1YDYA

Crystal structure of periplasmic glycerophosphodiester phosphodiesterase from escherichia coli
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
328
structure length
328
Chain Sequence
b'NEKIVIAHRGASGYLPEHTLPAKAMAYAQGADYLEQDLVMTKDDNLVVLHDHYLDRVTDVADRFPDRARKDGRYYAIDFTLDEIKSLKFTEGFDIENGKKVQTYPGRFPMGKSDFRVHTFEEEIEFVQGLNHSTGKNIGIYPEIKAPWFHHQEGKDIAAKTLEVLKKYGYTGKDDKVYLQCFDADELKRIKNELEPKMGMELNLVQLIAYTDWNETQQKQPDGSWVNYNYDWMFKPGAMKQVAEYADGIGPDYHMLIEETSQPGNIKLTGMVQDAQQNKLVVHPYTVRSDKLPEYTPDVNQLYDALYNKAGVNGLFTDFPDKAVKFLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycerophosphoryl diester phosphodiesterase
publication title Crystal structure of periplasmic glycerophosphodiester phosphodiesterase from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 127
structure length 328
sequence length 328
chains with identical sequence B
ec nomenclature ec 3.1.4.46: Glycerophosphodiester phosphodiesterase.
pdb deposition date 2004-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 1ydyA00
3PTDA 1DJYA 5PTDA 4RW3A 4R7OA 3NO3A 3EA3A 3MZ2A 4Q6XA 1V8EA 2OOGA 4I9JA 4I90A 2ISDA 4S3GA 1DJIA 1DJXA 3V16A 3L12A 3V18A 3KS5A 1AODA 1DJWA 4GNKB 1T6MA 3RLHA 4I9TA 7PTDA 4I9MA 4OECA 5T9CE 2PTDA 2O55A 4F2BA 4PTDA 1T8QA 2PLCA 2F9RA 1ZCCA 3KS6A 1VD6A 4QJ3B 4I8YA 3H4WA 1PTGA 3QVQA 1PTDA 3EA1A 3V1HA 3I10A 1YDYA 2PZ0A 2P76A 1QASA 1QATA 5T91A 2FJUB 4QJ5B 1DJZA 4QJ4B 6PTDA 4F2TA 1O1ZA 2OR2A 3QR1A 2ZKMX 2OTDA 4RW5A 3EA2A 4F2UA 3CH0A 3RLGA 4RV3A 1DJHA 1DJGA 3H4XA 1GYMA 1XX1A 5T9BG 3OHMB 3QR0A
chains in the Genus database with same CATH superfamily
5EYWA 3I7QA 4MF4A 2E5BA 2I57A 3VNKA 1BRLB 3UYCA 3MZ2A 5C8BB 1WYIA 1EUNA 2FKPA 4Q4PA 1ADDA 2CU0A 5A8GA 2DT0A 3W1PA 2QZRA 1KM3A 3BCFA 5A3HA 5C7HA 3ARTA 3A23A 2JKEA 4DBEA 5XIMA 3WK0A 1CI1A 1KO0A 4FHAA 4N9CA 1E6QM 3GVGA 3OZMA 1G1YA 2W9MA 4GWEA 1BQCA 3OVGA 3NFUA 1QPRA 4Y9PA 5KETA 1CYGA 4TV5A 1K1DA 3B03A 5HJXA 2G0WA 4N9EA 3NYZA 2D1ZA 4QJ3B 2EPOA 3LA4A 2BHYA 5DF0A 1IYXA 3RCMA 3UG3A 4GZ7A 1S2CA 2W67A 2J74A 1OD8A 2PDJA 1QO5A 1TV5A 4KWWA 4N42A 4UQCA 4MZYA 4GLEA 4GBUA 4IPIA 3QZ6A 5E09A 2FHBA 3E02A 2GSHA 4UIOA 3IEBA 3GX9A 3S1WA 1LF1A 2VEKA 1QMLA 3VZZA 4G1NA 3R8RA 3NGJA 2WKGA 2FHCA 3NO5A 3STCA 3U7BA 2OMAA 1PS9A 5M03A 4CD7A 4K1WA 3A4XA 3S2JA 3JZUA 3HPSA 3TJ4A 3VIHA 1YHTA 3C5QA 4Y90A 1G69A 1TB3A 3WJYA 1R38A 1M7PA 2ZXAA 3VM7A 1VCVA 4F8XA 1YW1A 4S3AA 5A8QA 1B3ZA 3DFPA 3WLTA 3IACA 4AU0A 4EPDC 2XIBA 1AMYA 1JEZA 2XWDA 4B2DD 3POHA 5IFPA 4C7GA 3P5YA 4DBSA 2W4XA 1F6PA 1F61A 1VFLA 3ZT7A 3BTNA 1UMLA 1BHGA 1Z8AA 5JVLA 2WWCA 3LERA 1PCKA 3CO8A 1PKMA 2XN0A 3UZ5A 1H7NA 1LYXA 4WSKA 1LM1A 3UG4A 5JIPA 3B9OA 1C9DA 4KRUA 4KCVA 2CLIA 4GVIA 4KWUA 2Z27A 3OLIA 3ES8A 2OZTA 3TR2A 2Y7GA 4OU1A 1P48A 1R3TA 3LXCA 3LQGA 2OR2A 3BPWA 1LUCB 4GGHA 3ONBA 3D47A 3UESA 5HUOA 3S1UA 4Q4KA 1LRTA 4JY9A 1UKTA 5CCZA 4NZCA 1OZMA 1W9UA 1EFZA 4H7CA 2V6AA 3N6HA 3OB8A 1IEVA 4A21A 3W1RA 3BXWA 3LLXA 4Q8MA 4JN7A 1JRCA 1HP4A 1E0WA 1BKSA 4R7WA 2WM0A 5A6BA 1JYNA 2WOQA 1UUMA 2D22A 1JL8A 3BMWA 2AOSA 3NSXA 2ISDA 5K2ZA 4AWUA 3ZVHB 5HATA 2GGHA 3P67A 1WZAA 5CBJA 1MDRA 1EGVA 1U5VA 3HQPA 1CLVA 3HZ3A 3AWOA 5GPRA 3ZS4A 1Q6OA 5DY2A 1C92A 4GZJA 3RJYA 2CBJA 1Q6LA 1T8QA 2JKAA 3L4TA 2DVXA 3T09A 4UQBA 2PP3A 4GY0A 3M5YA 1KFCA 4NJGA 3WD2A 1AA1B 3W70A 4XIMA 1RVKA 1E40A 4I6VA 1B9BA 3AIVA 4YJ5A 3TYCA 3O05A 3H2NA 3T0AA 1PZ1A 1O66A 1I75A 1NSJA 1DOSA 3U6WA 4J3VA 2HQAA 1OX6A 1W5QA 3RILA 2Q3RA 2VVSA 3O1NA 4GPNA 4DXVA 5HPCA 4AZ5A 4JTHA 3BZJA 4MY9A 1UR2A 3N2XA 3FNDA 1H0GA 1E4MM 5DRIA 3CPGA 4BK9A 2BX7A 4QJ1A 1FWJC 1KV5A 1J93A 4L4OA 3VNYA 1ZRQA 4IIEA 1DYSA 4B5NA 2NWRA 5H8UA 2XJ7A 4Q6XA 3JVAA 3QOMA 1PB0A 1I45A 4I90A 2VFDA 3EX3A 3G1RA 4AY1A 3S9ZA 4Z1DA 2P8CA 3TX9A 4DXXA 2VD9A 4Y7EA 1U1UA 1AQ0A 3BLFA 3U4AA 5A6MA 3QHMA 3WMSA 2FGZA 4LV9A 1NTHA 2FVLA 4YTUA 4DWDA 4PEKA 3LPOA 1FHUA 2WQDA 4AHQA 1W3NA 2R6OA 1PKYA 4B9YA 3PZQA 4L64A 3TXVA 1TX2A 2GJPA 1IR2A 2WNQA 3SCPA 2E9BA 3BSMA 5BXTA 4MYXA 1AJZA 1DWJM 2V2DA 4MIMA 4A4AA 3T40A 1GVEA 2VCCA 3TN6A 4HVXA 3NL3A 5LIWX 5IHSA 1C29A 4AHOA 3P60A 2PUZA 4C90A 1MQRA 2W3ZA 1GTHA 3AXIA 2VEIA 4DWSC 4A3QA 3GW0A 2JIEA 5EFDA 4BKNA 2PU0A 3NZPA 3S2CA 1AH4A 3REQA 4WGHA 1BFNA 3BWWA 3KL5A 4GXMA 5G1TA 1DL3A 1CXFA 3EMCA 4NZ5A 4O57A 5ABEA 5RUBA 4EAMA 2MUCA 3AIQA 1QNOA 2IXVA 3ZJ6A 1EJRC 5D30A 1G7VA 1L6GA 1JDCA 2KX9A 4R9OA 5FF0A 4NJIA 3AMKA 4K7YA 3UPBA 3OPSA 4LXFA 3TH6A 4F40A 4XAYA 5JQ9A 5JH2A 5C2CA 3PANA 4L65A 4R34A 1E9YB 4Y9OA 3OP2A 1Q6GA 1XC6A 2A7RA 3TLQA 3NL6A 1NAL1 1R3RA 1FKWA 2WZEA 2AQOA 3CMFA 4LJ3A 3MPGA 1WOBA 3A21A 5FA5A 3KS6A 4M1BA 4Z1CA 3TFXA 1IEIA 4YL2A 1O94A 3W1XA 4L5ZA 2EXOA 2YA2A 5H2ZA 1TVPA 3V1HA 1WBHA 1A5OC 1Z48A 3AXHA 3N15A 3WQVA 5GJNA 4AYSA 2ODOA 3H2FA 2WMIB 2NUYA 1UA7A 2XH2A 3BMVA 4PULA 5LYRA 1HKMA 3AU2A 4TVCA 3UU0A 2YW3A 2ZYFA 1R3QA 2E6FA 3BSHA 4DEFA 2YLAA 1J6OA 5CPTA 4Q8TA 1S1RA 1VBUA 1TIMA 4RDWA 5TNVA 1PIIA 1US2A 1QJWA 3PTDA 3LI0A 5JIWA 2QKFA 4ALDA 1OINA 4RXGA 1EA0A 3GM8A 1E3XA 4F66A 2WC3A 3IANA 3WDJA 5I2UA 4AIOA 2GVJA 4Q8NA 5C55A 4PBGA 2ZDRA 3S2NA 1DPMA 1CGVA 3RX4A 3WBYA 1A3XA 1W1VA 3A6OA 3W85A 3BL3A 4EP8C 2PWDA 1VBJA 1E56A 3APTA 4DHGA 3K5XA 5DXYA 3THDA 2Z25A 2AAMA 2GUYA 4U31A 3IUIA 1EYEA 4OKDA 3S9IA 3RU8X 1KGXA 1S2TA 4P5UA 3Q2DA 3WFLA 3LS9A 1SW7A 2PBGA 2RDXA 3QC0A 4BF9A 5BWFA 4WXZA 1U5JA 1OD0A 4UZSA 1XLGA 4J3UA 6A3HA 1KM1A 2TSYA 3U3HA 2I5QA 3KOFA 1BKHA 3FHAA 4KH2A 4W84A 3QHOA 3CQIA 4E3TA 4KWVA 1A5KC 2YBUA 2CHRA 1E1CA 1V3MA 1RJQA 3WIJA 3THUA 2XH0A 4NAFB 3OLEA 1LJYA 2YCLA 1W8GA 2CHOA 2BS9A 2D3NA 3OBKA 4WF7A 1V0LA 3XINA 4IPNB 2WMFA 2WMHA 1NQKA 4O18A 5HQEA 3NURA 1K03A 2IMRA 4DIAA 3SFKA 1ISYA 1AUSL 3S42A 2G5WA 5I03A 4UXDA 4DLMA 3EXSA 2E67A 3OEXA 3EOUA 1JXJA 5LHEA 3DEQA 1JULA 1TCDA 2IQTA 3A9IA 2OZ8A 4EWJA 4FP1A 3O6YX 1FDYA 1MZRA 2VR4A 2Y5EA 3OYZA 2VFFA 2DY3A 2ZX6A 3BW2A 4HQVA 1WBJA 1ML1A 1RA5A 3KRBA 5D03A 2A85A 1AZ2A 1CXLA 5CZSA 4A3UA 1KBLA 3GKAA 4WSHA 1GEHA 1XLDA 3QN3A 1EDGA 3NZRA 3V5FA 3L0NA 4NX0A 2DFAA 2Y7EA 3KLKA 4ZL1A 4LAMA 4L4LA 1E3ZA 2OQHA 4FF7A 6ALDA 3GNDA 4NJHA 1K9EA 3H2CA 1XUUA 2ZRWA 4DUOA 2GVYA 3S5YA 1ZL1A 2E5CA 1HIZA 3VE9A 4DYJA 5AYBA 3LQLA 2NVDA 2PAJA 3AHTA 3CUFA 3PZTA 3GDRA 1W5NA 3IJIA 1TRDA 2B7NA 2BXVA 4WOQA 3UXDA 1XX1A 1C7SA 4H41A 4WLCA 3P84A 4V33A 4XAZA 4UTTA 1OF6A 3DENA 4FR6A 5JXQA 3RX3A 3BJTA 3CAKA 2AMXA 1H49A 1YNYA 1GZJA 3PZ9A 1O60A 3CWHA 3SN4A 3B8IA 4YTQA 4F48A 2GGEA 4JCMA 4H7ZA 3WQFA 1JF5A 3GXMA 4AZ6A 2F6XA 3AS0A 2DP3A 3T2QA 5MKGB 1GVRA 1V6UA 2VGBA 4EACA 5AN7A 2VURA 3GS6A 2BSLA 4WRHA 4J1OA 4UC5A 4NKCA 4E8GA 3W7JA 1RR2A 4TOQA 1PZ3A 3IJ6A 4OV4A 5I3KA 4D1JA 1S2VA 1JFHA 1R2RA 4IMFA 4ZR8A 1A5UA 1LQAA 3PWIA 1EL3A 2NT0A 3P82A 4TMCA 3EOOA 5J5RA 3S2MA 1M01A 1QI3A 3T44A 3ABOA 3HPFA 4ZO7A 2X09A 3N3MA 3KVKA 4D6IA 3SDOA 1Q4WA 3PZGA 2E09A 1S5VA 4G5DA 3WJSA 4H6EA 3FVDA 5A8NA 4JBRA 2BB0A 2WVUA 2V3DA 3NM1A 5BXRA 3NQDA 3A3XA 4JIRA 4Y96A 2X1IA 4J4KA 3CZ8A 4JGDA 1AW1A 3GAKA 2P5NA 4IXXA 3TNOA 4YXGA 2GQAA 4P7NA 5HJLA 1UW9A 2AQWA 3VD5A 4ERIA 4S38A 3HPAA 3W02A 1A5SA 3R0UA 4V2XA 2HTMA 3T0TA 3HGJA 1VS1A 2ZFAA 3M47A 1DJXA 1E70M 2CLMA 3WH5A 4IISA 1UPMB 1IGSA 2Q01A 3EB3A 3L5MA 1BYAA 2O9OA 1F07A 3EKZA 4PBFA 2CEQA 4DPQA 4D72A 4IP4A 4OHQA 3W2UA 2I5IA 3CQHA 1E4IA 1QCWA 1XFBA 3BAYA 3W25A 3EX2A 1W1A1 4AD3A 1R6WA 1CGWA 2OU4A 2ACUA 4FXRA 4EVZA 1E6ZA 4ILSA 1WZLA 3I7SA 4ZEPA 1GW1A 4S2BA 4GXPA 1UKPA 2OWXA 4L7ZA 3GC2A 4HNUA 4GIRA 4O17A 4WDTA 1GJPA 1OZQA 1XRSA 1V3IA 4LBUA 4HTYA 5D2TA 1O5QA 2B31A 4MWAA 1W8SA 4F4RA 1E0TA 2FGLA 3KBJA 7CGTA 1UD8A 3UJSA 1NP2A 3QY8A 4JNMA 3LCFA 4KEVA 5CZTA 1OG0A 2CZFA 4ACZA 1N7KA 1HUVA 1RXOB 4PRRA 1EB3A 3VOIA 2EF9A 3UJEA 1J11A 4FS9A 4C6CA 3E6EA 4IFRA 1W37A 1W9VA 1I1XA 3KHJA 3GB6A 2XZ7A 4PCFA 5FAJA 3L4UA 3SCNA 4M3PA 4ZBCA 4ZOEA 3HN3A 3UNDA 3S4TA 3EWDA 3MVTA 4GIAA 1TMLA 4WJ8A 3PAOA 5XIAA 1Y8BA 1DHKA 1H7RA 2VX4A 3G1HA 3DXIA 5ECVA 1GONA 3A4WA 2XIQA 1U22A 3EWZA 3KCLA 1YLVA 3AUJA 4L4PA 1XRVA 1ZAJA 1A3WA 3T2OA 1KXTA 4LANA 5E6ZA 3NR0A 3GTIA 4QLKA 3W83A 1AL7A 3ISIX 4QAIA 3ONCA 4JNYA 1EBGA 2YFOA 4JQAA 1F8IA 2GGIA 4FAMA 1M9HA 3Q65A 2YCIX 5I78A 1K9DA 2X41A 5KZ6A 4CNTA 1US0A 1XH0A 4UR7A 4MNLA 4Z0JA 3FK4A 2DZWA 5E0KA 4DM1A 3WNMA 1HKKA 4PSRA 4MNKA 1VAHA 3SQLA 1RPKA 3WJZA 4NHVA 2F38A 5EBAA 2Y85A 2V3GA 1REQB 1JYWA 1U30A 3H54A 2BHZA 1PEZA 3VCCA 3OGRA 3GLCA 3U8GA 5IOBA 2NQ9A 4R85A 3SQSA 3SGGA 1OX4A 1QHPA 4R9XA 3FYYA 4P8VA 2VUNA 2D73A 1V6XA 2J4GA 3BO9A 1HO1A 3UWWA 5I6SA 3KL0A 4NL1A 4IIGA 4LALA 5REQA 1UH4A 3WQ4A 4O4VA 3V18A 3LZ3A 3MUY1 3AOFA 4W85A 4FNRA 4S2CA 1YTKA 3ZZ1A 3NYDA 4XTIA 4XZWA 2ZUSA 2V69A 1OHLA 4KEUA 4UTTC 5T9CE 3ELFA 3IVTA 3T8QA 1X96A 5F4XA 1QWGA 1XYLA 2OKTA 4F0KA 1TPB1 3L2IA 1UBPC 2PDQA 1W1ZA 2DSWA 3CGTA 4JY8A 4JHOA 4QRNA 4EOUA 3M0JA 5IFTA 3CQJA 1YX1A 4M82A 1Z42A 1UIPA 3S47A 2P10A 3P93A 4LRTA 3ABSA 1AQFA 2D2HA 3TQ0A 3GG1A 5DN1A 4O8AA 1JI2A 1PKLA 1B3YA 2PF0A 1IEQA 3VIMA 3XISA 1JUEA 3AXMA 1WCGA 3NA8A 3TYAA 3VK5A 3OBEA 3WUEA 2Q8ZA 3CZLA 2ZZ6A 5TBOA 2XM2A 4LW7A 4WXYA 4AD4A 3G18A 3WDPP 1RALA 1V3JA 3AUOA 5I02A 1HT6A 2HZGA 4PA8A 1P1XA 3IVSA 3LD5A 4IMEA 2V81A 2JE8A 5HAOA 3DKJA 1VFTA 2Z6IA 5PTDA 2G4FA 5I24A 3TNBA 4J3ZA 1FDZA 4UQDA 3AHYA 4KWSA 3W71A 1S5NA 1EJTC 4XSMA 1GG1A 1XW8A 3R25A 3LI1A 4UTJA 2WPGA 4J7RA 4JL1A 3WQOA 4HPHA 3OODA 4Z08A 4HCLA 3OIXA 3M0MA 1E72M 1GWJA 3W1NA 3ZXWA 3OQ8A 3NO1A 1OFBA 1Q6EA 2YXOA 3R0KA 3HU7A 4O14A 4ZFCA 4KT2A 4C5YA 4O1DA 4O54A 4E0CA 1E73M 4I9AA 5TQLA 3Q67A 3GHRA 1NDVA 3F1QA 3QW4B 3LPPA 4C6PA 5GVJA 4DZAA 4U3AA 5CSRA 2QQ6A 3DHUA 3VYLA 3R1ZA 5AYXA 4RZ6A 4LC6A 3P0WA 3W7PA 4P8WA 2ZRUA 2FVMA 3VC6A 4C1LA 4B5XA 5JMUA 4D6FA 3K8MA 2DDXA 4L1WA 1Q6QA 2I14A 4NILA 1LOSA 1UJQA 4YYFA 1I2OA 1H2JA 1PHQA 4H01A 4NUWA 3B0XA 1FX6A 3B0UX 3S6OA 3GZAA 3B06A 3UZZA 1XIHA 1J0KA 1E43A 3SQMA 2X0SA 2PSNA 4H9YA 1OSEA 3DH7A 4A22A 4E5TA 3CUHA 2JEPA 1UASA 2XH4A 3N14A 3PTKA 3UA3A 1C90A 1ONRA 3V16A 3RN6A 4IMDA 2X0YA 3ALFA 3S9YA 3L7RA 4GFIA 3IRSA 3QJAA 4I9MA 1FHVA 3F7JA 3MQTA 3C2VA 3FXYA 4MY1A 4XVDA 4JS3A 4FNSA 2QULA 1A0EA 2HISA 4MOZA 1MW0A 1LL4A 3NCOA 3OVPA 3T6CA 4Q22A 1FWBC 4YTSA 1TRIA 3VIJA 4X9SA 1LCOA 3LHZA 4IQJA 2NV9A 1VB9A 5I3IA 3AC0A 3PWAA 2FZ8A 4GI4A 5D4YA 2GK1A 2REQB 1I0BA 1CIUA 4P7RA 2ZKMX 4KWOA 1S46A 4DBWA 3I3BA 3BGAA 3H23A 1TQJA 2A0NA 3M7WA 3DHFA 3UZJA 2H9AA 2IKHA 5C70A 4HA0A 2DUZA 4HSNA 2E25A 2CLLA 5HNRA 3WKZA 3WD4A 3DHPA 4KIRA 3B4YA 1XIBA 4IOTA 3DIPA 2YBTA 2DSVA 3LCWA 3ABXA 3NL5A 2DUXA 1EJUC 8A3HA 2E40A 1QXLA 1JPKA 3ITOA 4JTJA 1X6UA 4CQ8A 5DX7A 1B3VA 5A95A 1PWLA 5D02A 3N1AA 4MKSA 2YDSA 3VOCA 3P0XA 3U48A 1H7XA 2V68A 1TV3A 3OVRA 5CPQA 1VQTA 1XLLA 2O9PA 4ZOAA 3AYSA 1ISZA 2CPUA 2OZ3A 2C0AA 2OX4A 3NQCA 4HPJA 3K1GA 2A6LA 4GBDA 3M5ZA 1ISWA 3W1LA 2X7VA 2GWGA 3LZ5A 1Q4NX 4TIMA 1OGGA 4Q8UA 4JTSA 3LX9A 1JI1A 1FY6A 2W6RA 2HSAA 5BNKA 4J2MA 2WSPA 3W7DA 4DO4A 3RG6A 2BASA 4NG3A 2QT3A 1UH2A 1Q7MA 2XVGA 4HGXA 4WVXA 1PX8A 1MEIA 3REQB 3W2NA 4GY1A 4HJFA 1WA3A 5FF7A 3S0CA 4ATLA 2OGYA 5AHMA 1IZKA 2I9EA 1P0NA 4IQEA 1V6YA 4DZHA 4RDZA 3W07A 1UKOA 1TJ0A 3IIZA 4O15A 4YVXA 1NQ6A 3T0CA 2EJ1A 3EOLA 1VYSX 3MV11 4LSBA 4OT7A 4JDBA 1DBTA 5C9RA 1YMYA 4UTFA 1EJXC 1JNDA 5MHBA 4B5TA 5HXMA 5CPSA 4FOUA 4GJJA 2NWSA 2W91A 4JFUA 2JFEX 3VILA 3D5HA 3WDRA 4Q3MA 3ZYZA 3AS3A 5I77A 3UEQA 1PKNA 1KM0A 5I07A 4LF1A 1PV8A 3LBMA 4HPNA 3CS2A 4BQ4A 1O1HA 4FNPA 1DWFM 1HJUA 2J7BA 3FGCA 2OPJA 3NPVA 4WZHA 4FALA 1F5ZA 1QPKA 5C6MA 3PTMA 1W1IE 2UY5A 3W7IA 4IH3A 4KRTA 6PTDA 4HJWA 5BMXA 3W6MA 3GNRA 3HM7A 1ZBKA 4NZFA 3BDKA 3U2CA 4PUJA 3AS2A 4XZLX 4EWND 2WHLA 4JFVA 2F6UA 2PDXA 3DBNA 4JEQA 3WUGA 4U3CA 1IT7A 4AWEA 3AHZA 3MY9A 3WQDA 2RJGA 2H3DA 1DJNA 1TYGA 4W7UA 3MKVA 2OOGA 2XH7A 3BOFA 2WJFA 3KAOA 1WUEA 1XISA 2ISWA 1WXZA 3W73A 2HS8A 1L8PA 1E5NA 3P2VA 2EAWA 3BSGA 4F0HA 2ZX7A 5CC3A 2E28A 1KKOA 3WMCA 1BTMA 2ZDSA 2FIQA 2EQDA 4GVGA 3TFCA 1QFEA 1WQ5A 2ZCGA 5KZEA 3C8FA 4QM1A 4A2SA 3LHUA 4JZ5A 1MNSA 3WQ8A 4NRRA 1XH1A 3QLLA 3VVGA 4PMZA 4KFPA 2QVNA 3IUHA 1XRFA 2E9LA 2GWNA 3SY1A 3KM8A 3LEPA 3LRKA 3OVQA 1UA3A 4O0ZA 4W5ZA 4N6FA 3QV6A 5AHFA 1E1CB 2ZZ5A 3LGGA 1XGEA 4E38A 2Z1XA 3AMGA 4GG9A 3W74A 3EYPA 1DQXA 1HQTA 2QMKA 4ZTXA 1G0CA 3B0YA 4JN6A 3WNPA 3FA5A 3Q4DA 1EC8A 2PWUA 4AWTA 2FMNA 4B15A 4A8IA 1ITUA 3MANA 3OHMB 4E4FA 1WNOA 2YLLA 1P43A 3L23A 5HDRA 4WHBA 1XQKA 2IPJA 3PZNA 3NZ1A 1UJPA 4JQ4A 1MYRA 4JIHA 3VCRA 1GORA 3AXKA 3WUBA 1V3KA 5FOOA 1S2WA 1QI4A 1TSIA 4BEQA 4W9TA 4W93A 2OEKA 1GQIA 3OJGA 1TG7A 4BQ5A 2Q3OA 2IUZA 2D0GA 3VE7A 1CCWB 1TTQA 2FH8A 3ARYA 4Z1AA 3FKKA 2CERA 3UXIA 1H41A 1S3HA 3S5NA 4W7WA 1YE4A 3YPIA 2XZ9A 1NOFA 3GD6A 2FDSA 4G1KA 3W23A 4E2BA 3VD4A 4J3XA 4M6PA 1VP5A 5F4SA 2PTDA 1P0EA 3AJXA 2PLCA 1R3YA 4KEZA 3VNZA 1UZHA 1VD6A 1G7UA 2J88A 1L2QA 1RSCA 4GZIA 4IPJA 3O16A 1TV2A 4GQQA 2W92A 3GG8A 2G3FA 3W7EA 1UP0A 3QPYA 1FWNA 3KBWA 1H51A 4IHCA 4U28A 3WNLA 4Q7BA 4NQ1A 3MZNA 3AMLA 2V8ZA 2DH2A 5DELA 3VGGA 2NX9A 4LY4A 4V28A 4Y9MA 4LQ1A 1I8JA 4U2YA 1JQXA 3H4XA 4IP5A 1U33A 1IT8A 1PO9A 3B8UA 4AEOA 2X0HA 3UR7A 4RDVA 1KCZA 3DDMA 4QG6A 1CNVA 1Q8AA 3C0LA 4CD8A 1EJSC 2CLPA 1IXPA 3EXRA 4I9JA 3SR7A 3T08A 1HNYA 3WBWA 4WY0A 2HVMA 4B92A 2C16A 3ZLHA 1L6YA 5DBUA 4CQBA 3EDDA 4HMEA 1WZKA 1IXNA 2WV8A 1L6WA 4LCRA 4AD2A 1A5BA 1QT1A 2PGWA 2WHJA 3KDNA 1IF2A 1AJ0A 4DY1A 4OECA 4AC7C 1EWDA 4EKJA 3DI1A 1CGXA 4EPEC 2OT1A 4FA3A 1VBRA 4ICMA 3B9DA 5HR6A 2X2YA 2J8GA 2J7FA 4JYEA 1HJSA 3EB2A 3H2MA 2A21A 4JQ3A 4WY0F 4FIQA 4QNEA 2NQHA 1HGYA 3M6YA 3CNYA 1NWRA 2OLAA 4J9JA 4JIEA 4AUBA 3KL3A 4MY8A 3K1DA 3GH5A 1TJRA 3V1PA 2E6YA 4O16A 5CGTA 3ZT5A 1CWYA 2OYMA 1TE6A 1J18A 2WSKA 1TR1A 2C1IA 1NWTA 5DMLA 2WBGA 1EOMA 1WO2A 5EGRA 2TMDA 4AQLA 1EX1A 4DZ5A 2Q71A 1W56A 4HOZA 3MI2A 4NI8A 2FTPA 2WNNA 4XBKA 3A3WA 3TYBA 1GJWA 4A6GA 4KFNA 3QLDA 3ANUA 4LF2A 3BG5A 3UA4A 4H8NA 1R7AA 1ZU8A 1RUSA 2EEXA 5LNVA 3UZWA 2X05A 4IZGA 1RH9A 4L9ZA 1UD5A 4XK2A 2PF8A 3AJ7A 1D8CA 8XIAA 1UR8A 4DO7A 4HP5A 2VGFA 2KAUC 5CAKA 3IJQA 3V7PA 2VR2A 1PVNA 2PBOA 4M0XA 2AKZA 4Y9NA 1PZ0A 4W89A 4OIFA 3D3FA 4HA4A 3FYPA 1J9YA 2C6QA 3GU9A 3FKRA 2V82A 5C54A 1TV7A 1I0DA 3ITYA 1FCVA 2JGQA 2ZZ1A 2FB3A 1LUCA 4PFHA 4GABA 1P6BA 4JHMA 3PUGA 1G5AA 4AY8A 3HO8A 5AFDA 1M7JA 2WPBA 2E8ZA 3ABZA 1HL2A 5FAGA 4W86A 4DF0A 3HBLA 3NAVA 3ANVA 5M5DA 1MEHA 3QZAA 4PB5A 2GDQA 3OZYA 3B8TA 1FWAC 5CZJA 2NW0A 1IE7C 4B4FA 4MWAB 3RLGA 2CITA 4W7VA 4A29A 1CLKA 2P0IA 1HZYA 5CXPA 3W7QA 3AI0A 5I5RA 2YGYA 1TCMA 4GUIA 5E93A 1GTEA 1HVXA 1WX0A 4QQ3A 1EPVA 4UNLA 4WOZA 4W88A 2EKGA 1W31A 3N6JA 4P8UA 4ACZB 5BCAA 4C6IA 2PDLA 1L2UA 2ZUWA 3HIJA 3BLLA 1CZ1A 3UYIA 3BK0A 4C6OA 3RNDA 3ZLGA 2OELA 4ASTA 2Z1SA 3IGXA 3MP4A 5CQ1A 4UTMA 4UB9A 1B3WA 2NSXA 4O52A 1DKWA 2UWFA 3SRHA 1F3TA 2BXYA 3K30A 1JRBA 4HHMA 1NWUA 4RE3A 3VGDA 1GQNA 2Y63A 4Z2IA 1KR0A 5FEXA 1FFRA 2FZ9A 4YCPA 5C2XA 2J25A 1C93A 1DIDA 1E9ZB 1VPYA 2YR1A 4QE1A 2VXNA 4CN6A 3VOJA 4A8RA 2I17A 4JX4A 5HA7A 3EWWA 3IWPA 1OM0A 2VC5A 3ATYA 1FH9A 4P7LA 4O13A 3EX6A 4LAUA 4EXAA 4RNIA 4C7DA 4LAKA 1OEPA 4GX9A 4QQUA 1L9WA 3I6TA 1WUFA 1LLZA 4IJBA 3U7VA 5FJUA 4ADUA 2V30A 3FJNA 3LCXA 2E68A 5A6LA 1GVYA 4W8AA 3VDAA 1K8ZA 1V7AA 3QQWA 3SIMA 2IS7A 1D2KA 2O9RA 1XIGA 1XLMA 3MHFA 4LFYA 1POKA 3A64A 2HBXA 2CC0A 3RJXA 4QE5A 2QUNA 1XP3A 1DJIA 4GCXA 3EAUA 3QMTA 1EKOA 1PCWA 2FFCA 5JUVA 3UCDA 2BWGA 4CU8A 1JDFA 4DJEA 1H5VA 5M3WA 2ZX9A 1XCFA 4HCDA 2J77A 2VDGA 3CHDA 1LT8A 3FXGA 2VVNA 4AVNA 2Y2WA 3AYRA 3TW9A 1OCNA 1LWJA 2WCGA 2C1GA 1XKYA 1ZCCA 4LT9A 1TWSA 2HE5A 5CZKA 3UWVA 3GDBA 1V51A 2OODA 4BZYA 4I7WA 3P8JA 2IXUA 4DQWA 1HKIA 4HHLA 4AZBA 4O50A 5AHLA 4QJ5B 2FQIA 4IUOA 2O9TA 3W27A 4FX8A 4YHEA 1P0KA 3U5UA 1Z3NA 2J75A 4DZIA 1N8FA 4B5SA 2PDMA 1BAGA 3CZEA 4EF9A 3CH9A 3R6IA 5B7ZA 3PPCA 2X42A 3G1FA 2Z1VA 1MXDA 2OT0A 4U2ZA 3E2RA 2DT3A 4JL2A 4YYCA 1SSDA 1AD1A 5CPOA 4Z2LA 4NXKA 3THQA 1WXJA 3BAWA 1WAWA 2QXWA 2QF8A 1F2JA 3GXDA 4DJFD 3GIYA 2X16A 2YCKX 4YPJA 4S1FA 3S5ZA 1MW2A 3HFYA 3WQ5A 4L80A 4B5UA 2NQ5A 1KCLA 2OWWA 4NF7A 2FPYA 2GJNA 3H7RA 4K38A 2A4AA 1QVBA 3MWAA 5LNWA 1WKDA 1U2YA 2J78A 3BC9A 4US6A 1HO4A 3EOEA 3I68A 3KBMA 4GCAA 5CKSA 3R94A 2O56A 1T96A 4K39A 4KGJA 6XIMA 2ASHA 1F7BA 1ZNNA 2WMKA 1DORA 2QS8A 4Q4RA 1R2SA 2Y8KA 1EO7A 4ML4A 1C8QA 4L9XA 3MWCA 2QPXA 2BY2A 3WQCA 7TAAA 2XN2A 1JDAA 3D3AA 4GH1A 3PB0A 3ZFHA 1H1NA 2ZBTA 3HG2A 2EPHA 2DZSA 4XZNX 3SCSA 2WJEA 3T0DA 1H7PA 4AD5A 3HJEA 3WELA 1SQ7A 5D9MA 9RUBA 2H6RA 3D0CA 4QE4A 2P53A 2Z4GA 2JGYA 5AB3A 2JQXA 1I6NA 1SYTA 4IIFA 3EMQA 2J9XA 3CAQA 4GYKA 3TMQA 2BFGA 3UW6A 2R82A 5A6TC 1PTAA 3BCDA 5AC6A 3H7VA 1KRCC 1DJYA 2PDBA 3N17A 2D3LA 5CGQA 3GIQA 1E51A 1E71M 4ROQA 1ISXA 4UTWA 1T0OA 1ZBVA 4CN1A 3FS2A 3PBMA 2BMBA 1AH0A 8XIMA 2VX7A 1ZALA 2OGJA 5LNUA 4JTQA 3TTYA 3P80A 4DVOA 3BV7A 1RD5A 2AQVA 2JF6A 3SM0A 3C0QA 3R43A 3BQ6A 2ACSA 1H3GA 3LXBA 3MP3A 1XSKA 1RPXA 1KGUA 4WUIA 2Z2AA 1KRAC 1BWLA 2F7FA 3DFSA 1X8FA 3EX1A 2R24A 3M64A 1TO3A 1XIFA 4ZSTA 3FLUA 4PH6A 2F84A 3E0FA 1AG1O 2HJPA 3W26A 3N12A 3QF0A 4D8AA 2JIWA 4ICNA 3BJFA 1MQQA 1I60A 4QBXA 3T9PA 1BYDA 3UP8A 1YRRA 2ZC1A 1B31A 1R87A 4Q7NA 3K8KA 3GR8A 2BY1A 3LMZA 4PR4A 3EWUA 3STFA 1KFBA 1AW5A 4GKLA 2J6VA 2PFHA 2DV0A 2D0HA 1MO0A 2GK1B 2GVLA 1NP0A 4GVHA 4IM4A 1OFOA 3JR2A 1WE5A 2WW5A 2CYGA 3GVVA 3IUDA 1VHCA 3T05A 3VUPA 5FCZA 3CZKA 1FP8A 3NQVA 2VI0A 3B04A 2H9AB 4H7VA 4ECLA 5JU6A 1VZWA 3KOZA 4US5A 4NXSA 4NNBA 4GYPA 1E1EA 4LTSA 3TN4A 3EA3A 4PUEA 5HBFA 3EGJA 3WYZA 2PWHA 3N73A 1B30A 4DAFA 1W9PA 4JX5A 1WDQA 3LLDA 4GC4A 5D38A 1VEMA 4NU7A 1KM5A 3SUTA 2ATMA 1TPWA 4TX6A 3LV5A 3ATZA 4FX6M 1QK2A 4LUSA 3AMDA 1YDVA 4Z2KA 5FD0A 4I9TA 3V35A 4P2VA 1XIMA 2OYLA 2H8XA 3SY5A 3LCLA 3OYXA 3AIUA 3URBA 4HZMA 5IM51 3VKKA 2WO5A 3W7HA 1DTUA 3EDFA 1K4GA 3GR4A 4M1RA 4C1NB 4D6DA 3QY6A 3PP7A 2INEA 4OVXA 3B05A 3LDVA 3DFQA 5LGXA 1QW8A 1QATA 2A3LA 3N2OA 3W6LA 1DTNA 3CZGA 1XG3A 1QI0A 2Z6JA 1RJPA 1L8NA 1BLIA 1XH2A 4RLIA 2QVHA 4S39A 1HP5A 5HJYA 3DYMA 1OFAA 4PTNA 3UY7A 4KW2A 1NDZA 5FEPA 3BGJA 3WL0A 1WDPA 1SR0A 1H1YA 4NZ3A 1XLIA 1GOQA 4GUHA 3USBA 4TR9A 1IWBA 2VFHA 4F0MA 2V5CA 1GQJA 5EL1A 4RPQA 3ZVIA 1Q6FA 3GDMA 2PTZA 1YPFA 3A3HA 4GX8A 1JCYA 3LUTA 5D9PA 2C18A 2OXNA 3ITXA 2OG9A 2Q02A 5HNTA 3M0XA 1ECQA 1OADA 1O12A 1UR0A 3N29A 4RE2A 4DYKA 1FWCC 3TAKA 3SCRA 1KWKA 3HV8A 4AYGA 5C2GA 2CESA 5FJIA 3WMLA 4ZO6A 2V38A 1EJVC 4HZ8A 4W5UA 2CFFA 2E1WA 4HNNA 2QCCA 2R1NA 2FDMA 1Z69A 3P14A 2GLKA 4LUIA 2A1YA 3NNTA 5A6BD 4DUXA 4X60A 4QSFA 3CL8A 5A8OA 2INFA 1E15A 1THFD 3ENLA 3ABQA 5T8GA 1TZZA 2WZTA 3GHSA 4IGMA 4OJYA 1SW0A 3VOGA 3G8EA 2DORA 5CG7A 3RM9A 1LWHA 2OZ0A 2WQPA 1FTXA 2PE4A 2Y8VA 4JHZA 5AKQA 1OFQA 5F4WA 3GVQA 1DE5A 3BICA 1CENA 4ORMA 3OGSA 3A13A 4UOQA 5HWJA 3SAZA 2H3BA 2ABBA 1PDYA 5A94A 2UY4A 2OJPA 2GFTA 5I3DA 2GGJA 3E2VA 4PSPA 2X8RA 5DLCA 2GYIA 3E0IA 3WMBA 1VBHA 4IGSA 5CZ0A 4LRSA 4R3UA 4B9ZA 4GH3A 3RLVA 4ICCX 3LG3A 2ZE3A 4KEMA 1P0DA 3MYOA 4CU7A 3JRKA 4UCFA 1W32A 4FLRA 1M1BA 1TREA 4H9TA 2QJJA 2AGTA 2W62A 4NRSA 7A3HA 3UVAA 5KMYA 4GO9A 3SUVA 3G22A 3MI6A 5FSEC 2ADAA 3AICA 1WAUA 4JYDA 3QBUA 1AVAA 1NDYA 4GA8A 4BWLA 1SJCA 3EA1A 3C56A 4RE4A 4RX0A 2YKKA 2QPSA 2XWEA 1XRTA 4TXEA 1JZ2A 2V67A 4XD3A 3I6RA 1O4UA 1QK0A 1MUWA 1W3HA 2F2KA 3DUGA 4YVVA 3T4WA 4U5IA 1VFSA 3ZSTA 3EMZA 1NU5A 2XPKA 2G3JA 3SURA 1KRBC 3LPGA 5JH1A 2NZLA 5K9CA 4QDWA 2FH6A 1I2NA 1W3JA 2WKLA 2FGBA 4H9XA 4OBRA 3G1XA 3UERA 4D6EA 2YJQA 2O92A 3MUCA 3WY1A 4CD6A 1TX0A 9XIMA 2HV5A 2GOUA 5E1QA 1GCYA 3FX4A 1OCBA 4M56A 2VEPA 2TPSA 1VRXA 4O12A 3WF0A 2JALA 4E3VA 1KFEA 2X2GA 7XIMA 5ENLA 1TELA 1TKKA 3TU9A 3CXOA 3NVTA 1JZ4A 3K4WA 2GGGA 4Q8OA 5FEZA 4CGTA 4DELA 5FEWA 1B1YA 4YS1A 1SZRA 4S3DA 1G67A 3AIWA 4GYPC 3P6LA 5D8WA 1LRQA 3QY7A 1GNXA 5HMDA 2YIHA 1HJQA 3UG8A 1J2WA 3W7OA 1XYFA 2VD8A 1FFQA 4OBSA 4PZVA 1VHNA 3M0ZA 5DY3A 3GAYA 4RNHA 3VCNA 4KGLA 4KETA 2PTXA 1OIMA 3M44A 3WQ6A 1REQA 5BYWA 3VMNA 1SU5A 3GYCA 5LA2A 5G2IA 3MP5A 3NTYA 3B8SA 4ZODA 5I7GA 4PMJA 2PLKA 1V02E 4LS2A 4I5RA 1JPDX 3OLGA 1MWOA 4TMBA 4L61A 5HMSA 4F2UA 4K8GA 4C6DA 1DQUA 3TOPA 1B4EA 2ZX8A 4HBKA 1KW1A 1N2VA 2HS6A 4AF0A 3W7MA 4LBRA 1X38A 1UR4A 1VFFA 2ZA2A 1G4TA 1R9YA 1XPGA 3NEHA 3O6AA 3TWAA 2PDCA 2A3CA 1KB3A 3R5EA 1VFHA 4YLWA 1O5KA 4WY0B 4YVPA 4S3GA 4ERAA 1FCBA 2FVKA 1XSIA 5HNNA 1UZ4A 2XFYA 3TUUA 4L6HA 3V5CA 1ME9A 3L68A 1IZCA 3KOXA 1H09A 5LZLA 4GNKB 4C6KA 3TVAA 2DQWA 3PJUA 4V15A 1TPUA 1PIFA 2V2HA 3IS4A 1DXEA 4HZ7A 1ZUAX 4XIAA 1B90A 3AHVA 4EPBC 4LVFA 2ZXQA 1OYAA 3R89A 4YTRA 5LIXX 3P61A 3F2DA 4WDWA 4XO6A 5I3FA 5CGMA 7TIMA 1VEPA 1AH3A 1KFJA 3ZOAA 4S23A 4IPLA 5AYYA 4LWWA 3W7NA 3VTRA 5LKYA 4ADTA 3H8AA 3GFYA 4OWGA 5DRCA 4XISA 2C3ZA 1Y5XA 4GE8A 2R1LA 3FY1A 2A6NA 1Z7AA 4PUNA 3QKEA 3MSYA 3CLWA 4DI9A 2J47A 1V3HA 4IG2A 1KA9F 4JFTA 4H00A 1UUOA 5I00A 3QXBA 2GQ8A 4IX2A 1R85A 4KCTA 1XC4A 1MMFA 4J28A 3M07A 1KFLA 2BVDA 4D1IA 4ES4A 3H21A 3ZJ8A 1BVNP 5AY7A 3STPA 4N4QA 4HNOA 2Z1BA 5GQBA 4O28A 1CXHA 4XUYA 3WF2A 2DEPA 2I56A 4L1GA 3MI3A 1NF0A 2NLYA 1S39A 4NIRA 3R4IA 1JD7A 2EO7A 3W28A 4IXHA 3HQ1A 4HOWA 3CL7A 2F2HA 1WP6A 3KE0A 4WJXA 4F79A 2GQ3A 3V4BA 4LUJA 2RGLA 5D09A 1BWKA 2Z29A 2P1FA 5F2GA 1EIXA 4I3GA 3W81A 4MJ4A 2X1UA 4Q7IA 5BU6A 1G4SA 1ALDA 5HK4A 5HOSA 3BCJA 4F0SA 3BGGA 1OCJA 3BV4A 1JYXA 4JEJA 2D69A 3MB9A 4GC3A 3DESA 3WD0A 2VC9A 1AW2A 4B5WA 1LP6A 3FJ4A 3H6OA 4Y8FA 3M9YA 4GI6A 3GNXA 4JTEA 3A22A 3KZSA 4DJFC 1QPQA 2XIJA 5IBXA 3A12A 5M1TA 1EZWA 3SN1A 2WSYA 3WJWA 2BGSA 3MU7A 2NV2A 4AHPA 2VCBA 5C5YA 4W8BA 3GK0A 1RBLA 5BWAA 1GYNA 3WEMA 3W00A 1MFVA 1HN1A 1UWIA 3CBWA 3R7MA 1W2VA 3BANA 3N9RA 1YQ2A 3QMSA 4XZHA 3POCA 4H8VA 1XLHA 2VMFA 1B2YA 1PYFA 2P3EA 3LHWA 2PZNA 5LGZA 3GFXA 4WIWA 1ICPA 3MT1A 3EWYA 1W9XA 1HKVA 3ARQA 3N18A 1XYCA 1XBVA 4PMDA 3PR2A 1HFBA 1BYCA 2J8FA 5KTLA 4FOJA 4J2PA 2WMGA 2QYGA 1J0IA 3OO2A 3L65A 5BRQA 1RP9A 2EKCA 3EX4A 1RBAA 3W1QA 2VDIA 3W88A 3DG6A 3GG7A 3PZVA 3W7LA 2QMJA 2POTA 3L2MA 3U0HA 4MZ8A 1OCQA 5L6UA 4S3CA 2REQA 2O7SA 3WENA 4IJRA 3GDTA 1ESWA 3M41A 1J6PA 1YTEA 3AROA 1IXOA 2V3EA 4FXFA 4GUGA 1IXQA 1JVNA 4IGHA 4MNMA 4ZCWA 3PZUA 4WDXA 2VFEA 3LOTA 4MB1A 1DEDA 3VNJA 2O4QA 2BXZA 2PC8A 5G2WA 5LSMA 1TE1A 1Q6CA 3CV2A 4LCQA 3WLNA 4OTKA 1OT2A 1VPXA 1LT7A 1VBGA 1D8WA 4GKTA 2NT1A 4ZOBA 4K1GA 1A5MC 4J3WA 2EG8A 4C65A 2V5DA 3UJ2A 1V79A 2AL2A 1K8XA 3UGVA 1S2UA 1C8YA 2HEJA 4AD0A 3LYEA 5I3HA 1XD0A 2VZVA 4UNKA 2QV5A 5D05A 4HPXA 3LN3A 3F4CA 5IRPA 3NQ2A 1XDMA 2ATSA 4FLOA 3VNLA 2J27A 4JR5A 2CBUA 4HIBA 4AW7A 4PRWA 3DYOA 4X63A 2R1MA 2FPTA 1CGUA 3CEPA 2HPMA 4HHPA 1X8CA 1ZBCA 3LGDA 3VPLA 3BG3A 4Z1BA 4ZO8A 3DFOA 4X61A 4AWSA 3INPA 1NFGA 1ENUA 2BDQA 1JJKA 4KMQA 8CGTA 3RM8A 1GEQA 3BLPX 2R9RA 3ES7A 4RPPA 1E55A 3FAWA 4NSBA 2AAAA 3H4WA 1CGYA 4PUUA 1Z44A 2FLIA 3GHUA 1V93A 4H4IA 4S3EA 3AALA 5LIKX 2YXGA 3KP1A 3CB3A 3WK3A 4ZE5A 1VH7A 3HQNA 4AAJA 4HD5A 4ZO9A 3ZJ7A 5J8LA 3V0TA 1KXVA 4QCFA 1JCTA 1H50A 1ZAHA 2JKPA 1FH7A 4RZBA 4WD0A 4IGNA 3TQVA 3I6EA 4BI6A 1XXXA 5LNSA 3WD1A 7ODCA 2E5DA 3WF3A 3QYSA 1W2PA 2CBVA 3GSMA 3QR0A 2X7WA 4QLJA 3EPOA 3C2EA 4XSLA 4R53A 3BURA 4PBEA 1FQ0A 3A5VA 2WANA 1SUXA 2R94A 1BGGA 2NXHA 1GOWA 1DWIM 4JPGA 1TIWA 2VC7A 2CLOA 2D20A 4TX8A 4UTHA 4MTVA 3GNPA 4YCOA 3O15A 3O0FA 2OX1A 2YA1A 4CCCA 4PC8A 7REQA 2BHUA 1EGZA 3ZWSA 1H0IA 1LQ0A 2FJKA 2PDIA 4Q8QA 3L67A 1LBFA 2FZDA 4MWAD 5I0DA 3KVJA 1UUQA 4PTDA 4Q8WA 1WXYA 4IF2A 4LUTA 1A0CA 3S8HA 1M65A 1UG6A 5FESA 1QI2A 3PULA 4E6MA 1E6SM 3E1F1 1J4EA 3FSUA 4X22A 3N13A 1CXKA 4DJDA 1ME8A 4TVUA 3CEUA 1BSIA 2WHMA 1Z9AA 1NFBA 5CPLA 1VPQA 3T8LA 4DBDA 3BLIA 2Z7GA 1VRDA 5T91A 1J2BA 3F4NA 2VQTA 2FPVA 1RVGA 1F74A 1X98A 4AIEA 2DVTA 4MAZA 4UCGA 3LSCA 1BF2A 2G3MA 3GC5A 2PRHA 4Q33A 3W38A 2WLZA 2PDPA 3DECA 4RL3A 3T1GA 3W1UA 1MRAA 3FHQA 4P61A 2VFGA 4L6DA 3BOLA 3L66A 3CHFA 1XIJA 2XU2A 4RKAA 5AYZA 4CU6A 1SW3A 2X1SA 3Q37A 3W9ZA 3WF1A 1M5WA 3GQYA 1DXIA 1CLXA 2XSXA 2R14A 3G3DA 1H60A 4UFIA 2VQUA 2G3NA 3KDOA 1A50A 2YL6A 3IGUA 4ORIA 1VFMA 4KF1A 1R30A 4EPKA 4UFHA 2Y62A 2YZRA 1XYAA 3PSWA 1VENA 5AHNA 5H1WA 1Q6DA 1GOKA 4RCXA 1CEOA 1KQZA 4AXNA 1YTDA 1NIUA 3WK2A 4KS0A 3RCYA 5CAHA 1J0ZA 3GHTA 4ZQNA 3EDJA 1PTDA 2GJRA 3LM7A 3NL2A 3NOYA 1KM4A 3RMJA 4ZZ9A 2DIEA 3DYPA 3SY8A 3HB9A 4PMOA 2W61A 2IPWA 2Y8UA 4ZXOA 1WKFA 3H4GA 5C71A 1TQXA 1J12A 4E8DA 3AU6A 2DZAA 4RZ4A 4CNUA 3N25A 3L21A 2MNRA 3CC1A 1SPQA 3UR2A 3TQPA 3BOXA 4GISA 2R1PA 1HL9A 1W3LA 2WK2A 1GVIA 4KFOA 1UR1A 1XHGA 2Z2UA 1W17A 3WLRA 4PMYA 4QS5A 3W2JA 1Z89A 4RE0A 3NZQA 2G95A 4BF7A 2D23A 2B7PA 1MI3A 2XFFA 3G1YA 1A5CA 4NY2A 3KVMA 3ZMRA 1RQHA 5LIUX 1ZJAA 4UR9A 3WQWA 4QROA 3HFTA 4AY7A 4H19A 3STGA 4LUSB 4DAIA 2Y0FA 4G6CA 4IP7A 3NG3A 3CJPA 2A7PA 1KQYA 4Q4QA 3I4EA 5HR7A 3QPZA 4UNIA 1JUKA 4MZ1A 2VX6A 1OYBA 3EB4A 1K8YA 5FF4A 4LPCA 1KD0A 3WN6A 3T7VA 2ZVIA 3LPFA 2DSUA 2P8BA 3ZIZA 3HG3A 3GTXA 5DMNA 3CTTA 5E9XA 3VX0A 5H91A 3ZM8A 2QDGA 2WZIA 3W4RA 1B9ZA 3NDYA 3L5LA 3CH0A 2E9MA 2YPIA 2WNZA 2PWGA 2XGIA 4BF5A 5T26A 4KBXA 1FXPA 1RBOB 4UZUA 3L2LA 2Y88A 4GY7A 2VZUA 3B97A 3SADA 3NDOA 3KOWA 2XHYA 4R7OA 3T07A 4FR1A 3W01A 2CWXA 3H2OA 2DSKA 1ZLPA 2XSAA 3VI2A 1WDDA 2CZ5A 1UH3A 1TWZA 4MJMA 2A3BA 2WAGA 4CCEA 2V5BA 3EZ4A 1OX5A 5CC5A 3S83A 5H8PA 1XD1A 4D6HA 3PJXA 2G37A 3EBVA 2VTFA 2WVVB 4NI3A 1A49A 1UD2A 4RNFA 4D9PA 1NELA 2CZEA 3WFAA 2V5JA 1FKXA 4LVAA 4YU1A 1DHPA 2YDAA 1BEUA 4N2YA 2VX5A 2INZA 1JPHA 2WLYA 3DG7A 1FWSA 2DVUA 3KEHA 1TJ2A 2ZUNA 2WSRA 3BLDA 4MPKA 4LNCA 4JTKA 4EXBA 2HROA 4AFYA 2ZVRA 1ITXA 3D46A 4A3YA 1R46A 1TZ9A 3DI0A 3S1GA 3OZOA 2Q8LA 1CBGA 1ME7A 3GIPA 3IJ8A 3PY2A 1GUVA 1IQ8A 1FWFC 1W1TA 3TJIA 3GXFA 5AYIA 1UQYA 5DBTA 2YCEA 4K37A 5CPNA 5A8PA 1XLBA 4WSJA 3JU2A 1XV8A 4YIWA 3WJXA 4HNVA 5K4XA 1YXCA 1FXQA 4NJJA 3CU2A 3G77A 2WJZA 1W54A 1KC7A 3TAOA 3TA9A 3T81A 3KXQA 1TJ1A 1JXKA 3AQUA 3LBCA 4QIUA 3N2MA 3TQKA 3NO3A 2B7QA 4HHHA 3SCUA 4ROPA 2ESCA 3ARZA 5GNYA 1SFSA 4N9DA 3OW1A 4ML9A 4GNVA 1W6TA 3SCTA 3NPUA 4RXFA 1J5SA 1J8VA 3KS5A 4GACA 3U2ZA 4MFDA 1BG4A 2RGMA 1YADA 3I65A 4OOUA 5ABGA 1CXEA 4RR4A 3EKGA 3KWXA 1ICSA 1QNPA 2LLEA 1RHCA 1E6RA 1WV2A 3CZJA 4JKKA 2PI6A 5AZ0A 1GK8A 4HYRA 3S1VA 1PTGA 3Q45A 4KRZA 8RUCA 1IHIA 1EYWA 3UZYA 1BWVA 1E6XM 3TROA 2YYTA 1PX3A 1BXCA 1KLYA 3LTYA 3RIKA 3UWYA 3P81A 4PODA 1BD0A 1KBIA 2WXDM 2QCDB 3G2GA 2OTDA 1UWRA 3QYQA 4D8ZA 4MUPA 2WJDA 1V08A 1FOBA 1KTCA 4I5UA 2OKOA 5F1UA 1JGMA 3K2GA 4UOZA 1Q66A 3G5EA 2OYKA 4Q8VA 4K68A 5DQPA 3L4WA 3QRHA 3V0SA 1UOZA 2NQJA 2YXXA 3URQA 3U9IA 2HVOA 4GOAA 3KP0A 4PMVA 2OB3A 1EQPA 3GXNA 1A5NC 4XZ9A 1LG2A 3E38A 4M7SA 4HTBA 5CBBA 4MADA 2XGBA 3ZR6A 4HU8A 3DFYA 1J79A 4K8EA 1BF6A 5H8MA 1DXFA 1XICA 5FJJA 3UCQA 3XIMA 1JAEA 1RCXB 4Z2JA 3B9NA 4GRSA 3IAPA 1DJQA 4JKMA 4D8LA 3CUJA 3K4DA 3TP4A 1QAPA 3MW7A 2PP1A 3OGVA 3NUKA 4R7JA 5HQMA 3LMYA 2QJIA 5DXXA 5KZMA 4XBSA 1XSJA 3GTNA 3OA5A 3MV01 2WBKA 1T8XA 3NIYA 3B40A 5BXSA 2DZBA 5IHRA 1NOUA 4E2VA 1F3XA 1FVPA 1UCWA 1ZFJA 2Y89A 3SZ8A 4B5VA 3MSGA 3BE7A 3B9EA 5KITA 4RNJA 4W8LA 3HMJG 3RCNA 3PPGA 4LYQA 3WNNA 4R27A 2IW0A 2GL5A 4H6KA 1H1ZA 1O5RA 2PGFA 1KR1A 3WEZA 4A05A 2WC4A 3UXLA 1G9HA 1W3TA 2ALRA 2EG6A 2YA0A 1AD4A 4UOJA 4AF0B 1EA9C 3TDFA 2BP1A 3GU2A 4NZ4A 4PGLA 1GVQA 3W76A 2DH3A 4HMCA 3R10A 1IIHA 3BAIA 4QFUA 5GJMA 1PX4A 1QHZA 2J24A 2Z24A 1QW9A 3HG5A 1AFSA 2NX1A 3PK7A 1NF7A 4J5NA 4HNCA 2ZXDA 2VM8A 1JR1A 1EUAA 3L4YA 2Y7DA 3MCOA 1M41A 5GJPA 1KKRA 3NXFA 3G1AA 3CK5A 5CLWA 2OQYA 3TTOA 1XLFA 3DU0A 2VWSA 1FCUA 1CX9A 2C79A 3MCNA 3F2CA 1XGDA 4G8TA 1AQHA 2HDJA 5ABTA 4AZIA 5JBEA 3H53A 4JAWA 3QHNA 1LQ2A 1RD6A 4GQBA 3MA8A 1KRMA 3EEZA 5FACA 3J7HA 3MMDA 4DWSA 5ABFA 1XIDA 3UF9A 2XSBA 9CGTA 2P3ZA 2PZ0A 5FF3A 1F4HA 3PJTA 3PUEA 3EDKA 4DPPA 4K3ZA 4M5PA 4X2PA 1PZ2A 3PBUA 3U57A 3DOPA 1OFPA 3NXLA 4BCEA 1V7YA 4IG2B 4JNZA 1K7FA 3QOKA 3W2MA 1YNQA 4U5KA 4IJCA 3HGOA 1JDDA 4P8XA 1YDOA 4MMWA 2CIPA 1F3EA 2Z1WA 3W29A 3WLKX 1QOPA 3LTPA 4PCSA 5EFFA 2ONEA 1JGIA 3MKCA 3PBYA 3N9SA 2VR5A 4QS6A 4LS1A 4JX6A 3VXGA 2AMGA 1Q65A 1FWGC 1R8LA 3U4FA 3UR5A 3SFWA 4M24A 4OE7A 1U1HA 1DJWA 4LX4A 2PD9A 2DIJA 3G0UA 5EY5A 4TO8A 3RPDA 1W5MA 4JTRA 4MKVA 3AZRA 3VAVA 1EF3A 4XUGA 2BOGX 1LLOA 3DG3A 3LB0A 1FHDA 4ZVJA 4B4HA 1LOLA 2WB5A 3HJZA 5D9OA 3HURA 1P4CA 4FSAA 3KBVA 1AMKA 1Z32X 4I5XA 3BARA 3WBEA 1Q7QA 1D7FA 5D2YA 4W87A 2Z1KA 4G7EA 4IMAA 1Q2RA 2DZTA 2I1OA 2ZTKA 4UQEA 5I3JA 2WM1A 3F4WA 5K7JA 5EBUA 4LVDA 5BW6A 1QBAA 1J96A 1LL6A 3MYPA 1LTDA 1JUBA 4RK8A 3KTSA 3KVLA 3RU6A 4MWAC 3VGFA 3IK4A 1VJSA 1XPYA 3QEZA 3MUIA 3B9AA 2QUVA 1XIEA 2CKSA 3VKCA 6REQA 2NQZA 4V1XA 4F3HA 2BV9A 3H26A 5KINA 5K4ZA 3KX6A 3LCHA 4JICA 1SJDA 2OWCA 3K46A 1SO6A 4DO5A 3PBGA 1XLEA 3OOQA 1EOKA 3I4KA 4JN8A 5JBDA 4FLQA 1E9IA 1P1MA 1V4YA 4HK7A 1L0PA 4CEUC 5I79A 1JYVA 1EDQA 4JDYA 3TMLA 2G4JA 2G3IA 3UNTA 4IFKA 2IKGA 1XBYA 1D7KA 4BY3A 4WKHA 3CAVA 3GYEA 2WHKA 1SVDA 3TONA 3FN9A 3AZTA 1XR2A 2F8QA 1SO4A 1JCMP 2P0OA 1P6CA 2V2CA 3UT0A 3AISA 1K9TA 3LXAA 4JQ2A 2R91A 3PC0A 1HXJA 1BVZA 1S2AA 3P74A 1H11A 3EPMA 3OTRA 4Z0SA 2PCEA 1I9CB 3NQ6A 1B4KA 3O8AA 2A79A 1DJZA 1BG9A 4YWSA 1FWDC 3JZEA 4JTUA 1N55A 3CV6A 2YB1A 4HOXA 3RAOA 1Q6RA 1OFEA 3PSVA 3RRXA 3S6DA 1QPNA 3W7CA 3VINA 3W6YA 3M46A 4AEEA 3PVFA 4IIDA 2AL2B 3N11A 1H4PA 2QR6A 2OO6A 5AECA 4K36A 4AZCB 1LBMA 1QW7A 3EWBX 4CNPA 1J0HA 1XL9A 1HGWA 3GZ3A 3VD7A 4HPGA 2GVGA 3W7GA 4H83A 4LNYA 4BI5A 3CYVA 4S3KA 2JBMA 3AIEA 3FEQA 2V3FA 4JIIX 1RQEA 4JTGA 1V77A 1EO5A 4B91A 1XJBA 3QFEA 1FH8A 1BXNA 4C1NA 3HTWA 1G01A 1HTIA 3O9NA 3HF3A 1ZSXA 1UWAA 4REQB 4O1CA 2VJXA 5LHFA 3EWXA 1YE6A 5DMYA 2O55A 4MAVA 4AZ7A 4BQ2A 4B3ZA 1A5AA 2KZHA 3PAJA 3N4EA 2OVLA 1ZS2A 3WQEA 4D6CA 2UZ9A 2QHAA 4LAZA 3N4FA 1UB3A 2VZSA 4FI4A 4MLJA 3GFZA 3ARRA 1G6CA 4N0RA 2E3ZA 3PPFA 3SECA 4JIPA 4FZIA 4IL2A 1YBQA 3VGHA 1X7FA 4URIA 4QP0A 4AZHA 4XZIA 2F6KA 1P7TA 2A5HA 3HGRA 4HN8A 3DGRA 3KBSA 1XS2A 3VMOA 2XFWA 4EAYA 2FMOA 3W37A 1H63A 2QV4A 3LNPA 2DT2A 5L9FA 3VKAA 4CUCA 3P3BA 3CB8A 4IWWA 3VDBA 1F4AA 5A6JA 4PUDA 5CJ5A 2ZADA 1V8EA 4JTAA 3UG5A 1D3GA 2CWNA 2QLYA 4H2HA 3NQAA 5C0QA 1HG3A 2ZZ4A 1OB0A 3IV8A 5DCEA 2G96A 1MEWA 3OZPA 7REQB 5D04C 1QTWA 2I16A 1M3UA 4PCNA 4XZBA 3VA8A 2J7GA 3WH9A 5HINA 3UWEA 3P5ZA 3NPXA 3WL1A 5G4WA 4H9MA 3B0VC 4LUTB 5FL1A 3CAWA 1AK5A 3AXXA 2QJNA 3TK7A 3QGVA 3APGA 4LYPA 2YYUA 1T5AA 2YW4A 3K13A 4ADSA 2V63A 3W3OA 4CKQA 1WKYA 3S6TA 3U2EA 4GYFA 3TJLA 3UETA 1Y65A 1OVDA 3TTEA 4LS0A 2PU1A 3IIPA 5LNRA 5EMMA 5TIMA 3SGZA 1E0VA 2HPIA 1O6IA 1KTNA 3KCJA 1O95A 4AMAA 4EANA 2TODA 1EP1A 1V3LA 3GW3A 4WX2A 1OK6A 2EHHA 4N02A 1X1ZA 3AHXA 4MJZA 1EP2A 3OHIA 3KBNA 1TFVA 3ID7A 2B7OA 2YL8A 2ZA3A 1TWDA 2CLKA 5C9ZA 1SR9A 4FIRA 4CLMA 3GY1A 1EQCA 4DUWA 2OFJA 3F2BA 1W1PA 2I9UA 3TTSA 3C2OA 3ZO9A 1E6NA 4HU3A 4JFSA 3AMCA 3NQ8A 1SZFA 2ZUMA 3DKLA 1A4MA 2EGZA 4EE9A 3NJ3A 3HQOA 4F9DA 4MSSA 1Q3NA 2GSEA 4DI8A 2D2OA 1T6MA 4Y2WA 5I06A 4YN5A 3VMPA 1VIWA 3IRDA 4E2OA 3A5FA 4NAEA 1JCXA 4LVBA 4UUIA 3UWZA 5AC4A 5K9DA 3O63A 3H55A 3W7KA 1XYBA 4HA3A 2C71A 2B0MA 3F5KA 5BOFA 2BOFX 1NARA 1MVYA 3BW4A 3ZLFA 4OGZA 5AC7A 4BHYA 1R3VA 3L4VA 1OWQA 4JTDA 4AISA 5FJTA 1OC6A 1GW9A 1O7AA 4B2DA 4GFSA 4PTVA 3QR1A 1MZHA 3GDLA 3KUMA 4CQ9A 4MWAE 2NXIA 5LXEA 3NPWA 1A3HA 4JFWA 4MM1A 2EPKX 1GKQA 4DJED 1NEYA 4M6QA 2GUBA 2CLFA 4Y8EA 1L6FA 1G4PA 2PWEA 1G94A 3C3UA 4H6RA 3ZWTA 2PRLA 4JYFA 3PJWA 4GUFA 1CXIA 3W0KA 3VGEA 4HN4A 1PXGA 1VIZA 3JS3A 4N9BA 3DX5A 1FHLA 3PZOA 1F05A 3V36A 2YL9A 4QAWA 4HSHA 4C6JA 5FF2A 5DO8A 4XAPA 2PDUA 4C6QA 6TAAA 4TTUA 2GPTA 4QX4A 1M68A 3RR4A 3W1AA 3B8DA 4MFEA 1YXYA 1GGOA 2BGNE 6TIMA 1ZBWA 2PA6A 3USZA 4U4MA 3SJNA 2NUXA 4M29A 3QV9A 4ENLA 4GO8A 1PPIA 3MJYA 1B3XA 3UFYA 1X97A 4CQAA 3MO7A 1J10A 3MBFA 1LDCA 2QPUA 4O0KA 3O07A 4Q6JA 5BOOA 2ZTJA 2W66A 2PDKA 3PFMA 1XIIA 2AKMA 5HUPA 5BMWA 3BLKA 3ERPA 4LOCA 3M0LA 1TA3B 2NSOA 2OCZA 3FDGA 4QLLA 2PDWA 3E49A 1YNPA 5AHEA 3VIKA 3LSBA 1OGSA 3W1TA 4X0NA 2RFGA 4GJ1A 1XYMA 3VDCA 4DYEA 2V9DA 4HYVA 2Y1HA 2NX3A 4ZA0A 2J79A 1A4LA 1DP0A 4DF1A 4PMRA 1PE1A 5DCDA 5DFAA 1DJGA 2G97A 1V6WA 2PC4A 3SCWA 3E2QA 2YBVA 3URNA 3P7YA 1SO3A 4H9ZA 4A2RA 1JCJA 3RO8A 1VCGA 3W1MA 2YDQA 3OG3A 4C6LA 2OEMA 3V0UA 1X1OA 5A1AA 1GOMA 1NDWA 2W5FA 3CQKA 3E12A 2ABAA 4PFMA 2VFIA 4HU0A 2OLHA 1IWPA 4HT3A 4F9JA 1K4HA 3VZXA 4MVAA 3CTLA 2YCJA 3GXIA 2BTMA 2ZIDA 4W4QA 1UOKA 1OY0A 2QDHA 4MLRA 5CLTA 2TRSA 1TPVA 2C15A 7ENLA 1KGWA 4WKFA 4UFMA 2EJAA 3BVJA 3SO7A 5CG0A 3PF3A 4YNGA 3WLSA 3W86A 3ME3A 2VUYA 2XINA 3RLUA 2HRWA 4LEFA 2DZVA 1OBAA 1YDYA 1I2RA 3C0JA 3WLOA 3D6NA 2XVPA 2Y61A 1RCOB 1M7XA 1F8MA 2YDRA 2EG7A 3PWGA 5I3GA 2J66A 6CGTA 4PN2A 3RGTA 4RV3A 1OT1A 1DJHA 3WDHA 1EWEA 2XDFA 5T9BG 1KXQA 3SJ3A 4FO4A 5C7VA 2VWTA 1OFRA 2Z28A 1TMQA 4FEZA 3LNMA 1XLJA 4Z17A 3TWBA 1TVLA 1F6YA 1U5HA 3PZIA 4NNAA 2OSYA 4GIYA 1TTJA 4CVUA 1R86A 4BFAA 4EXQA 3FVMA 2JEQA 2C8NA 2WYSA 4YMZA 1FBAA 1V0NA 2JF7A 4AIBA 1FWHC 1WB0A 3L12A 2GDVA 2A3AA 2DZXA 3AIRA 1KTBA 4IQLA 4GINA 3LTSA 4I8DA 1QNRA 1XKJA 3P62A 1VLIA 1M7OA 3O2LA 2QAPA 1XLCA 4NX5A 4O11A 3DHDA 4FB7A 3GG0A 2X30A 5A2BA 4X2RA 2W63A 1EH9A 5CC7A 1W9BM 1FWEC 3MMTA 4US5D 5EKYA 3ITCA 5CH9A 4Z2GA 3QW3A 1Q13A 4H04A 4MJ2A 3VNMA 4WKAA 1W0MA 1OFDA 2YX0A 1KFWA 2PS2A 1A5LC 3ZSSA 3SRFA 4C7FA 4XB3A 2NUWA 4DF2A 2J9ZA 1V6TA 3RPTA 3IGSA 3PTQA 1PSCA 2VO5A 1POJA 2QAFA 1SZEA 1J0JA 4LBSA 3R13A 2AL1A 1A80A 3MSRA 2VNCA 1GYLA 1HKWA 2J62A 2J13A 1DVJA 3UJFA 3KFTA 3UZXA 1JPMA 4I7VA 3TYZA 2QCFA 4NNCA 1H5YA 4MDOA 1JF6A 3GO2A 5G1MA 1BVWA 2VKZG 1K70A 1SZNA 1EEPA 1FWIC 2VP8A 4ZSUA 2GDUA 3TIMA 3VNIA 1I2QA 1X6NA 3MS8A 4KCWA 3VO0A 3K4AA 2J6XA 4XTDA 2FFIA 5CSUA 3SN0A 3DN5A 4WR3A 2OOFA 5B7YA 3M16A 1N8WA 4GHRA 1MXSA 4DM2A 4TV6A 5B80A 3SRDA 3BW3A 5E0FA 4Q4OA 1XI3A 4IMGA 3H2AA 1GOIA 2A3EA 2ZQ0A 4N4PA 1EBHA 4YWIA 2ZUTA 3QM3A 1UC4A 2QJHA 3UWQA 4AVOA 2GJXA 3DFHA 3CUZA 4QGCA 5BZAA 2OQLA 3U2OA 3M6DA 1TTPA 2V0TA 2DT1A 1NY1A 2WVSA 4ATWA 4G2DA 4S3JA 1XM3A 1IEXA 5TAOA 3CPRA 4LB4A 4P7OA 1YPIA 4MUZA 4OUIA 4H3DA 3GRIA 1XCWA 3IJ9A 4MYAA 3UXKA 4F2TA 1TV4A 3JW7A 1S38A 3CV1A 2DW7A 5EMUA 1XDJA 3VIOA 3EKLA 2HNHA 4LUYA 3O7UA 1DIOA 3IJLA 4WJEA 4MG4A 5BU9A 2WCSA 4TUFA 1JDEA 1CB7B 1ZJBA 3RFAA 4KERA 4TQTA 3QFWA 5AOUA 4JOMA 3VOFA 4L9YA 3WLMA 3AZSA 3GXPA 1SJAA 2Q6ZA 2F61A 4YHGA 1ZJIA 2D0FA 2PEVA 2VELA 1RCQA 2CLEA 5A6SA 2HXTA 4HZ6A 4FNQA 3WLPA 1TPFA 1A0DA 2CZDA 2E0PA 1UPPA 1M04A 2XIOA 1O5XA 2CETA 2BVTA 2VHLA 4PTWA 2FTYA 4O53A 3N4AA 5D37A 1OK4A 3BG9A 4GJIA 4HNTA 2FB2A 3GE7A 2BNJA 3PFRA 2PDFA 5G4HC 3ARUA 1C3FA 4WCJA 2PLJA 4DWSB 5ABFB 5LXXA 3WLLA 3FFSA 1CECA 2ZE0A 3EEGA 3GTFA 4JTIA 4RDYA 1VYPX 4ZQRA 2QF7A 1ODUA 1QOQA 4C6FA 3UXAA 3ANYA 5MF5A 4A3HA 3DC0A 2GZXA 1U83A 1SFTA 3SB0A 4L4MA 3VX1A 3CUIA 4H2CA 1P0BA 4MPQA 4HK6A 1SFJA 2ZA1A 1RY8A 1Z6KA 5FI8A 4XAGA 4KCUA 4NYUA 2C14A 4FOKA 1RAKA 1XLKA 3ARPA 4UQAA 1ITQA 4X3ZA 2ZC8A 3S5SA 2WCAA 4PB4A 1L6SA 1W3KA 4E8CA 3WD3A 1EGMA 3I3DA 5J5DA 5U7SA 2CKRA 2EPLX 1IIGA 4UMAA 3WNKA 1NWSA 1Y7VA 3L0KA 3PG9A 4QNWA 4ZOCA 3H12A 4CNNA 2ZUUA 1WPCA 2J7DA 1B54A 5F2LA 3MBDA 4UMCA 1V0KA 4C91A 2VC6A 3E96A 2TYSA 3RX2A 2PLMA 2J9YA 3VGBA 4EX4A 1PWMA 1UROA 1VJIA 1D9EA 3M5VA 5BXPA 2PB1A 2PODA 2ISSA 2UBPC 1M53A 2BY0A 4IIBA 6XIAA 5XINA 3NGFA 5DT5A 4F0LA 1K6AA 2PDYA 3URAA 3GNOA 1JQVA 1VKFA 2QCMA 4M81A 2VEGA 3KW3A 4G7EB 4C6EA 3ABRA 2QUMA 2VEMA 2ALDA 4QJ4B 2O7QA 3B4UA 5HANA 3F5LA 5CSYA 4QHRA 1ZJHA 5D2WA 4H8UA 3QKZA 2XTKA 1Q8JA 2ZRXA 2L5HA 2E6DA 4BEUA 3O6CA 3G6LA 4ZGYA 1FRBA 1XBZA 3E5PA 2CZVA 3WBXA 1E0XA 2E1DA 2QDDA 1QO2A 5CPMA 4G56A 4RW3A 3WDQA 2CLHA 2DSZA 6REQB 3R12A 1R9XA 5DEZA 2PDNA 2ZOXA 4MB5A 5BRBA 2CXEA 5DCBA 4NP7A 1GZGA 3UQNA 1ZZMA 1ADSA 3VKDA 4U10A 3VABA 1TUFA 1HJVA 1SFLA 3H2EA 5AC5A 4XKYA 1MW1A 2RHGA 3GWQA 3E5BA 1WOAA 5A6AA 2OEJA 3EOSA 4QISA 4LC8A 1LLWA 1BYBA 2QUUA 4IFKB 4GI8A 1NOWA 4G7FA 3BUVA 2QCHA 3UR8A 4DLFA 1MNZA 1ZAIA 1UKQA 1YDNA 1DWHM 3HPXA 1K02A 1EHAA 1UWUA 3TOYA 2VZTA 3WUFA 3TCEA 2ANUA 3M0KA 4KQNA 4J35A 4K7VA 3QQ0A 2VOMA 3H7UA 4PE8A 5G4EA 3NWRA 3E9AA 3FSTA 4UFKA 3UY8A 1N8IA 3DFNA 1TWIA 3CUXA 3SUWA 3N19B 1GT8A 1HJXA 1PBGA 3C86A 1MXGA 4RW5A 2Z0IA 3KHDA 4H9UA 4V27A 4X0VA 4CCDA 1C8XA 3N04A 4XWUA 3WDIA 4M6UA 1VJZA 3IARA 3R58A 3LHTA 3QSTA 2ZX5A 2DZPA 2V5KA 3KOYA 3N2CA 5EMLA 3E2SA 2GOKA 4J40A 1RLCL 3QGAC 1ZENA 2DJLA 2YL5A 1XFCA 3Q58A 5JBFA 5LIYX 3RDKA 2VT0A 3CIXA 4ZXLA 3WEOA 3ECQA 3CMGA 3TN5A 2CW6A 3PS7A 4BQ3A 3IIOA 3LHVA 2J7CA 2ZXBA 1V5XA 4JTTA 4FPSA 1IZJA 2Z26A 1PJ9A 1GKPA 4Z1YA 1Z41A 1KFKA 4X9YA 4HU4A 1F6KA 4WGXA 3MUXA 4B90A 5KZDA 4DJEC 4WQ6A 2IPGA 3UWUA 1H62A 3W82A 1LRNA 4M6VA 4BR1A 3I7RA 1TPEA 2FZBA 1W1YA 4PMQA 1ONEA 2FZMA 2ZRVA 3F4DA 3R79A 5HMEA 3TW6A 1UHVA 4AXKA 2H90A 1YBQB 2X1RA 4MHBA 1O1ZA 3M4HA 2Y6ZA 5A69A 2PP0A 5A5WA 3S3GA 1P7TB 3GNNA 4LVGA 3GXTA 2QCGA 2PRMA 1KBBA 1TJPA 4KIEA 1GQLA 1LL7A 3CM4A 1CW2A 3MDWA 3PUDA 4AX7A 4AIUA 3H24A 3B3DA 2V5LA 3TC7A 1C9WA 5J04A 3RPMA 4OV9A 1X6LA 3UGRA 3RXZA 2YB4A 3L4XA 1UD3A 2WVVA 3TSBA 4QDPA 4XAFA 4O8RA 3FA3A 1ECEA 1F9CA 3T4CA 2QJGA 3ITVA 4CCZA 4TTGA 2PURA 2YZ5A 3NEVA 1GPWA 1OQFA 3TEVA 3PBVA 1X39A 4E4PA 5D2VA 4LCSA 4DN1A 2DQXA 2XG9A 3WX7A 1S5MA 1MW3A 3AFBA 5DMMA 1UD4A 1ZTVA 1I4NA 3SSZA 4F2BA 1X7IA 4FF5A 2RH9A 4XO7A 3GUWA 4U33A 1M03A 3RK8A 4ZQCA 3GVWA 1OABA 3BLEA 1R3SA 3O06A 4A8NA 3WQPA 3FEMA 4POCA 1FDJA 2P76A 2DZUA 1GQKA 2IQDA 2Y7FA 3NQEA 2C91A 3LM3A 3WSUA 4DB7A 2ZRZA 1S1PA 1UZDA 3CMJA 3DERA 3C2YA 3VD3A 1F73A 4BI7A 5FJRA 2XVKA 1QNSA 3SRKA 1WDSA 3MVIA 3N9KA 2RJHA 1MUMA 2BY3A 1PHWA 4D6JA 4CD4A 1SJBA 3VDHA 4CQDA 1Q2SA 3GR7A 3MMWA 1K9FA 4IX0A 3WH6A 2XYLA 2XVNA 3S5OA 4HMDA 1GVFA 5C9XA 1Q63A 4ZTYA 2PMQA 2POZA 5ABHA 3T78A 3LGEA 3VIIA 4UTWC 4KKXA 1G4EA 1OGBA 3N2TA 3LY0A 1E6PA 1AODA 1IEWA 2HVNA 3PNZA 3VIFA 3QZEA 1RA0A 3WF4A 1RP8A 2ISFA 1B57A 4CQCA 4HKPA 3II1A 2DGAA 4LGXA 4NAEB 1HL8A 4O4WA 2PGEA 4Q32A 1JCNA 3NQBA 1UBSA 4FXJA 2QCLA 3S1XA 2QCDA 2ACQA 3LV6A 4FMVA 5G2HA 1GHSA 3TSDA 1T41A 1CPUA 3MO4A 5BRPA 2QIIA 3CYJA 3TSMA 3VZYA 1ELSA 3I10A 1UP3A 3N6QA 2RDTA 4PUKA 2HCVA 1NJJA 2FJUB 2BVYA 4PCPA 1HKJA 3VIGA 2VYOA 3Q94A 3C2RA 2D2JA 3VDGA 3EA2A 3NQMA 3TYEA 4DBUA 2ON3A 4N6EA 2HBVA 2PWFA 4UTLA 4FK9A 1XUZA 1RV8A 4JTCA 1PDZA 3E0LA 1XYZA 1Y5VA 1E4NA 1ADOA 1M6JA 2D24A 2FYMA 4LAOA 2Z7KA 1JNEA 3ITGA 2FZNA 1SM9A 3COTA 4YTTA 3DCPA 1NVMA 2YCLB 2XVLA 2RAGA 3CWNA 3HGSA 1H7OA 4HCHA 4DUVA 2TAAA 2HXUA 4E4UA 1UWTA 3CHEA 3MJMA 1UC5A 1GVOA 4H8HA 4WDUA 5FJOA 4S3BA 3GTHA 4PMNA 3H70A 1W1B1 3V5OA 4JD4A 3DC8A 3LLFA 3W24A 4XZMX 2C13A 1OG6A 1T7LA 2VL4A 3SCOA 4J3SA 3EWCA 3AS1A 3JUGA 4UQ9A 1O68A 4ZMGA 2RKXA 3AYTA 3AWNA 2CXGA 3O3RA 1ODZA 3SIZA 1EDTA 2DW6A 1TPDA 4M8UA 3RHGA 2QW5A 4I6KA 1QHOA 3CIWA 3CT2A 4MKNA 4KESA 4NYYA 3SGUA 4DNMA 4GUJA 1VEOA 3NDZA 1OYCA 5EMKA 5FKYA 3AYVA 5HWMA 5EPDA 3THAA 3K8LA 2C19A 3F4VA 2VGIA 3UJRA 5G1YA 4M19A 1FWRA 1AQMA 3N2BA 3V75A 3MCMA 2A2IA 2BBFA 2UY3A 2O4MA 3WLJA 1BRLA 1RJRA 3AIBA 3ARWA 3B8VA 1Y5WA 1OIFA 1MQPA 5EU9A 2NXGA 4DJDD 1BSLA 3EPNA 4FX7A 4S3FA 5KEZA 3FAXA 2Z00A 1LBLA 1QRQA 4Q4MA 5DANA 3VKBA 3FJ6A 1A47A 3W22A 3GU1A 3MTWA 1CT5A 4PTXA 3RMEA 2OSWA 4MDPA 2BGQA 3WH7A 5D2XA 2PTYA 1AZ1A 1QPOA 1JPIA 4QCEA 3M0VA 5LA1A 4UBPC 1ZB5A 2XFRA 1OJXA 1JZ3A 3OA3A 1Q85A 1RY0A 3B8WA 3CIVA 1D3CA 3W2LA 1Q7ZA 4OZOA 4NZJA 2R1KA 4XBJA 4AZGA 1UYQA 4ZB2A 1A53A 1KNWA 1VR6A 5F1VA 4JCLA 5IDIA 4HK5A 3A47A 4Y6GA 2I7GA 2ZUVA 4XG1A 3TE9A 2NVAA 1FWWA 4ZQMA 3TYDA 1IR1A 3WLHA 5CBIA 1JD9A 4M51A 3TZFA 3TC6A 3PUOA 4O0QA 5M17A 1WDWA 3TJXA 1PIGA 2OSXA 4EIVA 1F76A 3ZJKA 3EXTA 1XBXA 2D2GA 4TX9A 2VGGA 4PL2A 4AX6A 2VDHA 3T42A 1QOXA 4HSOA 3LRMA 4O1FA 2CBIA 1QUMA 4FNUA 3G6MA 2FTWA 5M2FX 4IT1A 2WZMA 3QV7A 4EK7A 4P7QA 2ZZ7A 3OIHA 3OLDA 5EMYA 4AH7A 1KM6A 4XD4A 3W7RA 1R47A 3VFLA 1GJUA 2QDEA 2VCAA 4EF8A 3IGHX 2YSWA 3NQ7A 1PL9A 1HX0A 3N3TA 1T99A 1R2TA 2DIKA 5F2IA 2BVWA 3TC3A 3T55A 1UWQA 3TV8A 3TCSA 1DWAM 5FIPA 2BLEA 1EXBA 4GNJA 5U4NA 2WC7A 4PB3A 3L9CA 2NQLA 1US3A 2XUCA 5FL0A 2PPGA 3S2LA 1JZ6A 3QPEA 2O0TA 3MUAA 1QBBA 2QCNA 1NM9A 4BWLC 4H1ZA 4CNSA 8TIMA 1EC9A 3CT7A 2XISA 3VU2A 4C60A 2W0UA 2OLSA 4QG9A 4ZE4A 1BTCA 2C0HA 1JCLA 4WK9A 4CD5A 3LCIA 4PL1A 1XF0A 4GQ0A 2PDGA 1XGZA 1CDGA 1GOXA 1OF8A 5CJMA 2HK0A 4XVEA 4PUMA 3THCA 2ACRA 2Y70A 4B3LA 2VRJA 3FIGA 3STEA 2R8WA 3QTGA 1KBJA 3LENA 1UP2A 4F0RA 1J5TA 3CHCA 4G9PA 5CSSA 4XQ6A 3SEPA 1GZ1A 4MB4A 3BAKA 3ZVHA 5BROA 2ZICA 3IJDA 2E77A 1Y0EA 3QMRA 3G1VA 4IFOA 4L6OA 3MUZ1 4NASA 1TVNA 3QH2A 4UTKA 5HQLA 1K77A 3TW7A 3RLHA 3L0GA 1EPXA 1SSGA 5GNXA 2F9RA 2GJXB 4K2SA 3DAQA 1K7EA 1E5JA 1GPFA 4PMXA 5EMJA 3TA6A 4BA0A 3M0IA 1JFXA 3R8HA 1QWKA 1GVSA 1OC5A 2E4TA 3CO4A 3FCPA 3NSNA 4ZFMA 3MC5A 5D32A 3R2GA 1XG4A 3KRUA 2WKJA 1YIXA 4AEFA 4A3RA 4AZCA 2XM1A 3TZNA 4DO6A 1EJWC 1FWTA 3W75A 4ZQOA 1V02A 1EEXA 4OQVA 3BAXA 2ZZ3A 3IV3A 4XX6A 3BH4A 1ITCA 1XINA 3GVRA 1BPLB 4UWMA 1AL8A 4HMNA 4K6AA 3E0WA 5HWNA 4REQA 5I23A 1UQZA 4O1AA 1PUDA 1LG1A 3ARSA 2G8ZA 3BQ5A 4ATDA 4A8LA 1NFPA 5E70A 4D6GA 3R8GA 4NZ1A 3PB2A 1C91A 2HE8A 3IK2A 3OBAA 3SW6A 2EPNA 2QUTA 4DNHA 2J7EA 1W9DM 1OX4B 3RITA 4GK8A 5G5IA 1YXDA 3PPHA 1J0YA 1SO5A 2CHNA 1R3WA 4ZB0A 4JTFA 2PWVA 1UD6A 2PCQA 1YYAA 3T2PA 3ARXA 2G50A 2QNEA 1I2PA 4PEEA 4XD5A 1C8VA 3HMCA 5REQB 4GMEA 2EBNA 4FLSA 1VGAA 5IDZA 1GG0A 1RZMA 2ZWZA 4QITA 2HK1A 3A4JA 2WSQA 2XGZA 3RM4A 3NM3A 4UMBA 1VYRA 4IQDA 5E6YA 3FA4A 4UFLA 3VIPA 3KRSA 3PBWA 4GZEA 1TZ7A 1H61A 2QGHA 1XDLA 2XIMA 4HNLA 2Q09A 3M0YA 2YOCA 2J7HA 3DFTA 3P8IA 1GHRA 2VRQA 4CNOA 1CB2A 3RR1A 4B3KA 3V3WA 2C1HA 2QCEA 3PZMA 2AGKA 4M7TA 1UWSA 1TUXA 2JK2A 4RZ5A 1AJ2A 1KLZA 1VCFA 3CUGA 3TN3A 3CL6A 2NV1A 2QJMA 3C52A 4GD0A 4B16A 5TD4A 1VFOA 4JIQA 3T0BA 3GH7A 4ONVA 1IT0A 1MFUA 1T40A 4C6BA 3E3HA 1MDLA 2GVEA 1UKSA 3HG4A 1SMAA 3FDKA 1EC7A 4OOZA 2QGYA 3M5XA 3KCOA 2P88A 3OU8A 3CHVA 3KWSA 1HW6A 3TTQA 2PTWA 1ZP4A 2XN1A 3ICJA 5CEWA 4Q4SA 1J01A 3HOJA 3A9BA 3HV9A 1JAKA 2Y24A 3HPZA 5BOEA 5E9AA 2Q8XA 3VUSA 3KZPA 1IGWA 3GBEA 3IJ7A 1QASA 5C9UA 2IQ0A 2NLIA 2DUAA 2WMIA 4QEHA 1HF6A 5K9XA 1TTIA 3AO0A 3F5JA 5FSDC 3B0PA 4RV8A 1KXHA 1W91A