1YDHA

X-ray structure of a lysine decarboxylase-like protein from arabidopsis thaliana gene at5g11950
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
184
structure length
184
Chain Sequence
b'QRSRFRKICVFCGSHSGHREVFSDAAIELGNELVKRKIDLVYGGGSVGLMGLISRRVYEGGLHVLGIIPKALMPIEISGETVGDVRVVADMHERKAAMAQEAEAFIALPGGYGTMEELLEMITWSQLGIHKKTVGLLNVDGYYNNLLALFDTGVEEGFIKPGARNIVVSAPTAKELMEKMEEYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords At5g11950
publication title X-ray crystal structures of the conserved hypothetical proteins from Arabidopsis thaliana gene loci At5g11950 and AT2g37210.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 60
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 3.2.2.n1: Cytokinin riboside 5'-monophosphate phosphoribohydrolase.
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03641 Lysine_decarbox Possible lysine decarboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ydhA00
3EHDA 2F67A 3IMKA 1S3FA 2A0KA 4KXLA 3O8OB 2PFKA 2F48A 1PFKA 1T35A 3O8LA 2F2TA 2KLHA 3BQ9A 2HIGA 1S2GA 4MEJA 3PFKA 2IZ7A 3U39A 5AJUA 4A3SA 1MTOA 4U1RA 2PMBA 4WL0A 4LJKA 4KXMA 4MCJA 1S2LA 1WEKA 1S2IA 4P5DA 3K2QA 4I4IA 4P5EA 2F62A 1WEHA 2IZ6A 6PFKA 2Q4OA 4NPAA 3OPYA 4I7EA 3UQZA 5ITSA 3F5MA 1F8YA 1F8XA 4LJLA 4OHRA 4JEMA 4JENA 1YDHA 2NX2A 1ZXXA 1S2DA 3GH1A 2F64A 2KHZA 4LJRA 3O8OA 3HNOA 4I36A 4FYHA 3OPYB 2Q4DA 4PFKA 2A33A 4FYKA 2IZ5A 4JELA 3QUAA 4KXNA 4OHBA 4HX9A 4RH3A 1KZHA 4FYIA 5AJTA 1RCUA 3MAJA 3O8NA 3SBXA
chains in the Genus database with same CATH superfamily
2WNIA 2F3UA 3FHOA 1DGQA 4FWTA 1U2GA 2FCAA 4RJIA 2NVUB 2YNMC 1ZNYA 1M0EA 2O2HA 3RFCA 3F3KA 1DT3A 4WEQA 4HGQA 4UNPA 4WK0B 1B3BA 6ADHA 1I1HA 2QXTA 3COJA 3Q0TA 2VP3A 2IYUA 2XXJA 4O1IA 4CG2A 4B3TB 3R3WA 3QELA 1YR6A 2I7VA 2DH6A 1EWVA 2NSYA 4EK9A 2BFDB 4I4NA 2REQA 1QB7A 4D79A 3DEAA 1O4VA 2VP9A 4E6EA 4RH0A 1KJJA 5EJIA 3VNVA 3NAZA 4LZZA 4C01A 1XZKA 4CETA 1U3VA 3G0DA 3QPAA 4CZ2A 4LXHA 3HFSA 4GPTA 4FBMA 5DV9A 1CUSA 1H2BA 1OI3A 4PSAA 5CUQA 2VBGA 1WKCA 2J5KA 1WUHS 4RVDA 4Q16A 5CCEA 3NBYC 1BX1A 3MPUA 4HDAA 1PUIA 1UJ5A 2JNWA 4RY0A 3CC8A 1WLSA 3C1TA 1D4FA 1ZHHA 2OT3B 2XGGA 1G9SA 4EQ6A 3HJUA 1YRBA 1YI0A 4V0MA 4UU1A 1B6SA 1DC3A 1J2RA 1T8UA 3D3NA 1H22A 3HXKA 5EEGA 3IIMA 3AVXA 3W0LB 4BNVA 3OD1A 2CN1A 1I4TD 2YASA 1JR6A 2ZWIA 3EGIA 1ELOA 2XDQB 5AUOB 2DB3A 2PWYA 4UW9A 2PUJA 3NB0A 5DLYA 4ZRMA 2UUAB 3TOZA 1KVRA 4EEXA 4WKCA 3SK0A 5I7VA 3G5TA 1KDVA 3ER9A 5TDHA 4RJ2A 3RTEA 2D3TA 5FR2A 1TO6A 3SNHA 1QWOA 1YE3A 2G08A 1CIJA 1MVOA 4MWCA 1VCHA 3QUCA 1DOZA 2FF5A 3LC0A 4MITA 3H4MA 2JKVA 4GBJA 4HQNA 3T34A 4NE7A 4HF7A 4JBYA 3MWEA 4KQ9A 1BRMA 1OX5A 1XCGB 2EFEB 1D03A 3BMOA 3CRNA 1RKBA 4ME6A 2QE7A 1SXQA 4QYTA 4R1OA 1IZ0A 2QXUA 4UCWA 4PTZA 2C1ZA 3IO3A 3KSMA 3A70A 4HZUB 1C5KA 3IA2A 3KJFA 5FBHA 3PA8A 2EJWA 5A71A 5JXJA 1XJWA 4X60A 4UNIA 1GKLA 4S12A 1PJCA 5JISA 2GFIA 2HLPA 3M34A 5FNVB 1HZJA 4EO4A 1YE5A 2I80A 4DANA 3KKOA 1G66A 3NM6B 2EJCA 1N1MA 4KXQA 4G9BA 1YOVB 2XCIA 5ENZA 4IKEA 5JD4A 2PXHA 4F3KA 5KBYA 1C3LA 2VDNB 4GKAA 5HJ2A 1NBMD 2V8BA 3VX4A 5I7HA 3UFXB 1TPZA 1TMGE 3X1MA 1CRLA 1Q7BA 3IE0A 2M6RA 4R8SA 4LJRA 2HLDD 2QMUA 3HVJA 4S1VA 5LUBA 3ZW9A 2JBAA 5AI0A 3FMOB 3HB9A 3VJKA 4V1CI 1X7XB 4XFJA 4ZEVA 2C5BA 1W73A 2JFHA 1YONA 3LP6A 4PNPA 5JCJD 5A4JA 1N36B 1WCWA 2NMVA 3LA8A 5K0LA 4AVYA 1ETHA 4KUGA 5GIPE 3OE7D 3UM9A 4R01A 5CJJA 4GICA 3MWKA 2IYRA 1EWKA 4IOJA 1XVLA 1SQ0A 2G5CA 5LU8A 5C3UA 4C07A 1E2PA 2O5RA 4MGIR 4E09A 1ZJ5A 2NN3C 3DMDA 4IXMA 2GHQA 4TRRA 1XZGA 4QBKA 4XZ3A 3T4XA 4QE3A 3ZV4A 3P27A 4A8JB 4FONA 3HBFA 2VCEA 1CR2A 5BNFA 5JFGA 1Y6FA 1T3GA 2P5SA 1N2GA 3ZK7A 4RCZA 5M7EA 2BM1A 1WBDA 1GAEO 3FSGD 5C37A 4EZEA 4K6KA 4QNMA 4HAOA 2A9FA 1BG6A 2QQGA 3CRW1 1LEHA 3NHLA 2ALJA 2P6NA 2NXWA 2BMVA 3PQCA 1H5QA 2HH9A 1D3AA 2Y4OA 1R0SA 4FEGA 3TWOA 5HS6A 1JHOA 3AMVA 4QRIA 2QUAA 1WNTA 2JBHA 3DHEA 1GLVA 1N1GA 2GZRA 3BULA 3G8YA 4D4IA 5H1YA 3X1YA 3F5SA 4F4HA 4IS2A 2B83A 1Q2XA 5TQ2A 1NXWA 1E4VA 1B41A 1CY7A 3WRWA 1E2KA 2B4KA 3GMDA 3R44A 1UXHA 2ARKA 2Z4TA 3CZ9A 5EXEA 4B6QA 5AVRA 4Q9AA 4O3MA 1U0FA 4JUIA 4M0DA 1I33A 2H1RA 4MLCA 3EMKA 2AWNA 4NMXB 3U4HA 3IAEA 1IY0A 4MGEA 5DRTA 4ZPJA 3RI3A 2ST1A 2HHLA 3ZE7A 4A0RA 4LF9B 2RGRA 3K70B 1Q16A 4JJEA 5EINA 2YJ5A 2ZJAA 1S2LA 3I3OA 5J59A 3PEEA 5THKA 1ZCBA 4ENPA 1KGSA 1TA0A 3ANLA 1DEOA 1XTQA 2I5PO 1Y7IA 2E4YA 5CA0A 3AVPA 1QFMA 4NICA 1HDIA 3BTUA 4MB0A 3D4BA 3O1IC 4AECA 3ITEA 2ZT8A 3CNQS 3TGPA 1LDYA 1ZUD1 3A6ZA 4P84A 1Y8QA 1K06A 4KGZA 4YT8A 3KTDA 1XDDA 4J16A 4D02A 5L51A 4PSKA 1L2TA 2OXCA 2PIAA 3D31A 4K8RB 3VPDA 3OO0A 3DMYA 5BWOA 4CI0B 1BJRE 2CWWA 4YRKA 2R4TA 2OSVA 5K6TA 4HI0E 1E60A 2MSCB 5JCXA 3RC3A 1HKHA 4YLEA 1HKUA 4M7RA 1XRSB 2OVBA 3PLAE 2B4RO 4B8WA 2WJ6A 2QMQA 6GPBA 4KNVA 2ETVA 4L0QA 3GLHA 4AN1A 4OK3A 1P80A 5GM1A 2YXLA 1ZVQA 5K4HA 3DQPA 2Q28A 1QOPB 4NYIQ 7MHTA 1Y5RA 4EF6A 3B53X 4FI3F 4FSDA 5B1IA 1XGKA 4EFLA 1T25A 2L19A 2RHCA 2HDNB 2IEAA 4B2PA 1Y5IA 4B6OA 4CCYB 2XRZA 1JILA 1MP0A 2NIPA 2Q9CA 3DYBA 4RIHA 3T1NA 3UV6A 1OJ7A 1BW9A 3GDHA 3H2ZA 2C20A 4BJ1A 3PB3A 3C5EA 1C81A 1Z6AA 2QAGA 1SHUX 4C7OA 1DPGA 2Z43A 3HZHA 3RS2A 2Z08A 1KL7A 1SU7A 3F97A 3T3PB 4D8YA 2W2XA 4IL5A 2TECE 2ZBQA 2Y6UA 3HP7A 4AKEA 4XWYA 2QVBA 2O0HA 4XGKA 1KK0A 4RA6A 2ZAYA 4Q1BA 1Y6JA 3HE3A 4MB6A 1F1BA 4LK2A 2AHOA 2A14A 1XEFA 2DECA 1ENYA 4DWOA 4ZYLA 3WNVA 2JH8A 2GQ0A 3L18A 4U7WA 4ZT3A 5DYYA 5U1PA 1U6KA 1VMDA 2LXNA 3NRCA 2BEJA 1BC5A 1L1QA 2YHBA 3R4CA 4JLMA 4P7KA 1YASA 3H2IA 4Q4JB 3K4HA 4KAXA 3ZX5A 5D8DA 3IQZA 1SCAA 3SMQA 1Q95A 2ATCA 5BWMA 5K01A 3P4XA 4CDMA 1KJYA 2BI7A 1HDEA 4IVRA 1YO6A 3NEPX 4CT5A 4TN1A 3EEOA 4BEJA 2NUPB 1TE2A 3Q9LA 4M38A 4D8TA 5HF6A 2DBVO 1QVWA 2VG8A 3PSHA 3SY8A 1T35A 3ZWPA 5J2UF 4MWGA 2I7DA 1C7JA 1NX6A 1VSBA 1GSOA 2ZU6A 3GJSA 3PL1A 4J07A 5CMLA 1FX1A 2ICAA 3A6DA 1O8CA 5ALKA 3E84A 3EAQA 2WB2A 2CNOA 3X2FA 1EB8A 1TFRA 2ODPA 2OP1A 2PWZA 1TQ8A 3A26A 3Q2OA 1RQPA 2PMEA 4EG3A 2OQIA 4ZCLA 3AFNA 5LA6F 1G4AE 1FS6A 2NYVA 1CW2B 4L07A 1RYFA 1X7GA 2IXDA 3KOWA 2GI4A 4UQOA 4WI1A 4ECEA 1TO2E 2BISA 2DCMA 2IP1A 3A2MA 2RCNA 3JYPA 4CLOA 1NBOA 1EDBA 2VDVE 3IALA 5DLQC 2V9ZA 1NN3A 4C3UA 1P0QA 2VQDA 3UWKA 4UD2A 2R86A 1Y5LA 3IJPA 2X4GA 1Y42X 4UD6A 3TR6A 5JAZA 1Q1AA 4CDGA 2AB0A 1ZN9A 1JXAA 5A4KA 2X77A 2C2WA 3O4FA 4HQKA 2BCGY 3HZOA 3HEAA 4OXNA 5HDBB 4MGZR 1I7PA 4PQRA 4WXHA 1OI2A 1KEWA 4L16A 4UBJA 4WECA 5DZSA 1RJWA 2SKCA 3BRSA 4PQGA 2NU8B 4A6EA 3G2PA 3AETB 1PSZA 3G2OA 3HA5A 4TMVA 1DAOA 2V1UA 2PRYA 3EMVA 1RMQA 4O29A 2WKQA 2DBYA 2RCYA 2CW5A 5J2TF 5CGQB 1BE0A 4WLOA 1EG2A 4IDNA 1TAQA 1MPTA 1VBFA 1RI5A 1L5OA 4H4CA 3C14C 3MCWA 3ED1A 2L0XA 4K03A 4B7AA 1XV5A 2V7PA 1CJSA 5DP1A 2RHJA 2YIJA 1JHZA 3D3EA 4QM7A 2PL5A 2FETA 3OM8A 1PT8A 1T5BA 2H4XA 1V6SA 2OC9A 3H2YA 2Q41A 1RAFA 1R10A 2Q5QA 4U7FA 2ZPTX 3X2SA 3JQGB 5G4KA 2ZYVX 1LPNA 4EP1A 3RUPA 4TXNA 5KC9A 2JASA 1LBIA 1M0SA 1ZZEA 4G4SP 5JROA 4JQSA 1F3LA 3LRTA 1I0ZA 1VHQA 5JATA 3H1TA 1MB3A 3I9V6 4FQ7A 3DLAA 2DUJA 1B0PA 1V3UA 3VR5A 4A26A 4EW3A 5L45A 3LC7O 2XOXA 3Q3CA 4HNAB 4L72A 1O94C 4DTCA 1GNQA 1OXXK 4TRJA 3GEIA 1L7EA 3W2IA 1GXSB 3FFWA 1Y1RA 1YNOA 3IBSA 2CB0A 2UZ0A 4GI2A 2Q8PA 3CYFA 4NZNA 5D1NA 4MOWA 4CLRB 1OH7A 3ZLTA 4PX3A 5A06A 1ODKA 3OCYA 3PQEA 4RACA 3SX2A 5H82A 5I7WA 4DC0A 3TUIC 5EMMA 3T7CA 4BLQA 2JK0A 3BE5A 2QTHA 5IN4A 1AZTA 2AX3A 2N0SA 5KQMA 4HNRA 5J4KA 4QAQA 5ES4B 4KN8A 2FLKA 2IYSA 2AUMA 4CL3A 5K0FA 3NR2A 5K4GA 1I36A 2H9IA 2XNDA 4NJOA 5LSAA 1XA4A 2VPWA 3BFKA 2QD2A 4NU5A 2QW8A 1L6RA 2W2TA 5CCXA 2YN2A 1UK9A 1QP8A 3ZZ1A 4CYMA 2DETA 1GRRA 3DMHA 2FRDA 2NNWB 4OHCA 3UBMA 5BUSA 2R4UA 1NN0A 1GTVA 3ZXUB 5FJJA 4Z1MA 5EPEA 3I2IA 1D1PA 4PGFA 3OUZA 3MD0A 3OX3A 3O4JA 1H23A 2D5AA 3D64A 4E5VA 3DZIA 4EYEA 3HUEA 1R12A 1T91A 2VDQB 1IIRA 4H6XA 3PQ7A 5JBNA 2W8ZA 3FCSB 4X20A 2HQBA 3OQOA 2D6FA 3ZXYA 2QIOA 3IKTA 1TU4A 4YJ3B 2NSDA 3FFBA 4M1KA 2QP9X 1YDGA 4KH1A 4AFNA 3VOAA 2Z95A 2GN1A 2NZJA 2XADA 1E58A 2GZMA 4CCSA 3F6RA 4LZAA 1SC1A 1JPNA 4FGWA 1SQSA 3AVUA 2TYSB 4P92A 3AL0C 3KQQA 1C8BA 2C92A 4C3ZA 3DAFA 3GLVA 3CX8A 1W88B 4QWMA 2R7MA 1IOWA 2SBTA 5AW7A 4BFLA 1EFKA 4OJYA 1J8DA 3ZJ4A 2EZ9A 3FPJA 3K2QA 4HDKA 5A4AA 1JIXA 4P53A 1XN4A 4F1KA 1EVIA 2IH2A 3LH5A 5DIFA 1JEYB 2QXYA 2PGAA 5T6BA 3B3AA 1P1HA 2WB4A 3IUNA 5I4BA 1USVA 2WVGA 2XIQA 1D0SA 2HJSA 4QELA 3SC2A 1QVZA 4EYGA 2DWPA 3H8SA 2JAPA 4L7QA 1T6XA 5KOJB 1ACLA 1H2FA 1OUMA 3UWOA 5KHAA 1KQPA 3L5KA 3OMXA 1N0IA 4NCNA 3RDPA 3KEFA 4BBAA 1UXIA 4GOJA 1D8TA 1NYRA 1NM5C 5HF9A 2J1LA 3RHZA 4MVJH 3HMKA 1B8PA 1H2YA 2KYRA 3FCEA 3I9MA 2XT6A 3BA1A 3BH0A 4IG9A 5FWXA 2A1UB 4D9IA 3CG4A 5F3DA 1JI3A 1ZIOA 3DMNA 5ESXA 1KYQA 4HQLA 1SOUA 4KO4S 3T35A 2WYIA 1NUSA 3DEHA 2R44A 1HYHA 1SVSA 3KAKA 3I0MA 4F91B 1NW5A 2OGUA 3QTTA 4N5NA 4V0ME 3TAHA 4IDAA 3T1YB 3VYTB 2P3SA 3VHXA 4CF6A 1E2JA 1K6IA 2UXBB 3G2MA 2GK3A 3B6ZA 3TG2A 4NZZA 3INRA 4KITB 1IY1A 3R3SA 1W49A 1Y33E 3GZJA 4OKIA 3IUQA 3OY7A 3TM5A 5JADA 3U19A 2C5FA 1X39A 5DHRA 2BFBB 4IUDS 3ZTTA 3INTA 1IQPA 4FKBA 1TCAA 5COBA 1EB9A 5AXCA 1D2RA 3EOBI 4JC0A 2BUBA 1LBHA 4YUWA 1AF7A 4UTNA 3A6KA 1SZDA 2CUTA 2PT5A 3R3UA 4K46A 3U60B 1BD4A 1JDZA 4V38A 2QR2A 3VDXA 1LVGA 4QPJC 1U3DA 4B44A 3ZNPA 1A4XA 2HADA 3JASB 3SICE 4URXR 4MPTA 1AD2A 5HWSA 4C0AC 4BU1A 1CUWA 3GQBA 3OBBA 2YS7A 3I6YA 3IMKA 3IP6A 1ZONA 3NFRA 4X6UA 5C81A 3B1FA 4X1IA 4KO2S 3V4RA 4F2GA 1S2NA 3WGOA 1VXOA 1FLAA 3F2IA 3GDGA 2A35A 3LPDA 1Z0KA 5A04A 1AQLA 2G9NA 3KOUA 2DUMA 2R8BA 3IQHX 4QGFA 3LP5A 3V97A 2JD1A 4RSMA 3GUYA 3ZGXA 1QWSA 5KOHB 1ZSYA 3FYSA 3URMA 4ER0A 1KDOA 2JGMA 1DTSA 4R6XA 1P3JA 2B69A 4U9UA 4YCSA 1T8WA 2Q2OA 2X5OA 1F4PA 5ECWA 3SC4A 4PAWA 1N2OA 5C8YA 3JARB 2IHKA 1Y3AA 5LN1A 4JD5A 4WNCA 1P7WA 1QR2A 1UDXA 1XLVA 4QSMA 3EXHB 3O3CA 2DWUA 5BYJA 3U3XA 4A2PA 4DLKA 1NG9A 1UADA 2GN4A 1T8PA 4CQJA 5LP1A 5ADHA 5KX5F 4OOEA 2FWPA 5JU6A 2HRBA 1YVRA 3MVEA 2XCQA 1ZWLA 3BS4A 1RKUA 4IW3B 5CLIA 2HCTA 2E5WA 2A0WA 3WS7A 2O5CA 1FZQA 3OPMA 3UOWA 2ET6A 4LQ4A 2I66A 4R9VA 1YZQA 1SAYA 2G67A 1JG7A 4YALA 5DSTA 2G17A 4YRBA 2C7QA 4MLPA 1DAMA 4C30A 2GCIA 2B20A 5KVQA 3CZQA 5LJIA 1ONPA 4W8OA 5IDQA 4BRWA 4NFLA 3W5BA 1RWMA 2R6FA 3VX3A 4IJ6A 2C0PA 3O4GA 5L7YA 2FTKE 2ZCVA 2A9QA 3PGMA 3C8UA 5EJ7A 3OC6A 4YJ2A 1SZPA 3TCNA 3WRVA 1YFLA 1TI7A 5KU1A 1W0CA 1M6NA 3P0JA 4MCAA 5HE8A 1M34E 3RJZA 2QDXA 3ENWA 4ZHQB 2XVAA 3NJRA 4M1TA 5GJVC 4AJEA 4YLGA 3EXAA 5LMCA 4L5YA 4ROTA 1PWXA 3VKVA 4O6VA 1LRJA 4QUIA 4ZVUA 4LXXA 4RHUA 3WJ1A 5A7FA 2P62A 5JSZB 3RB8A 3WL6A 1PEDA 2GCEA 1RI3A 3HDYA 1I3CA 3HR8A 4W1PA 2GTHA 2VL7A 4C0LA 4WWHA 1DC6A 1G5QA 1KQOA 4BCBA 1EFHA 4JP2A 4DOMA 2G63A 2H17A 1DJQA 1QHYA 3IQXA 4JR0A 4JGGA 3NDJA 4WKGA 4MHOA 2VJKA 4HVCA 1UFVA 3ME5A 4BO8A 1PL7A 1CE8A 3FTEA 3RREA 1QDLB 3I04A 3MM4A 3KYCB 3UJ7A 4EJSB 2AZMA 1GZ3A 5HJEA 2O7RA 1S5PA 5HUJA 5I4IA 4R1MA 1OU0A 3MJFA 4URFA 3PSAA 4DY6A 4GM4A 3M6WA 2NO4A 1L9KA 2AOWA 4JCOA 2WHYA 3DKKA 4LSZA 1T9HA 3B1XA 4N12A 2XECA 3TMYA 1G63A 5JQWA 5GOZA 1GSAA 5EQJB 3U56A 1THMA 1XYYA 3FOAA 3F74A 4F8JA 4LNHA 3K1YA 1T13A 4TWRA 1R0ZA 3NS7A 4UUOA 2VXYA 2VWQA 1GRCA 1A9QA 2NTYC 3EIOA 4KQIA 4XW2A 3R7FA 1DHRA 3MMSA 3G17A 4ZZ2A 3LY7A 1M2EA 4IRXA 2DUNA 4QICA 3OIWA 2PBRA 3GLHE 2WWYA 1ODJA 2C3UA 3BMCB 3DHNA 3QKRA 2C77A 2DFVA 4LVUA 4NJMA 5EJGA 1BIFA 1P4GA 1TYZA 1KA9H 2MT9A 3RBXA 4YFYA 4LRSB 3VSDA 2V6GA 2YWRA 3VVLA 2XYQA 2R5WA 3U1VA 2C5AA 3J7AC 1C0PA 4G07A 4KXLA 3BWBA 1SH7A 4Y1FA 2Q3DA 3DDNA 4EUEA 1B93A 2IXFA 4NV3A 4XSVA 3KE8A 2AN9A 2VP2A 3KOMA 1KH1A 3COSA 2BM9A 4YI3A 3N0TA 3AGQA 4YP1A 3RFUA 3TB6A 2J4FA 4AJPA 2VK2A 4HAUA 4LV6A 1B14A 4ZCQA 3IBCA 5H80A 2X0FA 4BVBA 3OJXA 3NTXA 1N8TA 5LLDA 2WWVD 4O5AA 2O0MA 5EJAA 1CU1A 4FNAA 4MVJI 3JRWA 2WWWA 2XW6A 4R4JA 3RYFB 1YQTA 3TMKA 4N8DA 4C7JA 4F4IA 4DZZA 4UDYX 1CUCA 1EM6A 1OXSC 2E4UA 1BE8A 2AZXA 4PYLA 1FP1D 1EP9A 1JLHA 3LTNC 3L92A 1YC2A 1PNOA 4PGMA 1M5TA 4NOLA 3VR3A 1LF5A 2M2IA 2X4DA 1Z5NA 1RZUA 3HVHA 3JATA 4BTLA 5JC8A 3EPHA 3VBCA 3C5HA 2PLAA 2OEPA 3E1GA 3OHSX 5LQRA 4BPRA 4Y30A 4YRTA 3KXIA 2H54A 5K3BA 3SE7A 1Q57A 1CNMA 4OFBA 4AIIA 1SJ9A 4ARCA 1IEVA 4HS4A 4XUGB 4NH0A 3PQ4A 2AKYA 2F00A 2OA0A 4LV5B 4XIJA 1E9RA 3FFXA 4IMJB 4LA4A 3V5NA 1QDEA 4HG2A 1CJVC 4AI6A 4FOLA 4LC9A 1ZQ1A 3K0FB 2A7XA 3UAZA 2MMCA 1YFZA 3QXCA 4GZLA 1I1OA 4IXWA 2YWCA 3T41A 4A6DA 4EZBA 1U2RA 3ADPA 5CBPA 3WL5A 1OI4A 3DVQX 4U00A 2OG1A 1KEVA 1V6AA 3ABRB 3U44A 2B0JA 5EIBD 3A14A 1PZMA 5F77A 3UMGA 1GZ4A 1T0IA 5FLKA 3PHHA 3B9PA 2XMQA 1G2QA 1ZG3A 4M9ZA 4M0MA 4B3DA 4CCAA 3IP5A 1NSFA 3PKZA 3GEMA 2B6HA 1OBHA 5CB4B 4IH9A 4HB0A 5TX7A 3ERCA 3EISA 1UC4B 4OHMA 4DEVA 1JMVA 5EERA 4W9NC 2QVCA 5F64A 4GVPA 4EB3A 4M53A 1M6VB 4L22A 1EVEA 1NT2A 3SX0A 2ATXA 4KBFA 3QG5A 1YJ5A 3OEED 2ID9A 221PA 4BVFA 1LNSA 3D54D 3ODPA 3BM5A 3QLEA 2VUHB 1QAOA 1NLMA 2R00A 1LI4A 4FMPA 4HQ0A 5FB3A 4C4ZA 3NKLA 1UMBB 4ILEA 4KLNA 4NEQA 1F7UA 2PU5A 3FCXA 1L4BA 2WTNA 2FR1A 3FPHA 2PXAA 3RHSA 1W9HA 3UHAA 4CLDA 2WFMA 5DT9A 5JV5A 4OBXA 1LLFA 1INLA 3KOXA 1TOAA 3PGVA 1EI9A 4KE8A 1G7SA 4FD2A 1ZD3A 3NPAA 4Z0NA 4GEGA 5AVSA 2IW3A 2X6QA 5E9WA 4RL4A 2GJ8A 1UWLA 3T0FA 1LV7A 1SUPA 3HJHA 3MMPA 5AJTA 3K20A 1T26A 4ZOAA 4C6HA 4WSOA 2VC2B 4DV1B 4EKDA 3IUYA 1FLNA 1VKZA 2HJWA 4OG2A 4R16A 3SP1A 3ZDRA 3Q0EA 1JAZA 5THQA 1RI1A 2ZTLA 6CHYA 4B7XA 3ANYB 1EZZA 3DMPA 3O5AA 3VH1A 2JGIA 1RQ2A 2OZLB 2FFQA 4OXYA 4CRWB 3HJAA 4RKRA 1KI2A 4DCPA 2BTQB 3QVOA 1EMDA 1PJ3A 3PC4A 3ML1A 1T2FA 4A1FA 3IPLA 3QH4A 1IB6A 1UKVY 5B58T 1HFEL 2QRKA 2VEDA 3BWMA 5ALTA 2JEOA 3M4JA 1M2OA 4OU4A 1YAJA 1A71A 4NCXA 5LQJA 2H16A 3O4VA 2WYOA 2HGZA 1WUJS 1DRUA 4LMRA 1R0BA 2Y68A 3RAFC 4DA4A 1D2EA 1EDEA 1UBKS 4GR4A 1QB8A 1NC3A 4P98A 3VISA 1CZUA 2P67A 1LSOA 3GEEA 3I6MA 4RVOA 2JJMA 4BNHA 5LM3A 2GM4A 1YHZA 3TBKA 3PT5A 1DEHA 1XD2B 2D2EA 2CUNA 4NJEA 4TYMA 1M7GA 2XX3A 4XGQA 3VTAA 2HWKA 1DINA 8ADHA 3WGIA 3PEWA 1T8RA 2IK8A 4C6SA 1C9KA 1MN6A 2BHNA 4E70A 5JBQA 1YS6A 4HXFB 1RJEA 4WASA 2XGOA 4MEAA 3EHEA 2PEZA 4I99A 3UPUA 2G8NA 4FI3C 4Q05A 2ANCA 1GDHA 1GGJA 5EZQA 4BEBA 1QS0B 4Z8XA 3AUXA 4Z5XA 3K0AB 3WY9A 4B0PA 5HCUA 3OQIB 3KSBC 3ORFA 3PRKE 3VGJA 1PWHA 3ELBA 2VUIB 4Q9DA 1ZBDA 4LKRA 2ZUDA 2QE7D 4OP3A 5JS6A 1XMOB 2I29A 4K26A 2DWOA 2MINB 1D6JA 2GEDA 1XT6A 1ZH2A 2VOJA 3BF7A 2FMKA 2VYFA 1CD5A 1L7QA 1MJFA 2JFYA 2EX1A 2QG9A 3FMGA 1WDLA 4NENA 1QRSA 3PC8A 3LLCA 4WNAA 1W94A 2C3OA 3F4LA 4Q02A 2BGTA 3OWHA 3EY4A 5SY9A 3RAJA 2C7GA 2FW9A 4JOQA 2QTCA 3I92A 1C8LA 3HJGA 5K3OA 1XCBA 4P7FA 2Z8YA 3MJRA 3Q41A 3F9IA 3T9AA 1I3MA 2JH3A 4X61A 1HNZB 1NW7A 3G6KA 2B1GA 3E61A 1T3HA 4TWZA 4ZO9A 4OUDB 5F21A 5IANA 1PFUA 2GDJA 4N0MA 5B1DA 2ZR8A 4K88A 3IRVA 1NJ2A 2AWOA 1N78A 1DRJA 1Q3HA 1MB2A 1TQ4A 3DKIA 5AVVA 3DMGA 2BEUB 4PLWA 4X71A 3MLBA 2I55A 4KU4A 1GGFA 1LJ8A 5BWLA 4ZJUA 3CXUA 3JAKB 3OZXA 4HEJA 5GIOE 2H0AA 4GXTA 1MX9A 4XOUA 1QGDA 4ZZIA 3AEKB 2NW6A 4L6AA 4RKWA 2BTOA 3PWSA 3TZLA 1SULA 2OFFA 4ALIA 4B7UA 1ZMOA 2J3QA 2HJVA 2OHFA 4G1FA 3KJQA 2NU6B 3A6PC 1W47A 1EK5A 3JQ6A 3MOSA 5L95A 4TXLA 4MRAA 3RARA 1QRUA 2IHNA 2Z58A 2OXRA 1ZUNB 3DEIA 1LV8A 2XUHA 1OFHA 3U2QA 3ODGA 2JCBA 4WCDA 1TZJA 4XASA 1LLDA 4Y0NA 4OFXA 3COPA 4ZEOA 1UZNA 5GONF 3DV2A 3I8XA 4ARUA 3BTSA 1NKVA 3QWHA 1E69A 4I1PA 1TF5A 1T0JB 4XARA 4PAQA 1W5BA 1H2HA 4RHEA 3ZG6A 4CMKA 3S4YA 4YRLA 3DEFA 3H6GA 2ZRKA 2RH5A 1WR8A 4QC2A 4RD6A 1H93A 3QPWA 4TL6A 1WMAA 1AKMA 4Q3AA 3CQ9A 4RAOA 1QP7A 3VDRA 5AW1A 2PUEA 1GL7A 1I4DD 2EF0A 4EYSA 2BZ0A 3M33A 4CIXA 4DV2B 1IE3A 3BGSA 2I0FA 3RWMB 1M74A 2EBHX 3EOZA 3I01A 4BO1A 2H7XA 1VKNA 3I2HA 5FFMA 1ECLA 2ZRNA 1ZK3A 3WDKA 1PWEA 1FSFA 3C6YA 3IVXA 5EA2A 3V2UA 2ZK7A 2FP3A 5LD2C 4F2HA 1ILWA 2BRUC 2XB9A 1KJIA 1RKVA 2B7BA 3FMFA 1NVGA 4IFEA 3FDXA 4L78A 5IAEA 1ES9A 1OV4A 1PS0A 2UVDA 1H66A 2WKSA 1GU0A 4MV8A 3U26A 5B2FA 3B60A 1OPRA 4PBTA 2EFJA 3L4BC 1E7MA 5SV2A 1YCDA 5TMBA 3AKZA 1KVQA 1Z74A 3V55A 5CHEA 2GB4A 4DUGD 5KYVA 3WLHA 2PFSA 4ZYUA 2GXSA 2FEAA 1ISJA 1XI2A 3C43A 4MW0A 3EQ2A 5CYGA 2CXTA 4XX0A 1EX1A 1EEXB 2VJMB 5L4LA 4GPIB 5AVZA 1WB6A 4QFDA 1ID8A 3PD1A 2A5FA 4LPSA 4M89A 5ILOA 4ACBA 1Y5MA 3DOHA 3KKLA 4ZVNA 3FI0A 4NYJR 1GZ7A 3WK6A 4KRFA 5NULA 4RULA 2E55A 3JQ9C 1Z2EA 1V8ZA 2HJHA 3RS3A 4FLFA 3MN1A 2E6KA 5KYWA 1ZC4A 1GITA 4L6CA 4RF3A 1FQJA 3CJQA 5AXBA 4YQEA 4RA9B 1QF7A 3ESBA 3CW8X 1AXRA 1CUIA 1DQNA 4ZA2A 3U3OA 4V0LA 1Q5PA 1HDOA 2SKDA 2Z9BA 1VB3A 3CO0S 4KUEA 3CW9A 5KOYA 1NLFA 1ZK1A 2KSQA 3O2NA 1K4YA 2ZIXA 3HEMA 5FBQB 5HIKA 1GDTA 1M1YE 2H85A 5GGYA 5JC1A 3VU8A 4AROA 4U2EA 5TEVA 3GLFE 5IDXA 3ZGZA 1KS2A 2CSXA 5H68A 2YXEA 1EGVB 1VHWA 2WR8A 2VH5R 3KQYA 3WL4A 4JBIA 2FZEA 2B1QA 1YS4A 2DJIA 9ATCA 2VDWB 3C1OA 1JSRA 4XSHA 3L7OA 3O1LA 4P7BA 4EITA 3L0OA 4GYJA 3SQWA 4WJKB 4BO5A 4U7PB 3A25A 5LKRA 2JJ8A 3N2KA 1ZIDA 1WNFA 2QJOA 4DE5A 2QX8A 4K9DA 3HLTA 4FMDB 1Y8RB 1EQAA 1T36B 3L41A 1GQSA 2QPAA 1Q21A 4JC4A 2PG3A 1YQWA 1J06A 1OASA 3GT7A 4DMMA 1WUIS 3T3OA 1U02A 3BGVA 4XDHA 2ZIGA 1E94E 1NMXA 3QFTA 1QP4A 4RV4A 2OBFA 3ZZNA 1QIIA 1UDWA 3A6GA 3IXQA 1I7NA 3IPAA 1U8CB 5DP2A 1RQGA 2OCKA 5DHSA 1T2UA 3R1IA 1FFBA 1GPYA 1ZL2A 1K6XA 3KQVA 1K8RA 5HCNA 3RYIB 3BE8A 2J0SA 2X8BA 2RGAA 1GGEA 3HVIA 4N82A 4QXRA 2ETXA 4RZUA 3UMRA 5L6MB 1W5TA 1FMCA 3EARA 1SC4A 3B5IA 1H3FA 3NORA 2RI6A 3P4YA 2H7CA 3QVGB 5F78A 3NATA 1FFGA 4B3IA 1FVHA 1SOWA 3FWZA 1VZ2A 1JHXA 3E22B 4R1SA 1RWPA 3OZSA 3UJ9A 3W1VA 5TGZA 5AK3A 5DHAA 3CVXA 1TK2A 3NXSA 3WQRA 4F92B 1AK9A 4R8VA 2AFIE 3GJ5A 3EZGA 1O5IA 5EOVA 2NZXA 3HDTA 4UDXX 3I5XA 4BPBA 3EXFA 1ZA2A 1KOFA 3MGKA 5DWDA 4BB0A 4XB1A 5BW5A 5JZVA 3FTFA 3DF9A 3WADA 3HY6A 3ZJVA 1O8BA 1HURA 1U90A 3OFVA 4HDCA 2CL5A 4O4IB 5KWJA 1MRNA 2P4EA 3C3AA 4ZQIA 2FQ1A 2PWPA 3IJRA 1DEKA 3MQ2A 1NM5A 4ZDIA 4M2LA 1DEXA 2DERA 3W04A 5J3JA 1P1FA 2GERA 1N6HA 4DDMA 4PU0A 4HADA 4O4HA 4GQIA 3ER6A 3DB1A 3T9BA 1GFWA 4RVHA 1X1QA 2IHZA 4MUIA 3M83A 5K9ZA 1SQGA 3I5UA 2XA9A 5HIIA 1KYVA 4NXNB 1E1CB 3RT7A 3QNMA 3ZHCA 5F9FA 2Q1SA 2V1XA 2WI8A 3D1LA 4ZCRA 3AR4A 4XPIB 2W98A 2R9VA 3AM5A 1Z5VA 4L1KA 4UNRA 2DWQA 1JKMA 2VHEA 3DGFC 3H84A 3M6AA 3KDAA 4IGIA 4PSDA 2NX2A 2FCRA 3C5CA 3N8HA 4TKVB 3T99A 4N6NA 5DGXA 4IIEA 3H8VA 5JPCA 3GZNB 1A1VA 4FDVA 3HFGA 1N4DA 4I8XA 3PZRA 2QMZA 2IEYA 3F0TA 4GMDA 5T6MA 1DZIA 4DIEA 2TSYB 3BK7A 1MIOB 3OQ6A 5BV8A 3L6DA 5L7WA 1ZJZA 3TRDA 2BHSA 2WWHA 3IQWA 4L50A 4F12A 5M29A 4K86A 2G76A 2GAIA 3EA4A 1ZJ4A 2XKBA 4IUCS 1GQOA 5H4HA 2FA9A 2ENUA 2ID4A 4NS4A 4YAKA 1JPUA 1M2WA 1JLRA 3NT2A 3ANTA 2PD6A 2ZIFA 1DADA 4MYTA 3EFOA 5A2QA 1CF2O 3BZUA 3RFVA 3EQ7A 5EJ6A 2BDUA 4ZAGA 3EVEA 1SUAA 5B3LA 3AP2A 4RESA 1FDUA 5ENVA 4H17A 4CR7A 1UODA 5FV7A 3GRPA 5I4CA 1BCRA 2H5EA 3TCKA 1BMFA 4LRTB 1MV5A 3M3DA 3C3CA 3IP3A 3TGWA 1R4NB 7REQB 5DBEX 1EJBA 2BFCB 2HC9A 4PYMA 4BV8A 4BQIA 5JECA 2XNDD 3VNAA 1VL8A 2XCTB 4KOEC 5HF8A 3D5QA 5CNKA 4JBHA 4M1QA 4UASA 4FYXA 2E9SA 1RJ9A 2Y9MB 2TMYA 2FRVA 3GV0A 4KB5A 1QBKC 4UVHA 1ACMA 4BMDA 2XUOA 4JLBA 3ZPXA 1O6ZA 1VBKA 3R40A 2D4HA 1EFUA 1X74A 1LU9A 2FPLA 4CV1A 1Z5WA 4OMDA 5LL6P 4UU8A 5DM1A 3RUIA 2R7NA 2X0KA 2WIGA 3UAYA 4QG3A 1FX0B 5KINB 1U1FA 1M1ZA 4KXVA 4CKBB 2E1RA 1M6HA 1EE9A 3LQYA 3H9BA 4K3UA 2ZYTX 1G9XA 4OSEA 4AKIA 1FFYA 5F5LA 4PLYA 3RLIA 1R0WA 2ACWA 3UB2A 5FV4A 5DFAA 5KAPA 1N2IA 2ZIWB 3DFZA 3IODA 1R3UA 3R0VA 1CY0A 1U0BB 3A7DA 4Z9FA 1V6CA 1W5EA 2ZI6A 1YDWA 2YIMA 1JHQA 4N01A 1Z17A 4EB6A 2QB5A 1AKUA 1E6CA 1VJ1A 5TQ0A 1L5NA 4JSTA 2IPMA 1JQLB 3TRHA 3F6CA 3PR2B 2NSLA 4OCZA 5TEWA 2RARA 1AMUA 3ZWMA 1JZQA 4NOJA 1SKUA 3ESQA 2OV1A 1V16B 1AGYA 2NUAA 2ZSAA 4PG8A 3KZOA 2AI2A 1GTG1 1V4NA 1VIYA 3EDCA 4OTZA 4UU7A 2WM9B 3GLSA 4CMIB 3QBDA 4UM7A 4E7OA 1VIMA 3BD9A 3GEBA 3W4JA 4HWRA 5B6IA 1E2BA 2PJRA 3P26A 2E18A 5ALVA 3DEKA 2ZAMA 2IPAB 2NQTA 4KL8S 5E1MA 1N2HA 3QVXA 1LSUA 5CEJA 3GLUA 3GRYA 1CG6A 2JAWA 4CM3A 3DKRA 1PS8A 4HDOB 3SZLA 3KSZO 3C4QA 3GVPA 4LXTA 3UA3A 1WUKS 4RMJA 3NDIA 3CVUA 5I7FA 2VUTA 4XXHA 5AYVA 4MKXA 3U17A 3W9BA 1KQFA 1TUIA 4U39A 1NR5A 2DU8A 2HSDA 2XQGA 2IWHA 5CIWA 3TRJA 3OFND 2JANA 4H7FA 2BN4A 2GEFA 2A0UA 1FFWA 3A1SA 3UOGA 1K68A 2PH5A 2J5RA 1KMCA 1TVCA 1ZX1A 2NO9A 1ZS9A 2FN7A 3E9NA 3OLYA 3RS8A 1PI3A 3FI9A 1T29A 2C2OA 3TIXB 3ETEA 1UJNA 4CM4A 4CGZA 3ZVNA 1NVUQ 2VPYA 3M1IA 3HLKA 3OX4A 2IF0A 2WM2A 2Q62A 5DTQA 3JX9A 1QE3A 2JH9A 4J0HA 3JZAA 4UTOA 1BNCA 2AR0A 3PQ2A 2BR4A 3ZJYA 2GO7A 1VG8A 1TU3A 4A7PA 4HGNA 1PL0A 3TL3A 2PE5A 4FM9A 1W34A 2A33A 2L18A 4FYKA 5IFLA 1IK4A 2Q6VA 2FPWA 3CUYA 3FFTA 3NEYA 2VATA 4AUEA 3GAMA 4ZGWA 3BEDA 4NV1A 3IE1A 3BXPA 3D3WB 5K51A 1VE9A 1D1QA 3QF4A 4IIDA 4MB2A 4WBNF 3PF9A 3BFXA 3RJ9A 2W6QA 2C9YA 3EVAA 1IN4A 1YWGO 4ZDKA 1AJEA 2VRBA 1H4VB 1C7IA 2CHQA 3N75A 2YBEA 3U37A 2Z2ZA 3QXGA 1R1DA 2VQEB 1X7WB 2OXIA 1E98A 2G4CA 5EHGA 5GWXA 5KB3A 3GUZA 4NL4H 2C0QA 4JV5B 1X9HA 2CMKA 2FPOA 4ZXFA 1YOBA 4L9RA 3I6ZA 4JHLA 3BMQA 2CFSA 4E4TA 4E7PA 2PRSA 1R64A 1Z0DA 3FSJX 3HZZA 3QLJA 3DW3X 4IDHA 5E4JA 4X0EA 4Z2AA 3IQDB 5K8IA 4QREA 4LKOA 2FG5A 3DVAA 2SHKA 1ZIPA 1V71A 2WT4A 3EAFA 2AD5A 2AIRA 2XGSA 3QY0A 4Z4FA 2OHXA 3GP5A 4FHGA 2FMTA 1XWWA 2C7BA 4E0BA 1JDPA 1N5JA 2BGLA 3QJYA 3G7NA 2LW7A 3TTXA 2C8LA 8ABPA 5FR1A 1AU9A 5CW2A 4GMHA 2VIIA 2RBEA 1Q1BA 4UAJA 2QN7A 2PZKA 1AA9A 3DULA 4C7XA 3CZ4A 2X3UA 3D7SA 4KMRA 4PX9A 4U0KA 1EVQA 4LXIA 4YUZA 2W8BA 2Y67A 2Y27A 1ODCA 4B31A 2YUTA 1SVIA 2PPVA 4ZIRB 1EUDA 2GXUA 2B1RA 3OWXA 5L8VA 3N0VA 3TNFA 2QQEA 3IX7A 1HE8B 5EJ8A 3TE7A 2UYQA 1N1DA 3RFFA 5JRZA 1MW8X 1E8NA 1QBGA 1UBJS 1GARA 4QUHA 5KYXB 5KPJA 2LDBA 3RF7A 1P0IA 1L5HA 3P9QA 4OO3A 5A5DA 3ET5A 3MC1A 4CM5A 4BQFA 3T9CA 3UTDA 4QKQA 3CBQA 1JMKC 1KJWA 3C7DB 1CK4A 2DT8A 2VDRB 2I6TA 3GEGA 1FLDA 2X22A 4A6XA 2QW0X 2FN9A 4BKMA 1W581 4GWGA 5SYNA 1Y7LA 5K03A 1TCBA 2C2BA 3LKZA 3S2ZA 3VMMA 5GZ1A 4DQLA 3L6BA 4PVCA 4V24A 4LV8B 2O3QA 2RK3A 2OCXA 1MZVA 1VJGA 1R8QA 4HLNA 3R20A 2HYDA 4W9NA 5EI5A 4KR6A 1XAJA 3DTVD 4UKDA 3OEHA 4PBSA 1HRDA 2Y0DA 1NR7A 2CDAA 2DKFA 2J08A 2O3UA 3EEBA 3EIHA 1C7EA 2ZUCA 1ZYUA 3T6KA 1QG4A 3X1WA 4DV0B 3B1ZA 4CM6A 1BDIA 1M2VA 4F4JA 1G20A 1A5BB 1DKMA 2EIHA 1OBOA 2WMOB 3E7FA 1VLLA 1XZIA 5AIAA 5E1OA 5C5EA 1XZQA 2G4LA 4B3BA 3U9LA 3CVJA 4RLHA 4Y0VA 3QBEA 3M2TA 5JZOA 3U4QA 1C4WA 2GM5A 2IDKA 2PS0A 3C3MA 1EFPA 1WZNA 4KNWA 4GM1A 4ZKEA 1EM8B 1J0BA 5B7GA 5BP7A 4A8JC 3HXMA 1J22A 1DBSA 1EVZA 3CPEA 2I3GA 4NFYA 3TVYA 2QUJA 1W4AA 1E2NA 2B82A 3KIPA 5BV1A 1PR0A 1G8HA 4Z6KA 1UXJA 2NO6A 2J85A 5IU6A 1GQQA 4IEIA 3BT7A 5DCWA 3N2NA 3WP0A 1X92A 4TYPA 1BFUA 3L0DA 1H94A 3UUFA 3S5JA 2FW6A 4RDHA 2A1TS 3CKYA 2XH8A 1P77A 1XPUA 4GX2A 2X40A 4AJJA 1XRRA 3FRJA 1I10A 3N8DA 4I6GA 4M1ZA 4Q34A 2F1IA 1GQFA 3TSWA 4B81A 5JH7A 1P7VA 1U1CA 4DVJA 1PJBA 2HSZA 3H3JA 3IMGA 1IWPB 4ZAXA 5C46F 1NQ5A 1RRPA 1Z88A 3G0CA 1PSWA 4BC0A 3HO6A 1H1LB 4OSPA 4CLEA 4ER5A 3SHTA 4LOAA 1RHKA 3QV1A 3DEYX 1BXRA 4PQYA 4OB7A 1XDGA 1YDEA 1P4HA 4AUMA 4BFZA 3O2QB 3RSSA 1TF2A 2ZLBA 2O3RA 1TZKA 4FP9A 3P0IA 3MJCA 3LUDA 4B85A 5LQCA 1RXWA 2H2DA 1ATZA 4CT0A 1NRJB 2HK7A 4E5PA 3DLCA 3T7KA 1C2YA 3E9RA 4D9EA 3K70C 2V3WA 3PJFA 4QXMA 4WV3A 2QGFA 2VQSA 2ZSEA 3ZS8A 4BMCA 5LYJB 1ZI8A 1W44A 2P9GA 3IHLA 4NQRA 1WZ2A 1ZI9A 1P5JA 1U1GA 2XYVA 4QHTA 1UCFA 3R7WB 5BOSA 5HRUA 1I01A 3HVRA 4OVKA 4W5QA 3MAGA 4O25A 4OYYA 2YJGA 3UV7A 1CUBA 1Y37A 1I6MA 3BJZA 4LE0A 5EIWA 3RF6A 3VR3D 7YASA 3PENA 3FUVA 5JZBA 1UBNA 3RSLA 1FFXB 2Q2WA 3TEJA 3W6ZA 1ADFA 1T5SA 3W3ZB 1Z83A 1N7GA 3P5BA 1C1YA 3CF2A 3FRIA 4X54A 3C98A 1QPZA 2JZOA 3L7MA 2F43A 4BNXA 3FJOA 3O84A 3BWXA 4TKUB 4QWWA 2GXQA 1M3SA 2WVAA 3MRXA 3BXEA 3H2HA 4HBZA 3TI7A 3TXYA 1OH5A 2HWYA 4DJJA 5AHWA 1PZHA 2MYTA 5IHPA 2WZBA 4W5WA 1W52X 2Q4OA 1TZMA 3W8NA 5IJ9B 4KLRA 1G6HA 3EZFA 4OIFA 3HDGA 4LWZA 1PT7A 2VJAA 1Z36A 4GI1A 4HPJB 2PRZA 2E4XA 2HFKA 3WO1A 1MRSA 3EVCA 3IMFA 1DQYA 3LDGA 2G40A 3DCYA 4NBUA 2C2KA 5CHYA 3K4PA 4C6TA 2RDMA 4UM5A 3HR7A 4HDMB 2EHJA 3TZQA 2WAAA 2JGAA 4RANA 5C31A 2DLCX 4DVGA 1YVUA 3K2IA 4MS4A 3QEKA 1D9ZA 3LWBA 1A95A 1JEEA 3UAOA 4YJ3F 4R7ZA 1XVTA 2BPOA 4KIUA 4ZO4A 1YZVA 2QUIA 4LNUA 4DXDA 4RFLA 2QL5A 2A78A 1HX7A 1V37A 3OESA 3SNKA 2VF5X 1Z3IX 5AJZA 4NX2A 4ZJZA 4US2R 3VC7A 2VP6A 1T0UA 4CIAA 2EW2A 2ZUTA 3S1SA 5BWNA 1JHVA 1YKGA 1ZEJA 4ZMBA 4LBZA 5I9BA 1EFLA 4UEWA 3B9RA 2PV0A 4XA8A 3H05A 2GBCA 5DNUA 3EEIA 4R71A 4F6LA 3T1QA 2NYRA 3QU4A 2I33A 1O7JA 2JIDA 1L5WA 2YZMA 5JJIA 1IAQA 1SBCA 2OV2A 1WQ4A 3FOCA 3M89A 1MIHA 4DBZA 5AM3A 2IUYA 1B42A 1E3QA 2J3LA 2R62A 4V0QA 4DHWA 1XU4A 3Q3GE 2MYUA 2QSUA 2P2GA 3JQ7B 2PJZA 5IH3A 3EVFA 1KBZA 1G5RA 1R4MB 3S2EA 1Z7WA 2A6PA 1YUBA 2WZCA 3CH6A 3DS8A 3GAFA 3EYAA 3PPXA 3R0ZA 1RLUA 4PCUA 3TW8B 2PJDA 3EX7C 3GUCA 4FHFA 1IEXA 3OT1A 3AFHA 2FPGA 3R3YA 1JEOA 4DDVA 3ZCPA 4PZ0A 1SXJB 4MVJE 4B83A 1KZ6A 1RBYA 4PYIA 1QHEA 3I9KA 1Z4IA 4WOBA 4K28A 5FWDA 3H8JA 2AOUB 5MGBA 1I2DA 4HN4B 4YPFA 4NZMA 1K5DA 5K6AC 1EGQA 4BRZA 1W76A 3O8OB 3L01A 4HDNB 3ILXA 4C76A 2JDIA 3NHSA 3GLGB 1PL6A 1G2PA 2BJWA 4HGYA 2MYNA 2P1RA 3TD9A 4P0TA 3O8LA 2X4IA 3EGCA 4MWEA 5A7GA 5EP2A 4UCXA 3DQZA 4HNUA 1KY4A 2ZYWX 2IZOA 3T4UA 6NULA 2DPGA 2LUOA 4L3OA 5J2TA 4BNTA 4D9NA 4QGBA 4FE4A 3Q3EA 4ZI5A 1XD8A 2ZBEA 1IOVA 1CUVA 4PYJA 2QUBA 3ZWCA 1NE2A 3QBVA 4LDRA 2QM0A 3L4BA 1K2VN 1JLSA 2XQFA 1JEQA 3DOFA 4G0NA 3HXOA 2V74B 3A3YA 3ZHYA 2RGYA 1TXGA 4M76B 2HMWA 2GAJA 2PKYX 2QSZA 3MK31 3FGPA 4PY2A 2H9YA 4BEVA 2QTNA 2PN1A 5DHPA 1VPVA 3SIPA 4MJXA 3CR3C 1GOTA 1G21E 5BQXA 4B6PA 3IAFA 3PGXA 5KSZA 1UBEA 1KU6A 3ZJ5A 4YDSA 5JSUA 4A8HA 3O0DA 1CWUA 1VIAA 1FVXA 1QFSA 2YV2A 3TR5A 4BWFB 1GGMA 1P0PA 1WB4A 3T5DA 4EFNA 1TU0A 4FS8A 3SXUA 2O59A 1TCCA 2C5SA 1WMBA 1QXSA 3FB1A 4HNVA 1EGHA 2P77A 2W2KB 2ZRPA 3A1EA 1I7DA 3PXXA 4I0WB 2BSXA 3RG8A 2GPTA 3SZUA 2B3DA 4ZO6A 4KCGA 2FMFA 3C4JA 1NMSA 4LWPA 4R0VA 4TXMA 4CPDA 4DLVA 3O9VA 3HM9A 4KK3A 3K5IA 1EUQA 1PGPA 4KPUB 2K4MA 4AKGA 2EWWA 2CVZA 5IPFA 1G3RA 3WNCA 3LQ4A 4U8HA 4ESHA 4I14A 3K96A 2ADOA 1KXJA 4II2A 3DZFA 1VJDA 3G0OA 4C9BA 3QXHA 4IRMA 2WF7A 1REQA 1FDTA 1E5TA 1P74A 2W6IA 4IBOA 4G1VA 4AL4A 1G3QA 3TIFA 1XL1A 1U11A 1FVFA 4QFCA 4XGNA 5HM6A 5KJCA 3W6NA 6REQB 1OTYA 4ZV9A 1K8YB 1WP4A 2GVNA 4P4SA 2EERA 2IXGA 2W2LA 3GH3A 4JWKA 4OD0A 3FIUA 2PWAA 1A96A 4ASUA 4LW8A 5CM9C 3JCZA 4F3RA 4CEIB 3COYA 1LNZA 3UT6A 4H0FA 3A6LA 3EQ9A 4URUR 4WCFB 3TOXA 3VTFA 3WLKX 2FPSA 7MDHA 1X1AA 4LDQA 4QOEA 1B3RA 2AF3C 5DVZA 3L0YA 1QR6A 3ROGA 4HX9A 1XNQB 2M1XA 1EDZA 1MCZA 1L7BA 3WYFA 1BVUA 3KCQA 4R41A 3DOOA 2W71A 1BE6A 3JSXA 1PJSA 3QF7A 2W0MA 3W77A 1RHQA 1RIFA 4OX9Y 2BBOA 5CLJA 4KXYA 2P65A 1CQIA 3IERA 1WPXA 3WDLA 3P20A 4R84A 4LHWA 1X7YA 4AZVA 4WN9A 5TV2A 1ZU4A 3BHNA 4LDAA 1Q6YA 1WXIA 1BCSB 1W96A 2NZYA 2JGEA 3DV0B 3L1IA 2FLWA 2LCFA 4RFSB 1KQNA 4FFWA 3KXPA 4ADSG 3SQMA 4TROA 4MDYA 4BLRA 1Z07A 2A0XA 4FTWA 2O1XA 4Z2YA 4DZRA 5AQ1A 1P8JA 2GZ1A 3CEAA 1GPKA 5E9JA 5L3ZA 1LPAB 1U2SA 2GZDA 3ETNA 2RHOA 3M4ZA 1KE1A 3R74A 5I45A 4DRYA 3AM1A 4IMIB 4Z4IA 3ZV3A 3E7PA 3I09A 1FYXA 1ID1A 1X9IA 3GR6A 4HAYA 2ORED 1N2ZA 4DUPA 1JS1X 3LDHA 3TQCA 4F9TA 1BXGA 5A0VA 5EIXA 2Y2VA 2Y1CA 3NHRA 4AJKA 3UJAA 1OWNA 1BMTA 3OIDA 1VP3A 1TYAE 4ZOLA 2VT7A 5K3FA 3E82A 3H18A 4MINA 2B1JA 4BB6A 3EASA 2VCYA 4N1AA 5KMGA 2D0PB 1X3LA 3WZ2A 3S27A 3TRIA 2PGIA 1GILA 2HV8A 4AJHA 1W9MA 4QZVA 3T5AA 4RMIA 2OPHA 2VS1A 3EVDA 4YMVA 1DJOA 3A1VA 1WO8A 3JQAB 5JSKA 4EVQA 3VZCA 1E1LA 4X7PA 2E4VA 4JVNA 5C1DA 1DMRA 3STXA 2BV3A 2VNIA 3U09A 1AZWA 4L8YA 2VDOB 3W7BA 3KVRA 5EE9A 3Q85A 2CJPA 1YA8A 3AM4A 4JLJA 1L3CA 3NTRA 4H35A 4WDRA 3RVBA 1DCTA 4JP5A 1GSHA 1BQ3A 4FDTA 1T6ZA 1Z73A 1UBUS 3LXXA 4LYEA 4O4IF 5HXAA 2V45A 4JVLA 3PA6A 3K6SB 1PKEA 1DS6A 2G3YA 2R1VB 3DB2A 4D97A 2AI1A 2GK7A 4UVEA 5CNIA 3A1WA 2FQXA 3F78A 1JSCA 4F8YA 5L3SA 1E3DA 1QZUA 1UPFA 1MB4A 4J76A 5FTJA 1JLLA 3LKDA 5F7ZA 3LPMA 2E6UX 1Q0UA 4M98A 1RWBA 4XJXA 2JGJA 3C6XA 1KY5A 1ZSNA 2C78A 2G9VA 2DFDA 4EKYA 1FXUA 3W6OA 1KDRA 3D0OA 1SU6A 3ROXA 4P08A 4JLDA 1MGPA 1TYCA 2WZQA 5L4SA 5AESA 5AVTA 4DPMA 1N2CA 1I2BA 5BRAA 1FVOA 3HU1A 3COWA 3GAAA 521PA 4PQFA 2IUTA 2ZIEA 2QRJA 3N5KA 5HQ3B 4RTMA 1BTOA 1KNXA 3X0DA 3ZWDA 3FVWA 3NWPA 5LQSA 2GFQA 3VZSA 5ALOA 5IWAB 4XLLA 4Y7CA 5K0TA 3K8ZA 4XGIA 1S4MA 3JALA 4F04A 4CM8A 4C88A 5CB6A 3FYUB 4CTMA 5JRDS 4KHPB 4AJ1A 5ALWA 1RPTA 3K92A 5C8ZA 1Z6ZA 3JTEA 2PQMA 3NHZA 4UE3S 2FHSA 3R09A 2O0LA 1DXQA 2R65A 1PGQA 3D8RA 5EKSA 1G20E 1QFXA 2QLLA 3MJ4A 4OFZA 3I6QA 2R6GA 4MLZA 16PKA 2W5UA 2EAUA 1M2KA 1QOQB 4UDOA 1Y4UA 1E8DA 3S40A 5G0UA 1X1CA 4FB4A 2QLJA 1Y5NA 3AR7A 3FLEA 1BDMA 1NXPA 2Q2VA 4LZNA 4DKXA 4DL9A 2Q29A 5BQFA 2YYAA 4FWIB 3UB4A 4E1AA 2P2SA 3I2KA 2HCRA 1KH3A 4PHTA 1NMEA 3NHUA 5BVGA 5JIBA 2IYOA 3PFIA 2R4QA 3UMJA 3R8CA 2FR8C 1U7OA 2G7ZA 4UHHA 1ZJ6A 1BRTA 1E0KA 1NHGA 3QOXA 4N7JA 4WT7A 5FWYB 5T4BA 1AO0A 4MARA 4CI9A 5HZHA 1DJLA 1RVDA 3F2VA 3DMRA 2FEWB 1QYIA 3EEFA 3HUTA 5BR4A 3DE5X 4K9PA 4KQ1A 3VU1A 3T3EA 3F90A 3WLMA 1IULA 2YQ4A 2PMBA 4YWHA 4AYWA 2ORIA 4LVOA 1E6KA 5D3MB 1I0LA 3OCJA 4NG5A 4BVAA 1KWKA 1YL5A 3D6UA 1SBHA 1XF1A 2QTVA 1U0SY 2Z98A 3LMKA 3H13A 3LIPA 4X95A 4DT1A 1TLLA 3R24A 3QEBZ 1JWBB 1ZMTA 2CCKA 4LJ8A 3LJKA 2ODQA 1Z37A 2P91A 1LF0A 1YRWA 2GEBA 2HX1A 3A1CA 3C48A 4KGXA 3CRZA 3H9CA 1C3XA 2ZPAA 3EXEB 1H9AA 3LUJA 2YXNA 2JIMA 4JUAA 4ACAA 5JNLA 3PFFA 1XTKA 2AGVA 4RELA 4R1QA 2CF6A 4G1EB 3CLHA 2E37A 3MQ4A 1PR9A 4D3SA 2VDKB 3CF4A 4EJSC 3RTDA 4E5UA 1JA1A 4NPCA 1H05A 4Y2UA 3L0BA 4B75A 4E2ZA 5E4TA 1P19A 1NF2A 4BMZA 4DCCA 4MVJD 1UKEA 1PR3A 2ONKA 4BMPB 2FW1A 2KBFA 3IDQA 1TUBA 4IR7A 2X86A 3AHJA 3PFGA 1AHIA 1VSUA 3K1ZA 3G7UA 1FJ2A 2G1JA 4PHHA 5ULLA 2NVUA 2YWDA 3M3PA 3PI6A 4JOBA 4D98A 5LQAA 1G41A 4G0VA 3QSGA 4J2OA 3FUUA 2FGKA 2JAHA 4M0FA 1XEWY 4X3OA 1K6MA 4IFIA 5KYYB 1KMIY 2E4WA 2IVFA 1E64A 2PA0A 2QZJA 3LUCA 1OGIA 2FSGA 2BFDA 2ZRBA 5EGNA 2QOEA 2XBLA 4E5KA 4QNNA 3HB5X 5FIUA 1WMSA 2ZYGA 1Z4NA 2BAGA 5AKGA 2OORC 4YUVA 1T9CA 2DP4E 1HH4A 3OBIA 4FDAA 1BMFD 5BXQC 4LY3A 4NDAA 1FP7A 1ZI6A 2H4WA 3PUWA 3LM8A 5KOIA 4V3CA 5B37A 1ZC3A 4G5XA 4LJ6A 1QIKA 4L4RA 5FOSA 3DZJA 5C5DA 4QXQA 4D25A 1OZ0A 1KAGA 1LVHA 3F4BA 1XQ1A 5A5GA 4TTSA 3TBFA 3O83A 4RJLA 3W5HA 4MAFA 2OXFA 2GCPA 3N8NA 2JLXA 3RLFA 3STWA 3BYZA 1U5CA 2D74A 2GNOA 3DO8A 1QHHB 3VKUA 2PY6A 1M8JA 2YHSA 3R9IA 4EY5A 1PZNA 1POXA 4YXWD 1L5VA 2XDQA 3C7AA 1E1QD 2H00A 1TIBA 4GNRA 1OLUB 1PE0A 3RRFA 4O4LF 4EG5A 2CLCX 4L0DA 2PUHA 1E79A 2VWPA 2F9LA 3MB8A 4PZ9A 4M9RA 5LIRA 1V11B 2FKNA 2VZEA 6YASA 1QK4A 3KLOA 1PR1A 3QKSB 4ZQGA 1P9LA 2IEZA 1A8IA 1UMDB 4KPYA 3KB6A 5BW8A 3QP9A 5JG7A 4MVXA 1Z25A 3GGGA 1TPYA 3NCTA 3DE1X 1UOEA 3C16C 3OVMA 1Y8CA 1Y3HA 2JIPA 3PQ8A 1N4AA 4P4NA 3ZNQA 2II6A 3SVZA 2ACKA 2X2EA 1DKLA 2LNDA 1U7TA 1V8BA 1I51A 3TUJC 2FW8A 2RHWA 2X7JA 4KDRA 1I6WA 3EC2A 4Q15A 1RD4A 1QV9A 3IC5A 3H2BA 5FNVA 4AUKA 1RAAA 4BAGA 4P34A 4E5NA 4EB8A 3EXIB 5CLGA 3QVTA 3LXRA 2AV6A 4EGQA 4QDXA 3D7LA 1YOVA 4H2DA 5FTWA 4FYMA 5K0JA 4JDUA 4D3FA 2ZQYA 4MV6A 4Q4HA 4MQ5A 4L2IB 1C7RA 4R98A 3HU5A 3RT9A 1ZN2A 1ZBQA 1WXQA 1E5LA 2VRWA 3DM5A 1QH0A 3FPGA 1U9JA 3GRRA 3UFXA 4EGFA 3GLIB 3RIEA 4P5EA 2H4YA 1P2GA 3Q4GA 1BQ4A 4NBVA 4RPIA 1KYZA 3SIWA 1QGED 4NNJA 1X7XA 2R1TB 2YVLA 3H1PA 3PXUA 4FIDA 4HD8A 5D87A 4N3GA 1TM5E 2VQ6A 4ZFNA 2C5HA 3NWBA 1SVWA 2JLQA 2JIRA 4DYVA 1L5RA 3H4IA 4NEHB 3Q8MA 2OCIA 4DLBA 5A9SB 5E2IA 2P69A 1TD1A 2HMTA 3TOSA 1QSGA 3CLTC 2B7CA 4Z4GA 1MU0A 3U3RA 2L69A 3IRUA 4UJ3A 3WMGA 4QPPA 3I64A 1JVBA 4TT8A 2R0QC 4A8JA 3NO4A 3Q1KA 1T2AA 3C2QA 4K2HA 2FMXA 1EVKA 1EWQA 3EZXA 2UAGA 1W2WB 2HU2A 3ZE9A 1W59A 3ZYZA 4B2IA 3CX6A 4FLEA 4NBKA 4D56A 4HR7A 4KVFA 4ZVQA 4A5SA 1AQUA 1UOOA 4I50F 2WD7A 4GQBA 4BO4A 4RWEA 4OYRA 3WB1A 4HPXB 5HHTA 3BIFA 2HRDA 4JXZA 1Y89A 3L84A 4QASA 1AURA 4S35A 2FDRA 1NW9B 3BWYA 1GM5A 3HUUA 4Z4EA 3BGDA 4IF4A 4KAFA 3BHJA 1LTQA 1Z47A 4FR5A 1I7LA 3JD4A 3PKIA 2NM0A 3H1FA 5JNUA 3LT5A 4X1YB 3PTAA 2XTNA 4IAOA 3E9QA 4KTVE 1B23P 4GZ6A 4WFKA 3ZE1B 1UAAA 2B94A 1QMGA 4QGHA 2DQSA 1SK9A 4URHA 1Z75A 5AM0A 2VNAA 4EI2A 1O95C 4LX8A 2UZIR 2ORVA 3SLRA 1E0SA 2WOOA 1E2HA 1I4EB 5AD1A 3KTAB 1X14A 3KSUA 3T3HA 4MV5A 3CIFA 2IYWA 2CYCA 1DU4A 2BE9A 4OQQA 1WG8A 2A0KA 1TMOA 1V1RA 5F4ZA 5JDCA 1OF1A 2A3RA 3A9CA 1ONOA 4DY4A 2OCPA 1W36C 1S1MA 4KX3A 1P3DA 4YDRA 3K5PA 4TS1A 1OCEA 1YB7A 4ZQFA 4EPTA 4YUAA 1VPWA 1F5NA 1MXFA 3DAPA 2ZTHA 4FBGA 4R2WA 5BN3B 2CJWB 1KO7A 1HYBA 1T0HB 4YRQA 3H0EA 3WRXA 1NBIA 2KLHA 4EG1A 5KREA 3QMPA 3NRJA 3QQ5A 1N6IA 3FBTA 2YRXA 2H1FA 2Z0MA 4QVGA 2NACA 2FH5B 1GVNB 2OILA 1T1EA 2JKYA 3AF3A 2IIPA 1VL2A 3V7FA 3TOCA 1DAFA 5HEKA 2VUSA 5ED0A 1XHLA 1ZPDA 4HMOA 1ZL0A 4KLCA 1XTRA 2VAXA 1U63A 2DLNA 1E1RA 3D5EA 5JI3E 2ZIUB 3T3DA 2RHBA 3ELYA 1IAVA 3OPVA 4A91A 4JFRA 2NUTA 3ZLVA 2VYVA 4J2TA 3L6UA 3ZY6A 4IJVA 4C22A 1R8SA 1NASA 3VZQA 1NVEA 2YXPX 1FOEB 4OEHA 3U7HB 3IDZA 2VPZA 1D6MA 4TYWA 3KKNA 1FFCA 1OB2A 2FEOA 2E87A 1HGXA 3UT0A 4ZAYA 3OKPA 4UXJA 4CCYA 4US1R 3HJFA 1W35A 2ISQA 3AY6A 2Q5LA 1GL9B 3AR9A 4BO6A 4GYWA 2G09A 2CVHA 4LMBA 1F48A 3ZZUA 3WLSA 3OD5A 4CKCB 5TJHA 5JY1A 1U8YA 2ZYRA 3FCUB 2G1UA 3GRKA 3MZ0A 1HO3A 4M1MA 4ZHSA 1R6DA 4CUJA 4N0QA 5IM5A 3EGVA 1USKA 5JS1A 3OEHD 4HLUC 2VSOA 3GUVA 2ILTA 3T7AA 1AHHA 2WFZA 4N3NA 4PAOA 2RONA 4RD4A 1Z6YA 2WC1A 4IIJF 4YDHB 5A5FA 2O2SA 3A6JA 4Y2TA 3AFIA 4G37A 1PQPA 2P2ZA 4P9NA 2JFVA 1DKUA 2Y1FA 2ORWA 2XB4A 1J8FA 2BMWA 2W6MA 3G2QA 2DHQA 2QYHA 4GC9A 4Q4JA 1IUOA 2OHJA 1MC8A 4J75A 4LI3X 1Y6ZA 3O95A 4EHDA 1JH9A 3GPCA 2AYZA 1UK7A 3AKCA 3RH0A 1SURA 3DR3A 4G1UC 3HKDA 1U2DC 3VO8A 4LE1A 3ZTYA 4IICA 1XQYA 2WSSD 4QT0A 4EM6A 3CRVA 2A4KA 3DCJA 3H7AA 1HM5A 5I5GA 1NW4A 1NW6A 1DAEA 1JF8A 2DHEA 1WU8A 3BHMA 3OPYB 5EUQB 2A9VA 2YCLA 3D3JA 1IVYA 3H4VA 4W82A 2B8NA 1XDBA 2ZBUA 2YW9A 3M6LA 1KSFX 5D7NA 3AUJB 1N5IA 3ZZMA 4AWXA 2PT7A 4IIXA 4YT5A 4ALJA 1XWIA 2X5JO 3K8YA 3FZQA 3N2YA 1L4LA 1K88A 4NQZA 5TQVA 3HR4A 1O9BA 4FJ0A 1CRWG 4X00A 3DZHA 2R6DA 2BCEA 3TTUA 2R97A 2WSIA 1AMOA 1G7CA 2GNPA 3EIXA 3VMFA 4B6FA 2WDPA 5BW4A 2WABA 1HNWB 4LYYA 4TMZA 3EFBA 3WA7A 4WADA 3L4SO 1Z35A 3PDIB 4F3NA 3U6BA 4LCEA 2VN8A 4D4HA 3I9JA 2QRUA 3BE4A 4I1SA 4OUKX 1Z0ZA 4X6LA 5DNEA 4QFMA 5T5QA 1N2CE 3AT1A 3TFOA 1RWVA 4EJ0A 2O8DB 5J5CA 1JKJA 3PHCA 1TM3E 4BN5A 3AESB 3HSKA 2R6HA 1EAYA 1XJQA 2AW5A 3LY8A 1W0KA 1J07A 3PJDA 1ZOSA 5I3ZA 2NU8A 1XROA 3DCIA 3EGDA 3VJRA 2C3MA 1P73A 3IAM1 3M81A 5ICMA 2H1CA 4V2UA 2BBSA 2W83A 5A2GA 5FPSA 3P0RA 2ZJ0A 1NF8A 2KQUA 3DBVO 3DUFB 5CVUA 1WETA 2JGRA 4R31A 5DMHA 1IHYA 5KYUA 1IPEA 1T5HX 3I1JA 3UZUA 2WUGA 4KKXB 4C4OA 1KC1A 1CRQA 4QECA 4R40A 2P9HA 3VU9B 2NZ2A 1RKQA 3ZD7A 3V80A 3N0WA 4XM2A 2P2CA 3A0UA 4G81A 1O1YA 1AB5A 4RS3A 3W79A 4IQ4A 1PUJA 1ENOA 3PEVA 1EFDN 5K0NA 1LC3A 1KAOA 4DQDA 4OQEA 4CGYA 3JQGA 2FZVA 2XHZA 3H83A 4LOHA 4XM0A 5AW6A 4DREA 2WW8A 4QOJA 1EEHA 1E9AA 2HBQA 2OBLA 5K8UA 4FCCA 1A4RA 1H85A 2X76A 2ZIAA 5H5JA 1DBVO 5DIZA 5DNCA 1JP7A 4UREA 1ZRHA 5EMNA 2R84A 3HDQA 3FDZB 2BT4A 4HNAA 3ZQ4A 4MROA 4P2GA 2AVNA 1NY6A 3CTMA 1II8B 5CEEA 4FILA 1GXSA 2AMJA 3DPIA 4IIUA 4CLRA 1CR0A 1ZOLA 2C61A 2I4MA 1GZVA 5LC1A 1R66A 2TMDA 4RYLA 2XZDA 1D4OA 3I28A 4UATA 4Q9HA 4EG7A 3JSAA 4GKKB 4F2WA 2WILA 3FCYA 3MQFA 4U63A 3B20A 1EU1A 1F06A 3G6WA 3H11B 2FXIA 4ZOBA 3T5CA 2ZTSA 1NDQA 4RGVA 1QGOA 1TMYA 4FFPA 1C9NA 2F1JA 5ES3A 1C0KA 3A3OA 4KFUA 1LQTA 2J7PD 4DLUA 4A6PA 4CMAA 5A1JA 2QN1A 1ZD9A 3LV8A 4Y1RB 1AQNA 1A7JA 2P0AA 3EUWA 1Y3FE 5EYPB 5EZYB 2EJBA 2I8AA 3SFTA 3V42A 2EXXA 2G5PA 2ZP1A 3R3JA 2EBWA 3WLTA 4XX1A 2RKWA 1FFSA 3WGMA 2BF4A 2PKQO 1OTXA 1AKNA 4D8XA 4P54A 2FSPA 1WY7A 2OG2A 3GVHA 3O7MA 1EPUA 5LR6A 4I4TF 3B2NA 3EMBA 2A8YA 3IV7A 4XQEA 1IBRA 1Y1LA 3L8GA 1QJ4A 4QBHA 4EEZA 3QLUC 5DULA 1A7UA 2B8WA 4D4JA 1BJKA 1Z0AA 2A9RA 4WXYB 4W5RA 3CZPA 3JAMA 1CY6A 4Y9RA 2JFQA 4O2BF 4UTZA 4M60A 4YJ3A 2UUPA 2XLCA 1HOTA 4M4SA 2WG0A 4WW0A 2YV5A 4FK8A 1B8UA 3NC0C 1VCMA 4N5LA 2P79A 2WU1A 2BI8A 1RZRA 1F6BA 3SHWA 2W2VA 4F93B 3TX2A 1ZAYA 3SIRA 1IVNA 4NHOA 3HBAA 1G3IA 2CNDA 1GYRA 4LYGA 3JR7A 1W88A 1WCV1 2IVZA 3IT3A 1NULA 4EKNB 5HKAA 2O8BB 8LDHA 3IGFA 4N5IX 5LLTA 5KTYA 2IU6A 2WTAA 1T1JA 3QBTA 1AGNA 3HU2A 3I2YX 3BMNA 3MJDA 1N0WA 3D0KA 3OP1A 3ZHOA 3NBKA 4J0DA 1XCOA 1ZO8A 3T9EA 4I1YA 3SJUA 2XTJA 4R3WA 2YY5A 1Z8FA 3QKWA 3VNSA 4G01B 1OFTA 5KOJA 3LZ6A 1KDPA 1EBFA 1MABB 1RMTA 3ABOB 3U4IA 1XVVA 2X5XA 4NF2A 4A0GA 4B9EA 4DR7B 3TSAA 1ZLYA 2Q5JA 3N8GA 4RQBA 1UPCA 3RU7A 3SYRA 2ZG6A 4J0KA 4D7AA 3H99A 5F73A 3W06A 4EHAA 1JG4A 1C3OB 2A1UA 3TZ6A 4FYPA 4BRUA 3DCNA 1SU8A 2YWGA 3OZRA 3OZTA 1PNTA 3FPBA 4LJKA 4Z9YA 3B1KA 3OJLA 1MC1A 1E2FA 3PQ5A 1XLTC 3L04A 3UMBA 2PL3A 2QR5A 4MCJA 5ECYA 3QBJA 4NMWA 2Q6TA 3WWPA 1F8GA 2N1MA 3JPWA 4H60A 1PV4A 4HHEA 3DD5A 3AILA 4KIGA 3KHTA 1GPNA 1TMKA 2X41A 2DG2A 3GFTA 1W4RA 4ND6A 1FLVA 3FUXA 4RJKA 4WH0A 1XTTA 2BFBA 3C87A 3RASA 1UKBA 2GA8A 5I7SA 3FF4A 3Q8WA 4NYJQ 2VQ3A 3VR0A 3H5WA 4E4RA 4DWJA 4N40A 2GD0A 3STVA 3GT4A 1C3JA 2ZSIA 1V45E 1RCTE 2F3SA 2IELA 3OCZA 5DGDA 4WVLA 3HS3A 1F8XA 4LRUA 1QHIA 1GTRA 3KYBA 2D0IA 1YUNA 1OFUX 4IXDA 1Y1SA 3S2YA 2XB8A 3QIAA 3HJBA 5IKEA 2QBYA 4KDCA 5I9LA 1L8QA 3MS4A 4C14A 3GOHA 1MAWA 3JASA 4OMFG 3ZU2A 1NJFA 4LJ5A 5EY5B 3THRA 3ASYA 4GYYA 1Z82A 5EE5B 1JIVA 1QG6A 4L4ZA 1O96B 3C85A 4J9UE 1LPOA 2HU7A 5FUYA 6PFKA 1S8AA 3MMZA 8GPBA 2W2LD 4HCJA 2X9GA 3L82B 4ASUD 4EATA 1OX6A 4BCCA 4DAOA 1FJXA 4KO1S 4NBWA 2QRQA 1PUXA 3I62A 3C3XA 3G9QA 3W5SA 3MUEA 3OOWA 5J47A 1ZCFA 5DOVA 3WQSB 2QAJA 2XE4A 4FXPA 4NIMA 5KOHA 2HL6A 2YCBA 4RUKA 5EKDA 1CUAA 1MPXA 4OK5A 4PFKA 4F5WA 2PMKA 3KALA 1PJTA 3CX7A 5BNIA 1P18A 3FR8A 1BS9A 1IG0A 1S2OA 2ZB7A 3PDHA 3T0GA 2DPMA 1AXEA 2V0CA 4I55B 4TUYB 3VV2A 1OGYA 3JARA 5BWBA 2X0IA 3EXHA 5NLLA 4JOSA 3WK7A 4JJ7A 4AY3A 1RWWA 1C4KA 1KMHB 4ZD6A 1QH1B 2EU8A 1R18A 1IZ8A 5FD8A 3KUXA 3R8XA 2ZKIA 1QQAA 2P2YA 1KI4A 3KD2A 3KWFA 3OOHA 2Q3HA 2XZTA 3D7MA 3KD3A 3P2IA 5LXTF 5TS2A 4MR7B 3VPAA 1QRTA 4KFSA 9LDBA 2FSSA 1I5EA 3FZYA 4MAMA 2OCBA 2V3CC 5G2OA 2AN5A 2G07A 3DAGA 4TVKA 3UV3A 4D6PA 3F3SA 4BO2A 2I2AA 2BC9A 1QHXA 3GNQA 4MPDA 5AICA 5EXPA 1X3SA 1T5TA 1QQ5A 2AUNA 2FR8A 3UMFA 2AF4C 1AM4D 3DQQA 1OZAA 1LS6A 3QUTA 5JMOA 3IQEA 5LDHA 3QSYA 2P5YA 1Q0TA 2I2CA 1NNLA 5ARCA 1PT5A 1ISFA 2OD7A 1T0BA 3SYMA 3ZHSA 1UMCA 2PNFA 2ESRA 5DYGA 4QDJA 1KR2A 3Q7RA 4JFAA 4L9WA 4DJAA 2OE2A 1B43A 3BXOA 4JT9A 4YCJA 3CG0A 3TM4A 4AMUA 3A10A 4ZZ0A 1LCIA 3K0CC 3KU1A 2GVZC 3QJGA 4ZHQA 3WYEA 1JV2B 2DH5A 3HY3A 1JDTA 1N9KA 1VE7A 4R1TA 2WTEA 4BFYA 1B8NA 1PHRA 2G5GX 2HK6A 2DSNA 2ZRCA 3I5YA 5JSZA 3OQ1A 4S1NA 4MZXA 4WL0A 2QPOA 1DFHA 2HA7A 1H2ZA 1LS1A 1M83A 2MSDB 5EZ5A 2BEVA 5FOQA 3IIEA 4CT4B 1QANA 3RIYA 2CLOB 3G5UA 1DOHA 4V2IA 4PAMA 2CT8A 4E21A 4EF5A 1KZGB 3HFJA 3NHBA 1OIWA 3FY4A 2A4MA 4EJSA 1NUHA 1V95A 3KYCA 4AJOA 3E4CA 3DDSA 2ROQA 3PGLA 3VXKA 5IBRA 1QTIA 3CUVA 2CYBA 1H2RS 1QLHA 4LYDA 4WEOA 1TEZA 4CXMA 3JWGA 1E2LA 2GFHA 1PYOA 2PUTA 4L51A 5I9TA 5T3UA 3VRHA 3RSZA 1AKTA 1JR2A 4RD2A 4XQCA 3FLAA 2FFRA 4ID3A 3OMWA 2IIVA 3Q87B 5IXJA 4PS0A 2HQ1A 2OYRA 3AKDA 4O59O 2QMYA 1KZ1A 1US8B 4X6YA 4QYSA 1I6KA 4RF4A 2DBRA 1WCIA 4UUBA 3CH4B 2RHGB 3IEVA 1PG5A 2JL1A 1NI3A 2Q7DA 3WR5A 4Z54A 2J9RA 4R8LA 4LHEA 1Y80A 3T0IA 4B47A 4BL5A 1SCKA 2CMHA 1QK3A 4UFOA 1V2HE 4RVFA 3L8HA 5KSWB 1KY3A 3JYHA 1NN5A 2DFPA 2OORA 4EWLA 3IVMA 1AE1A 4K9NA 3E9DA 5JNVA 4Y7DA 4ETMA 1MO3A 3QGMA 2NZUG 3LZCA 5FP0A 3ROEA 3K5WA 4MLDA 1D6NA 2QKYA 4HDSA 2OGSA 2C82A 1UKYA 1OA1A 5MGNA 3OI7A 1NNI1 4FC7A 4GRAA 1E4EB 4OJMX 1JDUA 3H86A 3ZV6A 3NGLA 2IV3A 3H75A 3N1UA 5B64A 4D6YA 5KC8A 2VTDA 3OQPA 2XKKA 2O8VA 1OROA 4RPLA 2FYTA 2Q0XA 3AP3A 4NNOA 3B9BA 4UZSA 3RYFA 3EW9A 1LKZA 1FFDA 3SI7A 4TTRA 4P3KA 4JK3A 5FPYA 1K9SA 2JGKA 1T4BA 4W63A 1I6LA 3MSXA 4IQGA 1GYPA 2Z2KA 1EP3B 4KMOA 3EHDA 5JRJA 1HTTA 1QQ6A 3GNSA 4J9VA 5M34A 1ULBA 3D2CA 3DC7A 2C1XA 1JFSA 2Z6AA 4OA5A 1XMIA 2C84A 3NH6A 2FN8A 2C5EA 1ZH4A 3EIEA 5KDDA 5IVKA 3PTLA 2G77B 1BH2A 1J9ZA 2AXEA 3ASZA 3IT0A 4FIZA 5TARA 3NHYA 3UKDA 2W70A 2BKXA 2IP2A 4XFKA 4JL8A 1D5WA 1M6YA 2CMGA 5GV7A 2C2HA 2WJ3A 3E58A 2QUHA 3IP8A 2HIHA 5K09A 4DV4B 2HQSA 3L7BA 3O73A 2WPDA 5SY6A 1WDWB 2YOGA 2FJ0A 3GARA 3HMQA 3JVIA 3K0FA 4I8IA 5A05A 2ZQ5A 3PUJA 4DJFC 2FX3A 3MS7A 2PAFA 1GR1A 2QI9F 2I7CA 3QE3A 2J59A 1XCJA 2G9ZA 2I8CA 2VHQA 5AH0A 3S2FA 2X0NA 1IZ7A 1JQ3A 1MTOA 1TC1A 1GQRA 4EY6A 2PZAA 4KAJA 3H17A 4PO1A 4Q9KA 5E8RA 1ZCZA 2V4UA 1V35A 3NRBA 2X9QA 1ANKA 3L8FA 2FMUA 4RLFA 1NU6A 4CKWB 4D3DA 4DSNA 5CB4A 1E66A 2OHHA 5CA1B 2O2XA 2OECA 3O47A 3BAFA 3D3QA 3FDIA 1UBCA 1U3CA 5JVDF 4BNDB 1M6VA 2O1SA 1QP0A 4JYAB 1VC2A 4W7HA 4Q03A 3KTOA 3O38A 2IOHA 4RADA 5C7YA 4W1QA 4FYYA 3HCWA 2PR7A 4FT4A 2JW5A 3FZEA 4YRCA 2HHHB 4B6EA 4X94A 1TTHA 3HVKA 1GPWB 3AHCA 1MC5A 3MTDA 2GJKA 1PDOA 1UMBA 4U02A 1ZSVA 1C50A 5KTNA 2WTXA 1Z5GA 4E13A 1L7MA 2OCDA 3EBLA 3RKSA 1UT6A 1YQ9A 5C34B 4XEHA 4R1NA 2HA0A 4PZAA 5CVCA 5ARDA 4NI5A 3UYLA 4M49A 1JIJA 3QU5A 4D9GA 2R60A 3R9XB 3GGOA 4C21A 1Z4KA 4R2JA 4H59A 4B3JA 1XZNA 2ZJ4A 5DGIA 2ZRIA 4HQFA 5G0VA 4LK3A 1AKYA 1Z08A 2FPXA 4AO7A 3W5DA 1RR6A 3P8ZA 5EGSA 3LUHA 1AKEA 2FVYA 1K89A 1FPQA 1WPQA 3DVRX 1F8FA 2AMFA 1J70A 1EGMB 2WLSA 4YIKA 1T4CB 3UYKA 2UKDA 3BSFA 1XTUA 3IJ5A 4W6ZA 2HPZA 1RE1A 3BXZA 1ZK2A 3EC1A 3KE9A 3RWOA 3SEZA 5JJKA 2BTQA 1IBCA 1WRBA 3UK2A 2JG3A 1NAIA 3HN6A 3RS0A 3STYA 1D1SA 4PZLA 4YAUA 1GN8A 5IG2A 3W2EA 3I9FA 4ESVA 4QTXA 4BZZA 5JS7A 3ONDA 2I3BA 5BMOA 1O95A 4Q6WA 3VV3A 4BJ6A 1JU3A 5J4VA 1EA5A 1NVBA 2EL7A 2QN3A 3FPEA 3UK6A 3AVWA 3AF2A 1Z5ZA 3PCTA 1DWPA 1K5PA 3T1VA 2JCSA 5IYZB 5JQGB 2AJLI 1NGSA 3Q40A 4YP7A 3PLRA 3RGGA 1AH2A 1JFFB 1XD2A 2VXCA 4LHXA 4H7KA 3KNZA 1OYVA 1UZAA 3AEQB 3TK1A 3WRYC 4O2RA 4BNUA 4ER6A 3WGQA 1KSHA 1YZKA 2IEBA 3RFXA 5CEFA 1FDVA 2WA1A 1WPRA 3N05A 2B2XA 5CYFA 3BBLA 4KAAA 5T8KA 3ZN2A 4JYZA 1H8HA 2Y1OA 5H02A 1V43A 1BX3A 1TVKB 2NT4A 4LVNA 1D1TA 1YFJA 4O8ZA 1E79D 2B21A 1OT3A 1S7GA 1YJCA 1Z2NX 4XIFA 3ZI0A 3K0AA 2VSFA 3OQIA 1DBRA 3SYKA 4Z49A 1N2BA 1JI0A 4H1UA 1IHPA 1HDYA 4J4BA 1CBUA 3EQ8A 3MYRA 4FGUA 5KUTA 4MQUA 2CMDA 3GZ4A 3ZVRA 1BKDR 1WABA 2I4OA 2IE0A 4K9QA 1RRCA 1YS1X 3RRXA 4RGQA 3WYCA 3QY9A 2W7TA 1FFHA 4FSHA 3KLPX 2CDBA