1YDYA

Crystal structure of periplasmic glycerophosphodiester phosphodiesterase from escherichia coli
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
328
structure length
328
Chain Sequence
NEKIVIAHRGASGYLPEHTLPAKAMAYAQGADYLEQDLVMTKDDNLVVLHDHYLDRVTDVADRFPDRARKDGRYYAIDFTLDEIKSLKFTEGFDIENGKKVQTYPGRFPMGKSDFRVHTFEEEIEFVQGLNHSTGKNIGIYPEIKAPWFHHQEGKDIAAKTLEVLKKYGYTGKDDKVYLQCFDADELKRIKNELEPKMGMELNLVQLIAYTDWNETQQKQPDGSWVNYNYDWMFKPGAMKQVAEYADGIGPDYHMLIEETSQPGNIKLTGMVQDAQQNKLVVHPYTVRSDKLPEYTPDVNQLYDALYNKAGVNGLFTDFPDKAVKFLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycerophosphoryl diester phosphodiesterase
publication title Crystal structure of periplasmic glycerophosphodiester phosphodiesterase from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 127
structure length 328
sequence length 328
chains with identical sequence B
ec nomenclature ec 3.1.4.46: Glycerophosphodiester phosphodiesterase.
pdb deposition date 2004-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 1ydyA00
4S3GA 4QJ4B 3EA2A 3NO3A 3QR0A 1GYMA 4I90A 4OECA 1T6MA 4Q6XA 3OHMB 3QR1A 3I10A 3V1HA 3CH0A 3RLHA 3H4XA 4F2TA 2F9RA 2O55A 1DJWA 1YDYA 4RV3A 4F2BA 1DJXA 2PZ0A 2PLCA 1O1ZA 1DJHA 2FJUB 3KS5A 3PTDA 2ZKMX 1AODA 4RW3A 1DJYA 2OTDA 1XX1A 1ZCCA 4I9MA 1DJIA 3KS6A 1PTGA 4QJ3B 3L12A 3V18A 3QVQA 2ISDA 4QJ5B 1VD6A 1DJZA 7PTDA 5PTDA 5T9BG 2P76A 2OOGA 3EA3A 4R7OA 1V8EA 3MZ2A 4RW5A 1QATA 1PTDA 4I9TA 3RLGA 5T91A 1DJGA 2OR2A 4I8YA 4GNKB 1T8QA 3V16A 1QASA 2PTDA 3EA1A 6PTDA 5T9CE 4I9JA 3H4WA 4F2UA 4PTDA
chains in the Genus database with same CATH superfamily
3M64A 1H7OA 3ITYA 1EH9A 3VIGA 3HBLA 3HTWA 4KGJA 1CLXA 1OINA 3KBNA 4HB7A 4NZCA 5AYIA 5G2HA 1YTKA 2KZHA 4N7QA 1OCJA 3A5VA 3AO0A 3WK2A 1K8XA 4MB4A 4F0HA 4WQ6A 1A3HA 3IRDA 4X9SA 3W6LA 1JXKA 2PGWA 3EX1A 3GX9A 4UMBA 2B7QA 5EFFA 5KEZA 4OOZA 4UFHA 2IMRA 3TN3A 3U48A 3OG3A 1QVBA 2FDMA 1I1XA 3BGGA 3F7JA 1QHZA 3OZOA 3W88A 3E2QA 1FWIC 3SBFA 2CLHA 3ONCA 4JKMA 3P14A 1EL3A 3L2IA 4QG9A 3GHSA 5BXTA 3SCSA 4DZIA 2FVMA 1BGAA 2Y24A 4BF9A 3NWRA 3HJZA 4HHHA 1XBZA 3MY9A 3TR9A 7A3HA 4NUWA 1FWRA 1VEMA 2IPJA 3RCMA 3AHVA 5EBAA 1IV8A 4QTGA 4JCMA 3GHRA 4IIBA 2X16A 3TW7A 3LHTA 1UWUA 1I9CB 4H1ZA 2YPIA 4GXWA 5D37A 2Y7FA 3ARZA 1GORA 1KO0A 4MKSA 5EMYA 1QAPA 5D9OA 4E4PA 1EIBA 3DI1A 3PPHA 4FR1A 3MDUA 1WE5A 4JTDA 5K7JA 2INFA 5IBXA 3RIKA 2PDGA 3VIKA 3N2XA 3G0SA 3TE9A 4W84A 4MY9A 3VNKA 1E6SM 3EXTA 2VR5A 3EAUA 2PDFA 3C3NA 1I75A 3A3XA 3MJYA 7REQA 4RX0A 1UASA 4B5SA 4L4OA 4GFSA 5HNNA 4C7FA 2YB1A 1UMLA 4XG1A 4HOXA 2VI0A 5CZSA 3QGAC 5LXEA 4H83A 3GYEA 3IGHX 3I3DA 7ODCA 4KW2A 4I9MA 4JIQA 3ZMRA 3LHVA 4QJ3B 2UY5A 3DHDA 3K30A 1RBLA 4CU6A 2Y8KA 3GG7A 4C65A 2G5WA 4AZ6A 2PTYA 3PWGA 3RYSA 3QQ1A 4BEUA 1CW2A 1EGZA 1PTAA 3W1MA 2ISWA 3TXZA 1I8JA 1V0NA 3ALGA 2OT1A 4Y7EA 3WJWA 3C8FA 3WK0A 3SURA 4GRSA 4MYXA 2Y89A 4A3HA 3CWHA 1X7IA 4CUCA 2Z6JA 4U28A 1XBXA 4URIA 2C8NA 3L4YA 4J3XA 3FY1A 1NFGA 4NX0A 2OQYA 3RMJA 2Y70A 3OA5A 3OODA 2H9AA 2A7RA 3EPOA 4D8LA 2EG6A 4RZBA 3TV8A 1L8NA 3VNYA 5BW6A 1NSJA 3E49A 5CJ5A 2J25A 2YYTA 4PYSA 4A6GA 1FHVA 3ARVA 1TTIA 2GVLA 3THAA 1XIEA 3W2JA 2G50A 4AD0A 2FFCA 2ZQ0A 1XX1A 4IGNA 4AXNA 2CBIA 4XV0A 3G0XA 1EO7A 1YW1A 4PUEA 2CLPA 1C90A 1RD5A 1RPXA 3B8WA 3ARPA 1RUSA 1VBJA 3W2MA 2X0SA 2QDGA 4IJCA 3GKAA 5F2MA 4IIFA 4M6VA 3WNOA 1NARA 3MMDA 2P3ZA 4CEXC 3LYEA 3NDOA 3BLIA 5I07A 1EEPA 3BOXA 2WK2A 1VIZA 3IVTA 3F2CA 3S1VA 3GZAA 1WBJA 1YMYA 1ICPA 4PMQA 4EXAA 3CB3A 4O0KA 2CERA 1Q3NA 1RVKA 5KZDA 4GI9A 4FLQA 4HJWA 3STCA 5BMXA 4YTRA 2ADAA 1KC7A 4ERGA 4HMEA 3UZWA 4IJRA 1J6OA 2ZX7A 1TJ2A 3N2BA 3H2CA 1QHPA 3GNOA 3LK6A 1ODUA 2E40A 3NGFA 4PUNA 1KGWA 1L2UA 1PIFA 3W7IA 2PE4A 4GD0A 3RM8A 2A3CA 3LUTA 4S3BA 1EA0A 1OT1A 4F8XA 2WMFA 3TLLA 3W22A 4EXQA 2PCQA 2BVYA 1XLCA 3FLUA 5DY3A 4PTMA 2WQDA 4RNFA 4KEVA 3INPA 1J93A 1IEWA 3PTQA 5DRIA 1UA3A 2J6XA 1QNQA 3NL5A 2C7FA 4ZOAA 4WJXA 4C6FA 1RA0A 1VBGA 3VGHA 5FF2A 2IXVA 1JPDX 1Z69A 3EWWA 1R7AA 4B4FA 4ES4A 1PXGA 4X63A 5CZ0A 3AC0A 4UOQA 4DO5A 4A21A 5D2VA 4FPSA 3LNPA 2YA0A 3LEPA 3TQPA 2HXTA 1UWTA 2WC4A 2V5DA 2PZNA 2DU2A 4KCVA 1H62A 2BS9A 2P0IA 2QT3A 1I4NA 4ASTA 2YB4A 2OLSA 3EB4A 1BXBA 1FY6A 4M7SA 5I3DA 3B9OA 3CMFA 2H3BA 3R8HA 4D6GA 4HMCA 4TX9A 3EXRA 4CNTA 2GOKA 1C8QA 3O05A 3UXLA 2XIMA 5HDRA 2W6RA 3W84A 2R1LA 4JY9A 3FEQA 5I3IA 1S1RA 3R89A 3ZWSA 4AWUA 1OF8A 1GNXA 1KQZA 1AVAA 3ZZ1A 5HJYA 3QFEA 1TVLA 3SDOA 3PS7A 1GW1A 1QFEA 3G22A 1XIBA 4PCTA 2ISSA 4IQJA 3AMKA 4AF0B 3NXFA 4EWJA 3IJ7A 2IUZA 4MADA 1GCYA 8RUCA 3ITTA 2ACSA 5CKSA 3KLLA 1H5VA 5TBOA 1TPUA 3PULA 1GOXA 1XINA 4R27A 3LM7A 3NQCA 3GWQA 3VVGA 4JY8A 4ICMA 3TC6A 1KFLA 4WF7A 3S83A 3O06A 1RVGA 3EDFA 4NJGA 5AY7A 2FZMA 1M68A 5CSYA 2V69A 5FD0A 1DWAM 5LNVA 5I03A 3M0IA 3QRHA 4QLJA 4H7ZA 4H8VA 1WYIA 2WZHA 4HTBA 5AHLA 1XYCA 3WLJA 4F0LA 4U31A 3BG9A 1VHCA 2VCCA 1GEHA 4MNKA 3LBCA 2MNRA 1W2PA 3K4WA 5D33A 4CD5A 3BMVA 2YJQA 2P8BA 1AW2A 2O9TA 3VD9A 2VEGA 2VX7A 3OEXA 4ZTXA 4XVEA 3AWNA 3G6LA 1QOPA 4KT2A 1H09A 2A6LA 3GG0A 5JBFA 4IIHA 1H1YA 2VDHA 3ZXWA 4FNTA 1DJWA 2TAAA 3C4UA 1W3KA 5FIPA 1UUMA 1UC5A 2CBUA 4DBWA 3AMLA 4XTIA 4J7RA 3SZ8A 4FLOA 3R4IA 5I2UA 3AZSA 4MHBA 1MSSA 3ATZA 1WV2A 4C1KA 4MNMA 2D0GA 4ZGYA 5C54A 5AKQA 3VAVA 2YBUA 3N14A 3VC6A 2G0WA 3DFNA 4A4AA 2KAUC 3CEUA 1EJ7L 3F4CA 3WNPA 1Q6DA 4WSJA 1A5CA 4GO8A 4G8TA 1UH2A 1TB3A 3GNNA 1PSCA 4FF5A 3SRHA 5LHFA 4LW7A 1YNPA 4J4KA 1ZAHA 4HK5A 4MPQA 2ZVIA 1G4PA 1R3VA 4YU1A 1XYFA 1CGWA 3M7SA 4S3FA 3DFYA 4NILA 3WJXA 3STPA 3E1F1 3TZFA 2HVNA 5CBIA 1JVNA 3QLDA 1THFD 1J0YA 4LNYA 2XSBA 3W7JA 4PMJA 2EG8A 3DFQA 4LAKA 4YCPA 4Q8UA 3GXDA 3P8JA 3TAOA 3G1XA 1MNZA 4CD8A 3WDPP 2YBVA 3O7UA 4GOAA 1XQLA 3GB6A 4GGBA 4O10A 2PUZA 2OVLA 1FDYA 3NQBA 3MSGA 2AAAA 1BYDA 4OBSA 3OLIA 1B4KA 1VFLA 2PDMA 4LV9A 2E09A 5HBFA 1SZFA 3WDJA 4ECLA 1SJBA 4GY1A 3T2OA 1Q2SA 4TV6A 4C6MA 3DYPA 3RUBL 1TR1A 5DCEA 2XFYA 2GGEA 1O94A 2WVVA 1R3TA 3PAJA 4ROPA 3TAKA 5H8UA 5CG7A 2OZ3A 4CKQA 2VJXA 1NP0A 4IM4A 5H1WA 1IWBA 3UEQA 3IIZA 2Q3OA 1H7RA 3KBMA 1I1WA 4Q4SA 1UKTA 4QEHA 1ZLPA 4ZQCA 3ARQA 3GE7A 4HHPA 4LV4A 2RDXA 1TZZA 4NXKA 1POKA 1MUMA 3VU2A 2V2CA 3STGA 3T2PA 1WKEA 3CT7A 5ABFB 1C93A 4XZNX 2YCEA 1EUNA 1QNVA 4UNKA 2ANUA 2WPBA 4GNKB 3KWXA 4XBJA 3NOYA 3WK1A 3L4UA 3HGRA 2GUUA 2WV8A 3VNIA 4A8LA 1TPEA 3G1VA 1WZAA 3FS2A 3PN8A 4XZWA 3L4TA 3MA8A 2WCSA 2VEIA 3AISA 1PAMA 3VOJA 3VD7A 3VNZA 3I3EA 4KETA 4KPLA 4POCA 5ABTA 3PG8A 1ALDA 1KBKA 1G5AA 2QULA 1A0CA 3PHAA 1EFZA 3E12A 5E6ZA 1ZBWA 2P3EA 1K7XA 1XPYA 3ENLA 3A4XA 3NVDA 3KW3A 2GSEA 2BB0A 1B31A 2GYIA 2VX5A 5C2GA 1MQRA 3IJQA 3HPAA 4CD7A 2E9BA 2EAWA 4P8WA 4UTIA 3M0VA 3W2LA 4QBXA 2HWGA 2DJXA 4K8HA 3CU2A 2DVUA 3FDKA 3TYDA 2BGNE 4UTJA 3PP7A 1JZ6A 1XDJA 3QQ0A 2WZEA 3NSXA 5A2CA 3O9NA 2FMNA 6REQA 3WQ4A 1EPXA 2DUAA 5DELA 1QW8A 5JUVA 1JGMA 2ZOXA 1UMYA 1RV8A 1GZJA 2NV9A 4K37A 1RSCA 1HVXA 3CPGA 1OSEA 3GC2A 3S5OA 4UFIA 2QLYA 4A3UA 3UWUA 2WYSA 4M51A 2WBGA 3ZS4A 3SUWA 1R3RA 1SO6A 3ZT7A 2OLHA 3JZUA 1QW9A 4YYCA 3W85A 2GOUA 1C7TA 4C1NB 1GQIA 2QUMA 3N4FA 4H9UA 3WF0A 2VEKA 3E0WA 5CG0A 4BQ2A 1J96A 2QJMA 1K6AA 2HVOA 1AQ0A 3T8LA 3UZZA 1XYZA 5CBBA 4L56A 3KL3A 5D2XA 3OVPA 5D9MA 3EWZA 4KIEA 3CUZA 4ZB5A 3KLKA 2E67A 2JF7A 1RCQA 3NQ6A 2XVKA 1AMYA 2Z25A 1YDNA 4RZ5A 1X1ZA 2DZSA 3K46A 3PBMA 4C7GA 3R11A 4FX6M 4N9EA 4XD5A 6A3HA 4NASA 3OQ8A 2BNJA 1JDAA 3N12A 1OGGA 4G56A 2FTWA 1GTHA 4JTGA 1NIUA 3BAIA 3SY1A 1KW1A 4GY0A 4PEKA 4UMCA 4O17A 3V18A 3ZM8A 4DLFA 4F0SA 5J04A 2ZUUA 3NEHA 5TQLA 2E25A 3W72A 2OSXA 2R8WA 4ACYA 2VVNA 2WHMA 3IEBA 1SSDA 1LOQA 3AJXA 3NSMA 2EG7A 3CAQA 4MLRA 3B40A 3TFCA 4A8NA 4XX6A 1Q8AA 3W73A 3HB9A 2Z27A 1HN1A 4MVAA 4MJ2A 3V0SA 2J6VA 3H4WA 3T0DA 1NQKA 4WY0A 1AW5A 2NSOA 3SGUA 1PBGA 2AAMA 2QCMA 1BRLA 2QCNA 3UJEA 4QJ4B 2HNEA 3WBXA 3DKJA 1JCYA 2F2KA 1N8IA 1GZ1A 3CS2A 1FHDA 2GZXA 4UTKA 3M9YA 4OE7A 4NAFA 2IKJA 4CEUC 2GLKA 4BQ3A 3VCCA 3SCOA 1J5SA 1R9XA 1CECA 1SPQA 4YVVA 1IR2A 3TYCA 2ICSA 1UWSA 3VKDA 4NG3A 1EJVC 1IR1A 1UQYA 3GHTA 4HJFA 3GW3A 4G5DA 2PDYA 2EGZA 4O57A 2XISA 4ZQOA 2NUXA 4M56A 3HPZA 1UB3A 3N3TA 2VZTA 2R82A 1U1JA 1E40A 4J3WA 4PMDA 4Z1DA 2V30A 4O14A 2QJIA 2HISA 1Y5VA 4RKAA 2VXNA 4QDMA 1DJZA 1H7WA 3LPPA 1AMKA 3UJRA 4XZHA 1JZ2A 4H7VA 1E1FA 3DOPA 1XG3A 3PZOA 1XLBA 5C7HA 2PRMA 2I9UA 2FZNA 1JCLA 3TUUA 1A0EA 2HE8A 2H8XA 2R1KA 1VJSA 4UZUA 4A3QA 4FO4A 1AH4A 3N4EA 4ZFMA 1H60A 2PDIA 1ZL1A 1AH0A 1WUEA 4YYFA 5EBUA 1UH3A 3MBDA 3CO8A 3LPOA 1OFBA 4V28A 3WF2A 2CITA 1F9CA 4FXSA 4FOKA 4HNCA 3M0LA 2YDRA 1E9ZB 1UR3M 4Q8PA 3QV7A 4HZMA 4Y9PA 5DT5A 4OV9A 1Y5WA 1Y5XA 3BOFA 4GI8A 2DIKA 3EOUA 3A47A 4LUTB 1SW0A 3B9AA 4CVUA 1E0TA 1N55A 4DHGA 4P8XA 4LJ3A 3PFRA 4FF7A 1QPRA 2RHGA 2NQHA 4ZB2A 3SN4A 4BWLC 2NVDA 5AYYA 4Z2HA 2XN2A 1FWHC 3O63A 3HG4A 4GACA 3TTOA 2QDEA 4OTKA 2VZOA 4K68A 1JL8A 3PPCA 5MF5A 2CIPA 1VCFA 1SJAA 4AG0A 4AZ7A 4REQB 1VD6A 5CAKA 4OU1A 1R6WA 1UBSA 5C9ZA 4O4VA 3W28A 1IT0A 1VFFA 2DT0A 1IXQA 2EJ1A 2VENA 3DYOA 3APTA 3FGCB 1SMDA 1O7AA 3ABSA 1JCNA 2XIJA 2CC0A 3RAOA 1XH0A 3EWUA 3UXIA 3EGJA 3N25A 4C91A 4QAIA 3VYLA 2VOMA 4Q32A 1TG7A 3WBEA 4GCXA 1GVRA 4TVUA 4MFEA 3MQTA 4LANA 4D2JA 4UOZA 1OEPA 4ADUA 3AS0A 2QUNA 1W91A 1TPDA 5A3HA 4HA0A 4MNJA 5HR7A 4HCDA 1PZ0A 1KXHA 2IQ0A 3R58A 3IJ6A 2YIHA 2WVUA 4PCNA 4L1WA 5REQB 1XLGA 1MUWA 1LOLA 1IQ8A 3CH0A 3QGVA 4UQDA 1C8YA 2GSHA 2OZ0A 2V9DA 3CZGA 3HPSA 3MCNA 1XH2A 1NDVA 3UZYA 3W25A 1PL9A 4JN7A 1EOMA 1DIDA 2ABBA 3CQJA 4D8AA 3UG3A 1BF6A 4AIUA 2CHRA 4PTXA 3C61A 1TQJA 4U33A 5CCZA 2EO7A 2ZRZA 3LLDA 2I57A 1QNSA 1JCTA 4FAMA 4JKKA 1EJRC 1XLIA 3M43A 3TU9A 1CB2A 2XFRA 2Y85A 4MMWA 5KZMA 2OT0A 3O0FA 4Q8QA 4AY1A 4GUGA 3ID7A 5IHSA 2AL2B 3W01A 2J7HA 4UWMA 3DFTA 1W3TA 1EHAA 3FJ4A 1QASA 4N9DA 4AYSA 3UGVA 3PBGA 4PUMA 1XIFA 3TX9A 1DYSA 3B4YA 3MB9A 4KERA 4PTDA 3CMJA 4FA3A 3MC5A 3LA4A 1TPB1 3OZPA 1GT8A 3V5FA 4XD3A 3N15A 3WQEA 3BANA 3ALFA 3KP1A 1YBQB 1JPHA 2J74A 3P3BA 3VDHA 3W7NA 3EKZA 4AD5A 3RLHA 3M46A 2V3EA 2YGYA 4L65A 2WSQA 3K8MA 1MW1A 1AUSL 4QJ1A 2JIWA 3BURA 3IAPA 4BWLA 1W1ZA 3T55A 3H26A 1ZCOA 5DBUA 3DYMA 3LOTA 4PB3A 2C91A 5BRPA 3URNA 3EEZA 3RFAA 1F76A 2F2HA 3OZYA 3GNPA 2G3FA 1XLJA 4GWEA 4FLRA 3CQIA 3RPDA 4A05A 4A35A 1C29A 2J7DA 4ZENA 4QDWA 4QE5A 1TCDA 5HWMA 1UZ1A 2B7PA 1HVQA 3CK5A 1KBLA 1WQ5A 4RDZA 4QHRA 2WVTA 3MANA 3I4EA 1XYLA 4ORIA 1MVYA 1PVNA 3MWAA 5G5IA 5GNYA 5D4YA 4LTSA 3MDWA 3QM3A 7CGTA 3W7CA 1HT6A 4UQAA 3E96A 1WP6A 4BI5A 1XIMA 2WMKA 2YCLB 5DY2A 2I14A 3G1FA 4K7VA 5CSRA 4DEFA 1MO0A 5DN1A 3GDRA 3ZIZA 1BHGA 3IVUA 3IJLA 4NP7A 2R24A 2ACQA 2POTA 2Y88A 3RO8A 3W70A 4A29A 3THUA 3A3HA 1W31A 1RY8A 3W7MA 1M04A 2VQUA 4YTSA 3ABOA 1E1CA 2B7NA 1DXEA 3N13A 3Q65A 2Z00A 4AIBA 1LL7A 4JQ4A 3UCCA 1B4EA 3DHFA 3NXLA 2XSAA 3HQOA 2NVAA 5A95A 4GUJA 1FFRA 5KZ6A 3BLLA 1ICSA 1LL6A 4JQAA 3EPMA 3WYZA 1TYGA 1R2TA 2PS2A 4D1JA 3T0AA 1X39A 4O19A 1JIBA 2CU0A 4GZ7A 3KVMA 1T96A 4PODA 3ATYA 3WQ6A 2DV0A 2E8YA 2D73A 2DP3A 1KGUA 1LM1A 2AQOA 2JKEA 2XIBA 3NJ3A 4JL1A 3GDLA 4FOUA 1GKPA 1XRFA 1XRTA 2FZDA 1C9DA 1JQVA 1NP2A 3L2MA 1JFXA 4ZQPA 2YLLA 1W17A 9XIAA 2VEPA 4YXGA 4GZIA 3GTIA 2CEQA 2FLIA 2I5GA 2BV9A 1A4MA 3JZEA 4DY1A 4D6JA 4Y96A 2W5FA 2PA6A 3OQEA 4PCSA 2OWWA 4IZGA 2DZTA 4GUHA 3EWCA 4XQ6A 4DELA 1W37A 1BD0A 1UWRA 3FCPA 3C2RA 3QMSA 3K8LA 2XVLA 4CQAA 3QOKA 1MDRA 4FZIA 1M7OA 4XUYA 3A4AA 4J2MA 1H0GA 1SZRA 4KWWA 3BZJA 3BL3A 4R7WA 5LIUX 1V3LA 2IKHA 1IZKA 3B04A 3PBYA 1I45A 3ZSSA 1WO2A 4IMEA 2D3LA 3GK0A 5A6JA 3VABA 2QQ6A 2VZUA 2XH7A 4FNSA 3NDZA 3IJ9A 1W0MA 2GDQA 3QYQA 4AB4A 9CGTA 2GK1A 5G1YA 4HNVA 2OB3A 1EEXA 5AHEA 3NQ7A 2REQB 1AQMA 4DI9A 3LRLA 1NU5A 1H0IA 2OJPA 3LNMA 4UQBA 3REQB 3VUPA 5K9XA 2DW7A 1PWMA 3MUAA 2Z1BA 3B0YA 2CKSA 2XIIA 1WX0A 5LA2A 5TAOA 4TVCA 2ZYFA 1PX8A 3FJLA 4YJ5A 3RDKA 1HJUA 1V08A 2WNWA 2RKXA 1JPKA 3AMGA 1Q65A 2OOGA 2IPWA 1YQ2A 1E4LA 1SSGA 5E5CA 5EY5A 2WNQA 3S0CA 2PWVA 2F6XA 3W7KA 1LLZA 1RCXB 9RUBA 2Y7DA 4NF7A 1HKWA 1ICQA 1W5NA 1PHQA 3HPXA 4YTUA 3ZR6A 1TV5A 1H5YA 3IGXA 3AWOA 4OUIA 1EWDA 2ZWZA 2JEQA 4R34A 2I1OA 3LHYA 4L6HA 3FDGA 3UA4A 2OZTA 3G3DA 1BAGA 2DW6A 3UJ2A 2VFIA 4ZA0A 1M53A 3RILA 1EJTC 4L6OA 3EOSA 1G69A 4WOQA 4D72A 1WZMA 2VYOA 2YCIX 1UR8A 1W8SA 2DPEA 1PZ2A 3FKRA 3LMZA 3WH5A 3WLTA 1YDYA 1Z6KA 3WF4A 1XBYA 4F0RA 1TJPA 1ZGDA 2OYLA 1P6BA 1PKNA 1LTDA 4MY1A 2DZWA 1UUQA 5IDZA 5A8GA 2QPSA 3GXFA 4LVAA 2WHLA 3L67A 4FXRA 3RJXA 2RJHA 3G18A 3H8AA 1XJBA 3WLNA 3SCQA 3EOLA 3R1ZA 2QVHA 3RF9A 1OIFA 1YX1A 3N2TA 4WR3A 1XICA 2VCAA 4G1KA 1BF2A 1UOZA 4ZQNA 2F61A 4RE4A 2DSZA 1Q2RA 4ZVJA 2V6AA 3WG6A 4MF4A 5K4ZA 3T2QA 5A2AA 5HANA 3UF9A 3DX5A 3KBJA 1SO4A 3E74A 3FFSA 3CV7A 3O2LA 2QUUA 3BGJA 1G7VA 5F4WA 1REQB 4C6BA 5BRQA 1TPWA 2XZ7A 3BAYA 4DM2A 3HM7A 3W24A 4XD6A 2H90A 2D22A 4D6CA 1KKOA 3C2OA 3D3FA 4WLCA 1D7FA 3QR3A 4I5UA 5D30A 3S1GA 1Q6RA 4P7NA 3TCSA 3FXGA 4CQ9A 1NF0A 1XLLA 3NL6A 2OFJA 3A4JA 1TV8A 2V3GA 5FF3A 3ZVHB 2GL5A 4JTCA 4AFYA 4JIRA 1TVPA 3BH4A 3IVSA 2GVGA 4WXZA 4QLLA 3B4UA 2QCCA 1YHTA 1FHUA 3IUDA 1JYXA 2J4GA 3OGRA 2AMXA 3HG3A 3GLCA 4LXFA 4US6A 4D9PA 1QUMA 3IK4A 3T42A 1XC6A 3N2CA 1KV5A 3N6QA 3KE0A 3PTKA 1JI1A 2Z1WA 3E5BA 4QG8A 2NWSA 3W7LA 3WK3A 1FFQA 3BW3A 2DFAA 1UKSA 4DQWA 3DI0A 4PMUA 3D5HA 4ACZA 1FCBA 4Y9NA 3C5QA 2D24A 4FS9A 1G67A 3F1QA 3BQ6A 3VKAA 3F4VA 5A6MA 3EDJA 1PIIA 2Z6IA 5CJNA 1UKPA 5T9BG 1DWIM 4Q4QA 5FEWA 1KWKA 5C71A 1QI3A 3WQWA 1W5OA 1UQZA 3R94A 4HA3A 5HAOA 2NT0A 2PDXA 1ZY9A 4H9MA 2QCEA 5FESA 1WB0A 4K1WA 2VEMA 2D0HA 1NAL1 4WOZA 4W88A 1ZNNA 2PP1A 2DZBA 4PE8A 4Q4MA 5JVLA 1VCGA 2VFGA 1H63A 2JEPA 1PCKA 2XDFA 1X98A 1W6TA 4HT3A 4KEUA 3L0KA 4XAGA 4NVTA 1ESWA 4UNLA 3LHZA 4IP4A 3JUGA 3NUKA 2FHCA 4CU8A 2OODA 3T0TA 1W8GA 4JTTA 4Y9AA 3WFAA 4XVDA 1LWHA 4B90A 4HPJA 4DRSA 4W87A 1QNRA 1X7FA 4CGTA 2J77A 3ICJA 3G3MA 1WA3A 1N7KA 5A2BA 4TUFA 3OJGA 4W89A 4US5D 3HU7A 2ZFAA 2QJGA 2GQ8A 3O0KA 1AG1O 4JFSA 2WCGA 1QI2A 4O1BA 3RCNA 2ISFA 1JZ7A 1UR4A 1MZHA 5H8MA 3BJTA 3O3RA 4R5EA 4MM1A 4W5UA 4PTWA 3L23A 1ENUA 3ZLFA 4Z0SA 3VD4A 2HEJA 4QEEA 4S3JA 3G1SA 3GU2A 5F4SA 5G2WA 4DYEA 1XSIA 4IQDA 3NDYA 1IIGA 3P84A 1SQ7A 1LLWA 1PPIA 4HCHA 3FHQA 1KTNA 1IHIA 4Q6JA 4C6KA 5CPQA 1B57A 1XLHA 3AYSA 3NQAA 4IPLA 4JICA 4S3GA 3VM7A 1R5YA 1JPIA 3RX4A 1W1TA 1EX5A 1TWZA 3EYPA 4WIWA 4W4QA 5HULA 2VC6A 4OGZA 1NFBA 3GR7A 5I77A 1E6NA 3T0BA 3B3DA 4L4PA 3IACA 3RLUA 1V4YA 3CUGA 4IWWA 2CLIA 3ES8A 3AMCA 1EXBA 1EXPA 3QSTA 1IE7C 2G8ZA 2P8CA 2NX3A 2QKFA 5A8MA 1OX4A 2WXDM 4DJFD 3DBPA 4RJEA 1V7AA 3HV8A 1Q6QA 1QW7A 4I9AA 3RO6A 3U4FA 1FTXA 2OPJA 3ZQ9A 2Z7GA 1TJRA 4LUIA 1IZJA 3W75A 1SGJA 3I7SA 3B0UX 1LQ0A 2A7NA 1DXIA 5LSMA 2J7BA 4PFMA 4HSOA 3P61A 1WUFA 4D6HA 1OYCA 3NG3A 1WAWA 1XLFA 5GJMA 3EBVA 3ME3A 3W71A 1QT1A 4QG6A 1V6YA 4TTGA 3JRKA 5HK4A 6TAAA 4CNUA 3M5ZA 2PU1A 3IK2A 3MO4A 3A13A 4S3AA 5LNRA 3U9IA 1IGWA 1LORA 1EF2A 4ZCWA 1S2CA 2J62A 2ZBTA 4ALDA 3PBVA 1QWKA 2DZXA 1GYMA 3LQLA 4JBRA 5LHEA 3RM9A 2RGLA 2J27A 3V5OA 2CHNA 2NV2A 4IFKB 5CBJA 1ISVA 1E6RA 4B5UA 1VYSX 4NL1A 1PKYA 2IQDA 4GYKA 5D32A 4IT1A 4XZLX 2R1MA 1XV8A 1ZP3A 3LI0A 5GVJA 1W1PA 1XR2A 4DJEC 4F2BA 1GW9A 3GKFA 3QGKC 3FEMA 1KM3A 1L6SA 2PDLA 4WZHA 2WW5A 1EP2A 1LP6A 3GTNA 4N42A 4B5TA 3LHUA 2VUYA 4J3TA 4ZMGA 4KRUA 2PDCA 4MZ8A 1TUXA 3UETA 3OP2A 2ISDA 3KL0A 3WCZA 1UYQA 3N9SA 4HCLA 2Y8UA 4JHMA 3USBA 4AC1X 3W1QA 3L9CA 2X30A 4R9XA 1D8CA 1AL8A 1QR7A 1VH7A 4ML4A 4DN1A 1F3EA 5DT7A 4CQDA 3TSMA 5BNKA 5CPOA 5CLWA 3NQEA 3V4BA 1DE6A 2X7VA 3T09A 3VUSA 2DIEA 1QDSA 4C6JA 3CL7A 2VTFA 3VOGA 1YDOA 3W02A 1HUVA 4CQCA 1J2WA 1H1NA 1EA9C 4CCZA 5A6SA 2ZXQA 4OJYA 1VFMA 1J9YA 5AHIA 4BY3A 4GQBA 3OGVA 2C1GA 3W7RA 2AQWA 4IMGA 1E43A 1TPFA 2VUNA 4U4MA 1G4EA 1QI0A 1V3JA 5C2CA 1KLYA 4Z42C 2RAGA 4KWVA 5H2ZA 3C2EA 1GEQA 3NZ1A 4QP0A 1CENA 2PLCA 3SN1A 4BJHA 5I6SA 1MEWA 1Q63A 3NQDA 4IH3A 4MAZA 4I6KA 3AIBA 5FEPA 3NZRA 3S2LA 5DF0A 5U4NA 2YDSA 4QS5A 3CUJA 1Q45A 2QIWA 1NEYA 1PDZA 2V38A 3CWOX 4F40A 4L64A 1QOXA 2DJLA 1YEYA 2WZMA 5AN7A 3S1WA 4HVXA 1V02A 3D6NA 4QIUA 4RK8A 3KOXA 3POHA 3SFWA 1BVNP 1D3GA 3VIMA 1JR1A 1VEOA 4UFKA 4WDTA 2ZRVA 4GMEA 3VIOA 2E3ZA 3SSZA 1JI2A 4BK9A 4MB3A 1EBHA 4WUIA 3WLQA 3ONBA 2C18A 4YNGA 4IFRA 3W2UA 3NQFA 1H61A 2QCDB 3U7VA 1H7PA 3U2ZA 3AROA 3QV6A 1R86A 3IPWA 1D7KA 4JIHA 4O1FA 1DPMA 3WMSA 2EEXA 1M3UA 1NELA 3ZLHA 1Q6FA 5FJIA 2PRHA 2BOGX 2Y8VA 1VBHA 3BVJA 3E0VA 1CZ1A 2NQJA 4EE9A 4XIMA 2EJAA 1RBAA 1MNSA 1XD0A 2X2GA 4QFUA 2OX4A 3G8RA 1ME8A 1CEOA 1J01A 1UP0A 1UKOA 4DJEA 1XUZA 2JKAA 3UD6A 1BWLA 3KTSA 5FJTA 2O4QA 4OV4A 2DT3A 4LFYA 2Z29A 1ISZA 3HGOA 3BAWA 5E0CA 3MI6A 3PVFA 4NT0A 3E3HA 4LBUA 3RX3A 1I0BA 2FPVA 3M07A 3H2MA 1RR2A 1Z9AA 3U0HA 4JTQA 3GBEA 5I3FA 4HU0A 5JMUA 3AHYA 2QR6A 4DUVA 3WJZA 2HBXA 4GVFA 2OKTA 3BAXA 2V63A 3TFXA 4D6FA 1BTMA 1ZJAA 5FF7A 4B15A 3TMLA 2XU2A 1IGSA 4CNNA 1X38A 2CNCA 4P8UA 4MZ1A 1UWQA 4GE8A 2EPNA 3GR8A 4GC3A 1I2QA 3AS3A 4D6DA 1GJPA 3GXMA 1T5AA 1ITQA 3GH7A 2QPUA 4FXJA 1A49A 4MTVA 3NGJA 4E3TA 3SR7A 3ZT6A 2XTKA 1MUCA 3QN3A 2X0HA 4GYFA 1KRMA 1CLVA 4CNPA 1HL2A 3THQA 3BARA 3UERA 4G1NA 1XKYA 1YNYA 2O55A 3ERPA 3CLWA 3G1DA 1I2NA 1VS1A 3S5NA 1ITXA 4CU7A 5AC4A 2E6FA 3STEA 2XGBA 3O6DA 1EGMA 7REQB 1ZAIA 3SUSA 4R3UA 3S2MA 2DY3A 3IJIA 1I2PA 5DXXA 3CPRA 1TTPA 5BXPA 1CXKA 3EKGA 2OMAA 2UZ9A 4Z1BA 3KRUA 3QJAA 1KM5A 3RITA 4J40A 3R79A 3KBSA 5A8QA 3TYBA 2PWDA 1EJXC 2D20A 3SCRA 5MKGA 5E9XA 4C6DA 1BYCA 1JDEA 3M16A 3SSJA 3MSDA 5LA1A 4HKPA 1E6XM 3PNZA 2ALDA 4E6MA 2IKIA 2WANA 2YDAA 4DO6A 1LDCA 3H2FA 3EA1A 4H3DA 4E2OA 4O11A 4XTDA 1S5WA 2FH8A 2PDWA 1W9VA 3M5XA 3VGGA 6TIMA 3TN6A 2GWNA 1XIJA 4J3UA 2OEKA 2ZTJA 3B0PA 1UH4A 4FP1A 1X1NA 3EX3A 4F3HA 7ENLA 1RAKA 1KFWA 1J0KA 5HQMA 5MHBA 3W7HA 2B4GA 1EDQA 4HK6A 1ADOA 5EFDA 5DCBA 4PMRA 4PRRA 1LYXA 2H9AB 3LPFA 5CPSA 2XFFA 4UTWC 1IZCA 2PZ0A 4W7VA 5KITA 3V0UA 3W7DA 4DNHA 1A3WA 3UJSA 1HKKA 3UR2A 6XIMA 1C9WA 4BCEA 3WD0A 4HOWA 9XIMA 2E68A 1HP5A 3AHXA 3FK4A 1EYEA 4Z2LA 1TE1A 5DFAA 3DC8A 5D04C 5TD4A 4TO8A 4U2YA 2J9YA 4LVBA 1I2OA 4QE1A 1Q85A 1GG1A 3E5PA 4PB5A 5AFDA 3W38A 4OKDA 2PBOA 2FVLA 2O92A 3MTWA 4UBPC 4O1DA 1EC7A 2FPYA 4O18A 1KCKA 3TSDA 2OO0A 3LCHA 2VZSA 4RV8A 4GKTA 1EP1A 1RCOB 4WKAA 5EMUA 3N18A 4Z17A 3DFHA 1A5NC 2G4FA 3QMRA 3OVQA 2WQPA 1RK5A 4DYKA 1UJPA 5CGTA 4JFVA 5F1UA 3GIYA 2CXEA 4IIDA 2FQIA 1AQFA 2D1ZA 3CL6A 4X0NA 3VX0A 5F4XA 1VB9A 3F2DA 1UPMB 4JYFA 2PFHA 4XK2A 3T4WA 3ABQA 4BA0A 1X1OA 3NZQA 3VNJA 3W53A 4EOUA 1KCZA 3CNYA 4K3ZA 3UWZA 2Q8ZA 1DJHA 2FJUB 3DU0A 1UP3A 3LRKA 2HVMA 1JZ4A 2WSYA 1XL9A 1DJQA 3TEVA 3WQFA 1V6WA 4V1XA 4UFJA 2TRSA 3L0GA 1KTBA 4IMAA 4B2DD 5A6BA 3CHVA 1HXJA 5I24A 2BBFA 4S3KA 4MWAD 3T4CA 1XYBA 1VBRA 1Y8BA 3AS2A 3SM0A 4MUPA 4O1EA 5BWAA 4K1GA 4ZO7A 1OYBA 1SMAA 1XYMA 2Z0IA 2NX1A 3DENA 3ZJ7A 1Z44A 2D2JA 1K03A 1UBPC 4F79A 1M6JA 4ATDA 3W1PA 1NDZA 3QTGA 3R7MA 3GG8A 3VOCA 1TIMA 3WDIA 4U2ZA 2FVKA 2VFDA 1Z3NA 5EA9A 1NOWA 4F0KA 4WKHA 3ZFHA 1E5NA 4Q4KA 1PV8A 5A6KA 1WDSA 1FQ0A 5E6YA 4NXSA 3VOFA 2VR4A 1TE6A 3NTYA 2CLOA 4UTWA 3PUDA 4WGXA 4A2RA 3PZTA 4W86A 4NU7A 1CXEA 1L9WA 1L6GA 3W3OA 2HK0A 1F74A 2O0TA 1RY0A 4W9TA 3PB0A 4RZ6A 5A1AA 2QV5A 5TIMA 1EQPA 1T41A 1W9XA 4RZ4A 4DBEA 4AIOA 3MI2A 4DXKA 2A3HA 1C92A 3L4WA 4NAEA 4UFMA 3WDQA 4LYKA 4JDYA 1S39A 3CUXA 4Z2IA 1J18A 3V7PA 1V8EA 4UFLA 2YR1A 3DAQA 3NQGA 4F9JA 5FI8A 5IBXC 3B06A 3VZXA 3OPSA 4IP7A 2R94A 1Z41A 5I3KA 3LTSA 3UY7A 4M80A 2PTDA 3C0JA 1C91A 1TJ1A 2BVDA 2TODA 3M1ZA 1EJSC 2ESCA 2IW0A 3CZLA 4JKLA 3VIJA 1OCBA 3SCNA 1KCXA 4JR5A 3OYXA 1LWIA 2NLIA 2EBNA 3VGBA 4M6UA 4DWSC 3KVJA 1H4PA 2YX0A 3G2GA 1PO9A 2W92A 2Y6ZA 3LLXA 3QLLA 4QR6A 4YWIA 1EJWC 3WX7A 4AD2A 3KRBA 3VPLA 5IM51 5E93A 4MWAC 2ZZ5A 1DWHM 1K77A 2XPKA 4K39A 1KV8A 5DLCA 1DJXA 1W5MA 3BICA 3I4KA 5CC5A 3WEZA 3GO2A 3R2GA 1ZJBA 4GYJA 1WBHA 4QNWA 2DDXA 2QEZA 4UIOA 3AYRA 2W27A 4RCXA 1RJQA 5CSSA 1YPXA 5EMLA 1VQTA 4YPJA 3PWIA 2XM1A 3TYZA 3DZ1A 3NM1A 3BAKA 3M6DA 1BGGA 4WCJA 1XBVA 1AZ1A 1CIUA 4BHYA 4S38A 4B16A 2YL8A 3LCIA 1QMLA 3IIPA 1EQCA 1XXXA 2PLKA 3IJDA 4AX7A 3EMCA 4NZJA 2QCFA 3CZ8A 3ZR4A 2FGBA 4OHQA 3WQ8A 1CBGA 3MHFA 3MU7A 1MW2A 3BJSA 3UNDA 1NOFA 2VRQA 4Y2WA 4AU0A 5H6HA 3VDBA 1P0EA 3H6OA 3CB8A 5HR6A 5LKYA 2CFFA 3URAA 4IUGA 1A80A 1G4SA 3EDDA 4GGHA 1OVDA 3MUZ1 4HMDA 5GJPA 3PZ9A 3DEQA 4GIEA 1PUDA 2ZA1A 3CV1A 3EA2A 1KCLA 1GZGA 3UGRA 3OVGA 4EPKA 3ZLGA 1BKSA 1QNOA 2HJPA 4HD5A 1O68A 1MQPA 2INEA 1PCWA 2RFGA 2BLEA 3UXDA 3NR0A 2PDHA 5J8LA 5HOSA 3B8TA 3WJYA 3PBWA 3WLIA 2FMOA 1K02A 3VDAA 1OK6A 1LZOA 4LS2A 3ISIX 4UTMA 2J8FA 1IEQA 1ML1A 3GBDA 3CXOA 4HSNA 2P88A 1TJ0A 1GVFA 3N1AA 4WVXA 4AWTA 3V35A 3F5LA 1J11A 2WVVB 4FLSA 1E70M 3JS3A 1UR9A 3NM3A 4H9XA 3AZRA 4BF7A 1MFVA 4KIRA 1SYTA 3BO9A 1E51A 1FWGC 3KRZA 1OX5A 3O6CA 3BSHA 2QJJA 2YCKX 2BXYA 5KZEA 1O66A 3MWCA 8XIAA 1ONEA 4G7EA 1U5JA 3VM5A 4QAWA 4YIWA 1SW3A 4FIQA 3MKVA 2WC3A 4Q4PA 1RJPA 5B80A 1G1YA 4DAFA 4JTUA 3S2CA 4D8ZA 4DWSA 3U6WA 4IQLA 2GVJA 2DGAA 1YRRA 3BCJA 3XINA 2WWCA 3H53A 2NW0A 3UQNA 4QITA 1ODZA 4IUOA 5DO8A 4UNIA 3V1HA 4HYWA 4MWAA 1ZBCA 1YDVA 1F3XA 4LRSA 4AD3A 4H19A 3UXAA 3WJSA 4XAZA 4TX8A 4DO7A 3SJ3A 1B90A 4C6CA 1DVJA 2O7SA 3A9IA 1XPGA 4IGHA 4DPQA 3DHUA 2BFGA 2NQ5A 3WNLA 2Q8LA 2HXUA 3LBMA 1OF6A 1JDCA 1O5XA 3NL2A 3SFKA 1OWQA 1ONWA 4OBRA 2WO5A 1E55A 3ZWTA 1JAKA 1SZNA 3MCOA 5E70A 2VL4A 3HQPA 4E2DA 1O1HA 1K8YA 4JN8A 1QPQA 1SJDA 5D9NA 4C6PA 3GS6A 4JX5A 1LRQA 1G7UA 2H3DA 3AXIA 4LYQA 3U5YA 3HMCA 5I5RA 1DQWA 3NPWA 6REQB 3LB0A 1E0XA 3TA9A 1WKFA 2X40A 3M0HA 2R91A 1GONA 1Z89A 4R7JA 2CXGA 3R43A 4YLWA 1CDGA 2E77A 4FIRA 4IGSA 3GFZA 4R53A 3V75A 1X96A 3UJFA 1Z8AA 4MJMA 4L80A 2BHZA 3UG8A 4AVFA 3CPUA 1F6KA 4DF1A 2Z2UA 1KFJA 3RNDA 2QDDA 3KL5A 3LDVA 4JQ1A 4XZMX 3COTA 3UR5A 1TREA 1BYBA 4OFCA 4HU4A 4XBKA 3S6TA 3AMDA 1OD8A 3MJMA 4PMZA 1M7JA 1FWEC 1R3YA 2Y62A 3N17A 1W9BM 3GD6A 3GUWA 2A21A 4QCFA 3RX2A 3FNDA 1HX0A 3TLQA 2FB3A 3K13A 3WNKA 2ZZ1A 5CZJA 2IQTA 2PDJA 3WH9A 3S9YA 1V0KA 4ADSA 1XKJA 1ZBKA 1H49A 4UOJA 1E6PA 1O6IA 1L8PA 1SZGA 3OA3A 4B3KA 2ZDRA 2P1FA 4GINA 2PCEA 3PFMA 5H91A 3GR4A 5ABHA 1GHSA 3B8IA 4K6AA 3ZJ8A 3TCEA 2XG9A 3EXSA 4GX8A 4ZO8A 3OHIA 2OEMA 4N02A 2A3LA 3ARSA 3K1GA 3ZJKA 1ZJIA 4RW5A 3A9BA 6ALDA 3E38A 2X8RA 3OIHA 2E6YA 2ZWYA 1CGYA 1B3VA 2WOQA 3OYZA 4X22A 3T05A 2C15A 1U33A 1VYPX 4Q8MA 1K7FA 2GDVA 5BROA 3KXQA 5G4HC 3P8IA 1QCWA 4GIYA 4AEEA 1J0HA 1VYRA 2GGHA 1BXCA 2ZX5A 1W2VA 4UTTC 1HKVA 3S42A 1R2SA 2DORA 1HL9A 2VGBA 1MMFA 3T08A 3UCDA 3WFLA 1DWGM 2V5KA 1S5NA 2WM0A 4J28A 4WY0B 4DI8A 3NO3A 2X05A 1ZS2A 1G0CA 4GJJA 3A4WA 1L0PA 1BRLB 4EX4A 3WQOA 3QF0A 4X2PA 3AIWA 1XHGA 4O8AA 3K4DA 1GPFA 4KWUA 3CZKA 4NAFB 1SO5A 5AHNA 3KOYA 3FKKA 3T1GA 4JDBA 5IXEA 3ZR5A 8TIMA 4AVOA 5J5RA 4L7ZA 2ZIDA 1EUAA 2OEJA 3VGDA 3RJYA 3L4ZA 2F6UA 1KXVA 4FMVA 3W1NA 5DMYA 3VFLA 4ZSUA 4YCOA 1V7YA 1BQGA 1HKIA 4MKNA 5TNVA 2TMDA 1FH9A 3B05A 3ANYA 3MZ2A 1BWVA 1GVOA 2ZX8A 1M03A 3CWNA 2ODOA 3MZNA 3TJ4A 1DE5A 1DKWA 1AL7A 4KEMA 1OM0A 3WQDA 4KRTA 3UFYA 2QF8A 2QHAA 3U4AA 4K2SA 4WX2A 3I7QA 4ZZ9A 1OG0A 2HZGA 1OCQA 1IEIA 3G1HA 1OZMA 3RR4A 1YLVA 3G5EA 1WXYA 3FVDA 1BG9A 1GK8A 3BE7A 1JCXA 4I8DA 4AC7C 2HMCA 3OVRA 4N4QA 4GO9A 4MY8A 1EB3A 1M5WA 2ZUWA 1RQHA 4HTYA 4ZXOA 4MDOA 4RPQA 1XIIA 4H6RA 4JEJA 3FAXA 1XUUA 3PSVA 3AOFA 2Q8XA 2C16A 3PY2A 1SW7A 2PP3A 2ACUA 4LH8A 3W0KA 1UKQA 4X3ZA 1FBAA 3CTLA 3UPMA 2VKZG 1P4CA 1ONXA 3QTPA 4Q8NA 1AODA 4RW3A 4AWSA 4PUKA 1Q8JA 4KFNA 3CHCA 2VP8A 4NI8A 4GVIA 3NQ2A 3BK0A 4QGCA 2BGSA 5AZ0A 1JZ5A 4G2DA 4NZ5A 4NNCA 3LZ5A 3O8AA 3ZT5A 1AJ0A 2ZXBA 4H9YA 3TK7A 4E5TA 2LLEA 1PTDA 1BKHA 1DWJM 3OLGA 4U5KA 1VPXA 3WF1A 4L5ZA 2V2HA 2QGHA 3BQ5A 4C6NA 4K38A 5EMKA 3BAJA 1UZDA 3VIPA 4BFAA 3T9PA 2FZBA 5IFTA 2PRLA 2VNCA 3PR2A 3WLPA 1H7XA 1CCWB 4XWUA 2WNNA 3W1UA 4UTTA 1HJXA 2OGYA 5C9UA 3UYCA 1QI5A 1P0KA 3NPUA 4GQRA 4PRTA 4WK9A 4E38A 4PMXA 3U2CA 3VDCA 1LCOA 3BGAA 3WL0A 2YFNA 2CZDA 2NZLA 4ICNA 1YXYA 4V27A 3CAVA 2A79A 3HMJG 3MBFA 4OQVA 2WNZA 1K9FA 4LOCA 5DMNA 4WXYA 2V3FA 1C8VA 4CN1A 4DUXA 2CHOA 1M01A 3PTDA 2Y5EA 4XAPA 1F6PA 4MWAE 3N2OA 3CUHA 3NA8A 3TQ0A 5LYRA 1QNPA 3P60A 1V6XA 4O15A 3HZ3A 4NSBA 4HP5A 4DB7A 1LUCA 2ATMA 3PG9A 2CLMA 4E4FA 1P6WA 3KOFA 1P7TB 4KESA 2BY3A 4GQGA 3TZNA 3UWVA 3HJEA 3C3UA 2RDTA 7PTDA 1EHNA 3P93A 4S3CA 2VQTA 1N2VA 4AIEA 3FA5A 3RM4A 1QWGA 1A5UA 4LEQA 5HNUA 1Q6OA 1O12A 3RLGA 2PEVA 3F4DA 1MDLA 3C52A 3JU2A 5A94A 4GBDA 4ICCX 1JPMA 3GXPA 5LIKX 3VCRA 2OCZA 3RRAA 2X0YA 3V0TA 3NSNA 8CGTA 1UJQA 1K9DA 1ZQ5A 1S46A 1RXOB 3QHMA 4H7CA 4W8BA 2NQ9A 1WXJA 3HG2A 4AZIA 2XVGA 3WSUA 3VKKA 1ZP4A 1KA9F 4GH1A 1QK2A 2O9OA 4J5NA 5JH2A 3DESA 4ML9A 2EHHA 2WAGA 2PC8A 3LGDA 4CCCA 3MVIA 2INZA 1NF7A 3DG3A 3S4TA 3GFXA 3VMPA 1E1EA 3UY8A 3WQ5A 2XJ7A 1XDMA 3ARWA 4LVGA 4WHBA 2D2OA 3CV6A 2XYLA 1TA3A 1OC7A 3EWXA 1OYAA 3EMZA 1DJYA 2PTXA 2O9RA 3I7RA 3S46A 1ZAJA 3LCLA 2X1IA 2J8GA 2V3DA 4EPDC 4KCWA 1POJA 4JZ5A 1ZFJA 1TKKA 1KNWA 4IGMA 1VC4A 3ZOAA 1KB3A 1R38A 1FKWA 3V3WA 1V3IA 1MXGA 2Z2BA 5BYWA 1RJRA 1OJXA 1E9IA 2C14A 5HPCA 1RD6A 4QCEA 3S5ZA 1HJQA 3RRXA 5G2IA 1N82A 4IF2A 4NJKA 4ILSA 3SGZA 1GVQA 1R0MA 1D9EA 1T8QA 3CAKA 3LXBA 1W3HA 2GPTA 4PUJA 1R8LA 2WZIA 4DIAA 3U7BA 3SI9A 3MS8A 2VHLA 4ZO6A 1XIHA 1Q7QA 5CC6A 4FALA 4Z1AA 1JGIA 3WL1A 1RH9A 3PUEA 3GY1A 2JQXA 4ZFCA 1B3OA 2NV1A 3PZIA 3QBUA 1TPVA 4JS3A 4E2VA 1IT7A 2WSKA 1DTNA 3PZVA 4F66A 4RUBA 3O16A 4PH6A 1TV4A 3VD3A 2GWGA 3OHMB 1EPVA 1E1CB 3BLOA 3KEHA 4S2BA 3CO4A 1MEIA 4C6OA 1HJVA 3ITVA 3MP5A 2BVTA 4UTHA 5KSWA 4OOUA 4MNLA 1O1ZA 5M17A 1KLZA 3KDOA 2PGFA 2QS8A 3KBWA 4WDWA 5G1MA 3WEOA 2XZ9A 3QZ6A 4AVNA 4N6EA 1GHRA 4RPPA 1V3MA 1FDJA 3WNNA 2WSPA 5EU9A 4LT9A 3VNLA 5HWNA 1KM4A 1JCMP 4M0XA 2CCRA 3TNBA 3MSRA 1CTNA 1T40A 3LXAA 3F4NA 3VXGA 2OSWA 1MFUA 1OBAA 3CHDA 1TRDA 4A3YA 3GM8A 2A0NA 1T7LA 4PMYA 3OLEA 2XH0A 4QROA 2W79A 4X61A 2P0OA 1JUBA 2QJHA 2VGFA 3LERA 4OT7A 1S3HA 1VHNA 1QOQA 3H54A 1XCWA 1GQJA 1EJUC 3H7VA 1TTQA 3NQ8A 3W2KA 1VJIA 1D3HA 2EKCA 3N19B 3TSBA 1GVYA 1TVNA 2WJDA 1B9ZA 3FN9A 4UQ9A 2ZUNA 1CT5A 1FCVA 3QMTA 4PBFA 3TW6A 1US3A 5CPTA 3GTHA 3OBAA 3W76A 1M9HA 5A69A 3R0KA 4LNCA 2TYSA 5K9DA 4EP8C 5D9PA 5AC7A 3GAKA 3LV6A 4YN5A 1EWEA 5A8NA 2PD9A 4L6DA 1TTJA 3KS5A 3IIXA 2B31A 1OT2A 5HUPA 3KTCA 1OK4A 1GYLA 5RUBA 1JNEA 3A5FA 1CX9A 1VRDA 2ZZ2A 2GK1B 3C0LA 3NO5A 3PUOA 1TCMA 4RDVA 1ITCA 2TPSA 3L7RA 3URBA 2J75A 3W7OA 3MYPA 4KWOA 1P48A 5AC8A 5D2YA 3WD3A 3Q2DA 2C1HA 4PUDA 2VCBA 3QY7A 3LCGA 3R8RA 3AHZA 3AS1A 1VPQA 3CZJA 4HHLA 1XD1A 1RP9A 3VMNA 2EPHA 4LCQA 4FEZA 2X2YA 3PNUA 1K70A 4EXBA 2QYGA 3ORWA 4WDXA 4RL3A 4OUEA 4LAOA 1M7PA 4PTNA 5BWFA 1YPFA 2OLAA 2PWHA 2WKJA 1HQTA 2OYKA 1FWSA 3W86A 5AYXA 2OELA 5C6MA 5K4XA 1FWTA 3OLDA 3T07A 3M6YA 4LS0A 4ZR8A 1X8FA 1E0UA 4DF0A 1GVSA 3GQYA 4ZEPA 5L6UA 4RLIA 3PZGA 4BI6A 5I3HA 4RE2A 1AQHA 3LY0A 4Q8WA 2QW5A 1K3UA 3O6YX 4GXPA 4TXEA 2AGTA 4NRSA 4NQ1A 4PCFA 1O95A 3URQA 3CEPA 3S2JA 2NXGA 4IMFA 4CLMA 1PZ1A 4WY0F 2UV8G 1UR0A 3GU9A 1W1VA 1UD5A 3ITLA 5H8PA 3WMCA 1QTWA 2V0TA 1YE4A 1YXDA 2R9RA 2GJXA 1NWUA 2PTWA 1XLEA 2YSWA 4P5UA 5AVHA 3LRMA 2YA2A 2ZC8A 1XF0A 4BEQA 3P74A 1JCJA 2W3ZA 5BOEA 2FHBA 1WPCA 1V6TA 2WMIA 4IISA 2I9EA 4I9TA 2BY0A 3CM4A 3TC3A 3WN6A 2EQDA 3GVGA 3NPVA 3H7UA 1VEPA 1FXPA 2OSYA 4B5WA 3PWAA 5AHMA 3B8DA 3S2NA 3EOOA 5CSUA 2B81A 3QKZA 2F8QA 2EF9A 2C3ZA 1GKRA 1B30A 1K4HA 3GNRA 3M5VA 1NM9A 2O56A 1A50A 3E2VA 5XIMA 4IG2A 5CPLA 2ZZ4A 4JTLA 5KINA 1KXTA 3LG3A 3GC4A 3KVKA 1EKOA 4YWSA 2PMQA 2ZRYA 2PTZA 4JGDA 3KHDA 4L9ZA 3GDKA 1O60A 2VFEA 4LQ1A 2QNEA 4C90A 1JQXA 1GUVA 4UR7A 5CQ1A 3N6HA 2QJNA 4ZTYA 3FA4A 3SADA 3L0NA 1WDQA 4PZVA 3H2NA 2FHFA 4JPGA 1IYXA 1XI3A 2ATSA 4GKLA 2A7PA 2C1IA 4NNAA 3TP4A 1U1UA 2DH3A 3A22A 4GIAA 1J8VA 4JD4A 2V68A 2PDNA 2NUYA 1WKYA 4YMZA 4IMCA 1W1A1 4RE0A 2G96A 4ACZB 3BOLA 2I7GA 3EA3A 1AJ2A 3P82A 4O0ZA 5JIPA 4ATLA 3MW7A 1JF5A 2AGKA 3P0XA 4ENLA 1HJSA 4A22A 1PE1A 5DXYA 2POZA 1F73A 2PLJA 4J3SA 1OY0A 3GXIA 1HO4A 2WC7A 3AZTA 1VR6A 3K5XA 2JE8A 1ZRQA 1YTDA 3EX2A 5HJLA 4S3EA 2YLAA 2E9LA 4BR1A 5AOUA 5FL0A 1HW6A 4JQ3A 2ZUTA 4FI4A 3FA3A 1J79A 3T81A 2DSWA 3SRDA 2BY1A 2FZ8A 5K3VA 3WH7A 1L2QA 3LPGA 4M82A 1H3GA 4E2BA 1W54A 4M1BA 2DIJA 4FK9A 1CXFA 3QFWA 3FHAA 3H23A 1G6CA 3Q37A 2DEPA 3IARA 1P5BA 5JIWA 4DLMA 1XC4A 1XISA 3UWQA 3W7EA 1P0DA 4U10A 1WDPA 3QYSA 3FW6A 1T8XA 3QC0A 4LC6A 4PSRA 1BSIA 2E4TA 1JF6A 3RK8A 4FNRA 3NL3A 2G3NA 2Z1SA 4FNPA 3M0MA 2ALRA 1QATA 3CC1A 5HQEA 1HFBA 1V0MA 3VKJA 1KRAC 1Q4NX 3VCNA 2HROA 4DM1A 4J1OA 3CUFA 3TTSA 4DAIA 3V16A 3W4RA 1LG1A 2VWTA 2G3IA 3SCTA 1DP0A 3LD5A 2CZEA 3SCVA 4QM1A 3M5YA 3W1XA 2DVXA 3E0IA 2NWRA 1RPKA 4D6IA 1M1BA 1OFAA 1JFHA 2C0AA 2X42A 1M65A 4LAMA 3VFCA 1XWYA 2Y4SA 3NPXA 2C71A 1V93A 3CHFA 1XFBA 4FR6A 2XSXA 3N2MA 1C7SA 1KRBC 2W91A 4AD4A 4EKJA 4AZBA 3AYTA 4F48A 2R6OA 2Z24A 3KP0A 4LUSA 1OCNA 1EDTA 2ZRXA 3BMWA 2BX7A 4HN8A 2D0FA 1W5PA 4JIPA 1Q5MA 4H2CA 4L9YA 2J24A 5G4WA 3GTXA 2C6QA 1V51A 5LIWX 1OX4B 3EPNA 3R8GA 4WSHA 1SFLA 3JVAA 2P50A 1BG4A 1U1HA 1LRTA 4JTJA 4PUUA 2ZRUA 7XIMA 3NCOA 2DT1A 1W1B1 2F6KA 4ERAA 3RHGA 3MP3A 2OX1A 4M1RA 5ECVA 1I0DA 3P67A 4MB5A 4JTIA 5T91A 3BLDA 3BTNA 3AIUA 1G9HA 3R13A 3VA8A 3SB0A 3TDFA 4LB3A 1RZMA 5FSEC 1QRQA 2EPOA 2ASHA 2Y5SA 2HS8A 3VGFA 2BSLA 3H21A 3R0UA 1SO3A 1P0NA 2RH9A 1UPPA 2JIEA 3W87A 2I16A 3AXHA 2J47A 5EPDA 2ZUVA 2XN1A 1DOSA 4AY8A 3TNOA 3SGGA 1EZWA 4X2RA 4HPHA 1LT7A 1TIWA 5I00A 1CPUA 3L5LA 2VRJA 2GQAA 4V33A 1W3LA 1TZ9A 4LWWA 3I10A 5HXMA 3S3GA 1ECEA 3A24A 5D05A 3W29A 5HMFA 3VO0A 1Y0EA 2PBGA 2QXWA 5A6LA 4M5PA 4LCSA 3W81A 4AYGA 2HK1A 3HOJA 2W0UA 4PTVA 5CC3A 1ZTVA 1PX3A 4WJEA 3EWYA 4XZ9A 3T40A 1DQUA 3DG6A 2Y0FA 1AA1B 1JYVA 1UD4A 4QRNA 4LCRA 3EWDA 4OBTA 4XBSA 2ZZ7A 4GQQA 2CBVA 3KS6A 5DEZA 3QEZA 5FOOA 3EDEA 1GOMA 1J5TA 1OFEA 3II1A 1A5LC 4MGGA 4MJZA 4H2HA 3H24A 4GPNA 4GG9A 2J9ZA 3FJ6A 3HQ1A 1ZPTA 5PTDA 4J3VA 4DUOA 1CGVA 2J7CA 3LM3A 3WFZA 2BDQA 2WLZA 4PULA 4NRRA 4H8HA 4LUYA 1CXIA 3FVMA 4KF1A 1LQ2A 4HA1A 3BG5A 1NDWA 2DSVA 3M0JA 1S3TC 3TWBA 5I3GA 1YPIA 4AZCA 5C70A 1GKQA 2NQLA 3UG5A 2XFWA 4C6EA 3B97A 1BXNA 3BWWA 3P2VA 4P61A 1BEUA 3WEMA 4GY7A 1L6FA 1WOBA 3SUUA 2G4JA 3CZEA 4YVPA 1LBFA 1V6UA 3ECQA 3DERA 4XKYA 1UP2A 1PB0A 4AZ5A 2PC4A 3PTMA 4JTEA 3QV8A 1E4MM 1A47A 3F2BA 2VD9A 3AIRA 3KOWA 4QQUA 1JJKA 3WMLA 2ZE0A 4O52A 2QIIA 3UWWA 1DWFM 1DJIA 3D47A 3PJWA 4S23A 4AISA 3N34A 4GIRA 4MJ4A 4MYAA 3F5KA 5AVNA 5HQLA 5AC5A 4L9XA 1UW9A 2YDQA 4L1GA 3JW7A 4OZOA 3N11A 5JXQA 3TMQA 1BVWA 2PB1A 3S8HA 5C8BB 3U5UA 3SCWA 1QO2A 2G37A 1SVDA 2HNHA 1YYAA 4JTRA 1FWFC 4G9PA 4FHAA 4HZ7A 4WGHA 1F07A 4I9JA 4IPNB 2DUXA 2GVEA 1JXJA 4P7OA 3PBUA 1OD0A 1FWNA 2WHJA 1HL8A 1Q7MA 1E9YB 4N2YA 2OQLA 2FYMA 2A6NA 2JGQA 3N04A 2ZICA 3WUGA 2UY3A 4TVDA 2WJFA 2Z1VA 2PLMA 2XN0A 3APYA 3W37A 3CL8A 3H4GA 2Y1HA 1BSLA 1JZ8A 1OC5A 3SY5A 2NX9A 1Q4WA 1H50A 4NYYA 1E3XA 3CLMA 2QPXA 4ZB0A 5J5DA 2QUTA 3KVLA 3R25A 1EOKA 2V81A 1B2YA 3P80A 4H6KA 1S2WA 4O1AA 2ZC1A 4W8AA 5I3JA 1K9TA 1GJUA 3LBOA 3TJXA 4LYPA 5CC7A 4D1IA 6XIAA 4L61A 3SY8A 1AK5A 4M8UA 1PTGA 3GYCA 1J0JA 2J66A 3DFSA 3NOEA 4ZOEA 4HZ8A 2Z1KA 3P6LA 4C1LA 3LCWA 3ZVIA 2Z7KA 1VCVA 4ZXLA 5BMWA 3TXVA 5LNUA 4PBGA 2XGZA 5AC6A 1GTEA 2BASA 3H70A 1JRCA 3UU0A 4C7DA 1UD2A 3WBAA 2ACRA 3VOHA 1BTCA 1B1YA 4RNHA 3DFPA 4TIMA 1DIKA 4UQCA 4NNBA 1CXHA 1H51A 4BS0A 1SFJA 4O53A 4KH2A 3GXTA 2G95A 1DEDA 1IEXA 4J9JA 3EKLA 4BF5A 5CEWA 1CNVA 4I90A 2IPGA 5CZKA 4P7LA 1OG6A 4UMAA 1V03A 5D8WA 1E3ZA 3USZA 4HZ6A 4AQLA 2GJLA 2YCJA 3EB3A 1RLCL 4QLKA 2OG9A 5JBDA 1TWIA 3LENA 2DZAA 3PZUA 3GU1A 4AHPA 4UCFA 4TMCA 3TOPA 1KM0A 4A8IA 1VIWA 3P5YA 1SR9A 4S3DA 2E5DA 3T6CA 4E4UA 1W1IE 2ZKMX 1TV3A 3QW4B 1FWBC 3MV01 3N3MA 2NLYA 4Q4RA 3AUOA 4FOJA 2HTMA 1FWWA 4IIEA 5K2ZA 2E1WA 2HV5A 1V3KA 3CTTA 2RDUA 1UROA 1ISXA 2XGIA 1A5OC 1XQKA 3L5MA 1CB7B 4NYUA 3W6MA 3H2AA 1K6WA 4DJDD 1EIXA 2VO5A 2BHUA 3PPFA 1TMHA 3CQHA 1VKFA 3WBYA 5MKGB 3V1PA 3VNDA 3THDA 5DQPA 4N6FA 5LNWA 4W85A 5M2FX 4GUFA 4WKFA 1WAUA 4U3CA 3IWPA 4I6VA 1UOKA 5M1TA 1FX6A 5HPOA 4JQ2A 3BCFA 4LEFA 3O6AA 4Q7NA 3GXNA 3WO8A 1FWAC 3ITCA 4EAYA 1VF8A 1XGEA 1B9BA 4IIGA 1Q6CA 1MI3A 4C5YA 4O8RA 4HOZA 1P1MA 1LRNA 2WZTA 4B92A 3JR2A 5JH1A 3BXWA 1SR0A 4M3PA 4DXVA 2DQWA 1TQXA 1KFKA 2VFFA 3W7PA 1KBIA 3R10A 4W8LA 1VFUA 2CZVA 4CD4A 3HGSA 3CQKA 2RGMA 5HNTA 4S1FA 4O28A 4QSHA 1W32A 1A5MC 3E2SA 2YOCA 1H1ZA 4QJ5B 2AKZA 4LS1A 1QO5A 3BDKA 1TWSA 2HPMA 1QPOA 4CN6A 4AZGA 3I68A 3M0YA 3PF3A 3CASA 1NOUA 3WF3A 3HGJA 5U7SA 1JUEA 2A3AA 1GOIA 2CLKA 2ISVA 4INFA 1DJGA 1S2AA 2FIQA 3NAVA 3VKBA 4BKNA 2CYGA 1GOQA 1IIHA 1CXLA 2GVYA 5FEZA 2E1DA 1PZ3A 2W61A 1PX4A 1VFOA 2BVWA 4UR8A 1UUOA 1ISYA 2E6AA 4XIAA 1S5TA 2XVPA 1NTHA 1X6UA 3MYOA 3SAZA 3LS9A 4DBDA 2E28A 4CQBA 1AD4A 2Q09A 4Z1YA 1BQCA 1ONRA 4MSSA 3MKCA 2FZ9A 3UVAA 4B91A 1WKDA 3DECA 3P62A 4KGLA 1E6ZA 1RLDA 1UC4A 3KWSA 4LGXA 3VINA 3QR1A 4AHOA 4DJDC 4HNNA 1KR0A 3WD1A 4GZEA 3CIVA 3PC0A 1RK6A 3BC9A 4DZHA 1JYWA 3CJPA 4GK8A 5LXXA 3OW1A 4GI4A 3W23A 2QCGA 5HATA 3WDHA 1F3WA 4JN6A 1FCUA 4ZQMA 1IEVA 2D2GA 1KTCA 1P0BA 3GAYA 4JFUA 5F2GA 3W74A 3MI3A 2ABAA 1XGDA 5DX7A 1W5QA 3Q67A 5C55A 4E8GA 3LLFA 1HG3A 2J78A 3FSUA 3HFTA 3AIEA 2XWDA 4ZQRA 5TF0A 4NKCA 5F1VA 3S6DA 3P5ZA 2OWXA 2A3BA 3WLOA 4UQEA 4ATWA 2R1PA 1RP8A 5HINA 4IPJA 1FHLA 3LXCA 4ZO9A 1IWPA 4O54A 3WLKX 4B5NA 1LLOA 7TAAA 3MUY1 2YL9A 2G41A 1WZKA 3WD4A 3U57A 4LC8A 1PIGA 4NZFA 3AXMA 5LIXX 3A64A 3F4WA 4ZE5A 5CPNA 1W3JA 1LT8A 4Y8EA 5EMJA 1VBUA 1XH1A 5HJXA 3MKKA 5BZAA 4HN4A 1NH6A 3Q58A 1US0A 2WJEA 2VEFA 2HQAA 1R7OA 1LJYA 4F9DA 3OZMA 2QAFA 1UWIA 1TPH1 1A5AA 3KUMA 3YPIA 3D3AA 3H2EA 2V67A 1TWWA 1F61A 3DIPA 1MWOA 1TX2A 5DBTA 3E2RA 1XM3A 2WWDA 1I6NA 4I7UA 3ITGA 4AEFA 1TMLA 3VILA 4N4PA 5DMLA 5GJNA 4PMOA 3V5CA 3UXKA 2AQVA 3ABXA 3MUIA 3ANUA 1XYAA 4AY7A 4DJFC 3I3BA 3UNTA 4NAEB 3MPGA 4B9ZA 5D03A 1W3NA 2X7WA 3WBWA 4RXFA 4K36A 2XH2A 2GGGA 1XCFA 3BLPX 4Z0JA 3MO7A 4HIBA 4IL2A 1NDYA 4GVGA 3WQGA 2VWSA 3MMWA 3C86A 1HJWA 4WRHA 2G3MA 3TYEA 1GQNA 4D71A 2BHYA 2BMBA 2PPGA 3W82A 2W66A 1PKMA 4HNLA 1JDDA 3OOQA 4LU0A 2A1YA 2P10A 3LMYA 2HRWA 3PANA 2QAPA 2AKMA 4AF0A 3VC5A 4IL0A 1LF1A 3RCYA 4I7WA 1VRXA 1UA7A 4KEZA 4UR9A 1UG6A 5K9CA 4DJDA 2F9RA 1XCXA 3DBNA 2YA1A 3HV9A 4U5IA 1LBLA 3I6TA 1WOAA 4GLEA 2Q71A 4LSBA 1J12A 4XKMA 1FWCC 5AECA 4H6QA 4H8UA 2PD5A 2CLFA 4PR4A 3L4VA 2ZVRA 1WXZA 3GSMA 4EPBC 3AQUA 3FJNA 4ZBCA 2IKGA 2BXVA 3PJUA 2FDSA 2GQ3A 2YZ5A 1J2BA 3H12A 3HF3A 2BGQA 1ZJHA 4WDUA 1EP3A 3A3WA 4IX0A 4US5A 2NXHA 1SJCA 1HTIA 4CD6A 1L6WA 3KCLA 4I7VA 2ZRWA 3P81A 4PEEA 3GFYA 1K8CA 1K8ZA 3OU8A 4KKXA 2CESA 2KX9A 1BPLB 1E72M 4TQTA 3GDMA 1FDZA 4ORMA 1TSIA 4EVZA 3GH4A 3FSTA 2SFPA 4B5XA 2VZVA 3LCFA 2DZVA 5E0KA 1GG0A 1NVMA 3HURA 4Q7IA 2I17A 2PDPA 2B7OA 1T6MA 1GVEA 3ARRA 1E6QM 4TOQA 2E9MA 3D46A 2PWFA 3IS4A 2AOSA 4Z2JA 2FFIA 3NVTA 1EDGA 5LGZA 5C5YA 1S38A 3QXBA 4BQ4A 5ABEA 3F03K 2RDWA 1NWTA 2ZUSA 3SUTA 1KWGA 4AEOA 4B4HA 3IV8A 3J7HA 3CIWA 3VI2A 4A2SA 1KM2A 5E09A 2Z1XA 1U30A 4JHZA 2VDGA 3TH6A 2O9PA 4DPPA 5XINA 2VT0A 4Q22A 1JG9A 4E0CA 5CGMA 2PWGA 2NXIA 2FPTA 4EF9A 4UUIA 2JK2A 1JULA 4H01A 4JTHA 2R1NA 5GQBA 2VC5A 4MG4A 4PFHA 1R46A 3W1LA 4DJFA 1MYRA 4Y90A 1XRSA 1P7TA 5IHRA 2DSKA 3QOMA 3W83A 3VKCA 1HZYA 2DQXA 1J0ZA 1FWJC 1V5XA 3NYDA 3QZAA 3C8NA 5EL1A 1TRIA 4K8GA 3KTXA 1KRCC 4NJIA 3IV3A 1OADA 6PTDA 3CQ0A 1XSJA 2QF7A 3LCXA 2XHYA 4G7EB 4U3AA 4AH7A 3G6MA 2BXZA 2XM2A 2PGEA 4S39A 3B9DA 5I06A 4KBXA 1TO3A 2YKKA 3U3HA 4AUBA 3LN3A 2C79A 1BFNA 4IPPA 3AI0A 4L1XA 3WENA 2JFEX 2XVNA 4JTSA 3ZYZA 3SRFA 5JQ9A 5I0DA 4DWSB 3E02A 3ABRA 2DVTA 2PF8A 2XUCA 4L4MA 2Y2WA 4I5RA 3NYZA 2NT1A 3GC5A 5CGQA 4YVXA 3AUJA 4MWAB 1F8MA 4M81A 3SW6A 4QDPA 4CQ8A 5HA7A 1E5JA 4Q8TA 2Z26A 3WDRA 5LIYX 4XSMA 2JGYA 2BZNA 4HYVA 3L65A 4CN4A 3GDTA 2RJGA 3D0CA 1DL3A 3B0XA 3IANA 3AYVA 3RU6A 4G7FA 2FKPA 1UR2A 4DXXA 1XG4A 5M3WA 4EANA 5ABFA 3FAWA 1US2A 1Z32X 4JIIX 2VGGA 4H04A 5FJPA 5FEXA 1EBGA 3B8SA 4N9CA 1JZ3A 2J7EA 3M47A 2CWXA 2V2DA 1G4TA 3L66A 1E73M 2X1TA 3IIOA 4RE3A 5IFPA 2JKPA 4QXIA 2OZ8A 3LQGA 4RDYA 1U22A 2QGYA 1AW1A 1E9LA 2PSNA 4BZYA 3NQVA 3ARXA 4PUWA 3M0XA 1OB0A 5C0QA 1UD8A 3N29A 1QU4A 4H8NA 4H41A 4UTUA 3H7RA 3PK7A 2VR2A 5IOBA 4JTKA 3TN5A 4Q7BA 1T0OA 1XDLA 3G1YA 1XSKA 5DCDA 2HS6A 1VP5A 1SZEA 5CH9A 3VE7A 1U5HA 5I7GA 3FYYA 4HYRA 1HGYA 4B9YA 3SECA 4MKVA 4GUIA 5G1TA 4R9OA 3ANVA 3PPGA 1OFOA 1W9PA 2QCHA 1F2JA 2CW6A 3BLFA 1MW3A 4FB7A 2GQ9A 4FSAA 1J4EA 3C2VA 4YHEA 4CNSA 4HQVA 1W9DM 1E71M 3AIVA 1QHOA 4JOMA 3VZYA 5FAGA 5FKYA 3S9IA 2YZRA 5HMDA 6CGTA 3ARUA 4IJBA 4LPCA 2PDUA 4DF2A 4C1NA 3HN3A 4I8YA 1Q13A 3W6YA 1TR9A 3K1DA 3SO7A 4ZSTA 4Z1CA 2V5LA 3DUGA 1C8XA 4OIFA 3KDNA 3CH9A 3MP4A 2BWGA 3H2OA 1JRBA 1HF6A 1UCWA 5CPMA 4JX6A 5T26A 2WMJA 4ROQA 4R33A 1CGTA 1P1XA 1VZWA 2J8TA 2ZUMA 4GCAA 3IGSA 3MCMA 1YXCA 4DO4A 4AHQA 4K8EA 4IP5A 1AH3A 2WLYA 5IDIA 2CLLA 3PJXA 1RALA 3C0QA 2WVSA 1P6CA 4NZ4A 3UP8A 3AJ7A 3R12A 1DXFA 3KBVA 4GXMA 4O0QA 5BOOA 1PDYA 2HPIA 2ZDSA 5JU6A 3WH8A 4Y9MA 3WLSA 2BG5A 3MHUA 4LVDA 1XLDA 4FXFA 4LAZA 1TUFA 3E0FA 4XISA 3POCA 5JBEA 1Q6EA 1ZALA 3UPBA 1S2UA 4P7RA 1VFSA 1K9EA 4XB3A 1VFTA 2J7FA 4RXGA 1T99A 2ZE3A 5XIAA 1X8CA 2I56A 4O1CA 2QVNA 1JD7A 3KX6A 3S5SA 4TTUA 3MV11 3LTYA 1FXQA 1VENA 5C9XA 3SUVA 1RBOB 3ZO9A 5I09A 1FH8A 1OC6A 4UTFA 4XSLA 2IPFA 1BWKA 2GJPA 4NIRA 3VIFA 1OQFA 4EF8A 2CETA 2ZA3A 1CI1A 1J10A 1YIXA 3UA3A 3M44A 3S1UA 3RN6A 4DWDA 2QDHA 1S2VA 1V6VA 4X9YA 4M24A 4C6LA 2E8ZA 2C13A 2WM1A 2Q02A 3UBPC 1ADSA 4RR4A 3CMGA 3UZ5A 1FRBA 1DV7A 1WDWA 5ENLA 3E6EA 3TYUA 2WB5A 3BCDA 5C7VA 2Y63A 3ABZA 3HQNA 4CCDA 1VLWA 2ZX6A 4GABA 4JXCA 4KS0A 3T7VA 2I5IA 3MMUA 4IQEA 4PB4A 4KFOA 1PWLA 5C9RA 4HNUA 3BUVA 3K4AA 1OABA 3KHJA 1E4IA 1KFEA 3AFBA 4GJ1A 1YE6A 3GVWA 3FXYA 2YL5A 1EF3A 1M41A 4P2VA 5EGRA 3XISA 3BLKA 2D2HA 2IS7A 5KETA 2D23A 3M41A 1K4GA 4W7UA 4M7TA 4M19A 3SIZA 1IWAA 4AMAA 3W2NA 3SN0A 3MT1A 5FJRA 3C56A 3CV2A 5BU6A 3HA1A 4LBRA 2VFHA 1R87A 2WHKA 3GVRA 2PODA 4HPGA 3RR1A 4IXHA 4J3ZA 1A0DA 1GWJA 3EX4A 2V82A 3UR8A 3T44A 1R9ZA 5BCAA 3SCPA 4EK7A 1SU5A 3U2OA 4MPKA 3DGRA 3E9AA 3GDBA 1OZQA 1A5SA 1D2KA 1HIZA 4LUTA 4W93A 4Q33A 1UD6A 4DZ5A 1WCGA 2Z28A 4Q6XA 3N6JA 2RUSA 4FX8A 1SM9A 4X60A 2V5JA 1XLKA 4DNMA 3H4XA 3FOKA 3UESA 3MVTA 4MDPA 4F0MA 1R3QA 1OFQA 1F4HA 1FKXA 3H55A 1DHKA 4LF2A 1DTUA 4KQNA 3NQMA 2Z4GA 3WNMA 3AHTA 2W67A 4REQA 4TV5A 3ELFA 1Z42A 1GQKA 3TROA 4JTFA 1TMQA 4UTLA 4AMCA 3PB2A 2VELA 3PUGA 4CNOA 1C3FA 5GNXA 2FTPA 4ZL1A 3BV7A 1QPKA 3FGCA 4EIVA 1LUCB 3WZ0E 4PBEA 3WQPA 1JUKA 3DG7A 4XO6A 2A4AA 4YTTA 1X6LA 5ABGA 2YXXA 4WEVX 3WQCA 4MB1A 6ENLA 4J27A 3SQLA 2A3EA 3W07A 2OR2A 2QZRA 1G01A 3PZQA 4IFOA 2VM8A 5LGXA 2V8ZA 1KQYA 3UWEA 4HHMA 1NQ6A 2AMGA 3W9ZA 1ISWA 4W5ZA 1EC9A 5BU9A 1DHPA 2WJZA 3AXKA 3QV9A 5REQA 3TTEA 4PL1A 3DGBA 1MRAA 3S9ZA 1I2RA 2YL6A 1W3IA 3CHEA 4HU8A 3OO2A 1OGSA 5F2IA 4IHCA 1R9YA 1UWAA 2MUCA 4JFTA 1ZSXA 3P0WA 3G0UA 3GVVA 1Z48A 3UZXA 1VJZA 4LY4A 3F5JA 5CXPA 3SJNA 4QSFA 4D6EA 1OFDA 4E3VA 1CWYA 1ECQA 4JNYA 1EX1A 1VFHA 4C6QA 1SFSA 2FB2A 2OTDA 3W1AA 5FL1A 1ZCCA 1Q6GA 3EDKA 1FVPA 2YFOA 1YTEA 3MSYA 1E0VA 1S2TA 1TA3B 4DUWA 1ME7A 5HNRA 1WNOA 4TMBA 1GOOA 3SEPA 4DYJA 2JALA 3OG2A 4H9ZA 4J35A 2D3NA 3RG6A 8A3HA 3B9EA 4H9TA 4ZOCA 4LRTA 1J6PA 3IIVA 3FIGA 4JCLA 1B3XA 2AL2A 3CYJA 1SFTA 2BTMA 3GIPA 1S1PA 3FYPA 3BW2A 2ZZ6A 3LHWA 3C0SA 5AYBA 2ZX9A 4C6IA 2W62A 1AFSA 1Y7VA 4JHOA 4CVWA 1K7EA 3KCJA 4W7WA 5EKYA 4NJJA 4B2DA 3GZ3A 3KM8A 1XFCA 4LUJA 3THCA 1F8IA 4RDWA 4NJHA 4AAJA 2EPKX 4IICA 4DJED 2Q3RA 4GHRA 4IMDA 3ES7A 3OTRA 1YBQA 1TELA 1F05A 5E0FA 1B0IA 1EGVA 4GX9A 4OECA 3KAOA 1XLAA 3S1XA 1PYMA 3W00A 1X6NA 2J88A 2VDIA 1FA2A 2FGZA 1U83A 1LROA 2MANA 4C60A 4RV3A 4Z2GA 3Q94A 1CYGA 3U8GA 2GJRA 1CGUA 1HKMA 4IPIA 1WZLA 3QW3A 1LQAA 3NZGA 2C19A 2Y5JA 5T8GA 3NEVA 3BJFA 4KMQA 3UW6A 2ZCGA 1MRQA 1B3ZA 5ECUA 3W7GA 2X41A 3L68A 1U2YA 1QBAA 3BZGA 1A53A 2EPMX 4JNMA 1NWSA 2VGIA 3SIMA 2X09A 3UZJA 4MUZA 1R2RA 2GDUA 3Q45A 2Q01A 4LALA 2XINA 3BPWA 3ARTA 3QHNA 4JNZA 1EZ2A 4OWGA 4JEQA 5AYZA 4O13A 3L5AA 3MHGA 4O50A 4JX4A 4AWEA 1XP3A 2YCLA 3EOEA 2O4MA 4P7QA 2FH6A 2V5CA 1OIMA 1QK0A 3S6OA 4BQ5A 3GRIA 2WKGA 1Z7AA 2ZADA 1F7BA 5EYWA 1XLMA 1A5KC 3QKEA 4ZOBA 4ERIA 3TW9A 2OGJA 3GNXA 3WKZA 1V3HA 3VE9A 4FNQA 1NJJA 3CAWA 1ZZMA 4DBSA 2BOFX 3OBKA 5FJJA 2OKOA 4GQ0A 2G97A 3RGTA 3TWAA 1E0WA 3M7WA 2QMJA 3TN4A 2HE5A 3ZSTA 2VX4A 1KBBA 2DZPA 1U5VA 1KBJA 1H7NA 2UWFA 4HNOA 4GBUA 2HDJA 4DX3A 1N8WA 1IT8A 1GGOA 1DQXA 1FH7A 1DORA 2JF6A 5LNSA 3QPZA 5F7UA 2BP1A 1ZBVA 1R85A 5KMYA 4FX7A 1S5MA 1HGWA 2F7FA 2DT2A 4GNVA 3A6OA 2WKLA 3K8KA 3VK5A 1KGXA 1ME9A 4ZODA 3K2GA 1KM1A 4GYPC 3W1RA 1XRVA 5IRPA 4TU1A 2EKGA 2WBKA 3DXIA 5B7YA 4FNUA 1DJNA 2Y7GA 2VOTA 5HMEA 4PRWA 1XGZA 3KFTA 1EC8A 1YKWA 5LZLA 3M0ZA 4JAWA 3TONA 3IRSA 3RLVA 1B5TA 5G4EA 2E5CA 2WMHA 5HWJA 4IOTA 1TPC1 3M0KA 1OFPA 1HKJA 1X97A 5KTLA 4IXXA 4LF1A 3STFA 1GQLA 4XAYA 3BSMA 5A6TC 1G94A 1RQBA 1Q6LA 2C0HA 3GW0A 3NURA 1KM6A 5FJUA 1W9UA 2F38A 5CLTA 3QR0A 3E0LA 3T0CA 3LTPA 1H41A 3LSCA 4HNTA 3LU2A 4EACA 4GI6A 3IUHA 2Z2AA 5I78A 3LX9A 3CGTA 3TR2A 5F2LA 1QXLA 1TZ7A 2REQA 3TVAA 2ZTKA 3UG4A 4KFPA 1H2JA 3REQA 3BSGA 1N8FA 1IXNA 1GOWA 4F4RA 3AALA 1NFPA 2V5BA 1MQQA 2Q6ZA 4I3GA 4V2XA 1VLIA 1LBMA 1QJWA 4HPNA 3LSBA 2W4XA 3QY8A 4PCPA 3LGEA 1BVZA 1F6YA 3QVQA 3N9KA 1MXSA 3SRKA 3A12A 3PJTA 1YADA 3EZ4A 4M29A 2Y61A 2W9MA 1F5ZA 2OYMA 2P76A 4A8RA 2ZXDA 2GJXB 1H11A 5D2TA 2PDBA 2YBTA 3TYAA 1GOKA 4H6EA 4Y8FA 1ZUAX 3QPYA 4HGXA 1R47A 2VURA 5BXSA 3ITXA 5L9FA 2WMIB 3R6IA 2UBPC 1DIOA 4LVFA 3N73A 2FJKA 1S5VA 4Q8OA 1VGAA 5T9CE 4I5XA 1WDRA 1JAEA 1E56A 3EMQA 2J79A 5LA0A 3UPWA 4YTQA 4H9VA 2GJNA 4DBUA 1PHWA 2H6RA 4WSKA 3WLLA 1ZU8A 5C2XA 1GVIA 3ARYA 4GH3A 1KKRA 3NFUA 4L4LA 5I23A 2HCVA 3TJIA 1AZ2A 3AU6A 1WDDA 4IG2B 1LOSA 5DRCA 2WCAA 4JIEA 4OVXA 3BMXA 3R0DA 2VX6A 1IXOA 5A6BD 1O5RA 1A5BA 4BI7A 4QE4A 2CWNA 2W63A 4GISA 3B8VA 3QPEA 3WMBA 4X0VA 3UT0A 2XWEA 1XIDA 3DN5A 1MXDA 3S5YA 4NI3A 1PEZA 2EXOA 3NZPA 4Q8VA 5AZ1A 4GVHA 3APGA 5AHFA 1FOBA 1SUXA 5M5DA 1O5QA 1REQA 3T78A 4GYPA 3UYIA 2OXNA 4R7OA 4B3LA 4E8CA 3C2FA 2YW3A 4GNJA