZA 2VUUA 3VPHA 4BKPA 5F1PA 1E7QA 3GEMA 3JYQA 2B35A 2O3TA 3TF5A 4NMHA 1LDBA 2E48A 3ENNA 3KSDO 4K6FA 3QJ5A 2EG9A 1YQDA 4FFRA 4FFLA 1HE4A 3FWZA 4CQLB 3NUGA 3HSKA 3VPSA 4J1SA 1SB9A 1PJCA 3E6AA 4EZBA 5L95A 4TKMA 1NM5A 1YGYA 1NVMB 1BXKA 1LEHA 1EEHA 2VRCA 4HX5A 3T4XA 4CLOB 2A4KA 1RM3A 1SBYA 2FWMX 2CDCA 5EQDA 4MVJD 1HDOA 4PRKA 2Q2WA 4QTZA 3WSWA 3L6EA 1H9BA 3CZRA 2AG8A 1NAHA 3R3SA 3ZZNA 4KTVE 4HXYA 3PYXA 1W6UA 2H6EA 4NHEA 1DDOA 2QYTA 4J1QA 3IAHA 4CPDA 2O3UA 3NX4A 1DEHA 4ZRMA 1DBVO 3ZGYA 2I66A 2VWQA 1IHYA 1P1JA 4GKBA 2YW9A 4XWYA 2CZCA 1HYEA 3WGGA 1E3WB 1JW9B 4WE3A 1PGOA 1GADO 1I0ZA 2BLLA 2X0JA 3L07A 3AI3A 5CAEA 2O7SA 3UW3A 4DL9A 3CPSA 3MZ0A 1QYXA 5IZ4A 2ZB4A 1Q7BA 1UJMA 1YDWA 4B8WA 1DIAA 4D42A 4MVJE 1M76A 1NQOA 2IZ1A 3QWHA 1U3VA 3DMYA 1QV7A 3KHUA 1V0JA 2Z95A 4ALLA 2ZTMA 4HFMA 1HL3A 3NJ8A 4YAEA 5JO9A 4Q3CA 2BFAA 2P9EA 1OI7A 2G1UA 1OMOA 3H9JA 4OL9A 4TRMA 1A4UA 1UAYA 1QYVA 3RUEA 3GUYA 5JPIA 8ADHA 2ILTA 5G0SA 5A3VA 1PR9A 2FOIA 4RF2A 5I9NA 2PZLA 3EC7A 3OA0A 4KDEA 2C7VA 4L9RA 4Y6SA 1ZIDA 3WQSB 4MVJP 3DHNA 2UDPA 2QZZA 1CYDA 2OOSA 4ZA2A 4GBJA 4G5HA 5L3ZA 1CERA 1P74A 3ROPA 1JAXA 4GGPA 3IKVA 3TZ6A 1YJ8A 1L1FA 1EZ4A 1EFLA 4XJSA 3V1YA 4DYDA 1HDCA 3ZV3A 4NU6A 2IODA 2FPIA 3WGOA 3RASA 2DBQA 3ZU3A 1HSOA 1BTOA 3GG2A 3SJUA 3HN7A 1WMAA 3JQ7B 4GH5A 4D43A 1ZNQO 1E3JA 1PX0A 4HUJA 1QLJA 5I9MA 2C82A 3KM0A 1O6ZA 3JYPA 5IXSA 3WLFA 1GYQA 4YRBA 3TZQA 5MGBA 1KYQA 2X58A 1E92A 4NPCA 5DT9A 3A06A 3R0IA 3QQPA 3B1KA 3GF4A 2OO5A 1N92A 1VSVA 1R4NA 4BNWA 5T57A 5G0VA 3GT0A 1I8TA 1HRDA 1C1DB 1LQUA 1M75A 4CM4B 3F46A 2B4RO 2QQ5A 1ULSA 2BD0A 4J9VA 1IE3A 1T2FA 5C37A 1ISGA 1JWBB 2V65A 4S3MA 5G0WA 3ZU2A 3ETEA 4P38A 4B4WA 1VI2A 1I10A 2NTJA 4U8GA 1HZZA 4FSHA 5KKCA 3JQ9C 2DUUA 2HLPA 4WOKA 3P19A 4PRLA 1R4MB 4RDHA 1Y1PA 1T4BA 4NIMA 5COQA 2YFHA 5KKAA 1G0NA 1PQPA 3COSA 2DTEA 3ASVA 1N2SA 3JQAD 4XJTA 4E13A 3HG7A 2JKVA 5I8WA 1U7TA 1TXGA 2HSDA 2EJVA 1LC0A 3VTZA 3EVNA 1MFPA 3WQQA 5JDCC 1ZEMA 4OMUA 4LMPA 1R66A 2AEJA 3QE3A 2P91A 4HFNA 3GDOA 1MV8A 3IP3A 3A4VA 4J0EA 4QSMA 4KP7A 3O03A 2RHRA 4O1MA 4XZ3A 3ZWWA 3TDKA 4TROA 2D0IA 3OJOA 4TMFA 3WFIA 4CMEC 1LLCA 3LT0A 2VTDA 3GC6A 2NU6A 1ZSYA 3RKUA 1H6AA 2NV6A 2VUTA 3RD5A 3ON5A 4BO5A 5C7OO 4BNTA 3FR8A 3RUDA 2GCGA 2FMUA 3RC1A 1YBMA 3DBLA 4EYEA 2ZCUA 4CL3A 1CQIA 3QVOA 3GA0A 1AUPA 4BO8A 4EGFA 3UOGA 2WE7A 4BGVA 1YRLA 3DZGA 3QVWA 1NTOA 1KEUA 1LUAA 4NJMB 4PFJA 2YZ7A 2X8LA 1VLLA 2B37A 4U0JA 5COAA 1LLDA 2CY0A 3PVZA 3T7CA 2AQ8A 4OSPA 4IMRA 2ZATA 4FB5A 3ROMA 1A27A 7ADHA 1ZK3A 5EINA 1PJ2A 3NDJA 2D59A 4RPJA 3HDJA 3BTOA 2YDXA 1VL6A 2BI7A 4I5GA 3RKRA 5BSFA 5TF4A 2WWRA 3GMSA 4FFMA 1QV6A 4JIGA 3AOEC 4RF5A 1PGPA 4WJZA 1YDEA 2PH5A 3MJ4A 1MC4A 4XR4A 1ZZEA 3NDRA 4AVYA 4WCFC 1SEVA 2I3GA 2Q1TA 4XIJA 3ZWCA 4XGKA 3ZNPA 4KUEA 2WYUA 3U62A 4J7XA 5IZCA 1DB3A 2OFPA 3FR7A 3CKYA 1KVRA 2WSBA 4AJEA 1C14A 1HEUA 5IDXA 5HM8A 4UULA 2BELA 3D1LA 1GL3A 4RVDA 3OJ0A 5C5IA 3PWZA 2OMEA 1RPNA 1ENOA 4R9SA 4WK6A 2RCYA 2BFMA 1GCOA 1T26A 4D0SA 4J16A 3DZFA 4IBOA 4O63O 2P68A 4WLOA 4EDFA 2D4AA 4FJ1A 2DAPA 4HFRA 1PZGA 3KSZO 3PXXA 5T8KA 4DMLA 1B8VA 4YACA 1N7GA 2GN8A 1AHIA 1EUZA 1H93A 3JQGB 3LK7A 2O2SA 1X7GA 5B37A 5JLAA 5EERA 1QKIA 5KVVA 3LSYA 1EVJA 1RM4A 4YEDA 4OSOA 5EESA 2I6TA 3HQ4O 3A28A 1Q0HA 1IOLA 1N9GB 1B0AA 3IQDB 4HBGA 3VOSA 1DSSG 1BSVA 1H2HA 1VC2A 2X9NA 4TRRA 4YWJA 1DHRA 4DC0A 2Y66A 5I7FA 1K0UA 1T2CA 3WG9A 3GGPA 1H6DA 1I30A 1HTBA 1EVZA 5CEFA 4JBGA 4RVFA 5T67A 5L4SA 2WD7A 3G0OA 4IPTA 2FSSA 4BOYA 2VOEA 3RU7A 2EIHA 1T2AA 4FGWA 3W4JA 2ZKLA 3EZLA 4JJGA 1E7RA 3UAGA 5KNLA 2X86A 4FCCA 4LN1A 3BHJA 2DUWA 1MLDA 1ZJYA 1YXMA 2V6FA 3I4CA 3WIDA 4IUYA 5A5EA 1ZSVA 4MIYA 4IJKA 4FW8A 3PWSA 3WGIA 3GUCA 4LW8A 1R12A 4E0BA 5KIAA 4CM3A 5BQFA 1ZFNA 5KOIA 4INAA 1A7KA 3HB4X 3WXBA 4RCVA 4ZQHA 4QXMA 1LX6A 1M2WA 3AWDA 1VJ1A 3TZKA 4DIBA 3UCFA 1E5QA 2VRCD 4KDFA 4EITA 1FDSA 1NASA 5JS6A 3I9LA 2YV3A 2HAEA 3L4SO 3WTCA 2AW5A 4XDZA 2C0CA 3MJTA 4Z0HO 4DVJA 5L9AA 3VH4A 4ALMA 1BG6A 1TLTA 3GQVA 4N5LA 4BVAA 5A3JA 1SO8A 2AG5A 3RBVA 3L4BC 4RORA 4L4XA 4XQCA 2NQTA 3IUPA 5F5LA 1KETA 2J5QA 3RQSA 3SC4A 2Y0DA 4E6PA 3NEPX 1SPXA 4F46A 1DLIA 1B2LA 3HE3A 4BGIA 1NWCA 1Y7TA 1BMDA 3PGJA 4PG4A 5JAZA 1YL6A 2ZTVA 3K31A 4IINA 2GF2A 5DP2A 2B4QA 3U0BA 4ZN6A 4DBZA 4ZQGA 1XU9A 1YL7A 3E1KA 5K6AC 1J4AA 2C29D 3MJVA 2ZJ0A 3VKUA 3U3XA 4B7UA 4ZQFA 3UN1A 2O4CA 3W8DA 1E3LA 2NUAA 3DOOA 3DB2A 2DBRA 1GU7A 1KIFA 4J7UA 1QYWA 1YL5A 4OYRA 3VC7A 5T5QA 3O4RA 3PHGA 4I08A 5TIIA 1CF2O 2XF8A 3MOIA 1H9AA 3EGOA 1N8KA 3PJFA 5ES3A 1X13A 4BKUA 4HNHA 2HK8A 4W4TA 3JYLA 3IDSA 1U4OA 4LRTB 1EK6A 1I36A 2IEBA 5ICMA 3EYWA 4DIFA 3O38A 5JCJA 4EJ6A 2XXBA 2OP1A 1ZH8A 2Q4EA 3FHLA 4IJVA 4D7AA 3BTUA 1ARZA 1MGOA 3C1TA 2HJSA 2CVQA 4R51A 4F6LA 4PGFA 5IG2A 1SAYA 1YQXA 1OBFO 4E32A 3S2EA 3VZPA 2C59A 5EIOA 4RLSA 2EGGA 5CG1A 3NRCA 3SEFA 1GUYA 4A73A 3D4OA 4YYZA 3H5NA 3QRWA 4ZICA 5JBIA 1VJ0A 1UH5A 3C7CB 5FWNA 3KZVA 3AM5A 1YBAA 5ER6A 3IOYA 4R4JA 4XB1A 4MP6A 1CQJA 2PK3A 1B16A 4D44A 1SOWA 4IY1A 4ALKA 3K5PA 3CXRA 1WP4A 4J4TA 2XPCA 1AHHA 3I23A 3KLPX 4JCOA 1OZAA 2PZKA 1ZUD1 2GGSA 1NHGA 4R5MA 2HMWA 1PJBA 3HDHA 1PL6A 5TJHA 1ADGA 4ALIA 3GDGA 3NGXA 2VWPA 3RBZA 3JQDA 2Q4BA 2QRKA 1SCUA 1Q0LA 2V6BA 3VAZA 1Z45A 2ZTUA 1XIVA 3HDQA 2YJZA 1BXZA 4ILKA 5KVCA 1LBEA 4ZJUA 4RGBA 3FRJA 2OL4A 2JAHA 3H5AA 1WPQA 1DAPA 2HDHA 4MVJG 2BRUA 4JX8A 3I4FA 4YAJA 1D4FA 3M1AA 2PA3A 5TT1A 1FJHA 1KY5A 5TX7A 4XYGA 3TZCA 4IJUA 3WGHA 2VYVD 3U4DA 4IXWA 2VYNA 1LDEA 3ZDFA 2C7GA 2DPHA 4FQ8A 1EMDA 5K0ZA 3OJFA 4IMPA 2P4HX 1HF3A 3INTA 5BT9A 4E5NA 3BHMA 5EQFA 1EK5A 1P44A 2Q45A 3JTMA 4J4HA 1O8CA 1QR6A 4OJNA 3MJEA 4CM6A 1LU9A 3K92A 4R1NA 3RU9A 3UKOA 4J4BA 1C1XB 4I9NA 4ND4A 1E77A 3ZN2A 3H6KA 4YJFA 2CF6A 4YJHA 1IUKA 4A0SA 4U6QA 4BMNA 4R5HA 1R6DA 2C54A 4IIUA 4E2ZA 4FDAA 2DQ4A 2O3JA 3W6UA 3OA2A 2E4AA 2FR8A 4WUVA 2D5AA 1HLDA 4UAGA 2RAFA 3JYOA 2PGJA 4J91A 3SVTA 3HNPA 4HY3A 4ND2A 4RVGA 4IDGA 2HRBA 1PR3A 3P5SA 4XGIA 4URFA 3RROA 3ZWYA 1PWZA 4Q3BA 3U9LA 1ZEJA 4TVBA 3WJAA 2TMDA 3PK0A 5DDIP 4FPXA 4GX2A 3ORFA 1V8BA 3QWIA 3ETDA 4AJJA 4R54A 4BO7A 3WIEA 4E4YA 4XKJA 4DPLA 4MKZA 3ZV5A 4M86A 1LSSA 2JHFA 1MB4A 3GZ4A 2O48X 3I5MA 3V2UA 2O3SA 2CF5A 3PHJA 1YB5A 3CE6A 4AJLA 1FDTA 3KO8A 3PWKA 4IJWA 4YCAA 5EPOA 1GAEO 4L8VA 3QW2A 3RC7A 2J5KA 4FGSA 2RBEA 1LDYA 5IDYA 1NR1A 2FZWA 4ROSA 1ZSNA 4BO6A 4XYBA 4BNFA 1BRMA 3GVPA 3NGLA 3OIFA 4AJPA 3B1JA 4EUEA 5IDWA 2CD9A 2OHXA 3QSGA 2W2KA 1LLQA 3BAZA 1LSUA 2ZYGA 1NFFA 4ONEA 5A9TA 4RV9A 4XQEA 4A03A 1E6EA 4YJDA 1HZJA 1Y8QB 4FFNA 5CPFA 1NPYA 3JSAA 4IM7A 1J49A 1YWGO 2POQX 3FTNA 2Z1NA 3B20A 4CV0A 5HS4A 4HV4A 1ENZA 3DR3A 5HWSA 4OO3A 5FI5A 1HDXA 2JJYA 4IDDA 1XCBA 4DLBA 4A10A 1YVEI 2YDYA 4UEOA 1I3KA 1GPJA 4CM8B 2BGKA 4BNJA 5ILOA 3A1NA 2FSVA 1NAIA 2JAPA 3ANLA 1H6CA 3DAGA 3JD0A 3PQEA 4W9NA 3STHA 1FK8A 2YUTA 4II3A 1Q2XA 4IDFA 5KVQA 2WD7B 1UXGA 2Y0EA 3IC5A 3UF0A 5JFOA 2QIOA 2GYYA 1LLUA 4Z3DA 4DLLA 2VHVA 2HRZA 4OKNA 2IXAA 1E7MA 4NJOA 2PKRA 2B69A 1GQ2A 4DYVA 4NK4A 1BVUA 1HDGO 4J9UE 3V2HA 2PKQP 2J6IA 5B12A 2RH4A 4TWRA 4CMIA 2FRDA 5JY6A 3LF1A 1VKOA 4CLHA 4P8RA 1AXEA 4E2YA 2VNSA 1V35A 2JCYA 1ADFA 1KVUA 3OIDA 5KJEA 1GPDG 1PIWA 3VDQA 5L45A 2NQ8A 3O8QB 4NI5A 2DBZA 5G4KA 3PJDA 5A4DA 1KEVA 3BMCA 4Y6RA 5I8ZA 5CPBA 4KMSA 4RF4A 3MEQA 4LSWA 1DXYA 4E31A 2H9IA 4CMHA 2QHXA 1PS8A 1NQTA 5AOVA 2BF7A 4XIYA 2PH3A 4PLYA 2BMAA 1G1AA 4MIEA 2AMFA 3I6QA 1WDKA 3GGGA 1ZXBA 2A92A 2PTGA 3MTJA 4ZGWA 1Y9AA 5EN4A 1U2DA 1LSJA 3P2YA 3O9ZA 4OGWA 4WKGA 3GFBA 4CMGA 1ZK2A 4BV8A 5A04A 4YA6A 3I9OA 1LJ8A 4IZHA 4NG5A 2IRWA 3LDHA 1IULA 5GZ1A 1VKNA 4DTIA 5FFFA 3V1UA 3ITKA 3JYNA 1NVTA 5LDHA 3AY7A 5HTOA 3OFSA 2AXQA 4D3FA 1E7SA 3DBHA 4G2NA 2GZ1A 4U7WA 4J2HA 3EZYA 2I67A 3LF2A 3DDNA 3FN4A 3U4IA 5AQ1A 5A03A 3WWYA 1OOEA 3RWBA 4FC6A 4EBFA 3WQRA 4DGSA 1IHXA 1DFIA 2FP4A 3FBTA 3KOUA 1EUDA 3QP9A 2GUGA 3ULKA 3IKTA 3RBXA 4AJNA 4I9HA 4CM9A 3AU8A 3S2GA 3GPIA 4RVUA 4E5KA 1MXHA 4YT2A 3ANMA 5G2OA 5CDGA 3U09A 4YTEA 2VT3A 1P1FA 1ZO8A 2LDBA 1CDOA 1E1MA 2G5CA 2OBYA 5BNFA 3VPFA 4YB8A 1RYDA 2I76A 1E3IA 3IL2A 2HU2A 1YO6A 1BW9A 3W4KA 2VHWA 3KEOA 3LT4A 5U1PA 3KBOA 3M1LA 1U3UA 1SOVA 4MVJI 2GNAA 3HZZA 4P4LA 3W8EA 3WDSA 3ZU5A 5JCJD 3ZNQA 2ZYDA 2YQ4A 3LYLA 3DBRA 6ADHA 3E5MA 4QX6A 3KYDA 1U9JA 5MDHA 3MTGA 3JQCA 3W1VA 2NACA 2VWHA 3WICA 2TMGA 4E30A 1TT5A 3GEGA 2FHSA 2UAGA 4WCDA 1H94A 3LZ6A 5I7VA 4K26A 4A7PA 4E2XA 3EAGA 5CDTA 1NR7A 2G76A 2ZJ1A 4MVJF 3RUFA 3M6IA 1KBZA 1UDAA 3RIHA 4BO3A 5ICSA 4I5DA 1GQQA 1ZXLA 4RVSA 2B0JA 3B1FA 3PDJA 3C85A 1WNTA 3QIVA 4M55A 5L7WA 1UXKA 4CR7A 1DIRA 1WVGA 1XQ6A 1B26A 1K3TA 1XDWA 2DM6A 2Y1GA 2Y67A 1PJ4A 2YV2A 3GNTA 4N5MA 1T24A 4KQWA 1ZK0A 4K1LA 3VPGA 3WLEA 1E5LA 3OBBA 1C0IA 1LA2A 3DHYA 1DC6A 1DRWA 1U7HA 3JQAB 4BNKA 1SZJG 5HRUA 4IS3A 4QUKA 2EKQA 1GV0A 1IB6A 3DBVO 1PGJA 1EFKA 3GN2A 3IMFA 4G65A 3E9MA 3JQBC 1E1LA 1DPGA 1VPDA 3OQ6A 3UGKA 5FI3A 4MIOA 1LRLA 4JJIA 4BB5A 1DIBA 1SEPA 2HCTA 2VCYA 2J8ZA 1I24A 3D7LA 3H9UA 3JQ9A 3JQBA 3OF2A 1YH3A 5FF9A 4GSLA 3GNQA 2NU7A 1WLYA 3PZRA 4GWGA 5F5NA 4BNNA 2Y93A 4MJLA 3GDFA 3H2ZA 1GTMA 3ZH2A 4BS9A 2VYND 1E3SA 3JD2A 5JSFA 1J6UA 3LC7O 5KJCA 4Q3EA 4XYLA 4D41A 3HWRA 4XYMA 4YJFB 4OIMA 4YJHB 2HK7A 4N18A 3DOCA 4TZKA 4JROA 1ADCA 2H1SA 3DC2A 2VN8A 3E48A 2R00C 1SMKA 5JDCA 1PQUA 5TT0A 2CNBA 2GSDA 1D7OA 4JP2A 1N5DA 5HS6A 1U8FO 1DC5A 1U5AA 4BO1A 2X0RA 1RYEA 1L7EA 1VL8A 1GCUA 3HDYA 3ZHZA 1MC5A 2E37A 1EDOA 5CP8A 3TWOA 3AOGA 4CMEA 5CG2A 2HUNA 3ST7A 1C3VA 4J2OA 4AL4A 3OECA 5IN5A 1J5PA 1UUFA 3ICPA 4B7CA 3QLJA 1V3TA 4L74A 3IP1A 1JDJA 2HMTA 4KWHA 1KEWA 4H7PA 4BQPA 2D1YA 3ADOA 4XA8A 3IUSA 4RZIA 4JK3A 1YS4A 1Z6ZA 1DOHA 3E82A 2OZPA 1I5RA 1V3VA 5KCZA 3CEAA 4JGBA 4CR8A 4W6ZA 5KJFA 3QVTA 3PJGA 1F0YA 4BNGA 4YAIA 2OXIA 3NT2A 4D3DA 2QZ9A 1M67A 3KYCA 4CL8A 4DPMA 4XDYA 3Q11A 5BNIA 4FD3A 1P31A 1PJ3A 3KXDA 5DCYA 1GV1A 2WJPA 1C0LA 2P5YA 4K6CA 4L75A 4E5YA 4D3SA 1PU2A 4CUZA 1HE5A 5L7TA 3AUTA 1A71A 3PIIA 1WWKA 1P45A 2B5WA 3BMQA 3KYBA 4YAKA 2WYVA 5CEJA 5AXAA 1ISIA 1XELA 3AOEA 4M89A 4MINA 4UVIA 3ZWOA 1D1SA 5T6BA 3H3JA 4AICA 1H5QA 4R41A 3JQ8A 1I2CA 3FNHA 1UZNA 2BGMA 2GASA 4WCFA 4Z3KA 1T1RA 1F8GA 4XYEA 1R37A 3GRKA 1HWYA 1TEHA 2ZK7A 2ZB8A 2JFHA 1JLLA 2J3KA 2BKAA 5U4QA 3OEYA 3K8ZA 3PQDA 5TQVA 2EKPA 1FMCA 4IIVA 3EW7A 3E9NA 1E6WA 4BNLA 4PZDA 3V5NA 4NBWA 4Q3NA 1PWXA 2VZ9A 1KVQA 1B7GO 5I9LA 5JDIC 3LT2A 4TVOA 1RWBA 5T64A 3FTPA 4CMIB 4AJKA 4YT8A 2YHIA 3E8XA 1FDWA 1LC3A 1MG0A 2CDBA 1PEDA 3AI2A 4FJ2A 2BI8A 3PHLA 3QVXA 4E12A 4EEZA 4LSMA 3IJRA 4IQGA 3F1KA 2NU8A 3Q2IA 2NVBA 2PR2A 4ITUA 3B70A 1XA0A 1YBVA 2NADA 4WEOA 5DNAA 3RI3A 3KSUA 5G4KB 4Q39A 3DZKA 3GRPA 1UAGA 3BMCB 3ZV6A 5CDYA 3H2SA 3WX0A 3FNFA 4BNXA 1Z74A 1CJCA 5ITWA 4MKRA 4GMGA 2ZYAA 2I65A 4EW6A 3BMOA 3PHHA 4YAGA 4AG3A 1EUCA 4YDRA 3GG9A 4E33A 1UXIA 4U6SA 3K6JA 1YB4A 5ILGA 1KY4A 2JFGA 1OC4A 1P9LA 1MA0A 3PZBA 3WYCA 5BSHA 1IY8A 3SXPA 3UUWA 2C5EA 2ZQZA 1GY8A 2I9PA 3UHAA 4CLRA 4DIOA 3EMKA 1ID1A 1R15A 2Q46A 2PD3A 1MUUA 2VZ0A 4BNUA 3W4IA 2HK9A 4OXNA 4MVJH 4HKTA 4TRJA 4WNIA 5F3RA 3VZRA 3OMLA 3RUAA 3K30A 1YQGA 4TRNA 5IN4A 2DT5A 4UREA 3RJ5A 4DC1A 4ZVVA 3DBHB 4P4NA 3RFXA 1QP8A 1ML3A 1P1HA 1EQ2A 4ALNA 4QFDA 1X1EA 3C3XA 2AEMA 3D3WA 3FWNA 1F06A 1T2DA 1V9LA 3L4BA 4U5QA 1P1RA 1UDCA 2YHUA 3BA1A 3ZCXA 4NBTA 3UVEA 4NBUA 4CV2A 2V7PA 1TI7A 3G3EA 4R3NA 4C7JA 3PIDA 1QRRA 2PNFA 4Z9XA 2WMDA 4CLOA 3CINA 2EKLA 2Q2QA 3JD3A 3RUIA 3WGTA 3VTFA 4P22A 1KEPA 3HFGA 1ZK1A 3JQEA 4Q3AA 1NFRA 4WEQA 2CMDA 5K6AA 2I3AA 4II2A 4E21A 5G0TA 5L4LA 2X9VA 2Q49A 3I9MA 5B4VA 3ANNA 4CM9D 1FXSA 4CM5A 1BW9B 3WNQA 2W2LA 2NVUA 2GN6A 2FR0A 2HMSA 4KZPA 3PP8A 4MPDA 4BNYA 4ND3A 2IZ0A 1ISJA 4BV9A 3BIOA 1E7WA 2ZIZA 4RO0A 4YR9A 1ISMA 2F00A 3KRTA 4W99A 5CFZA 3D0OA 3KYDB 3OQ1A 4QO7A 2FZEA 5A1TA 2WEKA 2D5CA 2G17A 2G82A 2X5JO 4TQGA 4BGUA 1PZHA 4M87A 5GY7A 5DBIA 4BMVA 3V2GA 2C5AA 4J90A 3RFVA 2A94A 3FBGA 1EVYA 3GN1A 3OIGA 3TFQA 3TPCA 4GX1A 1JVBA 2GPTA 4FIZA 3TL2A 3RUCA 3I3OA 4ND1A 4WLFA 1T4DA 3TQHA 2GN4A 2DU8A 4O0LA 2PWZA 3AFNA 4J1TA 5GMOA 3IJPA 4CLDA 2B36A 3GNSA 4BNVA 2YQ5A 1Y5RA 3ZHYA 4R9RA 4BB6A 1O89A 4KTTE 4P4GA 1R4NB 4DQXA 4YPOA 1IZ0A 3R1IA 3G79A 1WDMA 2Y1OA 5JNLA 5TNXA 3FSRA 1C0KA 3D3EA 3LLSA 5JYEA 3NJ4A 5JAMA 3D4NA 3BTSA 1CIVA 1ZVMA 1K2WA 3C24A 3RFTA 3JQFC 1PJTA 3UICA 4XRGA 5EL0A 3BXXA 3ETGA 4CUKA 2O50A 3OEWA 3ZWMA 2JCXA 1XG5A 2OGUA 1PJQA 3U4HA 4LISA 2OUIA 2LDXA 3NTOA 3QY9A 2DTXA 5I7EA 3S2FA 1UR5A 3WB9A 3NT5A 3C1OA 4J1NA 5F21A 3VH3A 1R16A 4BNIA 2AQHA 4RQUA 4PVCA 1Z73A 3KETA 4Z0TA 4PZEA 2FR1A 3VKVA 4BO9A 1X0VA 1E6UA 1W4ZA 1E1KA 3ADPA 3MWDB 1DIGA 1FDVA 3H65A 3O26A 4CLEA 4A26A 1NX6A 3I1JA 1X15A 4UUNA 1PZEA 3Q2KA 2NSDA 1PTJA 3WGZA 4DXHA 1I3NA 3GLQA 4PLPA 3H9QA 3D5TA 1ZMTA 4DRYA 4E5MA 4U0KA 4D0RA 1YKFA 1FDUA 4J43A 3RUHA 1A9YA 3AK4A 4PG5A 4R1SA 1S7CA 1JN0A 3MWEB 5I7SA 3S1LA 1K5HA 3I6IA 3N7UA 3DBLB 1JU9A 1V3UA 4LGVA 1F17A 1P1KA 3PGXA 4AJOA 4IQ8A 4RPHA 4UVHA 4YRAA 5IAAA 2QG4A 4LVCA 1OFGA
chains in the Genus database with same CATH superfamily
3UJBA 3C8HA 4X9XA 1JS1X 1JBKA 1D04A 4ZT7A 4BAZA 3ZE6A 1M2KA 1MVOA 1CLUA 2DJ5A 4K2AA 3KUXA 5BYKA 3W1WA 3QA9A 1HDZA 2HJHA 4KPGA 4DUPA 4F4FA 4TLEA 2XB4A 3X44A 2BCEA 1UZLA 4TKUA 3HBJA 1EXMA 1GTL1 3G0CA 1ZWKA 3A58B 4INZA 4OHXA 4QJIA 5FOQA 1F8XA 1NBOA 1US8B 4MB6A 2OUKA 1V9CA 2QD1A 1DJNA 1WSBA 1MXFA 3VISA 2VHZA 5KS2A 4XQGA 2B5VA 3BB3A 4KPFC 2HA3A 1W88B 3CH4B 4RS4A 5CYPA 1C1YA 3I30X 1U0FA 3WRYA 4R1TA 4RDIA 3TTXA 3EAFA 1TMYA 3GFFA 1NQXA 4H4EA 2PXAA 1YUMA 3BCRA 1JVSA 2HPVA 2XTZA 1NXQA 5LR6A 3U19A 4ARVA 4PX3A 3G0GA 3SLKA 2QNRA 3SNKA 2HF8A 4G1VA 1SQGA 2QTFA 4K6GA 3E03A 1TYEB 3IT1A 3RHFA 1W2HA 4KO1S 5J3JA 2G71A 3ZY3A 4CTKA 3VR4D 1I2MA 3FPJA 4K6MA 3S1AB 1KZ7B 2NYAA 3RC3A 2WAXA 3ROQA 3O83A 3HH8A 1O5OA 1R0KA 1L7AA 2QROA 4CMKA 2PLRA 1B14A 4D8VA 4J0JA 4F93B 4JH0A 1YIOA 5DCUA 3HV2A 4EF6A 5ADHA 1FYEA 2WYWA 2HKIA 4FYHA 1R7RA 5T4HA 5H83A 1V26A 2I4IA 3FYCA 4Y9RA 1QYCA 5KBYA 3RANA 4X1IB 1D2EA 5LZ4A 2W4MA 2D2VA 3MSXA 3OZAA 3ZY6A 4LQCA 4GLFA 5FI0B 1VG9B 3BWCA 5LA6A 2ZBGA 3LQKA 6CHYA 4JVOA 2QN8A 4QPCA 3TJMA 1HT2E 3CR3C 2J3IA 3GMDA 2X6QA 3I04A 4JASB 4JI1B 3NCHA 4RD3A 5IK2A 5CXUA 1TQDA 5F3WB 3NNDA 2ZPTX 2HA2A 2YHIB 1K63A 1E66A 1A72A 2PGLA 2QRVA 4H7KA 3INGA 5ARCA 4ZZ2A 5JH7A 2NU8B 1WPGA 3ZQJA 4LY3A 4C1NA 4JOBA 3EIQA 5AFSA 3WYEA 4TZTA 1Y8RA 2O3RA 4TYNA 2Z2YA 1IN8A 4LV5B 4UHBA 4U7FA 3RRFA 1G98A 1KIAA 2UUPA 2CL0X 3CT6A 3GDWA 4R2WA 5EMHA 6PFKA 4AY3A 1KWKA 1G2PA 1VYHA 3EFOB 1CEYA 4QHYA 2IDZA 2XGSA 1GKLA 1H66A 3I83A 2WK1A 4X0EA 4EL5A 5J59A 1CLEA 3BIWA 4UE3S 3O8BA 3G88A 3AR9A 2IE8A 3BMOB 3Q8MA 4BMSA 3D2CA 1CFJA 3AF0A 4RVOA 5SZKB 4NCJA 4GLLA 2VPQA 1CW2B 1GZ3A 5DBGA 2HXSA 2H29A 2GK4A 3OX4A 2GEBA 4PLTA 3M7IA 3R4VA 1T2VA 1RMYA 4PZLA 2IGTA 3O82A 1AU9A 1Y37A 4RIEA 3WMWA 3RAJA 2V7EA 1BDHA 3AIIA 1AVTA 2VF4X 1YQUA 4MUBA 4X61A 1ZITA 1XTUA 5E6SA 4CLRB 1W4CA 1YK1A 2Q2VA 5A1JA 3ACBA 3LSTA 3RSHA 4MV8A 1I01A 1T9AA 3LI2A 2H52A 5FXMA 1PNVA 4UEJA 2BEUA 2ZS8A 4J0DA 2ANBA 3GH1A 4JI4B 4TM7A 1E0SA 1EDZA 3GH3A 4B6PA 2VWGA 4PSDA 3UW1A 4MRAA 5CFQA 5JO0A 3KKLA 1QPGA 2R1TA 1CZKA 1ZCJA 3FSJX 2OLKA 4BO4A 3CH7A 5JUWA 4ALJA 5CT9A 3VFDA 1E6KA 1NQAO 1U5BA 2D5LA 4DLAA 4OOEA 3ROEA 4RK1A 6REQA 1JG4A 3I73A 1SC6A 1FP1D 4W7HA 2IYNA 3W9SA 3IURA 1N5MA 3WB0A 2G72A 2FHPA 2GT1A 2JFQA 1DTSA 3L8FA 3MRTA 4FJ0A 4LXYA 4XW2A 5I7AA 2IYFA 3ODPA 3C3BA 3L06A 5LNK6 2H1OA 3TNJA 4XCQA 1UBFA 5FCDA 1A9TA 3UMCA 1XMIA 2DOKA 4URVR 2OQ2A 2W6OA 3AUYA 1N2GA 2GD0A 4FQ5A 4GI1A 5TE9A 2WFLB 3CSDA 4PAGA 4NMLA 1Y81A 3VU0A 3SHFA 1X94A 2B8TA 4XLTA 2WYHA 1MG5A 3ORRA 1IBSA 2HLNA 3DWFA 4DWVA 4O5AA 3AESB 3OJLA 2H7VA 1N3BA 1OHHA 1O57A 1Y3IA 1CUFA 2QLTA 4BMOB 1JUDA 4HWKA 3H4VA 1JIVA 1NFQA 2ZI6A 3GL9A 2YV4A 5CLJA 5SY6A 1CNFA 3A4YA 2NVUB 2ZZNA 4MW6A 4B32A 5JQWA 3O2NA 4W5WA 3ENQA 1E0JA 2JI8A 3BYZA 4LZJA 1XZAA 3SVZA 1VE6A 4EEKA 2WU3A 2ZRGA 1MO6A 3A70A 4QYSA 1JIKA 2BWJA 2KI5A 4UOEA 4PFKA 2NAFA 3I9FA 4NU0A 1XTKA 3UB2A 3CEJA 3V8NA 1Z7EA 4MW1A 3Q15C 5AK0A 1SVLA 3H5RA 3UYKA 2C5HA 3R3JA 4R81A 2EHJA 1T0JB 2XMGA 3UNXA 2VDWB 3JWIA 1U4SA 5CITA 1JQDA 2AE1A 4IZIA 1VLZA 1YB6A 1V6SA 1FP4A 1YCHA 4A8PA 2IOFA 4JYBA 3H18A 3K1AB 3C98A 1VSTA 4DIKA 1BHSA 5DK4A 3DDZX 1V4BA 1OFUX 4UTVA 3GW8A 5DRYA 4N3NA 1KMIY 2BP7A 1UBSB 4BRUA 4C04A 3F9RA 4TYQA 1U3WA 4LK3A 4KVFA 4A6DA 1C30A 3FPAA 3ZE8A 1RXIA 4YJGA 3D4PA 1B41A 4ZI3A 3BTVA 3HKCB 3HHPA 1Q74A 1R9MA 5AIBA 1M2OA 4GQAA 3P26A 3OAAD 3UY4A 3ZGOA 3KNZA 3EA0A 4JN6B 3OQIA 3K8YA 2WQ7A 1PV4A 3C4QA 1NVBA 4UARA 1HDYA 2FFRA 2KW5A 5FP0A 5L3RA 3DAOA 1NE7A 3JAKA 5CDSA 2O8EA 3I37X 1QOPB 1O6CA 3DLIA 5JQGA 2C7OA 5C34B 5A4IS 4R31A 4CQJA 5K45A 4BCBA 2ODPA 1CBUA 2R96A 2CNNA 3IERA 4GOKA 4WNCA 2VTEA 5EIHA 1DADA 4A8JC 4O4IF 1JA0A 4JB3A 1M0EA 4N0QA 4DR6B 3NPAA 5TQ2A 5KZMB 2CLSA 1CZUA 3EUAA 2J3DA 3QKSB 3F47A 3H4TA 3PE3A 1BDJA 1E0KA 3WLJA 1BS9A 1X7ZA 2ZJ8A 3JZAA 1ESMA 2WD8A 5EJMA 5HE8A 1NOIA 1YS6A 1BNCA 3BH6A 1GD1O 1U90A 5ALZA 1XLVA 2CXXA 4KO8A 2RI0A 3S55A 2I62A 1HQYE 3WK9A 4ZGGA 2HR1A 4CMAA 2Q6IA 3LXUX 4PS1A 3CZ5A 1YRBA 1YI0A 1SUPA 4RULA 4C4SA 3P96A 1QTIA 3WAGA 3IKJA 4GGOA 2B34A 3WGNA 1R6AA 1D0IA 2QRLA 4ED9A 2XYGA 2CFCA 2MR5A 4HUQB 4JUFA 1NVFA 4YPFA 1Y9EA 1L5WA 4JLUA 3LC1O 5AHKA 1VB3A 1S9DA 4RBNA 4RW0A 3C5HA 3DQQA 3HA7A 3QENA 1UOEA 3ZTYA 4LNUB 1JHQA 1O95C 3HJBA 3D6TB 3D54D 1YMUA 3NCTA 1PYGA 3LO8A 4LJLA 3UJHA 2X8WA 4C78A 3FB4A 4EZEA 4F3KA 4KFCA 3NOOA 1LDNA 2P4EA 2X6TA 1DIHA 2Y99A 4CIYA 2XBLA 1FUIA 3BQMB 4TV9B 3CMMA 1Z35A 4GPD1 4PWZA 5IM4F 5EYPA 5CFOA 1Z75A 4HDSB 4FUQA 1EFDN 3OEHD 4OH1A 5HFAA 5CB4B 3RADC 4GMXA 4KVAA 3UWDA 4L8WB 4UE2A 2VYVA 3G2HA 4ND8B 1U1DA 3OKCA 4QFCA 5AJZA 3U4MA 2WJWA 4C4RA 1XXHE 3SLGA 5EUQB 4IKEA 4XQ9A 1PRYA 1ONSA 2ODEA 3IDQA 1VFNA 4GECA 4B09A 4MNTA 2CUTA 1LDMA 1N6NA 1Q0QA 3DM5A 4B3JA 4L5IA 2RHTA 8LDHA 3I4LA 1Y8AA 1YR2A 3R5KA 2ZZMA 3ZBTA 2G0AA 3I9NA 3BB4A 2JAOA 1PJZA 3QYFA 1OI3A 4Y2VA 3LW8A 2I3ZA 3DBOB 5GPBA 4AUNA 5C31A 1L7RA 5CDFA 4DCJA 5JNSA 1I4DD 3Q7QA 1GPWB 3C2QA 1I14A 3LV8A 1WB9A 2Y1LA 1TCAA 3C1UA 3QITA 5HKOA 4P4TA 1AK1A 4QULA 4G5RA 1WCWA 1E2DA 2ZAMA 1ZINA 1T43A 2GYWA 4DUGD 3P9IA 3I39X 5JSQA 2H4WA 3C97A 5KTRA 2EEZA 2E4WA 3DAFA 3F5DA 3UM9A 1DAOA 2P2SA 2PBZA 3JTEA 4LFCB 5DBFA 4EG1A 4PIVA 1BMFD 1BO6A 1PFWA 3WRXA 4FWTA 4WOJA 1EZ1A 2L42A 3LQ2A 3ZVLA 2AHRA 4RPKA 1T2NA 2BOVA 4X1YB 2ZTLA 2Q27A 5A9SA 2EGHA 1GT6A 4AT1A 5K3FB 3MCVA 2NTEA 4H7FA 3WK8A 4BHTA 2PUGA 2FPRA 3FHJA 3D31A 3K70C 3RH0A 2DFPA 3P2OA 1SB8A 3EFEA 4WBNF 3R20A 1XUOA 5LXTF 1KZ6A 1FRVA 1RWPA 2VNKA 2XRFA 2C4UA 3OZFA 5FL3A 2DB3A 1CP3A 1RKXA 4L0QA 4OLJA 3P20A 3D02A 3H8VA 1JR2A 3GV0A 3PDHA 1XU7A 1T5TA 2JFWA 2W83A 2QW0X 4R3WA 4P93A 3WTBA 3N2ZB 1NXVA 2CSUA 2F7SA 5IYZF 1S2MA 2IE0A 1Z0FA 4YALA 3JXEA 3BICA 2Z8ZA 1T9GS 2H4JA 5G1NA 4IDBA 1QF7A 3AETA 3GLVA 1XLTC 4KXMA 1E32A 2VXCA 3USES 4XX0A 2VH2A 1UBCA 4ZEXA 3AFMA 4CQMA 5CFMA 3L79A 2JD1A 4PLFA 4B3SB 1AGPA 2NIPA 2WILA 3DV0A 4PLHA 5G3ZA 5TJ9A 4RXTA 5K05A 5BUSA 2ZKIA 3B60A 1XEWY 1RQNA 1XWFA 1TC1A 4Q1FA 4KWEA 1PR2A 2JCGA 4I5FA 3L6UA 4I1IA 1GZDA 3RVSA 4F6CA 3IRVA 3PGA1 2Q1UA 4OXYA 5IKMA 4G8DA 3ZY4A 1USWA 3ONEA 3JQ6A 3CS3A 4GGMX 4PPQA 5BVHA 2H63A 2QBYB 4OX9Y 1V3QE 1Z2AA 4YQYA 1JFRA 3AONB 5JAMA 5HKKA 2IV3A 1IIRA 1T29A 5IAJA 2ZCVA 1FXWA 3UCXA 4KQCA 2PEYA 4B3IA 3C5EA 5ALKA 1MAWA 1A5BB 1ZHFA 3VSEA 2JIRA 4O2BB 1YOVB 2C4VA 3AU9A 1FPQA 1U9CA 4GM1A 4UVEA 4NENA 1IZ8A 2BN4A 1IDOA 3U5TA 1ZJWA 2ZWMA 4KOAA 2WJVA 3NWEA 3VV3A 2VDNB 3DZIA 4TPKA 2E2WA 1SIOA 1VL2A 2N0SA 4OQDA 7REQB 2F3QA 4F11A 3W6NA 2LRHA 1VKHA 4PLWA 3QXXA 2J3JA 5AUPB 1A96A 1U3TA 2XVAA 3NB0A 2CHFA 4QECA 3OU6A 4I4CA 1T6BY 2X0DA 2AJCA 4B3FX 4J0FA 1BU5A 3PTZA 2J3QA 2H8GA 2Q4OA 1EDEA 4FNMA 1NKTA 4K9LA 3MGBA 1GKKA 2DJIA 1PNQA 3QMWA 3F6RA 4I5IA 3PICA 3UZUA 4DCUA 1O0SA 4MPTA 2O7VA 3O3CA 3ZGLA 1TO2E 3NVAA 1OTHA 4FONA 3DONA 2OC9A 3B5EA 7ABPA 4NMXB 4U2FA 4LMRA 4KI0A 2AZTA 4N41A 2O2CA 2QY6A 4R68A 2CVZA 2AWOA 3O8LA 1ULHA 1IHPA 1FSPA 3MJDA 4BNMA 5JROA 5CD9A 3SKYA 4LJRA 2GDZA 1LX7A 4NYMR 5DLPA 2ZUCA 4BRSA 3GNLA 2FEPA 1W73A 2Y3IA 4DNFA 5KJ1A 1DTWB 1IG3A 2VF7A 3BGVA 3CNLA 2OQVA 1P1IA 3TRFA 4KR2A 3K0CC 3OTGA 1UZUA 1A95A 1VOTA 5A2QA 1EBFA 4UBKA 1PS9A 3N74A 4FX5A 2QNIA 2BI4A 4LE0A 2B4TO 4DADA 4ZMBA 3OLCX 1W36B 2GRAA 4DM4A 2JFFA 2CKMA 2XQKA 3CEHA 4BKOA 5KOHA 1L7DA 5DLYA 4LDJA 2PUCA 4KB5A 4V0KA 4BMYA 1M72A 2A0XA 1R0RE 4PZ9A 5DOZA 2JAUA 5ESXA 1ECPA 4BFXA 5KNBH 1BWSA 3FF1A 2XVZA 5EIBC 4S12A 2RG1A 4L27A 4DDMA 1QGOA 2VRBA 1ZKDA 1LQTA 3A9UA 4LJ8A 4X41A 1V8ZA 3L7AA 4N7BA 3UJPA 4E22A 1CE8B 1V5IA 5BQXA 2JJ1D 4M83A 3A4TA 3VSBA 1R5JA 1S6YA 4NP6A 5KVSA 1Q7GA 2CWDA 5H3LA 2BIFA 4WXEA 3IBCA 1BQ3A 1MOZA 3E3OA 4R1MA 5DP1A 3C15C 3C43A 1BE6A 3EEQA 3T4EA 1AN9A 2PWBA 4N9WA 4EUNA 5ADVA 1JWAB 3F5SA 3PR2B 4RDCA 1TAUA 1MKYA 4KPUB 4LJ4A 5G41A 4Z2AA 4ZOAA 1NW8A 1UPFA 2PKXA 2WVAA 1LI5A 4YFVA 3LCMA 2VHQA 3CNQS 1HA3A 3PQ2A 3D5QA 5DHQA 1JEYB 2CGEA 4ZU6X 5FBHA 1ZKMA 1KVSA 1LNQA 4O4HB 4Q3DA 5LP6B 2HH9A 4E70A 1ZC3A 2DZDA 4EUFA 2ACWA 1AY0A 4P3OA 3EWIA 3HGMA 3DL2A 3KV3O 4GE3A 4H3HB 1YULA 3DBRB 2IYPA 2FUG6 2HMAA 1E3WA 1TEXA 2JCVA 1I7PA 3KR9A 3V1NA 1Z8HA 1SVMA 3PLNA 2JFPA 3CSSA 3KPJA 4JT8A 1TTQB 3B2NA 1QNFA 1CNEA 3QPDA 3MJSA 1SXQA 4G81A 3VZQA 4JQYA 1TT5B 3AEZA 1UM9A 4KSYA 4N3BA 4DBVO 1K6XA 1DHTA 5LCXA 3SBXA 1QZUA 3FI9A 3Q7SA 3L1HA 5DTMA 1GRRA 4TM8A 2V5AA 2BFWA 2PPLA 3WHPA 2ZWIA 4HP8A 4CYMA 1QRUA 3FTFA 4D9IA 1KP2A 1A8IA 4Q9AA 3T7SA 4GYWA 1OREA 3SF0A 3SR0A 1NUSA 5LWQA 1VJTA 1DXQA 1QHHB 2IEZA 4OUKX 1T0UA 3E5NA 3WADA 3F96A 4HFJA 1WMDA 3C8DA 3ZTWA 2HGSA 4ROTA 3CLVA 5SY9A 1KSGA 1YB1A 2CJYA 4FDTA 1K2VN 3FPLA 1I32A 4JNKA 1ZD9A 4NMMA 4DABA 4TWIA 5KX5A 2VQDA 2JHAA 1DG1G 2WE8A 1VRWA 4LEIA 2AKAB 2OYCA 3U3JA 1JKJB 1NHWA 2GAJA 4HDAA 3FPSA 2BFBB 1DEOA 1RLIA 5JMPA 2EFEB 4JJFA 4R0NA 2PH7A 3SXUA 3WK6A 1ORRA 1XCJA 4H15A 2DY0A 4WJLA 3QG1A 3OIVA 3ZVKA 4D8TA 3K5IA 4CN9A 3H04A 3W9UA 3D8NA 4Q7QA 1EFAA 1UEXC 4Y6PA 3DDUA 3GZTB 3PA6A 5HUHA 2CVOA 1G1MA 5TDHA 1KAHA 4PLVA 4P3PA 2PAAA 5C8XA 3PVCA 3S7TA 2P2YA 4KQ1A 1Z6GA 3TKYA 5U4XA 1QJ4A 4FCVA 4GXTA 3LYHA 3CXUA 5EKTA 2PMWB 4CMJA 2WV7A 1ZG3A 4QEDA 1RYZA 5SV2A 1YJQA 3AEQA 4NDNE 1X9IA 4H1UA 3TW6A 4F45A 3IXLA 2FX3A 1GZ6A 3IULA 1OYVA 2YFQA 5CHEA 5KSZA 4RVHA 1D0VA 2AOUB 3LE8A 3PC8C 3VH1A 2ZBQA 3W5HA 2BE7A 1AA9A 4OHUA 3TNLA 3ZZ0A 3BJRA 2AE2A 1LI4A 5ALYA 1X1SA 4C6SA 4EVRA 1U65A 4KXWA 3FOZA 1FUUA 3VVBA 4C30A 3IQWA 3TE7A 4I46A 3EK2A 4WVLA 1IATA 2R6AA 2V7UA 2WWXA 5B2ZA 3AM3A 4DILA 2QZSA 1CULC 3L9WA 1HE2A 1FF9A 3A25A 4IUCS 1FFGA 4LRXA 1JQLB 4YUXA 1CS0B 5FEMA 1THGA 5ERYA 3A32A 2BRUC 2JFUA 1P3JA 3FWKA 4LHEA 3WOHA 1U94A 2QN6A 4QDKA 5AR1A 1OFTA 1W9HA 5JARA 1ODLA 3GAFA 4NEGA 4X64B 5F5XA 5IBRA 4LF7B 3LH5A 1O95D 1U9IC 1G4HA 4H1VA 4A1OA 4ZKDA 4JLWA 3FVRA 2GAOA 2L19A 1R3UA 4AMVA 3LYAA 1P0IA 3OO1A 1W1UA 1JDNA 3QEJA 4IDNA 4ZU1X 1Z0JA 1XDDA 5M3BA 1WP9A 4RHYA 2V54A 2ERXA 2C2XA 2BCJQ 1CQPA 1PT7A 1Y48E 3L0DA 2FPPB 4C0AC 4C7XA 5ARBA 4QQNA 4Y1FA 2F8TA 1DWPA 4ER3A 5EJ8A 4K28A 1RMQA 3HMQA 4X1OA 1Q3TA 3MM4A 5AM3A 1ZGGA 2P62A 3KVVA 1ZAYA 1N2BA 3ZKWB 1MAHA 3HB7A 5JJIA 4X7RA 1X1QA 4RABA 4KGVA 4MUAA 1GM5A 5AVXA 2ZT7A 4R1PA 3AVVA 3C3CA 3DMTC 1DTEA 1PS0A 5FUBA 5A9SB 2I3DA 5D85A 3ROGA 2G4VA 1XL1A 3LBFA 4WI1A 4F04A 4Y8VA 1SN7A 1AQLA 2AEFA 4KIGA 2PWAA 3GCZA 3WGYA 4KUGA 5CFNA 3HXOA 4QXOA 5EJ2A 1I6MA 2ZUDA 3NIWA 3OH8A 4HHEA 1KOFA 4L5BA 3H3FA 1OH5A 1CIJA 1QIKA 2X3UA 1AKNA 1VM6A 4XM1A 1MO5A 1K6JA 4MVCA 4LVUA 1D3AA 3O8CA 4F38A 4NCBA 1ZH4A 1AKEA 1LTKA 1P7WA 4ZRNA 3GUVA 3DZBA 5FUWA 3D6VA 3T3DA 2IP2A 3KXPA 4D4LA 3TL3A 3KJNA 2UYYA 3QHAA 4PGHA 4OPMA 1TYAE 1P2BA 4HO1X 3JQ8B 4MWOA 2I7XA 2IZ5A 1F14A 4WRRA 3V97A 3TRIA 4E5VA 5T7BA 5TSDA 4W5QA 4G01B 1I1HA 2HU8A 1SCNE 4FYVA 2XXAA 1EP2B 1AXGA 2A0UA 2Z2KA 3LD9A 3R7NA 3ZHTA 5BOSA 4FFWA 2ZRLA 3QUAA 4CV1A 1CWUA 3STYA 4O25A 2VNAA 4RJIA 2ZIGA 4B7XA 5TS3A 5CM2Z 3PC6A 4UAVA 1MMFB 3VOTA 1UWLA 3NH6A 4BP3A 5IUNC 4WLUA 2L69A 3EXG1 4JENA 1XPJA 3WK5A 3W34A 1SOMA 2I4MA 3IE0A 3LCJA 2X1LA 1IUNA 1FFSA 4I9GA 4HJXA 1DO8A 2WTNA 5JHHB 5JR3A 4HR7A 1XBTA 3O90A 2FXIA 5A05A 1G5TA 2EWMA 3GOHA 3IKMB 1NL3A 4YRDA 1ATIA 2FW9A 1W1IA 5TQJA 3ZU4A 5DM60 1BA2A 1RPZA 4MW4A 1KI4A 1Q1NA 4YXFA 1XL0A 1UOQA 4KXFB 3T5AA 4X85A 3EF1A 1VYUA 3R75A 5JAQA 4JYCA 4MUXA 4ZJZA 2HZBA 4KRFA 4Q0MA 4M3NA 3EGDB 3K73O 5K8IA 5AXBA 4QQRA 4HB4A 2G7ZA 5A06A 2XTMA 1Z2OX 2Y71A 3ZD7A 1TIKA 4K87A 4PQEA 1GN9A 1RRCA 3GGOA 1CFZA 1YB2A 3GI1A 2P2LA 1K86A 1ACMA 1L5SA 2GLXA 2UXBB 2B83A 1KMCA 2X5OA 4LC9A 3OESA 2YIMA 1M1NB 4JI5B 3E9RA 1ICIA 2ZBVA 3CE9A 3LXXA 2Q3HA 2WIBA 3NHMA 3L6DA 2YYSA 4DQVA 1LBSA 3EGWA 2NW6A 2XRYA 5FIUA 2FSHA 3AVYA 4OXIA 5FNVB 3GLIB 2AH5A 3RRZA 4PTYA 1NMYA 4FDVA 4OHFA 5GOZA 2EQ5A 4FN4A 1Z4QA 3CO5A 5TPWB 4DG8A 3OZXA 3TTTA 1M8FA 1C3OB 5ALGA 3P0IA 3V4ZA 3AUUA 1PLLA 3TJZA 1GQYA 2DECA 3HLTA 3PB3A 1HKUA 3D6FA 4YO7A 3LXRA 4I19A 2X6RA 3NTRA 1ZU4A 3LCRA 2WVGA 3AY3A 4Z7NB 2JLZA 3F4LA 1U7PA 5CLFA 1E20A 2CUKA 4HLCA 3ZS9A 4BVLA 1ZD4A 1DJOA 2JD0A 4IQ0A 3HFSA 3UV6A 1CUBA 1P9RA 2JFZA 1WCV1 3O9VA 3BK7A 2ZJYA 1LWNA 3IOEA 3HN6A 3O8DA 4KXNA 5FTKA 3NVKI 3U40A 2VUUA 4Q4JA 1UCFA 5F1PA 3R9KA 3VU1A 1JDPA 2B35A 2DQKA 1ESEA 1YR6A 2XUAA 2ZYUX 2Q9UA 1T9BA 4NMHA 4OB8A 4PRZA 3TF5A 1LDBA 2E48A 2QXUA 5K0GA 4Y9TA 2R0QC 5KYWB 3RYCA 4ARSA 1CDEA 3P27A 3O31A 4FEAA 2EWWA 3RKSA 3NUGA 3OBIA 4AROA 3O1LA 2VAPA 1DL5A 3H17A 1YR9A 4YBRA 4TUYF 4EZBA 1C7IA 3P32A 3R3XA 4HVAA 4DHWA 3QOWA 4GSYA 1IBRA 4QQFA 5CVUA 4MA5A 4LKRA 1BXKA 2ZM6B 4QYTA 4DLRA 2FK8A 1RM3A 2BTOA 2LPMA 3PENA 1SBYA 5EQDA 4E11A 1ZX1A 4R8SA 4MVJD 1HDOA 2X4DA 4YCDA 2RGAA 3UTCA 4C3OB 6YASA 3OCCA 3FKJA 1JJ7A 3EIXA 3KHSA 3CZRA 2BEKA 3C8UA 1KAGA 5I5GA 1W6UA 2X15A 3SR4A 1P4SA 4MWCA 4HAWA 2W93A 4O33A 4E5NA 4J1QA 1THMA 3OT4A 3T6KA 4Z2YA 1JU4A 1DEHA 3QEAZ 5IWAB 2B3DA 3HCFA 4G26A 1PP4A 5FBLB 2FUNB 3AP1A 4BTVA 2YW9A 3M6WA 3IP9A 5JTUA 4LBVA 1CY0A 1OYWA 4L4YA 1CF4A 1EP3B 4WE3A 1NV9A 1I0ZA 2OBFA 4AF6A 2CLOB 2XCLA 3AI3A 5E8RA 3UW3A 3DHVA 4G1FA 3FWPA 421PA 4D3ZA 2O2EA 4ZGBA 4JJ8A 4L28A 1QYXA 2OR3A 3WGLA 3RFFA 3H7IA 3AUXA 3IAUA 5IZ4A 1UFRA 5KOJB 1CVIA 1YDWA 4I4TF 4MR8B 5EQJB 2CHEA 2IXEA 2NO7A 3Q0IA 1DIAA 4B8WA 2HWUA 4D42A 3CF4A 3RIYA 2O2XA 2PZFA 3QWHA 3DMYA 3B51X 4B31A 1T4CB 3GJ4A 2QAJA 2AX3A 2C84A 3TIXB 4W5JA 4RNDB 2G80A 3KJIA 2J41A 2LUOA 3DFMA 4NTZA 4ALLA 2ZTMA 3E3NA 2PSFA 4RAQA 5IJ9B 2XBMA 5A6SA 1QO7A 2H3HA 2G40A 3FXAA 4NQRA 4RKEA 5JADA 1I7QB 1BWPA 1UAYA 3MELA 4KH0A 5HKLA 4QVIA 3PC3A 4V0RA 3EPRA 4DVGA 3GUYA 8ADHA 1GPMA 2IF2A 3R3YA 2ILTA 1PL0A 5EZYA 1R9GA 4PNHA 1NMEA 1WSDA 3H1EA 1OI2A 3BIFA 4BDSA 5CYFA 4ACBA 4RDXA 3LXMA 3F78A 5F2OA 2C7VA 3X1KA 4KE6A 5IT4A 1XMJA 2J08A 1H3FA 3DHNA 3OD5A 5IBCA 4UHEA 5KQPA 3T7AA 2QZZA 1CYDA 3SSOA 3AFOA 3VR6D 1FS5A 2K6GA 2HSWA 2QM8A 2GBIA 3MHPA 4G5HA 2VNHA 4XAQA 3RRMA 1WNFA 2QE7A 1Z2DA 3IKVA 1OWLA 1YJ8A 1IEWA 1L1FA 3OU7A 4B71A 1EZ4A 3V1YA 4KQIA 1HDCA 5C4MA 4AD8A 2J30A 3ZV3A 1LNSA 1GU1A 4BCDA 1P5HA 4V38A 1TKAA 3N3BC 2JLVA 1XXHB 2ALJA 3CONA 1PT9A 3GG2A 4A8JA 2F2TA 1JEJA 2Q5IA 4WL0A 3R74A 3FYHA 3HN7A 5AWFC 1OXUA 1UBUS 1MPTA 2C1EA 3JQ7B 5JCZA 4JKYA 4EJSB 3IESA 1PZMA 1ZNQO 5EZ5A 3OOYA 2QG6A 3N1UA 3CGGA 4B43A 2C82A 3O2JA 3KM0A 2ZI7A 3JYPA 3WLFA 4F85A 2VJCA 3P4YA 4GOMD 4O02B 2WYIA 3PNPA 3QX8A 1T3ZA 5AHXA 2Y9PB 3V1LA 1VL5A 4PXSA 1W2WB 1ZHHA 3BQNB 4M7RA 3VR3D 1VSVA 2DT8A 4BNWA 1RIFA 5T57A 5YASA 5K3DA 4C4XA 2ENWA 1HRDA 1LQUA 1M75A 3IDOA 1FYWA 5I51A 2GD2A 2BEJA 2BD0A 1ZYUA 5FUYA 3TVYA 1IE3A 2QL5A 5LNK1 5L3SA 3RIGA 2QP4A 3SQLA 3IAXA 2R5WA 3ETEA 5K99A 1TQ4A 2WF9A 4N12A 1D6MA 1YC2A 4U8GA 5KKCA 5FX2A 2J0SA 4RKWA 2PANA 3ZV7A 3PGVA 2VJMA 1NLMA 5CLQA 1N5OX 3KE9A 1R4MB 1W75A 3P19A 4RDHA 3ZBQA 1G8PA 4M36A 4FYPA 5COQA 1F4LA 2YWEA 3EJWA 5LLTA 2D0PB 5A5VA 1GG9A 2DTEA 3JQAD 3HWX1 4XJTA 4GPIB 3T0FA 2V6IA 5DYNA 1ORVA 1TXGA 2QYHA 4ZZ0A 5HM6A 3D1JA 2ZUWA 5KREA 4CQNA 3HKEB 1Q2UA 2R6FA 1QH1A 1Y1RA 3KQHA 3CX6A 2P9JA 1XD8A 3WQQA 1E2BA 3VSAA 1CUIA 3FKSD 4XEUA 4L78A 3G8AA 2ADOA 3PTAA 4OMUA 4LMPA 3DOIA 5B3AA 1NF9A 1E99A 4JLAA 3GDOA 1JIIA 2I34A 3IHWA 4K0KB 3IP3A 1G59A 5BXYA 4M0UA 4QSMA 5L3QA 4IF4A 1P2TA 4TN1A 4ES6A 2I54A 3C6ZA 2OGWA 3I0ZA 4ZK2A 3KQUA 5K3EA 5H5JA 1L8OA 1U0OC 3DEIA 1AD2A 3G9ZA 4HWPA 1CF9A 3TDKA 3DE4X 2BR3A 1I4LD 5AVWA 4JMPA 3WLTA 3LT0A 4P53A 2EATA 4OTZA 1W52X 4GI7A 3WYGA 1JLRA 4UTPA 5LQDA 2NV6A 4F72A 4IHKA 1T0HB 1ZIXA 1OB2A 3RUDA 1B73A 2GCGA 4TKZA 3RC1A 2BFFA 4EYEA 3WE7A 3IUJA 1EEXB 2ZCUA 3D3QA 3ZXYA 1YJBA 3V00A 1OXSC 3GA0A 2O0JA 1XK6A 3SJZA 1AUPA 1S2NA 4HI0E 1KJ8A 4BGVA 3BT7A 3WAJA 2Z6QA 5FBQB 1BX0A 1QF9A 3FPHA 3H1PA 4LMBA 3UA4A 4D9JA 4NJMB 5K8VA 2MSWA 2B8EA 5COAA 3CVYA 1WHTB 3OI7A 3DHWC 3PVZA 2AQ8A 2VSOA 2AMVA 2VC2B 2V7VA 4FLFA 4OSPA 5KYXA 4W9MC 3FWYA 4NCAA 2MT9A 2PKYX 5LKAA 1RE0A 3SQDA 1E9BA 2BM0A 1NONA 2BT4A 2C8LA 4OU4A 2B1JA 3KOXA 4H77A 2Z4RA 4EKNB 2WNSA 2VYFA 4RS3A 3NEAA 1DWUA 1VLHA 3HDJA 1E6LA 4NPHA 1YK0A 5BRAA 4V1CA 3H1FA 1VL6A 2P90A 4Z4EA 4D99A 3OJWA 2ZI3A 2YFYA 3IMEA 4OX9B 1HFEL 3RKRA 3NANA 5TF4A 3Q8WA 4QXQA 3VHXA 1N5LA 2A5DA 4YYEA 3HJRA 1MO2A 3ACDA 3AOEC 4JIGA 4A23A 2O0LA 3MB5A 4WJZA 2GCOA 1PTKA 1ZZEA 3NDRA 4LZWA 5CH3A 2XNDA 1XKLA 1SCAA 2WYUA 3U62A 2BBOA 3TLKA 1L7NA 4C22A 3TIGA 3DNPA 1RAGA 4C5AA 2VPTA 1AT1A 1N5IA 4CF5A 3FR7A 2ZU6A 1BEUB 1EYZA 3KUUA 4DSOA 3HS3A 2XMDA 2HT1A 3BSSA 3HKBB 1EK0A 1GL3A 3STUA 3LQ4A 2XB8A 4C03A 2X5XA 4OF4A 4RK0A 4WK6A 3WYDA 2BHNA 1Z5WA 2ZUBA 3F4KA 2GFQA 4O3FA 3GRAA 4D0SA 3JWJA 2P68A 4ZVPA 4TMYA 1AUXA 4HFRA 1CZOA 3KSZO 4HMOA 4IJ5A 4KNVA 1H22A 3H99A 4DMLA 5JZVA 1FFEA 2MMGA 1KFKB 4FDUA 1EUZA 1H93A 3JQGB 3IEXA 3RK1A 5JVDB 1J7KA 2QN9A 5B37A 5JLAA 1CUHA 2OM6A 3T8YA 4MPPA 3LL4A 1EVJA 4FXOA 2NQ2C 4ZDKA 5EESA 2I6TA 1B0AA 7YASA 4HBGA 4G9EA 3CUEF 4RE5A 2R1TB 4TRRA 3SZ3A 3W5CA 3UMSA 1A3CA 1F51E 2HN9A 1XAHA 1HEYA 5SICE 5JRJA 3N2KA 2HC9A 2WSYB 5FUMA 5DYYA 3WG9A 3DOEA 1U1EA 4YRRA 1BC5A 1EVZA 3AJ9A 3NHYA 1KZ4A 4MV0A 4RVFA 4R9UC 4B9EA 4EHKA 1U6IA 1ZISA 3BORA 3NXSA 4JA0A 3KU4A 5AJWA 5T67A 4BNDA 1Q1EA 2WP0A 3N9IA 1EJBA 1Z63A 2NV0A 1KGDA 2VOEA 5J4HA 2EIHA 5F98A 2XT6A 3CWCA 3EZLA 5BUQA 2YWRA 3QXGA 4H18A 1G8FA 4YR7A 4NHOA 1KOJA 3S0JA 5DHRA 4CW7A 1E9VA 4OFZA 1YXMA 2V6FA 2D2XA 4IUYA 1ZSVA 4X8MA 4ZMSA 2VDKB 4HX9A 4FW8A 4IJKA 3PWSA 3OKPA 5C1DA 2IHVA 1GQRA 2JHCA 3LOQA 4ZK6A 4FYXA 3K0CA 3HY6A 3TSYA 3DYVA 5FO1A 3B2EA 3CURA 5BR4A 4EYGA 5BQFA 1HR0B 1JR6A 3KQQA 4CBVA 1YDHA 3PKJA 5KI6A 4RCVA 2PHZA 1SBHA 4LIPD 4RKRA 2H85A 2GCPA 3JAMA 2WIAA 3UCFA 3NETA 4KDFA 4EITA 4WADA 3IIMA 1ZI8A 4MQFB 1W46A 5FA8A 1E59A 3L18A 3S99A 3WTCA 1R0CA 4KR9A 8GPBA 3FZYA 1XTIA 5AVKA 3IJ5A 1V5WA 3MJTA 4DVJA 3VH4A 1E1RD 4NE7A 3O94A 1RYBA 3QPUA 4DEVA 1XZPA 4BVAA 5CAEB 1SO8A 2Z9DA 4O29A 4QTUB 4HAYA 1NZFA 3L4BC 3LIPA 4KXYA 4OXRA 3QU7A 4GM4A 4XQCA 1XO1A 2CMKA 3IUPA 4ZI2A 2C8JA 3M9LA 1A9SA 1OT5A 2PRIA 3NGMA 4YJKA 3RQSA 2ZIEA 4AN4A 3SC4A 3AW8A 3R9IA 3EA5A 1JR3A 1QRSA 1GG2A 4U00A 3MUFA 3QUSA 5LZ5A 1B2LA 1FP4B 1SM4A 4MGKR 2W2QA 3PGJA 2V8BA 5CJJA 1ZONA 4CKCB 1YL6A 2ZTVA 3U0BA 5EE0A 1MVLA 1K92A 4YV7A 1U0EA 1YL7A 3E1KA 4KWTA 2YNMC 4TYMA 2IV2X 3W05A 1E0AA 3IOBA 4KBYA 2F17A 5HIAA 3U3XA 4B7UA 2CXNA 1T36A 4LUCA 2O4CA 2NUAA 2IUUA 1I0LA 1RQLA 3DOOA 3WO1A 3UB3A 2Z4TA 2NZUG 4YRFA 1P1BA 2ZRKA 1KIFA 2O8CB 3K09C 1E60A 3QEOA 3LW7A 3LX5A 2IPMA 2XCTB 4JI8B 5ERXA 3OQIB 4G0PA 5T5QA 2FWBA 2ISQA 3GOQA 4DMKA 1X3SA 3JAKB 2O8EB 3HBNA 5DM0A 1NSFA 3H05A 4Y9UA 1CF2O 3T3MB 4CNQA 5IM4A 2WA2A 2NT3A 3AILA 3UHJA 1ZUIA 3PDCA 3R6LA 4FR0A 4ENQA 4XVCA 3CR7A 1NN5A 3RG8A 5ICMA 2IEBA 4N5IX 5F2EA 2ZBEA 1NT2A 5JCJA 2XXBA 2PLFA 3N6XA 1ZH8A 2J7PD 2Q4EA 3NI2A 1OV4A 1B6RA 1TMGE 3QU9A 3O4JA 5EE5B 3R2JA 1X7ZB 1G8HA 2YHBA 1JH8A 3N87A 3CUVA 1U8YA 1A9PA 3TQCA 3IQXA 4D9CA 3CISA 1H2ZA 1YQXA 2H4ZA 3KUKA 1MX9A 4E32A 1TVKA 2M98A 3S2EA 5EIOA 1ESNA 3SYMA 2EGGA 5DK6A 3QMMA 2P6RA 5IARA 4G0VA 1XHFA 4ZI7B 4ZICA 1J8QA 1RQPA 1J2TA 5JBIA 2KJQA 1UH5A 4RJLA 5FWNA 3NNNA 2IYYA 3G2JA 2HIMA 2RJNA 1CQJA 2JRLA 3KEMA 3I5YA 3VDMA 3DG9A 2DPXA 1KR2A 3N2EA 1H1LA 4I55F 4J4TA 1CX9B 4L07A 4TMTA 3HO8A 1EX1A 3L02A 3A36A 2XPCA 2F9MA 2QSUA 2O7NA 2OK8A 3WDKA 1C0EA 5BORA 2YVUA 2Y9MB 5C1PA 4DLVA 2P2GA 5DGXA 1YS2X 4KREA 1Z6XA 2QTVA 3NATA 5DWQA 2HD4A 3OE7D 4WBNA 3ZCSA 4IVNA 2RJOA 5LXTA 3BFKA 4ZYWA 1DQYA 2Q4BA 1JPUA 3PC8A 3O7MA 4BTEA 2V6BA 4G07A 4IX9A 3VAZA 4G5GA 4YMHA 3MRVA 4E5SA 2D1FA 2PGXA 2YR0A 1XIVA 2V4UA 2ZYIA 4EB3A 3K0FA 4CEJA 2H9AA 2QA5A 4LRQA 1YRQA 3DWEX 5FADA 2RGRA 4NOMA 1FA9A 5IYZA 1VPWA 3AJ8A 2XB2A 4RGBA 4YCSA 1E5VA 3IMCA 4YROA 4MMXB 2JAHA 4EI9A