1YDHA

X-ray structure of a lysine decarboxylase-like protein from arabidopsis thaliana gene at5g11950
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
184
structure length
184
Chain Sequence
QRSRFRKICVFCGSHSGHREVFSDAAIELGNELVKRKIDLVYGGGSVGLMGLISRRVYEGGLHVLGIIPKALMPIEISGETVGDVRVVADMHERKAAMAQEAEAFIALPGGYGTMEELLEMITWSQLGIHKKTVGLLNVDGYYNNLLALFDTGVEEGFIKPGARNIVVSAPTAKELMEKMEEYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords At5g11950
publication title X-ray crystal structures of the conserved hypothetical proteins from Arabidopsis thaliana gene loci At5g11950 and AT2g37210.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 60
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 3.2.2.n1: Cytokinin riboside 5'-monophosphate phosphoribohydrolase.
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03641 Lysine_decarbox Possible lysine decarboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ydhA00
3PFKA 4U1RA 4OHBA 1F8YA 5AJUA 1YDHA 1MTOA 4FYIA 1WEKA 2Q4OA 4KXNA 3UQZA 3F5MA 4MEJA 4LJLA 4OHRA 4PFKA 4LJRA 4I36A 5AJTA 1S2GA 2F64A 3QUAA 2IZ7A 2A33A 1F8XA 3O8OB 4WL0A 2HIGA 3GH1A 4A3SA 4I4IA 2PMBA 1S2LA 1S2DA 4KXLA 2F48A 3OPYA 3BQ9A 3U39A 3IMKA 2F62A 4FYKA 3K2QA 4KXMA 4MCJA 2Q4DA 1RCUA 2A0KA 4P5DA 2NX2A 2IZ5A 1KZHA 3SBXA 2KHZA 3O8NA 5ITSA 2IZ6A 4I7EA 4NPAA 1T35A 4LJKA 4JEMA 1ZXXA 3OPYB 4P5EA 3O8OA 3EHDA 4HX9A 2F2TA 2KLHA 4JENA 4FYHA 4RH3A 1S2IA 1PFKA 2PFKA 6PFKA 2F67A 1S3FA 3O8LA 4JELA 3HNOA 1WEHA 3MAJA
chains in the Genus database with same CATH superfamily
1AQLA 2OHFA 3KKKA 3OEWA 1H66A 4GX0A 1AD2A 1E6LA 1ZSYA 3S5UA 4X8LA 1BJRE 2JJQA 3O9ZA 3LUGA 2HHJA 1CEEA 3EZ6A 3GEEA 2QN6A 3LTNC 2WBLC 5A05A 1O8CA 4Y2QA 2P6UA 4IKOA 1U3UA 1H9AA 1NF3A 3B6IA 3KB2A 4XDGA 3SIWA 5LM3A 4A4DA 1G5IA 1GPJA 2QOEA 5ADHA 1XRSB 1BH2A 4QGFA 3ZGNA 4KITB 3LNCA 1ABEA 2YN2A 3FDZB 1BWRA 3MN1A 5DHFA 4B4WA 3WP1B 4FKBA 1TU0A 2R7AA 3H99A 1XKTA 4IILA 1J2YA 4GNKA 2GPTA 1DRJA 1C7QA 2DBZA 2QZPA 3HKCA 1KPIA 4LOLA 1X7XA 2WHPB 3CEAA 3PHGA 4Q4DA 2BP7B 2ZQYA 1RE1A 4G4JA 4GOLD 1CB0A 5B3AA 4S24A 1KWGA 3B5IA 4PR3A 3FWHA 3A7DA 3VR4H 1E9AA 1K5HA 1R6BX 2OQIA 1WKBA 4EW2A 4HDRB 5C31A 2Q29A 1OA0A 4R05A 4URWR 2PVCA 4F06A 4DMMA 2WKWA 1TQ4A 1WDMA 2HXGA 4HDQB 4JYBA 5CCEA 4KPUA 4XGKA 3ZV7A 2P62A 1DLIA 2VSYA 2YY6A 3TQFA 3AFIA 1PVVA 2WSYB 4G0PA 1FRQA 1SVNA 3NRCA 1A7KA 3E0QA 4FM9A 3KHTA 1C0PA 3WAJA 2YJNA 4K86A 1FYEA 3LDAA 4DDKA 4DMKA 1MO4A 1XKXA 2YHBA 2ZRMA 4FX2A 1D5CA 5DCYA 4QRIA 3FHTA 1JG2A 1FFBA 3I28A 1JF8A 3ETLA 2BUAA 4XW2A 4WBSA 2C58A 5CDHA 1GTRA 4UTVA 3DDUA 3F9RA 1ZOIA 3WFZA 3W9YA 4DT1A 4ENPA 2CB0A 3KPUA 3PYLA 1XA0A 4NDAA 5FPQA 4CV0A 4FONA 3W4KA 5KWSA 2WPNA 1IZ9A 1XMJA 2IYOA 5CFZA 2XOKD 5DYNA 3TZEA 4QUIA 4YRTA 1T9ZA 4Q93A 3QXCA 1C3EA 2CUKA 2E48A 2JANA 1KO1A 4UM7A 5CIQA 1XO1A 3PYMA 2I2XB 1OBVA 1TA0A 2VIIA 3QW4B 1ZN8A 4JJZA 4F38A 4OJNA 2P6RA 3IHLA 5H0IA 4MJLA 3BSSA 1XLTC 1ZN2A 3KXLA 5EJEA 2LRHA 2EFJA 2AHRA 2XF2A 3WBBA 2HK8A 2GPAA 3GK3A 4AB1A 4AZTA 4V2UA 4C89A 3LPNA 1QHXA 1VJCA 2PUWA 3LK7A 4Z4FA 2PSEA 2J6CA 2A1UA 1IY0A 3D4PA 2CBGA 2GZ2A 4QA9A 3WDSA 4GLFA 2PFSA 4MA4A 1KYQA 4YRDA 3KV3O 4DDVA 3T35A 2VJAA 3MWJA 4MZXA 2QQGA 5DMXA 4FB5A 1GTMA 2V4UA 3ECSA 2CLOB 5TR9A 1SCNE 3AB8A 2PNJA 4BQPA 1I0LA 2GNAA 5I4KA 3ZEIA 3AHJA 5GIPE 1DCKA 1DLJA 1ISJA 3CLRD 2AEJA 4FFSA 1Z2CA 1IHUA 1WWKA 4ZZ1A 1JU3A 2X4DA 3TZKA 2CSUA 3KEMA 3JRWA 5HUQA 2RAVA 1XZDA 3N70A 3W2IA 5BYKA 5IYZF 1H6AA 2RJNA 1FFXB 3S40A 3L18A 5AW4A 1DVRA 3KT3A 4XI9A 5EZ5A 3VV3A 2L18A 2O8FB 2WR8A 4R98A 1YAHA 2YDYA 5BNTA 5ALWA 4HAZA 4C7KA 1KEWA 5BSMA 3E9NA 2Y4NA 5H4GA 4C0QC 1OXVA 4YRIA 3IE2A 4F04A 2J30A 2J3HA 3ESXA 3A27A 4Q9NA 2JCXA 2BKLA 2IUSA 2QSJA 5ARCA 5MN6A 3WYDA 4AULA 1FBNA 1YUNA 2M32A 4CU5A 3VTFA 1KY2A 1B8PA 1CPYA 1VB3A 5KQSA 2O6LA 3BL5A 4YACA 3O9MA 4E07A 2Y92A 1YVEI 2FZEA 3BXGA 1PP4A 3WYGA 1I7SB 1LV8A 3WGMA 4IIFA 4MVJA 4Q1VA 2DBYA 4ZRMA 3L7YA 2XDQA 1S89A 2AF4C 3JYHA 4Y0AA 1LX6A 2FPGB 3DE2X 3PUIA 3GDOA 1IHDA 4O2AB 4LF7B 4B3CA 2ZRAA 4D6YA 2QX8A 2CL5A 4FSXA 2CK3D 2FVYA 5TGZA 4OI0A 2LIVA 3LC0A 2CYBA 3LUBA 3M49A 2MSKA 2MJLA 3NDPA 2EYQA 3O26A 4MHTA 4JP2A 1QHIA 1DT3A 1FXWA 3P2OA 2WWTA 3PVCA 1Y3FE 2HJSA 4G97A 5KSYA 3TUJC 4X66B 2GHQA 4N8EA 4QGBA 4D97A 3WLJA 1DAOA 4E2WA 3IQXA 4KLZA 1P1RA 2QTFA 3VSBA 1SQ6A 4J1QA 3CZRA 3PJFA 3I83A 4HDKB 4WK2B 4WH0A 4M88A 4AFNA 1QK3A 2I1LA 3OQMA 2GRUA 1XJ5A 4EB6B 4CM1A 1G6Q1 3HU2A 1H6CA 1TYAE 2ZB7A 1QUFA 1R6DA 3GB9A 2E1RA 4I19A 5E3JA 5E8JA 3KQLA 1CUHA 3IELA 4QYXA 3VVMA 3R3ZA 2GAJA 4O3FA 2W6JA 2VQ6A 2BGGA 4OQDA 5CDYA 1U9IA 4D0GA 5I4BA 2IH2A 4UDXX 3AYZB 2IDJA 4JITA 2B5VA 3N2KB 3WRXC 2LIPA 1JVBA 1W6RA 2ISCA 4LXHA 2X5KO 5D3MA 3DHVA 5B1HA 4GWGA 1G3RA 4EOGA 2JJMA 2IYTA 3REGA 4D80A 3EAQA 3KJIA 4YO7A 5KJCA 4D43A 4CU2A 1V16B 2ZJ1A 4M98A 4NH4A 1OBOA 2I7CA 4AT1A 1KO4A 1H5NA 3VI4B 5CFOA 2XSZA 4URVR 1KEPA 5FR2A 4E6EA 4OSPA 2QBYB 1UDWA 3U40A 1WNTA 2IYXA 2XUDA 4EK9A 4RZQA 1SXPA 3H83A 5JAQA 3WV5A 4G5FA 4DB4A 4ALKA 2YN4A 4Q48A 4QFMA 4BO3A 2QE7A 2XUKA 3NCTA 2OAGA 4KQ9A 4RU1A 1CYDA 2VRCA 4FE4A 5CR9A 2Y1EA 4XVHA 3EVAA 4DJDC 4GS5A 4ESHA 4HB2A 1YH3A 1D7AA 1KMMA 5COAA 5KCMA 4EW6A 2X76A 2WF7A 1FTSA 1E4EA 2PX2A 4KWHA 4EHAA 3GQVA 3NLLA 2P2DA 1FMTA 4B44A 5KYNA 2XMRA 4IEFB 3SLRA 1U3TA 1B1AA 1L4FA 3T0GA 1LI7A 1Y6QA 2OCGA 3EXHA 3KYDA 5K0BA 4X84A 2G9QA 1TKRA 2GYYA 1L4EA 4PLTA 2YKGA 3Q0TA 1M6HA 4ZGBA 3QI7A 3RRYA 4CODB 1Y1KE 2NZXA 3C3AA 5ADUS 5DI3B 3QV1A 3Q3IA 3OD5A 4GKVA 3QU2A 2VKTA 2O8VA 2QY9A 3JYPA 4X20A 4OKSA 2JVIA 1L5KA 2HPVA 4PO3X 5HS4A 1C3JA 2Q1XA 1KI2A 1A77A 4DV4B 3GUVA 3WQBA 4F4UA 4HEJA 1RRVA 2AZMA 3ES9A 3NBFA 4IV0A 1Z7WA 5E9AA 4BLRA 2G08A 1JFFB 4C6TB 5JZBA 3G9UA 5GADl 1NKTA 4IVNA 5J2TA 4UJ5A 5A4MS 3WGTA 3P9IA 1ZAYA 2CJPA 5L4SA 3T61A 1FVFA 3HLKA 3A6LA 1PL7A 3H1EA 3DDNA 5DHQA 1DQSA 1BZYA 3RTBA 2PS9A 3UUFA 1P2UA 3CLHA 3JU3A 1E1QD 2D2FA 2I5PO 4FX5A 4JGBA 4TQUS 1YZUA 3T4XA 1TZKA 2XCQA 2ST1A 4LSWA 3QLUA 5F3RA 1YMUA 3U26A 3ORQA 1N9GA 1Y3CE 2HDNB 4TWZA 3NHSA 2Z8XA 4KDCA 2FDXA 2VPIA 3FYUA 3UZUA 4E09A 1BQ4A 4EKYA 3ZHRA 4YT8A 5CDUA 4WUTA 3K8ZA 3SDBA 3UMYA 3EQ7A 1A95A 1JGTA 1PR3A 2CUZA 3GPBA 4NV3A 1L4BA 4P7JA 1JWLA 1VL1A 3V4FA 2C94A 5C4GB 2Q5IA 3PITA 5D5HA 1L7EA 1PS8A 4M1YA 4EG6A 1KFBB 1SBQA 2JASA 5JHHB 2GPNA 4I4NA 2J4FA 2JD1A 2R65A 2C9MA 4WGFA 3TTYA 1OFUA 3BH6A 1MF7A 1H0RA 1SCDA 3QF7A 3KB6A 4UEKA 3U4QA 1USKA 5DV9A 4OM8A 1LUAA 4RULA 3MUEA 4B84A 1J5PA 1S2NA 1KDRA 2EBUA 1G59A 2OR3A 2YHIA 3V8RA 3RIEA 2BY4A 2PG3A 3UWOA 1EP2B 1SPBS 4XCVA 5CPFA 3AUAA 1NV9A 4JL8A 1AU9A 4OP2A 4NNJA 5LB4A 3W9SA 2XTMA 4BQNA 2IEDA 4KIJA 4PIVA 2VP2A 3PYXA 5BNZA 5C9ZA 1J8MF 1M67A 1V7QA 2QRNA 4IIYA 5DB4A 1P9OA 5EUQB 1DWUA 3DQZA 3WMXA 4D46A 5C81A 2Z2IA 4C6SA 3DA8A 4HGNA 1L3BA 3PGXA 1FPMA 3LQKA 1J70A 2CUNA 1PS0A 4NC9A 4RJIA 1NXSA 1Q6ZA 3OX2A 4UNSA 4IVQA 3RH0A 3W1EA 4X9XA 3OHSX 3ASZA 2JVJA 4MIYA 5JDIA 5FTLA 2Z9CA 4RDHA 4H7EA 1FRVA 1YDEA 4UHDA 1M34B 4POAA 4Q7LA 2JI4A 4B4VA 2ZJYA 1R9JA 4RKRA 1FUKA 4RTLA 2GM3A 5HYVA 1ESCA 4KTVE 4S1PA 1DC4A 3ZGYA 1UPXA 3SQNA 3P2KA 4CG3A 3LA6A 4U0JA 2AX4A 3PX2A 2BI7A 5FOSA 3I4LA 3KKLA 2FSVA 4JR2A 3KB8A 2Q3JA 2I1WA 3FHJA 4MW2A 5L7YA 1EEXB 3ZTWA 3CE6A 4GECA 2FGKA 4D42A 3OCCA 4UTXA 1XMSA 3ZWYA 3R74A 1WO8A 1PNTA 5C1DA 3L0ZA 4JCOA 2PLAA 4WTOA 1BS1A 1Q20A 1U3VA 2OV6A 5DTRA 4DEVA 4CF7A 3MIZA 3U16A 3QNWA 5GZ3A 3SEFA 2PX8A 2Y9MB 5J4HA 1P75A 1OC4A 3QPWA 2ZI9A 5C5IA 1LSJA 1F4PA 3LDUA 2ZVJA 5FH9A 3WYAA 3IP3A 3RADC 3AHGA 2IK8A 4XIYA 3Q0IA 3LLUA 3NHFA 4WOKA 4EZEA 5HKKD 4MV6A 2INGX 4P08A 1KFKB 2NUPA 4U7FA 3GEDA 1ZGBA 3WKCA 3M6WA 4G5QA 1D03A 2Q50A 5AQ1A 2BGTA 2H4YA 3ZY3A 4IFEA 3ZXIA 4FT4A 2OCLA 4YJGA 2C5GA 1P5ZB 2CMHA 3Q3HA 4GAEA 4NULA 1K6XA 2RFLA 3ELYA 5EESA 4ARUA 3K1ZA 10MHA 4AG6A 5BW8A 1R8XA 2PSSA 5LDGA 2YVQA 2V0NA 2BEWB 2WMYA 5B3KA 4GKJB 5ALLA 2O8FA 4KAAA 3ZQ4A 4WEOA 3THSA 1RI5A 1XL0A 4ZYUA 2UYCA 4OUDA 2C9CA 3UGQA 3JYOA 4QRDA 3HKDA 3IMEA 1ZA1A 3G85A 2QP9X 5L6MB 5BN5A 4HBGA 4IIVA 4PWYA 2J8ZA 4TT8A 1YE8A 5LR6A 1YHYA 1RAGA 3AHDA 4FDUA 4HADA 2V4ZA 1IM5A 2R6GA 1J8YF 1LBEA 2V7VA 3LMKA 3ZZTA 2QM3A 3AL3A 3TZQA 3GXBA 3U7RA 4D4LA 3EXEA 3V2GA 4LMBA 3UOWA 3RANA 1U9ZA 1PAUA 4CMAA 5IX8A 2GAAA 4PLVA 3ZTYA 5JO9A 2H2WA 5JAHA 2Y99A 4L08A 3OUUA 3TNLA 2I4MA 1CC1S 1G21E 2WSSA 1IN5A 3LZ6A 6Q21A 3WY9A 3N28A 5CYFA 1SVOA 2VDUE 1OMOA 5EKUA 4ENWA 4NAHA 1TF7A 3R7BA 3ROMA 5JARA 2YFHA 4DDHA 2IZ5A 3TRHA 2F59A 5JDCA 5ICMA 3ZDDA 1GTG1 1USGA 3UJNA 3AV3A 3O8DA 2RC5A 1V5FA 2Y71A 3CJQA 4PPQA 2QTRA 3T8YA 3BA1A 1IEQA 3IT0A 4JBHA 3ZXUB 4EHNA 1QRSA 3OCJA 3AETA 1ZUD1 5CA1A 4XYEA 1E0AA 2NUBA 3OA2A 3VZSA 3OSUA 3KQWA 3L07A 4RV4A 1GPLA 4WXYB 4YT4A 1E1RA 3A6PC 3V4RA 3I2YX 2X42A 3FYSA 1T25A 1JYSA 2ZSJA 5AM4A 3RU9A 4HV4A 1C3XA 2BF7A 4M0EA 1SEPA 3A1VA 1FNDA 1YBFA 2GEBA 2QPLA 1QH1B 4ZOLB 4CMIA 3I4CA 1HZZC 2B92A 2Z0MA 3BEOA 3CTMA 4IMPA 4LX0A 1ADBA 4MI3A 4YC7A 3T5DA 1Q2XA 1T4DA 2V6MA 2Y27A 1NX9A 4WFQA 2FWPA 2NTJA 1R5BA 2WPDD 2ZGVA 3ILXA 3OH8A 1ECJA 1JHAA 2P9TA 3IEPA 5LP6F 1RW4A 2VLBA 3B70A 1CUSA 1GG5A 1LSOA 2JLBA 3B1JA 5CHEA 1KSJA 4D57A 1A1VA 5HM6A 3MSCA 2CCGA 5E1DA 4BEBA 1RTKA 4KJZA 1Y9EA 4GBMA 4MLCA 1Y4SA 3MJTA 3UPDA 4EEXA 1TYZA 1H5QA 5BWOA 1IUKA 2CSXA 5SZKB 3A0RB 4IXWA 5FX2A 4NBKA 2BZ1A 5FBHA 1P3JA 1PK9A 1YCHA 1K6EA 1YB7A 4A5OA 2XVAA 3GT3A 2GLXA 3H16A 4ZT2A 2QTVA 4B83A 3G2IA 1Y6RA 3FKJA 2QLFA 4BUZA 5LMUB 1R6VA 2NXWA 3DMTC 4WOBA 5FCDA 3JSAA 1SC1A 3UC9A 3WBJA 4QHTA 3QH4A 2QT9A 5E0KB 2PPLA 3AG5A 3EW7A 4X1YA 4JI3B 1Q0TA 2NOAA 4HUJA 4G0WA 2L19A 5L9AA 5HGXA 1ICIA 4TUYB 5ABPA 4K9NA 4URZR 4PFQA 2GAIA 2B61A 3CRNA 1ZUHA 4HEHA 2ODEA 2PIDA 3SSAA 3QUCA 4GRAA 3PDUA 1FFCA 1Q0LA 2ZIXA 3GI1A 1F0KA 1PGJA 3OF2A 2CXUA 4FNMA 5EWMB 3M9WA 5AUNB 4YIHA 3ZUPA 1T2VA 1R0ZA 3RU2A 3L9WA 3SE7A 5KQLA 1L1RA 5HFAA 4QXAA 1NQUA 2KB0A 1PJLA 2A5FA 1YRYE 5AJVB 1LXCA 1UP7A 1YQUA 4G1VA 3GJ3A 1EFAA 3PGLA 4MLDA 4RK4A 2VYVA 4P82A 1BHO1 4XWYA 1LZKA 3SAJA 3D43A 1A71A 1FUEA 2P9GA 4IZOA 3RC7A 3LUHA 2H52A 3OQVA 3QX7A 3SSOA 4CMJA 1E0SA 5JYCA 1PL0A 1P1JA 4KUHA 4UDNA 2UUCB 1NGSA 1PK8A 1OV6A 1U2ZA 3HO8A 3ROEA 1KEZA 1B14A 1Y1PA 4J0EA 2RGAA 5AT1A 5CD1A 1U7PA 3KOXA 1D9ZA 1COWD 2PZJA 4GYJA 2NUAB 5EWJB 5EIHA 2IV2X 4Q7EA 3DFUA 4LZZA 4BTVA 4DG5A 5FWNA 1YRWA 3PNPA 3QEJA 3OPYA 4J75A 1N2SA 1JRLA 1JG7A 3K0EA 2F43A 1VKJA 3HABA 3C7AA 3CNLA 3PFFA 4JLOA 1GGEA 2F1HA 2B3DA 1QFJA 1YDMA 3NX4A 3N5KA 3PK0A 4IP0A 1ULAA 1MN6A 1BN7A 1Q57A 4E2FA 5C1IA 3KQHA 2CLKB 1WBDA 2ZB4A 5HHTA 5I5GA 1X1TA 2CLIB 2ILVA 4GLLA 1D2CA 2J1LA 4NS4A 3FUUA 4LXGA 4B74A 1O5OA 4B3RB 1ZMBA 5B1DA 5KJ6A 5DIFA 1T6BY 3K9WA 3MIIA 3OOJA 4NDZA 3NAQA 3TI9A 4B43A 1HE1C 4MJ7A 3AEXA 3NKFA 1ZX1A 2ZSFA 2AE1A 4RWEA 1JILA 1T35A 1YGYA 5GAJA 4EGSA 1BMQA 5BRAA 2FX3A 3QKSB 2C97A 4IO1A 4F4IA 3V7WA 1PO7A 4AMVA 1HSOA 4ANFA 1NVTA 1ZEJA 1R0YA 1V41E 2AVDA 2HA0A 2XYGA 2ZR0A 3HP7A 4YPFA 3Q8MA 2ZSUA 2QW0X 4IH4A 4YUXA 3FPCA 4FMBB 5HUJA 4C5CA 3A05A 1TJ4A 5EJ6A 4HDMB 2OSBA 2AXNA 4NSNA 2WQZA 3ORSA 4B6RA 4OJKA 4F1JA 3DE5X 4L6AA 4YWHA 2ZIFA 3TNDA 1DWQA 4MGZR 4RPJA 3CEPB 3M0EA 4QLBA 2OZKA 1C7JA 3IV6A 4IYRA 2YJ4A 1I7PA 4KQCA 1Z5VA 4OQNA 5EMMA 4B1FA 6PFKA 5AW0A 5DO9A 3ETJA 3QVKA 1Z5UA 4MINA 2UYGA 4YAIA 2NZ2A 3D3WA 2IV7A 3CH5A 2C9YA 1JV2B 1Q1BA 2DCMA 4D2IA 3DDOA 3P5SA 3GQBB 4KSCA 4CIBA 3RLFA 1RAEA 4HRXA 2QN2A 3WHLA 1T3HA 3A6JA 3G8AA 1HX7A 2JW5A 4MHOA 4AJJA 2O3SA 1EFRA 2FWRA 1RPTA 3TSCA 5IN4A 5CX4A 4JVMA 1DTSA 1V1RA 5T4BA 4RKFA 4CQMA 4CUZA 3WNQA 3T1YB 5B1YA 1TD1A 2QTAA 4DABA 1GCOA 1SOVA 2ZITA 4B17A 4QYIB 3Q9SA 4U7HA 1SBHA 3ZHXA 2O07A 3WRWA 1R0BA 3R7FA 2IOYA 1M2FA 3LCUA 3FTQA 1XWIA 4Y2HA 4QGAA 4NPCA 1UBJS 1VLMA 3H9UA 3LQYA 4EYGA 4LDAA 1WIWA 2YMLA 3T34A 1RC8A 3FPHA 4YP0A 1RBZA 1SO8A 1K9SA 2VRWA 2AYZA 4PF1A 1ST2A 1IB6A 2ATXA 4MW0A 1EVYA 2A35A 4DV0B 1KDOA 2FFHA 3O8BA 4J4HA 5AKHA 1OIXA 3K35A 3GT4A 4Q7KA 3T3PB 1N78A 4L73A 4EY7A 1ZMTA 1JE0A 4JMLA 4O0LA 4HNVA 5AVRA 3KETA 5JBQA 3ADPA 3FCUB 1FUIA 2J4DA 2CY0A 2UYYA 3GARA 5CT6A 5FFMA 3WO1A 1QE0A 4BTEA 1BXRA 3V8QA 4NBUA 4DA7A 3HB1A 2Z6VA 5JG7A 4BGUA 1NVFA 2D3TA 1C1YA 1RYEA 221PA 3DTVB 3GZTB 1US8A 3K15A 5CX1B 4EF5A 1FDSA 2ZKLA 4XLZA 3QU7A 3LZCA 4MV3A 4LQDA 1UKEA 2RI1A 1RJEA 4BV8A 4CLOB 1XVIA 1GEEA 1TLLA 1HDZA 3I3OA 5CM8B 5J47A 3FLAA 1DNPA 2W93A 3P9SA 2ORED 1UDAA 1RS0A 3FNGA 3GJ5A 3IBYA 3WL8A 1UINA 4IDAA 5FWXB 1I94B 1JSXA 2BE7A 4JUIA 2O2SA 1NNI1 4R3UC 1Z2EA 4N65A 2FYTA 3KKPA 3HB7A 2P9ZA 2AOVA 1I80A 2VP3A 1QCCA 4JLUA 1UKZA 4WNCA 4OSOA 2JFUA 4ML3A 4NYIR 2PKEA 2H5JA 3DWGA 1OHHD 1GYPA 2IBSA 1RLUA 4NYJQ 4QEDA 4XLTA 4M87A 4Y9RA 4NENB 2DTXA 2GPSA 1U1EA 2V5UA 2IHZA 2W98A 1N25A 1UFKA 2QM7A 2I6SA 1JQ5A 1ZRMA 3E6AA 3K3PA 2B82A 5B7QA 4A36A 3OCXA 4TL6A 4D9HA 1LVHA 3MGCA 3LPLA 4AIRA 3E3NA 1YL5A 5KYYA 5KB3A 4MWGA 3LK6A 1VCIA 2IZ1A 1X94A 4OL9A 1IG3A 2YWBA 2VOJA 3VAZA 2ID9A 3W79A 3NIFB 3I58A 2VI5A 4AICA 4UULA 4FCVA 1JHMA 2OOKA 3WIEA 1RRGA 4DIBA 2AJLI 5TX7A 4AN4A 3BWEA 4IXDA 2UVPB 4TV8A 1CJMA 2NTNA 4PAWA 3P0HA 1XQ9A 1HOXA 1MXHA 4BQEA 2R68A 2B34A 4KQGA 5BR4A 2JJ1D 1PFGA 4O63O 2VF7A 1GG8A 3WK6A 4WKNA 3UMCA 1HMPA 2HA7A 5DYIA 4NXNB 3D8HA 4UW9A 4W8GA 1UJ4A 1F2TA 3HXPA 4AY4A 3AF6A 1QGUA 3NNDA 1YCDA 3QMMA 3CZCA 1SHTX 3JVVA 2NU8A 4BPBA 4BNWA 5K05A 2GK3A 3IC5A 4KAXA 4GPBA 5EKTA 2P27A 3FYHA 2XYQA 5CNMA 2BKUA 4R1MA 3GIWA 4OU5A 3RQSA 3G82C 4PX3A 1ECCA 4G1BA 5ERYA 3W1WA 2G6TA 1NMYA 4HPJB 5JNWA 3NMUF 4C4TA 5J4LA 4QRHA 5JWRA 3EZYA 4L75A 1FB5A 3MERA 2A8YA 5B3LA 1GSIA 2NM0A 3PF8A 1YR6A 4R9VA 5GM1A 5ES4B 2R5FA 3MJEA 1A96A 4IGKA 2OGUA 2FETA 1T1GA 5EE5B 3PGVA 4KLNA 3UXEA 2VHQA 4NZYA 1X87A 2XMQA 5GOZA 1PT5A 1J4AA 1QHNA 4JLNA 1IVYA 3VJLA 1GD1O 1ZJ4A 4BMOB 4XXHA 4P7GA 4TTQA 2WYOA 4HTAA 4W5RA 4EI9A 5BWBA 5EZSA 3GEMA 4YP9A 2H9AA 4JYZA 4AKGA 2G5PA 2XODA 3TG2A 1V0JA 1OBCA 1U8EA 3JD2A 3OLXA 3FJOA 4FHCA 2FPWA 2PO7A 3CZ4A 2WOJA 4JSTA 2R87A 4N03A 5DHTA 1KH2A 2IDKA 2PT9A 5KQGA 3HRIA 4JX8A 1QORA 1L4NA 5H3HA 3C16C 4GVXA 4EVRA 1AF4A 2BGIA 4EJSC 3R20A 1MDBA 4KQMA 3UKOA 4GBGA 2QB5A 4JDUA 4N4AA 2VHWA 4F97A 1E79D 1PFWA 1A9XA 4JB3A 7YASA 2P1DA 1K8QA 3UUEA 4JB2A 1SXJC 4BKRA 3PUZA 4KR9A 2QAGC 4PC7A 4WXMA 4A2QA 4JLJA 4L4XA 3H2ZA 2FSPA 3I92A 1HGXA 1SUEA 1G9TA 4B8YA 1M7BA 2FP4A 3Q0EA 2P3QA 4IDEA 3KO8A 1LC3A 4LRWA 4M7RA 1U02A 3E4DA 2HHAA 5HRCA 1H2HA 3VR5H 5C8VA 3L0BA 5EJAA 1TKBA 3CYFA 1IZZA 4FEGA 2QTTA 1J0BA 1QBKC 5I7OA 1L5FA 4D44A 1E32A 1WHSB 2CXHA 3CZQA 3O2JA 3PS9A 5AVTA 4P80A 1ZH4A 3G0HA 5D7NA 2ICAA 3G2LA 3ZDXB 1RQGA 2X6TA 4WJKB 1CCWA 4BLPA 4IR7A 5BY2A 2XHEA 1NDHA 1AZSC 1SC4A 3AH8A 3F97A 4CCYA 4E30A 4A15A 2QT0A 2G36A 1KZHA 1T3TA 1M73E 4DR7B 5D2CA 5FBKA 5K3FA 2DULA 4K26A 5H9VA 1II0A 2DFLA 1DC3A 2BT4A 3NM5A 4K2HA 2IZ6A 1DC6A 2RGUA 2PRIA 2VP9A 3HUTA 1MB2A 3SM9A 4ED9A 5FEUA 3RYCB 4O2LA 2QM8A 2DRIA 2JH8A 2Z8ZA 5A5GA 3BM5A 1Z06A 2HXSA 3WXMA 3S1SA 1QSGA 2KWIA 1PX2A 1BQ3A 2IIPA 4I1OA 1BGWA 2Z1NA 3D9QX 3GY0A 3M5DA 1N2CA 3IH5A 4ILKA 2I80A 3GAZA 1PD0A 3BJZA 1M1NA 3ULKA 4OXRA 1V9LA 1ZU5A 4D02A 3F4LA 1YCGA 3D5EA 1N3IA 4RIIA 3IEVA 1QS0B 1MO6A 3AJEA 4PY2A 4US2R 3J7TA 4B33A 4FYWA 2ZXEA 4WN9B 1NU8A 4LF8B 2CLFB 4AJNA 5HKBA 1XFAA 3H9JA 1WDKA 2NO1A 3LYLA 3PLRA 2Y6UA 4XGRA 2W6ZA 2ORIA 4EPWA 1CERA 3OHPA 4BP3A 1QFZA 2VYQA 3K31A 2E18A 4GUAA 4HNSA 2OYRA 3TLBA 4ZRDA 4HWSA 2FHSA 3PWZA 4KGVA 1XD9A 4F5WA 4F5EA 3CRMA 1EDBA 5JLJA 3KWMA 3TSWA 1M0TA 2QRMA 4YJ3A 5T41A 3ZD7A 3RVBA 3HWRA 2FN8A 1VXRA 1GPYA 4S3MA 3C4VA 2GESA 1YS9A 1WMBA 4Q24A 1ZM9A 3DC7A 4PBRA 1VPWA 4RUKA 2A84A 4LSMA 4NU8X 3AR6A 3JZMA 4I4TA 2DPYA 4N5LA 4DCTA 3UOAB 4EY4A 1BOFA 4UU1A 5ER6A 4B6FA 1FFYA 4XIGS 1IDN1 4W9RA 2D8MA 2J9XB 4RAOA 1VE7A 1E2BA 4RF2A 2F9LA 2JKYA 3ET4A 4IF6A 4ZQEA 4F4FA 2OY0A 1WF3A 2Z5VA 3PC8C 3M3DA 3MJDA 5U1PA 1JJAA 4H7DA 1KOFA 3E23A 4HGRA 4MQEB 3UW3A 4JS0A 2W6IA 3I0ZA 3RSSA 4CEHA 1EFVA 3F96A 3BHJA 1II8B 3EH2A 3RK0A 3DE6X 4OD0A 1L4MA 3CLUD 4CUJA 4Y2JA 1NZFA 1Y5RA 5C8YF 2C04A 1P60A 3FYDA 4Q7JB 3PEWA 2XJ4A 1UFQA 3PHBE 3IUQA 1FOEB 3DF9A 4RHFA 4WIAA 3V8EA 4BVHA 2P9BA 3V1MA 1ZVQA 2WIGA 2VT3A 3IEMA 4G0XA 1QLJA 2A5LA 2ZBUA 3OIFA 4XB2A 4ZVVA 4AJPA 3A3NA 2X2PA 5AW8A 2YIJA 3ZR4B 5I5EA 1A5TA 4DUYB 1POWA 1U2DC 5CXUA 2EWVA 5JNRA 2P77A 5DPMA 2DJIA 3USZA 4BLQA 4R2XA 1LWNA 4QWWA 1KI6B 2AXEA 3QVGA 5TJ9A 3VYVA 3W8NA 2J5QA 2IELA 1EZ4A 3RVRA 2PUEA 3WGOA 4HY3A 2C4VA 2EL9A 3C3CA 2HL6A 3EE6A 4Q3OA 4BB0A 5DJ5A 5KU1A 3G1TA 2REQA 3IKMB 4YJHA 1WXDA 4QSMA 3WWOA 1R8QA 3RIMA 3G88A 3W8FA 5REQA 1XHEA 2GN2A 1QGYA 1Q7EA 2PZAA 1P4JA 2R4QA 4JKYA 2FA9A 1V5IA 1UQTA 2DVMA 5FHRA 1CJVC 2M6SA 3ZW8A 2MYPA 4PZ9A 2IXDA 2CHQA 3C6XA 1KOLA 3L8DA 3TJRA 3WP0A 3OTWA 1GQRA 4EJ0A 2X1LA 5HJ7A 2WG1A 4IH9A 5DULA 3RE1A 5BUSA 4KX3A 2DECA 2ZIEA 4HOYA 1R88A 3B85A 3IVXA 3N87A 4G0MA 5AOBA 4EENA 4IIEA 3ZWPA 1D9XA 1OH7A 3EXIB 1DXYA 3LBHA 4IFBA 2HZBA 1J2EA 1W4BA 3CNNA 1O0SA 3BDVA 3I6YA 3ILYA 4L1KA 5EIAA 3H17A 5HIJA 3WRVA 1KXZA 4TMVA 3RTEA 4E94A 1YVPA 5D5QA 3RFTA 1JPNA 2ZUDA 2WUGA 5EC8A 2VNHA 4MYUA 3P26A 1KPHA 3M33A 3ND9A 4PX2A 4TWIA 2AX3A 3CIFA 4N6GA 3RJZA 2PNFA 2WNIA 3VHRA 4MVCA 1E1KA 5F2OA 1Z33A 2ZR7A 2GD2A 3R0VA 5JR3A 5JH7A 4D7AA 2W48A 4MNTA 2Q3EA 3K6RA 1H2AS 1UWVA 4CG1A 1V8ZA 4U8HA 1JDBC 2YQ5A 1DO0A 4JJ7A 4DG8A 5K0GA 5LLDA 2JHGA 3B7GA 5F98A 3AY3A 2Q5LA 4IQGA 5AQEA 3OM0A 4NCXA 3A9TA 4C0AC 4YN3A 3CLKA 4M8KA 4YAUA 4FZ5A 2AZTA 4GG1A 4K81B 1XMPA 1RYNA 2WWGA 3E7PA 3OJLA 4XFKA 5AI4A 4ZRNA 5K4AA 1KA9H 2AKAB 4DQUA 1LWOA 4GD3Q 3P2JA 5E7MA 3RBXA 2I2DA 4HH0A 4CCWA 3HM9A 2PX5A 2YNMC 2HYIC 3T3GA 3D6FA 3QELA 3MQ4A 2AVNA 1FL9A 2B99A 2JBWA 1BD3A 4KN9S 3R24A 3EH1A 1WMSA 3U19A 4WK0B 4HYQA 5H8WA 1FJ2A 3HYRA 1H4QA 1V39A 1OGIA 3W6ZA 1SOAA 4CL2A 1F51E 1ODJA 4CCSA 3E7FA 5AXBA 1Z35A 2FX5A 3QGMA 5TEWA 1R9MA 4AJ9A 3F6CA 4RESA 1OTXA 3DZDA 1QFSA 4OHCA 3L1JA 3G0DA 1ZD2P 4HAYA 3L6BA 1J0CA 3BFKA 5KAPA 1BA2A 3WZ2A 5CVUA 1OZ0A 2HFJA 1PEAA 2ZPUA 1T3ZA 1OLUA 3IP1A 4GBED 5D85A 2QTGA 1U5AA 4J0JA 5L4LA 5JFTA 2A1UB 3HB0A 1PZFA 3AHFA 2PEYA 2VNJA 3UVEA 3KV1A 1YVDA 2BRUC 3MK31 1EFHA 1B93A 1XIVA 1Z4OA 1P2TA 2Q3LA 2BMVA 3BGIA 3CQ9A 1CRLA 4C7XA 5IEBA 4OHWA 3V9PA 4G26A 3UGTA 2O14A 3FF4A 4ZQGA 1ZRHA 5CNIA 1AN9A 2RAPA 5BV0A 3KUCA 3U3OA 1L5LA 2Y05A 1H93A 1J8VA 1MAWA 4RA6A 2BFOA 2O7NA 2P9HA 2P9YA 1TTHA 2K4MA 3DMFA 3H3FA 5DWDA 5AW6A 2HQOA 3M6VA 1UBNA 1B3RA 2VDLB 3DEYX 5AI8A 4CBVA 4EHKA 1NG9A 4COOA 2PO5A 2EAUA 3T1NA 3ICEA 1T4CA 1F7VA 2NAPA 4Y98A 1KQOA 4OAPA 5G3YA 2WQ6A 1QHSA 3LHSA 3LHIA 3QLJA 2R2GA 2P2CA 1KJWA 3CR7A 4B9AA 2DUWA 2JA1A 2PRYA 2G71A 3QVLA 4NK5A 3LUCA 2PVSA 1HG1A 3EC2A 4KXQA 4A5SA 1N5LA 3MCWA 2JLQA 3KQNA 1FMLA 3BD9A 2JGAA 3K32A 4XDHA 4OQPA 9LDTA 5AVZA 4R1UA 4E33A 2ZUEA 1RMTA 2IE0A 4RBNA 1U7OA 3RCBA 2IPAB 4X7RA 4R7TA 1P9WA 3KELA 4ZEMA 4W7SA 2GX6A 1CUEA 3UFBA 1OTYA 4L9RA 4MCAA 3THWB 2B6NA 4RPKA 2ZUUA 2I3AA 3FUVA 5TLSA 2O4UX 1DSSG 3NXSA 3I37X 3RI3A 2XDQB 5LYJA 3RKSA 2CJWA 2D5BA 5JCXA 1EM8B 3KT8A 3PXBA 2XDAA 2B1JA 2WUVA 2C82A 2I7VA 2Q21A 2RK3A 4KO1S 3UUGA 3OFVA 3TW0A 2VHUA 4AX4A 4HH1A 3O8LA 2EZ4A 4DSAA 4CIYA 3H1PA 1X42A 2W6QA 1V4BA 2XWSA 3MRXA 4CR8A 1WTCA 1DHTA 4F45A 2DCUA 2EYUA 4E70A 4TZKA 3OIUA 3TZHA 1M66A 1ZA2A 1IHOA 2CWWA 3BBLA 1SVSA 1M2OB 2X8BA 4JBWA 3D2LA 3PFKA 1JQEA 4BE7B 1QYVA 2OAEA 1UXKA 2I3GA 3UHFA 4ASUD 3LY5A 1AHHA 2R1VB 4O1MA 1WA5A 3QYJA 3DWEX 1D0VA 4DIFA 1VPVA 1VLLA 3NWEA 4BO5A 2CMKA 3EHEA 2I99A 2QGNA 3B6MA 1NW3A 3QNMA 4KFSA 3FVQA 4OCZA 4J2OA 3ABRB 5KTTA 4YAEA 1SBIA 1HEUA 5FNVB 3HSYA 3B13B 1Z74A 4YREA 3CA8A 1NI4A 3IDZA 4TVBA 4PW0A 3B3GA 4WA7A 3W5AA 5D3MB 2HCJB 5FO1A 3JQGB 4Y0NA 4Z1MA 3E5HA 3ZBUA 1QRUA 3HYNA 4WZBE 5E6UA 3HUDA 1IZ0A 2OZLA 1R0XA 1X3SA 3M2PA 4J0GA 2ZRJA 2ODBA 3RU3A 1MX3A 2ZI7A 1RQNA 2H6EA 2DG2A 4C3ZA 4C0SA 2NVUA 2C0CA 3X2EA 1ELOA 4AKSA 4BKPA 4KLCA 3N0WA 2D5AA 4H27A 4L0CA 2BDTA 3GA7A 4D0NA 1P6XA 4X1KB 5KJEA 1IZ8A 1RPZA 5GONA 3QUQA 4ZQCB 3SF8B 3E18A 2L82A 2JEYA 4OTZA 4Z0NA 3CJRA 4AWAA 2EKZA 3RVOA 3UMGA 1OIVA 5H83A 2GVZC 5A9SA 3BFVA 3PXDA 2AH5A 2BMDA 5E6RA 2EJVA 2BJWA 5BOSA 1R50A 1SM4A 4Y18A 2ZPTX 3IERA 4BGIA 5B1SA 1YCFA 5JJKA 2C2GA 3K09C 2HRCA 5DN6A 3PCRB 3ORRA 5SZJA 4NOMA 3EXHB 3W5HA 3ZHTA 4HGYA 1D2HA 1KJQA 4PPYA 3RIGA 5F3WB 4RJJA 3E2PA 4NCNA 4F2WA 3RS5A 5B7GA 4BOYA 2FUKA 2GNPA 1GTSA 3HJCA 3DPUA 4RVSA 2J6BA 4RZ3A 2WM3A 5DT2A 1XZKA 2A0XA 5G2OA 3OO0A 2ZRNA 5DW0A 5EPUA 4PNHA 1EUCB 4KAFA 4GI3A 2GR9A 3R5XA 4F4CA 1PDOA 1MB9A 4U2KA 2A0YA 3RLIA 3TD6A 1UC5B 2YW2A 2Y0EA 1J1ZA 3WMRA 2HO4A 4NBVA 1KI9A 1L5WA 4OQLA 4A8PA 2F9MA 1N2BA 2C2MA 1RI3A 4G5SA 4G63A 2XKKA 1E1MA 2E4XA 5JRJA 1XZCA 1E58A 2X3FA 5EJ4A 5JI2E 1KBQA 1QTRA 1JN0A 1RKBA 4X45A 3KPVA 3IPAA 1KO8A 3V55A 5BXYA 5JTTA 5BWNA 4BFVA 3DVLA 3NB0A 4QODA 5ICSA 1UFRA 1VSBA 4E0BA 4F6LA 1W5TA 2A6PA 4DPLA 1EUDB 5SZIA 3IQGX 4MJXA 4Z4HA 3ZCPA 1G3IA 5LA6F 1OWMA 3W8EA 3WK5A 1K97A 1SFRA 2W0MA 2Z5GA 3C3XA 2UZ1B 4H60A 3H1GA 1I2CA 5CGZA 2EDCA 3T9BA 5JSZB 1J7JA 3W6NA 2Y2UA 1UBRS 4KSBA 4QTZA 3EMKA 3ZVLA 3PFCA 1Y5MA 4I3GA 3IA2A 1DBVO 2J31A 5IFLA 3ZJUA 3AI7A 4K0RA 4G0QA 4EECA 3WLEA 4Y2YA 4BGVA 4BO9A 1KNXA 2H4FA 5CB4F 2VK8A 4J29A 4LUCA 2ZAOA 2Q27A 1AUVA 4NBLA 1TQHA 3K0KA 2OHIA 3CXUA 5E4YA 3U4QB 4ZZ0A 4W5OA 5EKXA 4EJSB 1NBIA 3D31A 4EMUA 3USCS 5I7EA 1IK4A 3ZX5A 3LT5A 2C57A 5CCDA 2BZGA 2QMYA 4CR7A 3JQ7B 1CF4A 2AYYA 1L5SA 2JRLA 2V8BA 2WC1A 1JH9A 1SBZA 4IHQA 1JG3A 1NJFA 2QAGB 3V6LA 3PQEA 4MYTA 2WHXA 1B2RA 2Q0HA 5CVVA 3SYTA 3HDJA 1VP9A 1YZFA 1E6UA 4LYDA 1JFSA 1CQWA 1L4YA 1DKLA 4NFYA 2H1SA 4BX0A 5DMHA 5CBKA 4FBGA 5CB8A 3ZXYA 1JDTA 4RHYA 1W52X 2EARA 3ZHSA 1KYYA 2AUNA 4CTNA 3PJRA 1KAOA 3IAM6 3PC2A 4R2JA 1S2GA 5K99A 3H42B 1FTYA 3HI6A 1SQ5A 2JHPA 4YRNA 3HXTA 5LSAA 5G02A 2NU6A 3T9EA 3ZVKA 3CUYA 3LPDA 5DVZA 3N8GA 3TTUA 5BT8A 4N41A 1UMBB 1ZW1A 2C3MA 1KO7A 4BQIA 2ZS8A 3AXSA 1KY5A 3BE5A 2ZYIA 2HWKA 3RUCA 1MENA 1XYVA 2HMSA 2JZCA 4OI4A 3FHCB 4DDMA 2TECE 1A72A 2GZDA 3ONWA 4R1NA 4EHDA 5GZ1A 5K8UA 2G5TA 1RXEA 1IUOA 2IE8A 3EVNA 2NW6A 1RD4A 1FZQA 3D8NA 1VG1A 4P33A 3S55A 4K87A 1SKMA 1U8CB 2MSLA 2QZ9A 3BIWA 1PL6A 3LUJA 3NWBA 3JARA 3V4OA 3TLGA 2DZDA 4IDBA 5B3JA 1IK6A 1UMCB 1I1OA 3KFXA 1Z4QA 5EEHA 5F5NA 2GNOA 2BH2A 4X62B 2XWBF 4GFDA 3NTVA 3B36A 2XRFA 4FGZA 2F8MA 2Q5JA 1K7FB 3EXG2 1Q3HA 4JL6A 1TMYA 2HPZA 2Q07A 1QQ6A 4US0R 3CZAA 1GZUA 4UATA 4JI0B 1QX3A 1LEHA 2F1KA 2B5WA 3CUTA 3HVJA 4EDHA 3I2IA 2BFCA 4NP6A 5FTKA 4GOXA 4A91A 4TOIA 2DH5A 4G41A 4X0EA 3EPJA 1H8HD 1K0UA 2Y1LA 5FO0A 4Q4CA 5G4KA 1TYCA 2DF8A 2XUPA 2Z1DA 3C41J 1AZWA 1JFLA 4H1HA 2NUPB 3V7FA 1U0LA 2EVWX 5JCZA 4BYMA 4YMSA 2WJ4A 5C7OO 1AK1A 4EAAA 1HOTA 4Z9FA 4RTNA 4JOSA 2ZIWB 1FRNA 4CNBA 2R8ZA 2E5FA 2H1HA 1XMQB 2APJA 3O4GA 3MMSA 1K1EA 5EXDA 1A7UA 1OFUX 4C4YA 2VBCA 1W44A 5DGDA 4EARA 5KSOA 3B5JA 3UOGA 2Z4RA 4AJIA 1E7WA 3NJ8A 2FMUA 1YI0A 4ZV7A 2PN1A 1U0NA 4WCVA 2PFKA 3A4VA 3OP1A 1C41A 4RM3A 1YZHA 3RU7A 1DBPA 3BE8A 4V0RA 5FHQA 3LYUA 1D2NA 1K4MA 1UPBA 2Z83A 3H5TA 4MWEA 3KAPA 1TI7A 3O31A 3ZS9A 3EA5A 3MAJA 5BUCA 1WQ3A 1KQPA 2W6PA 1N33B 4FHFA 2HC9A 3DL4A 4L4YA 4AQYB 4JU8A 3KHUA 1CWUA 2IYAA 4G1CA 3T7CA 1E61A 4E5KA 1FMFA 1HT1E 2FWMX 4A2CA 5CGQB 1WEKA 1PZXA 3GG2A 1E62A 4IKEA 3QFRA 3EW9A 3JALB 4JJGA 4F3NA 5C5EA 1ZR2A 1QC5A 1P18A 2HRDA 3I5XA 3QK7A 4NZMA 4E12A 3AIIA 3AUUA 4AO7A 1RQRA 5A06A 3AOGA 2GASA 2QN3A 4QYSA 3TQSA 1L6IA 3SHVA 5CDGA 4R1PA 1A88A 4YUVA 2ZUFA 2EFDB 3KYJB 1M6WA 2BLNA 3IBFA 3RASA 4H7JA 5EA2A 1FQJA 3T9AA 3N86A 5CA0B 1OYOA 5FAXA 4L0QA 2FZLA 2AC7A 3I8SA 4FHGA 3AETB 5DNDA 4EM6A 2YDXA 4X44A 2TYSB 1XU9A 2QM0A 1TO2E 3HLYA 1J2JA 5DTIA 1ZI9A 2QMZA 2RGBA 2ZIZA 3HUEA 4WVFA 3F5DA 2JIDA 1JLKA 3RVDA 3KQUA 1VHJA 1L8AA 2OFXA 3A1EA 1RLIA 2G4CA 2HBRA 3QHPA 1CRQA 2RIPA 5IKPA 3HC7A 3R9KA 2PD4A 4JAVC 4KKVA 4H9GA 5T4FA 5A5FA 1U7ZA 4F5YA 5AK5A 4D4JA 2JRCA 3HJHA 1TT5B 1XSEA 1BKDR 4XFDA 1Q1ZA 4O33A 4ZO4A 3FCXA 1X70A 3IAXA 3L43A 5BW6B 1P7CA 3FRIA 2W6NA 2H4WA 4R41A 1K5DA 3HYLA 4EUHA 2BKAA 3CPEA 1V1MB 4KYVA 5TPWA 4CRWB 5C52B 4G8DA 1CLEA 1MZVA 1NM5C 2IWHA 2R0QC 4QARA 4RTMA 4X3CA 1JMKC 4DV1B 3LSYA 2I55A 2JAHA 1IATA 2OE2A 3HVIA 1XWFA 2HI0A 2WM8A 5GVRA 1TQ2A 2HUNA 4RIGA 3UHAA 1NHGA 2KBEA 2WLSA 2PGJA 3NNSA 2CNLA 3FMPB 4Q7MB 3TPCA 1O08A 3DMGA 4HRVA 1KYZA 5EJFA 4DNXA 4QFBA 2V6IA 4XAQA 5EOVA 5AM3A 3N9IA 4FE7A 4MRMB 1HFJA 2TRSB 4QWMA 5I9BA 5CB6A 5HR5A 1DDGA 4NPAA 3ENVA 2NU9A 3KLNA 3OC0A 4RVOA 1R6XA 4HGPA 3ZI7A 1WULS 4CI9A 1J22A 1DC5A 2NYAA 2J3KA 3LOUA 2FKNA 4F3TA 2A67A 1QB7A 3FPLA 4RLFA 1E3MA 1DG3A 4AO6A 2ESRA 2JGIA 3ROXA 1XL1A 3H4MA 3WLAA 2ECPA 3CVVA 2G1AA 2P2LA 3KFVA 4AI6A 3DFZA 1GCAA 2IF2A 2I6FA 4N5IX 2W2NA 2OHXA 1NBAA 4UFOA 3R3SA 4QJIA 3T94A 4GEGA 2OXCA 3LO5A 3I72A 1AXRA 3OZSA 3TTVA 7ABPA 1MAUA 1RXUA 1THZA 2GZHA 1Z22A 1V26A 3GGSA 4N1AA 3GLGB 1SU4A 3HG7A 5GJWC 5SYAA 5L3QA 1NY6A 2G0TA 2Q2OA 3DP9A 5CJ2A 1Z75A 3FZQA 4Q6WA 5T64A 5TV2A 5ALZA 3RSGA 3KTFA 3ZCSA 1BC5A 3PXAA 3ZWWA 1E3QA 4J0FA 5CLQA 3P9PA 1HTWA 1AQUA 2KI5A 3ROPA 2HIAA 3S3TA 3F5QA 3I9MA 2PEZA 1MH9A 1YS7A 4TSRA 5ECGC 4DJTA 5FOQA 3S2ZA 2O8DB 1Y4AE 2XE8A 3E7XA 5KOJA 3WTCA 3ZNNA 1G3QA 2FFBA 3RAGA 1X39A 4MJ3A 2QRHA 3D5TA 1NLUA 4O4HA 5IT5A 1MZPA 4MUNA 1NN3A 2Q1TA 4LWOA 1G5TA 1SBYA 4UUBA 4HDNA 4UHHA 5I4IA 4M9UA 1ND5A 5F4BA 2WTEA 3DGFC 1D7OA 1XDUA 2A30A 3LT0A 3SVTA 3VNVA 2PJZA 1M6VB 1JMVA 1L4GA 3HCEA 1U0EA 4JP3A 1OPRA 1VI6A 2IZ7A 1XTZA 3Q12A 2OBXA 3ZGLA 5KNBA 2H51A 4KGZA 4W5JA 4BVJA 4RIEA 2GD1O 3WK4A 3ZWBA 1B8UA 2DQ4A 3ZH2A 3LPAA 3NHZA 2B83A 3IT3A 4MI1A 3GJQA 3NIBA 4QUHA 2PBFA 1FMCA 2RH9B 2VNAA 2X2OA 3WBFA 4AW9A 1B8OA 4M55A 2JCYA 5ESXA 4D9EA 5CDFE 3H75A 5D8DA 2R3SA 3PC6A 4N7MA 5L3RA 2Q9CA 2YOFA 4AC9A 5AW7A 1B23P 5JT1A 1PR5A 5EY5B 1JALA 2PL9A 2IXFA 4OXIA 4DRXA 5FPYA 1Z17A 1ILWA 3AUTA 1CE8A 1GDHA 1VJTA 2Q9BA 1KZGB 4LJ9A 1ZK4A 4GW3A 2XWPA 1JNYA 1XLWA 3D3WB 3JYNA 2C8LA 1T43A 1U8XX 4F7DA 1L7XA 1UJ2A 1T1EA 1IJEA 2QUBA 3PL1A 1KAMA 2CW5A 1PR6A 4RMNA 3W9UA 2XQJA 3F46A 2QY6A 4CQLA 3U7HB 1Z56C 3JQAB 3VTAA 2VC2B 2V7TA 4ZJUA 2AQIA 5KVCA 2OCYC 2AYXA 1I2AA 4CQMB 3G5LA 4LGCA 3L8EA 3LCRA 3NOXA 2O1WA 3OFNA 4ZZ2A 3RVJA 3TL2A 3LOQA 3EARA 2V7EA 4HO1X 2IFTA 3H9BA 1ZOLA 2P6OA 2TS1A 1VKRA 3ET5A 1A4XA 2DOKA 3IUPA 4LC0A 1NTRA 1R9NA 3D7NA 5B1IA 4KRGA 2OQVA 4RD4A 2Q9AA 3O1LA 1X1SA 5L6LB 1B16A 3ZDRA 1XZBA 1KF0A 3V2IA 2H31A 3GLQA 4U9IS 3DG9A 3MJHA 1O5TA 1RCTE 1GNPA 1RHQA 4RH0A 4M76B 3CUWA 4LYGA 1AS2A 1QTIA 2E4ZA 3TZBA 4FXOA 2A86A 1U5CA 3I0NA 1ZXXA 4G56A 1DAHA 2VSXA 2LV8A 3PQ8A 2JB9A 5LQNA 4J7UA 4DNQA 3L4BA 1KYVA 4P92A 2JD0A 1C9MA 3Q7QA 3SZLA 2DP4E 3KSZO 4OFZA 3TXYA 2A9KA 2WNHA 3MSXA 3UB2A 3KP1A 1DXQA 1U3GA 2OCIA 3BGSA 5B4UA 4LKRA 5GTDA 3IUSA 2V5AA 5IJAA 3ZU2A 4AUNA 1EDOA 4KHPB 2OCAA 4P34A 1T26A 5AKKA 5DNUA 3DH0A 4YDHB 5IYZA 3NOVA 1E63A 1IHYA 5H9WA 4DUGA 5KNCH 4IIHA 3WLRA 1A2QA 4KPEC 3CEJA 2Q2NA 3O1JC 5A0FA 3G9XA 4BQFA 4C4OA 3TGWA 4FYVA 3SI7A 1OUMA 1SCIA 2YVAA 1SA0A 2EJUA 3WLSA 4L3WA 4JC8A 4ZXPA 2DFDA 2J0UB 4S12A 2PMFA 1L5HA 3I39X 3PXUA 1DAEA 1W19A 1YRAA 3MRSA 1ZJ6A 4KIUA 4H35A 3DXFA 3U7GA 4JKIA 3P2MA 3L8MA 1C7IA 4IBOA 1P91A 2EBHX 1ZVVA 4HYTA 1FYWA 3ZQJA 2FG5A 4DSNA 1WXFA 1YJCA 1UZLA 4AP5A 2VJPA 2FEOA 4FWBA 1C0LA 2OHHA 2RGEA 5CFNA 2F4VB 1Z0KA 4R9RA 1RU3A 4M53A 4ARZA 1CF9A 4QTTB 4MVJD 1Y80A 1LS6A 1ZIXA 5A6SA 3T7AA 1G8AA 4L4ZA 5IWCA 4MVJE 4F85A 4ZEOA 2PKYX 3O4IA 1XZAA 1NASA 1QVZA 4AS2A 1O77A 3B1KA 2QQEA 2N42A 3LIPA 5A71A 3JQBC 3QBEA 1D3AA 5HBGA 5BOVA 4ARAA 3SQMA 3HH8A 1LQUA 1SXGA 5AVKA 2RHRA 4PC3A 1NMZA 1P2FA 1RKQA 2IKQA 2FFAA 5T57A 3X3HA 1SHUX 3K72B 1B6TA 3AL0C 1M3SA 3I45A 1EKXA 3DMPA 3PTLA 3R23A 5A04A 3CR3C 2XQGA 4ZT3A 4KFCA 3AOEC 3QVWA 1Z18A 1ZL2A 3P4UA 5D1NA 1ORVA 4YMTA 5CAEA 1RJGA 2HJRA 2P8SA 3LIIA 4WCDA 1U0BB 3COVA 2GB4A 5KVVA 2BEUA 4Q4HB 4CKEA 3FWZA 1QBGA 2D13A 4BNGA 2PTGA 2B78A 1N6HA 2GTIA 1AT1A 2X1MA 4UQOA 4CGYA 2X7JA 2X9QA 3CRW1 3WSWA 3TPZA 4AZ3B 4ZAZA 2MMCA 3B3QA 3ZZ0A 1KMNA 2COUA 1PSWA 5ALTA 4DVJA 2XZDA 2O20A 5C35A 2W6JD 3IHTA 5E7JA 5FWDA 3FXAA 5F35A 3VO1A 1JIKA 3HXOA 1NYRA 3O2QB 4R01A 3FIJA 3IOMA 3ZU6A 3TOVA 4RKQA 2W71A 4ENVA 3DOIA 1APBA 3ND8A 2RD2A 2C3UA 1S3GA 3CFYA 3O3MB 1W4RA 2FR8C 3MXTA 4RC9A 4QUAA 3SBXA 3VPCA 1EVIA 3N7UA 4E3WA 1DU4A 4DR2B 1K3TA 3GJ0A 1PQWA 4TYQA 1KI1A 3M6IA 4D9FA 1WD7A 3GHHA 4D4MA 4REOA 3G8BA 2QLTA 5BSWA 4DV7B 4E32A 1I7LA 3EDQA 2WABA 1C7ZA 1Z0FA 1GRCA 5EMHA 1F2UA 2GK4A 2GZMA 3U2QA 2XSZD 3O74A 1L7NA 3UTCA 1AMNA 2VA8A 1THTA 2C4TA 4Y3UA 2I54A 3L6DA 2RBKA 4AY2A 1E5LA 2QF7A 2NSLA 4FYPA 5JIBA 3JZAA 2QQFA 2QE7D 3QLVA 2YIMA 1YK1A 1SK8A 1ZVMA 2VRCD 4C14A 2WWIA 1A2KC 3ASYA 3N53A 4FW8A 1E3LA 1YA8A 2ZU6A 2YBEA 3BRSA 4HNHA 4L6CA 1NVEA 3CE9A 4L5AA 1C8VB 3WGYA 1YA6A 1S3FA 2OXFA 1G7TA 1QYDA 2EFHB 4ISCA 4PHGA 3H2HA 3DMRA 2HMUA 5GM2A 2BISA 4U7TB 3T5BA 5IXSA 1M8GA 2GCOA 2ZR8A 3H8WA 1KOJA 2FPPA 4H4DA 4I50B 2QXUA 3DEIA 4KW7A 1EFCA 4S05A 2JG3A 2FP4B 2MSEB 1Q0ZA 3RPEA 4BB5A 1T5OA 1Y7TA 3MLEA 4ZJPA 1GADO 1KL7A 1AK9A 2I67A 4KGDA 2ZJOA 3F71A 1G0NA 3DZKA 4J1NA 5AJUA 4AZWA 3U56A 5HIMA 1PTKA 1ENOA 3RKUA 4Z5XA 1X2BA 5SY6A 3GT0A 1G6KA 3KQTA 1DP4A 5G53C 3UQZA 3PKZA 2R60A 1XVUA 2SKCA 1JEYB 1D07A 3P9XA 2I1VB 2FPRA 3K20A 1QRRA 2G5GX 2IYZA 1ZKDA 4KIFA 4YMUA 1XRRA 2HSGA 5MGBA 4IGEA 5HILA 3C8ZA 2VK1A 5AJHA 3PUKA 7ADHA 2OEPA 1IN8A 4QX6A 4BJHB 3WLMA 1SIUA 4AZ0A 2OXTA 3NBZC 1G2QA 2PUVA 2O2HA 4IX9A 4K6HA 1SG0A 4IWNA 1VGQA 4IMRA 1MD9A 3F2VA 4MP6A 1CNFA 4PZEA 4ZYTA 1VBKA 2G1KA 1OTHA 4I1YA 3WV4A 4AQDA 3ASVA 4X65B 1ESZA 1NHWA 5D6NA 2HQRA 4J91A 2Z9DA 5DGIA 3TBFA 2J0SA 3HY4A 4MIKA 3SS8A 3QFHA 3TKYA 4B4DA 4KFUA 5FJJA 4MUGA 4PQYA 3HA5A 3MFQA 3NT2A 1BFDA 4QBGB 4WD3A 4DWJA 1GSAA 4MUJA 4BV2A 1DFIA 2BM0A 2W2KB 3JAWB 1N2HA 4EKIA 1JR2A 4NMLA 3ZWOA 4DSOA 4DR1B 3IMGA 4MS4B 1TF5A 1HL7A 2CKDA 3L7MA 3R0JA 4ZI2A 3HADA 1GSHA 1UKVY 1KJ8A 1YJ5A 4OMFG 2OB2A 1YBHA 3PWTA 4JT2A 5F4ZA 3WX0A 3VJRA 3AZPA 4K1LA 5EZ6B 1BXGB 4IG4A 1LLFA 1V1JA 3OECA 5F1KA 1RQ2A 7REQB 2C9ZA 2ZIVB 4J0IA 2C83A 2D1QA 1NIPA 1WAMA 5ALRA 1O3YA 3V48A 3ANTA 1G55A 3L7OA 5HIKA 5IJ9B 3GMDA 5MFZA 2HHLA 1D1PA 1JDUA 4U5QA 3MOIA 4P84A 4W9NA 3KUUA 4TKVA 4YAJA 3D0OA 2PWPA 5DT9A 1MJHA 1UZUA 1CS0A 2IP2A 2QL9A 2H5EA 2PZKA 2R00C 1GZ4A 1Z0AA 3IOEA 3SX2A 2R1ZA 2AJ8A 1WDLA 4O4LA 2QX6A 1UK6A 1E2LA 2FLVA 1A1SA 5IUJC 1L3CA 3S68A 2A5JA 3TO5A 5C8XA 4LRTB 3HR8A 1F6BA 3M6LA 1HDEA 1XZNA 5LQKA 3PQDA 2ATVA 2Q6IA 1YV9A 1Y8ZA 1BEUB 4MX8A 4ZI7A 1I9CA 2MTBA 3KJFA 2XB6A 4NKRA 5DZSA 2JFZA 1IBMB 3SJBA 4X7PA 4DB2A 4GPZA 1HG0A 3DBIA 3BULA 1YZKA 3K53A 4UFPA 2PXCA 4D3SA 3VO2A 2Q1SA 3EC7A 1XAGA 2JS7A 3BEDA 2HNKA 3CKYA 4PS0A 4ZTBA 1NF8A 3HQ4O 2H54A 2PX6A 4M9QA 5GJBA 2OCDA 1FZTA 3EVCA 4PE5B 4MVXA 1C9EA 2CKMA 1T3SA 4WNAA 5AOVA 1QJ4A 3DVAA 1UBMS 3QXJA 5B2EA 3RFCA 2M2IA 1FDUA 3P8ZA 1BNCA 5KHLB 4IDOA 1UBOS 3RSOA 4WCFC 4WXEA 3N76A 3ND5A 1AUQA 1V7PC 2AEEA 3NAMA 4DR3B 3WE7A 3UF0A 1CBUA 2A7XA 1CP2A 4IJ6A 3UB4A 4B48A 1NN5A 4MEJA 1VSTA 2H2FA 5CG1A 5JAPA 2O57A 4BU0A 2G88A 5CYPA 2PLWA 2F17A 3VKHA 5C7IO 2CNKA 4NI5A 3NGXA 4XX1A 1QR2A 4P35A 3LXMA 4LNUB 2GZSA 1BXKA 2OWEA 2YXNA 1XEXA 1DKRA 2VYFA 3KLOA 3AR3A 2HRBA 3X1JA 1XTBA 1CJSA 5FL3A 2HCFA 4F3CA 1NVUQ 4WDQA 3R9IA 4DZTA 2C4NA 3MTJA 3V1YA 3ZKWA 3R9XA 3KXIA 1M1YA 4JB8A 3TVYA 1VG9B 4EUNA 3MG9A 3C3MA 4TX1A 4EHFA 1MGPA 1OXTA 2B2CA 2O3JA 3BCHA 1EB9A 1GGKA 1YE5A 2X13A 3E35A 3FNFA 3H4VA 4UBOA 2IXEA 3AP2A 1RFGE 2X2FA 4MEAA 4GQIA 3KLBA 4LJ7A 4EYSA 1KI3A 4XWTA 2O8CA 3Q7SA 3FF1A 6YASA 4RPLA 2H0AA 3LNTA 2OBFA 2OO5A 4JCCA 5AR1A 1TFRA 4YMVA 1EUYA 3PQ3A 1CY4A 2X15A 5MGNA 1GPMA 3A31A 3UXMA 2XYRA 5L45A 4Q1FA 1PK7A 1ZZEA 3CNOA 2DPMA 3PG5A 4C5BA 3BWCA 3BB4A 3TR6A 4RL4A 3D02A 4YRCA 5THKA 1ZCAA 4N5DA 2PSJA 1S96A 1C4KA 1NVAA 2PX0A 1KKUA 1RKXA 2OQRA 2XLBA 3PNSA 3RVPA 3EOBI 1Z16A 4ZEXA 2NPOA 4KL8S 4Z99A 1X8XA 3IE0A 1FF9A 1KDVA 4BECA 3GWGA 1ZK1A 4NG4A 1BDBA 4URUR 1MJGM 3IUJA 5C4MA 1E1RD 3T0IA 1WRBA 2MINB 4GMFA 1GVHA 1GFZA 3Q7EA 4JNKA 3D7SA 1DG1G 3WJ1A 4ND4A 3I52A 3E2MA 2WTMA 4K9MA 2AKYA 2H92A 2HSWA 2NSJA 3K0FA 1K6JA 4MAMA 4EMBA 5LP6A 2G4VA 4P5EA 1WBBA 2V0GA 1U7HA 2R48A 1XJQA 3E3OA 1MO3A 2YXBA 4MMYB 3LJKA 3MCVA 3B1FA 4DJ5X 1GZDA 3HFRA 2J0QA 3IS3A 1KO5A 2FW7A 2XTAA 1YL7A 3PQ6A 5AKJA 5JCJA 1H9CA 5SYMA 1U5BA 1V6AA 3G5TA 3FJ1A 3EY4A 4CM3A 1YQXA 1G42A 1OBFO 1CR4A 3K1JA 2G28A 1H2FA 1IULA 3MMXA 2VG8A 5HIAA 3KVNA 1QR6A 3SSMA 4OAOA 1XOIA 4Y8VA 1QIMA 3N7TA 4XPIA 4TWAA 4YHHB 3AJ9A 1MG0A 4G0YA 1THGA 4I46A 4ZHQB 1UIMA 2DTDA 1J7KA 1BX0A 4IDQA 2B69A 4AUKA 4DIDA 4B2LA 1GU7A 1N7GA 3HB4X 4HRYA 1W36D 1E5VA 1TO1E 2ZT6A 1NXQA 4N3AA 2RHBA 5CM2Z 1O9GA 1YJBA 4PNZA 5JBNA 2JHFA 2UUBB 4GC5A 1E8DA 1MORA 1HT0A 2O6HA 3VRHA 1X7WA 4ZHQF 4UZFA 1T4CB 1TO6A 2YHUA 1H3NA 3OWOA 3L05A 3VU8A 3KYIB 8AT1A 4B79A 4FPXA 1KOGA 2DBRA 1P17A 4IW3B 3T3HA 2PKXA 1XNHA 1N2GA 1Y3IA 4DLZA 1ZGCA 1QONA 3RF7A 1CY1A 4CDRA 2A9JA 2X4IA 5AIAA 3IKTA 1OH5A 4F2GA 4TM8A 2FUCA 1IN4A 3ODGA 3T5PA 2JH9A 3EOAI 4B82A 4ICIA 1PJ8A 5L40A 2VYVD 2EHJA 4KODA 1SIOA 1C81A 5A4DA 4PRYA 2EDAA 5AUOB 5AW9A 1B43A 5KCZA 4W6ZA 1ZXBA 2OLKA 4PAOA 3H3XA 4TS4A 1UAYA 3HJNA 1N1DA 2CMGA 1TIPA 3ESAA 2WFLB 3OEEA 4TLBA 3VX4A 3NVKI 3LHKA 4S2EA 5J5VA 3SM3A 4BLUA 5HQTA 2NUTA 1VPLA 4R1SA 2VL7A 2YWEA 2EZ9A 4WZAA 3V7UA 3THYB 3STVA 2WU3A 3QYPA 3VV2A 4Q37A 3N2GA 4BIIA 4LQCA 4QUDA 4QXOA 3WRYA 5KSWB 5ANRB 4FEEA 7MHTA 4HNQA 3OCZA 1L8OA 1O6CA 4XQ9A 1YRHA 1HH4A 3LX4A 3W2TA 2GHRA 1KS2A 1WVGA 3CRRA 3M89A 4FWIB 2X5NA 4KACA 2X0NA 4Q0MA 1E4YA 1TTQB 2HSZA 2JAPA 3QHAA 1PR4A 4EMTA 3KZKA 3DJYA 3IMCA 4RY2A 1XP5A 3WZMA 3FPAA 3AERB 1Q0UA 3WGQA 3Q7RA 5E2BA 1GL7A 3DDWA 1OAOA 4TLMB 2QX7A 3I42A 4OXYA 3WYFA 1NUAA 3RUIA 2N75A 3TQRA 1EAYA 3GCDA 2R6DA 2IVZA 2G5CA 1YVUA 5KKNB 1XZ8A 3M82A 4OJTA 1NQOA 2FEKA 4BVAA 1ECFA 5BR8B 1MAHA 4XD7A 2C2YA 4H1VA 2VHJA 1DMSA 1FNNA 1R74A 2UVQA 2O5EA 3FDFA 4QJBA 3KPWA 3OQHA 1F8FA 2IIQA 2RH8A 4NTZA 2B1QA 4UTRA 2FSGA 4D1YA 5E6UB 2OZLB 2XEXA 3SYRA 3CVOA 3Q88A 1AA9A 2OCKA 3BREA 4O4IF 1C4OA 3E27A 3WHIA 4AECA 5I4CA 1O95A 4N39A 3T7IA 2WA2A 3KU1A 4BAUA 1Q7GA 5GONB 2B8WA 5E95A 3V33A 5C7LO 4XJVA 1DB3A 2VTBA 3D3QA 1RIIA 3U62A 5JNUA 2BC9A 1EFRD 2M1ZA 3VDXA 1CEXA 1E7QA 2DGDA 2FPOA 4LWZA 4S1TA 2FSSA 1L5OA 2JCVA 5C0OE 2I7DA 3T15A 3L7JA 4CQMD 1WHTB 5BOSB 1P62B 2GKGA 1PV4A 5EUCA 3U4CA 3DE0X 4NHOA 3KR2A 1H2ZA 1YT5A 4NJMB 3V8PA 3SZRA 3TBKA 3MYYA 1GUBA 1Q77A 1FE8A 3EVZA 4WECA 1JXOA 3WKEA 3AVOA 1RC1A 3G1WA 5DCLA 5C8DA 4ES6A 4I66A 2O5VA 3TLYA 3HDYA 3P0JA 3ZGXA 2GCEA 2XNJA 3AT1A 2F8LA 4EZIA 3TF5A 4EKEA 3EUWA 3FMGA 2D4HA 4LK2A 3BXFA 1ZSNA 1QV6A 2IS4A 2BIFA 1EK1A 3JQEA 4DE5A 2C59A 2AMYA 4U3JA 5CK4A 1T36B 3PHJA 1WMAA 2YHSA 4PLZA 4DQKA 1ZPDA 1FDRA 2EEPA 5G1NA 5LZ7A 3RYHA 2R751 3L8YA 3MA0A 1Y98A 2IYYA 2KS6A 4UMFA 1JJVA 4IUDS 2D62A 3EVTA 4MWSA 3U4DA 4B4UA 3GD7A 3HO6A 1UT8A 3OM1A 3X44A 2NZWA 2WOOA 3IKJA 1V6CA 4QDKA 2HIGA 5FD8A 3DV9A 1OWNA 3K0SA 1EFPA 3HA7A 4WFKA 3OIYA 1H6BA 1L7BA 1U2GC 1PIWA 3R6WA 2VR1A 4OVKA 5IJ0B 5A5EA 1XQXA 4AP9A 1MX9A 1LSSA 4ER5A 3KEGA 1C5KA 3KOYA 3N3BC 2QSYA 1T2FA 3DLHA 2OCBA 3NRJA 1WKCA 1YS6A 5EE1A 5FRDA 1AQJA 3ZDCA 1X15A 3I9V1 3L7DA 3PD1A 3V2UA 4EI7A 1W0CA 2YFYA 4IJVA 2IQIA 4AUEA 3DLCA 4ZCIA 4ZICA 2MCFA 4KR6A 3ELBA 2R1UA 2O52A 4OKNA 1RLJA 2QRLA 1YBMA 3AEKA 4PCLA 3I6IA 5ESWA 1CJUC 1N5RA 3FMOB 1H4TA 3EMDA 4LFCB 1H0SA 1YB5A 1UJMA 3U3RA 1MA0A 2CXSA 1QCDA 1OB5A 4M0LA 4Y6OA 5JADA 5FOWA 3EAFA 1P7ZA 1GPKA 2OESA 3BCUA 3DW3X 3PENA 3DT9A 4BMSA 5HEKA 4MP8A 1SGWA 3WWDA 4HLUA 3UO8B 1M2JA 2WSBA 3P1JA 3QA9A 1E2KA 1YZGA 2TMKA 1CRWG 1U28C 4U2FA 4Z9YA 2FWAA 1EBUA 4PSDA 4FFBB 5BSTA 3G79A 3FFXA 4PQRA 5HK8A 4RHCA 3NHKA 1G7RA 2JK0A 4HJRA 3OQNA 1GQ2A 4E5UA 3BMNA 3HM2A 2ZRFA 2RHHA 2J59A 1EFLA 2YBDA 2Q0QA 3AX6A 2IH4A 2HB6A 4OHFA 3ZIUA 3LYAA 1DFHA 3MTIA 4YQEA 2M6LA 1CY8A 3KUXA 4FGWA 5F9FA 4H7HA 4LGVA 4HXYA 3IJEB 3S29A 3VAAA 2LTAA 2YVUA 3JTEA 3K2EA 4GIBA 5HQ3A 4UJ3A 1NJ6A 3GRYA 3B12A 3I8XA 2OORC 3PDIB 3QP9A 3CUVA 4XGQA 4YVFA 3UHOA 3TL3A 3KJZA 1TVEA 3EQZA 4J16A 3IDOA 3PHHA 2VA9A 2WVGA 3CX7A 3GLIA 2W83A 2C1XA 3HMQA 4DM7A 2YJGA 1CZLA 3F8TA 3DZIA 4YGYA 4UQLA 2H18A 3OT4A 2WAYA 4QQNA 4W6QA 3CN9A 5MF6A 1T2EA 2PMEA 3K0CC 3W2HA 4E11A 1XTKA 3EGOA 2AOUA 3HDTA 1TT7A 3B1WA 4P54A 3RTDA 1N32B 4RDCA 3GUYA 3WLKX 4TYYA 1Q0QA 2I6GA 3DZCA 2QRUA 4B8ZA 2Z5FA 1MRZA 2AZDA 5LQMA 4YRFA 1KAGA 1MEEA 1TM3E 2CFOA 3BSFA 2P4HX 1T9HA 4J9UE 4LE2A 2OT3B 5ULLA 3SLKA 1DL5A 2ES4A 1IPFA 3UMJA 4GDFA 5AVWA 1DKMA 1FS4A 1V3QE 1FSGA 1OYVA 2RH4A 4K9KA 4N9WA 2FPIA 4FK8A 3F2IA 3ZVMA 1NNLA 2YZ7A 1O89A 4QXQA 4Q4AB 3E70C 2YV3A 3STTA 9GPBA 5DNWA 4IIJA 2MU1A 4NCAA 4UD6A 2BFCB 4KLRA 5A3VA 4W5NA 1HRDA 3QPUA 1QGZA 2X41A 2V6JA 1UDXA 3DBVO 4HNTA 1BGVA 3SYLA 1ZD3A 1JTFA 5G4KB 2IYLD 4LXYA 5FA8A 4CMEC 5KYGA 1Y6FA 4J0DA 4KMMA 3TD9A 1ML4A 4F5DA 2CJYA 3OZXA 4C7OA 1JT2A 2EOAA 2VDKB 2YYAA 5F9HA 3LC7O 5SV2A 3GIDA 2Z8YM 4KIGA 2DUUA 3QFCA 1NLMA 4GICA 3T3EA 5I3CA 1KMCA 2RSLA 2JI7A 1T2CA 3BRQA 1UBKS 1VE9A 4COKA 4P0TA 1G8HA 1PU2A 3KB1A 3Q5GA 4X71A 2HIHA 5COBA 3OSZA 2D2VA 1OJ7A 5LMCA 3D7RA 3MRTA 2JLYA 2YN0A 3GPDG 5ALYA 1NVKA 3KLPX 4DLWA 5J2UF 3EDYA 4OV6B 2O5CA 2D1FA 1SUCA 3T99A 5LJLA 1P7YA 1QOQB 1Y3BE 1ZBQA 1DCFA 3RV4A 4A2PA 4BRUA 2OCPA 3CHYA 3GR6A 2F62A 4TTJA 1PJ2A 4AROA 2CMFA 2ZCVA 3F9CA 4PS1A 5BVHB 1FFWA 1Z29A 1DX4A 2DTEA 3NVMB 4L51A 3LS2A 3JATA 4OI1A 5F12A 4ZYXA 3HSSA 4PZDA 2GMWA 3E81A 4U4AA 1TCAA 4DQ0A 1I3LA 1Q21A 1IMOA 3KCNA 3F47A 1LY1A 1JHZA 1Y9JA 2UYOA 4N18A 4RJLA 4S2UA 4GNRA 2W2PA 5DYYA 2D0PB 2VAXA 1EG2A 3CH6A 5CJPA 1JKJB 3NANA 4DNOA 1CZOA 3HB9A 4A7PA 3BS4A 5JY1A 3KSUA 4Q9HA 2LCFA 1ZU4A 1JQLB 2DX7A 1CV2A 3G13A 3ICVA 1QZZA 1TM1E 4FUQA 4ZDJA 5HKOA 1IVNA 5LKRA 2R8YA 3QYAA 1H4VB 1YE3A 3DP7A 2BKXA 4HDSA 4Y7DA 4YXWA 3ROZA 3VZRA 4A0QA 3ZCQA 1G20B 2X5XA 4K40A 1SZDA 2NO4A 1F3LA 2WFZA 4V2IA 1QGOA 2FDRA 3L9XA 1FYVA 1VBNA 5E8RA 4KN8A 2JFFA 1GRRA 5IABA 4JLDA 4MV9A 2VSFA 3HJGA 4HTFA 4QUJA 4DLRA 4ZOQI 4L2IA 4M38A 2FHPA 2UZ3A 4WCFB 1J00A 4LFAB 2ZI4A 4OMCA 4AWBA 3NT5A 2I4IA 4ENTA 1GPDG 4QHYA 5CB4B 2A9RA 3H13A 4ME6A 2F4NA 4AJOA 3AINA 4CQJA 4G8BA 4YRSA 3UIEA 3D7MA 3IURA 1AGXA 3UHJA 5G4LA 3BJRA 3A3KA 3K1AA 4QASA 2QZJA 4KFRA 3VKWA 3Q15C 1J8DA 3C6BA 1U8AA 1U98A 2D74A 4TZ0A 4K9LA 5LBTA 5EXTA 1JG6A 1U2TA 2RHMA 5TQ0A 1IWPB 2LKCA 1J8QA 1HQDA 2WWXA 3A6KA 1H3FA 2NNLD 4Z9BA 2RKOA 4RZIA 4CL3A 4O2AF 4B3FX 1Z63A 1R8JA 1OLSA 4OK6A 4NMHA 3OPNA 4KE6A 2GF9A 5G40A 4E1VA 2QRJA 5TQ2A 2PMWB 1YKSA 4OHZA 3L7CA 1NONA 2CMDA 2G8LA 1ZUNB 2B1RA 1L5YA 2BHSA 2O2ZA 1W6UA 2Z9BA 4E3ZA 3E48A 1QRDA 1EWVA 3VAYA 5C8YA 1PEKE 2W6ID 4CDNA 4OJYA 2D5IA 4FJ1A 3CX8A 3RRFA 4CIDA 1JLLB 3FE2A 5I7WA 4HAVA 4EJ2A 4G37A 2YYSA 4KQEA 1DOHA 1YBVA 3L6UA 1EFTA 2IEYA 3ER6A 4OU4A 1J2TA 2C3YA 3TB6A 1XEWX 3S2UA 4A3SA 1MC5A 5IM4F 5FQOA 4KXUA 2JGFA 5E4TA 3FGNA 5TPZA 5FORA 4GLBA 1G1MA 1N0HA 2FFJA 3IX7A 1OGYA 2RB4A 2XD4A 3K05A 4XSHA 4ZANA 3UXYA 4XRRA 2PZLA 1QWSA 1FSFA 3E1KA 5HBRA 5JS8A 5J23A 2WA1A 2K2QB 3SBOA 4RKEA 3AVTA 4ZU1X 3CLRC 2BPOA 5CCBA 3HRHA 1E9VA 1H22A 5IULC 5DHRA 4F1WA 4BUJA 3BWBA 3L0CA 1SXHA 3MMPA 3A9CA 2VKQA 4O2BA 3DMNA 3PR2B 4XYBA 3HGMA 5L3QB 2HEGA 1RWWA 2D6FA 1MIHA 4R6WA 4JDPA 4IL5A 4X8HA 3IR7A 2CDAA 3K5IA 4FP9A 4TV9A 1DRWA 3W5BA 3I5YA 2PJRA 4GC9A 5EXEA 2HA2A 3MBOA 2PWZA 5DHSA 1W96A 3A37A 1VIDA 5DNYB 4BMVA 1WM1A 1RM5A 3NV9A 4B4KA 4HS4A 4S1WA 3U3KA 1UWCA 3IIEA 4RGQA 3R8CA 2O0KA 2C8KA 5A4IS 5KOJB 2JI8A 4ZCLA 2ZIGA 1UBTS 4EUSA 4L8GA 4JT9A 2WU1A 1JAZA 1MFZA 3FNBA 1RFLA 1K7XB 3LF2A 1AQIA 1JU4A 4QOGA 4UE3S 3GG9A 3R76A 3DNMA 5EGSA 5I8WA 3ORHA 3LRPA 2JLZA 1HE8B 1XZMA 2B8TA 4LYFA 4HYEA 5AXCA 5JMOA 4DDWA 4I9GA 4AJKA 1DAPA 3WXBA 4WXRA 1NOKA 1P74A 3AQIA 3COPA 2PWAA 2OMKA 4OK5A 4P93A 3GRKA 3MLAA 3OBIA 4FYXA 4I4CA 2FRDC 3AFOA 1K3UB 4G8CA 4Q9DA 3CEMA 1FDOA 1NYQA 4M6WA 3A36A 2Y68A 3RQIA 3S1AB 3ISJA 2F67A 1TKAA 1VPEA 5T4HA 3ENZA 3QKUA 4LZAA 4B5LA 521PA 2GBLC 4Z54A 5K4HA 4JT8A 2P4SA 2N47A 2PS3A 1TK3A 5J4YA 3DOHA 1XRQA 3MAAC 1UQRA 2FLKA 4OYLA 4H0CA 1WEHA 5JCOA 1E1LA 1IH8A 4DR6B 4QPDA 3UW1A 5EERA 3EVDA 2FZ5A 1F8YA 1YOVA 1JTVA 3NM4A 1KMHA 4FDTA 4TRJA 4F4HA 1GPUA 1ZJJA 4JLAA 3U6KA 4EG4A 4HG2A 4DXDA 1XZEA 3HBJA 4W7IA 4YIKA 3HY6A 1CRPA 4F8EA 2P78A 5CLJA 3G02A 3DQQA 2YL2A 1C9DB 3GRRA 1GAEO 1N6LA 3UV3A 4CG2A 1YR9A 3AP3A 3RC9A 2DH6A 2I3ZA 4YRJA 2Q99A 3VZQA 2AFHB 4BFTA 4BFLA 4MKXA 1ZINA 4FC7A 4OHRA 3WLFA 4AZVA 1ENZA 1ANKA 2DPLA 1Z7GA 4RIHA 3FKSA 4YX9A 3S2EA 3CCCA 1RKUA 3HVHA 4CDMA 3EX7C 2ZDGA 1LQTA 4BCCA 1NBEA 2J67A 3JWIA 4ND2A 4UTNA 3VC3A 1XDWA 4PAMA 3RODA 1XJ0A 1T6NA 1X77A 1QYCA 1LLQA 3EGDB 3GBVA 2YOHA 5AKEA 2MR5A 5GMOA 1HE5A 1GAJA 1GL3A 1Z6ZA 4R1QA 4V0MA 2OD7A 4I9HA 4A0HA 2VBIA 3C5VA 4KAJA 5EGNA 3NC0C 3N8KA 2XMCA 3PR3A 3TAUA 3DUFB 3BGVA 3T9FA 3FGZA 4C08A 4C76A 4EO9A 5DGHA 3T7TA 4UNIA 3ZW9A 2BR4A 2CNBA 2BGKA 4CKBA 5KKCA 1ECGA 3H97A 4AMBA 3B52X 3ROFA 1AO0A 4RF4A 5BORA 2DY1A 1QIKA 4R8RA 2VEDA 2ZQ5A 4F3KA 1NNSA 3AKCA 5FTNA 3UN1A 1OZHA 3EA0A 5F23A 4M1QA 1E69A 3SF0A 1LDGA 2VH5R 2FQXA 3BTUA 1T0BA 1ZUWA 1S7CA 3C8HA 5FAKA 1BKSB 4IS2A 1UAGA 1R37A 1EBBA 2B9VA 3GA0A 4CF6A 5FLXA 1WCIB 1J49A 5L4NA 4LZLA 3ZHYA 3RRXA 2BFPA 3HZHA 4CLXA 4HEA6 4F2HA 5M34A 1OASA 4NOJA 4Q9JA 1J99A 3JWGA 1FIUA 2Z57A 1QP8A 4GYWA 5AM2A 4YO8A 5L3SB 4LG1A 4IHJF 3JASB 1Q12A 3R5FA 3BXOA 2R6R1 5BUQA 4LJKA 2GN6A 3T4EA 3VYTB 5ES3A 1XF9A 2P3SA 3JCZA 4ARZB 1HQKA 2LNDA 1A9ZA 1XZQA 5EFZA 2Y1XA 3HYCA 3EHDA 2AN5A 4P5PA 5HDBB 3TS1A 4B3TB 1PWEA 3RUHA 2J9FA 2HSEA 1IWBB 4UBMA 5FJIA 1EVJA 1T10A 2VWPA 3EZ7A 1LVUA 4IOLA 3RHFA 4DQXA 2EFYA 1C9NA 3H5WA 5KWIA 3KTDA 1I4EB 2JFYA 1N0IA 2ZRDA 5EAIA 5IC4A 1CULC 1U0GA 4GZMA 5ALDA 4ZKDA 5J4KA 2RGGA 1Z12A 1XRNA 3W7VA 4DWOA 4KH0A 3B3FA 1UXHA 3ETGA 4TXMA 2IY9A 3GNSA 3T7EA 3DEAA 4I9UA 3UGKA 4BBPA 4EG3A 1NMSA 5UKDA 2QLNA 1Z5PA 2WSMA 3OM9A 5IXJA 4X93A 4KK4A 2BEUB 2FZVA 4JZYA 3AQ4A 3TBHA 2IS2A 1RWXA 3NEYA 4F6CA 5CD9A