1YEEL

Structure of a catalytic antibody, igg2a fab fragment (d2.5)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
219
Chain Sequence
b'DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLSWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAADLGLYYCVQGTHFPYTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A FAB FRAGMENT (D2.5)
publication title Structural convergence in the active sites of a family of catalytic antibodies.
pubmed doi rcsb
molecule tags Catalytic antibody
total genus 49
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1997-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yeeL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yeeL01
1E6OH 3EJZD 3EJYC 5EBLB 5CMAB 1MJ8L 1CD0A 2L7UA 3CSYB 2DD8L 4UB0H 4HWBA 3AY4C 4XHQA 4O4YH 3MCLH 1EBAA 5I76A 5J89A 3DX9B 4J3WA 4L1HA 4OSUL 5HYJA 4OLUH 3FQRA 3H42H 2YPLA 5HHXH 5GRJL 3BSZH 1FFRA 4QOKD 5FHAL 3IVKA 4MMZC 1YJDH 3UDWA 2H9GA 1T7ZA 5IMOB 3GSWB 4LLQB 1OL0A 3S3JA 1FZKA 1P4IL 4HX1A 3U36A 1AR2A 1YYMH 4MQXC 2H8PB 4NQED 4RGOH 1T83C 1P1ZA 3FQXA 4PYHA 4S1RL 5K9KA 2IAMA 1CI5A 5MEPB 1TXKA 2HLFD 4U1KA 1T5XB 3ARWA 3MLZH 2AVGA 3WJLC 5KVDH 2YEZA 5JDJA 4ODVL 4PLJC 1IAKB 3KJ4C 2I07A 1F3JB 3L5XL 2IANB 4BQ6A 3VXTA 2W60B 3IFOB 2NY0B 3FRPA 1KTLA 1ZS8A 4GG6A 1S9WB 5CINH 1EHXA 4X0KB 2HVKA 3PJSA 4M1GL 3O8XA 4ZUVA 4I4WB 4JQIL 1CR9H 4LIQH 5EPMB 4IMKA 4EQ3A 4D2NA 4HWUA 4YDLC 3EYFB 1NGPL 4XGZB 3QZWA 1LP9E 3RHWF 3LS5H 1AH1A 1ZEAL 4KK8D 3SE3A 5HVWA 3VRJA 1IEAB 1NFIB 4F80A 5F96H 3ARYA 2YRPA 4FQXC 3ZLQC 4CNIA 5E03A 1ZWIA 3FB8A 2EYSA 2QHLA 3TV3H 5BJTA 1X44A 3EIFA 4K3EL 4LCYB 5F6HI 4K9EL 3PWVB 4MAYD 1WFTA 5L2KD 1JFQH 3K8MA 4M62H 2B1AL 5C07D 1UM5H 4HLZG 3T2PA 4HJ0D 4ZUUA 4MB3A 2AV7B 4F15C 4F8TA 4P9HL 4HWZB 1N6QL 5F21B 3DX6A 3WSQH 4KI5F 5HHOA 1NLBL 4XRCB 4JFHD 1GL4B 5ESVB 4Z18A 4PRHB 3GJFK 2MNUA 3MV8B 1I8MB 2YD9A 2AABL 1Q0YL 2YOCA 1B2WL 3TIEB 4XP4H 3MNZA 4KXZI 2D7NA 5ITFA 1DBKH 4X9HA 1AO7E 4PRDA 2B1HH 5IEKA 1L7IH 4KU1A 2IF7A 3MOAH 1RU9H 5AWNH 3L6FA 1FVDA 1MCSA 2OZ4H 3IDIA 1QFOA 2FO4A 5A40E 5GS0L 4A6YH 5I1JL 2L0DA 5DK0B 1R5IA 2BRRH 1C08B 2EDNA 2YN3A 2AQ2A 4GKOA 2GJ6E 5JHDB 5D7LE 1HOCB 1JPTH 1XIWC 3EDFA 5GJTL 3VMNA 2YA1A 3BKYL 3EOBB 3F5WB 1NDGA 4TVPE 3PABB 4NGHH 3V5HA 2Q76A 2IPTL 2ZCKL 4JLRA 4PJIF 3BGMB 3EBAA 4WUUE 3ARFB 2YUWA 1AQKL 1G1CA 4HXBL 5FUCC 4M43H 4FNLH 3OWEA 3KPRD 5D96B 1MFAH 1DN2A 5GGVY 2MQ3A 5HGHA 1IC7L 3CUPA 2VAJA 1DL7L 4HIIB 4L8SB 4MWFB 5DGQA 1LHZA 4XHJD 3TF7C 1SEQL 3BPCA 2L4OA 4Y4KB 3X11A 2OXGA 5IW6B 5EWIL 3X13A 2EKSB 2DJ4A 2V7HB 1Q1JH 3CVHH 3HZVB 1OP3K 3QCUL 1MRCH 4R96A 5EBMB 4RRPA 4I2XA 1FC2D 1DVFB 2LVEA 4RISL 1TVBB 5JR1H 4JRYE 4M7LT 2XTJB 4QY8A 2VXSH 5JW4M 4APQC 4GMSH 3PGCB 1F4AA 1P84J 4KGJA 4ZAKB 4Y7MA 5TDNA 2FX9L 2ITDB 2WMPA 1LO2L 1A6PA 5I30H 3U9UB 3WO4C 4JGJA 3BEWA 5FKAB 4QO1A 2XN9A 1T80A 1X4XA 5CEZL 5DGRA 3KPPB 3O9WB 1S7SA 2NY2D 5MEND 1YUHB 3EJZC 2VDQL 2AXFA 1HNFA 3D3VE 3FQWA 1PG7L 4H1LB 1HK6A 1EUTA 1R3IH 4PRPD 3VXNB 4PV8A 2H2SD 1IEHA 3QXDA 4X4ZA 3VGFA 4L8CB 2YPVH 4XCEA 4NQDD 4DOHB 4Y89A 1H15B 1Y18B 5JA8B 5E9DB 1JPGA 4OIBA 2GJZB 2J6EL 4GKNB 4QHMB 2DQIL 5J6HB 3QISA 5D2NE 2I9TA 3HG1E 5ADPH 4NQXB 2FWOB 4YQXH 3G6JE 1ZKAA 4K71B 3GI8H 4P57B 3FMGH 5IROC 3QFDA 2VDOL 4J8RB 3PQYB 5I8CA 4JFPB 1JJUA 5FUZH 3VFRA 4CMHC 5E95B 2HLFC 4LNRA 1NEZB 3QCVL 4XWGL 4R90H 4RMRA 2P5EE 3N50A 1RVFL 2NY5C 5D70H 3ARGB 3PHSA 1X6LA 3QHTC 4GW5A 1FV1B 1G9NL 4EIGB 4Z6AT 1RSFA 2BVPA 4HUMB 2EDWA 3BZDA 3ARBA 4LCCA 1T22B 5F6IC 1W72L 3D2UD 4PP2B 3GMRB 2HLAA 2XNAB 1UH4A 1ONQA 3PWPD 3S88L 4UMGA 1IC5H 2F53D 4HT1L 1OAYH 1MFBH 2Q87A 2VAAB 4KK8C 5TDOA 1CGVA 5BOZG 1CE6A 3HC4H 3LKSA 4NPYA 4PB9H 2H3NB 1T0PB 3NFSL 2EDQA 3EFDH 2GYSA 1CVSC 4NQTA 1MJ7H 4NCDA 3RWCB 3QQ3A 3QUXD 3LEYH 1KPRB 2YMXL 4F33A 1NFDE 2R4RL 3QUML 1BF2A 4WFFD 4YIQB 1BD2D 2R0KH 3RUGE 2DLEA 3U30C 2X2YA 1GRWA 1KLUB 3SKOB 3AB0C 2YRZA 3B2VH 3S5LG 5IV2B 2PO6D 4RDQG 3KGRA 5F9WC 4HJ0C 1WT5C 1JMXA 4ZS6D 3OKDB 1HE7A 2AGJL 5ESQB 4LDOB 1G7MB 3Q5TA 3QFJE 4MXWL 1XFPA 4OQTL 2VERN 4OT1L 5FYKE 2CK0L 1TJGL 2GSGA 1CGUA 1NC4A 2P5WE 4RNRA 1BHGA 5EZOH 5A16A 3SE9L 5KVMC 5HDQH 1CQKA 1MCCA 3QRGH 2CUIA 5J1SC 5EIIA 5L8LB 1UJTA 1FVEA 4B50A 4QCIB 4AEHH 4I3SL 4LFHD 5AYUH 1X5ZA 4ZFZA 2YR3A 5SWZB 5IR1B 5JUEH 5J06A 1JGEB 3MLUH 1JPST 1FJ1A 4Q74A 2X4TB 3C5SB 2XACC 1QNZH 3VA2C 5D7IE 1U41A 2EDLA 3FO2A 1UB6A 3TNNA 3L7FA 2GTZB 1ETZA 3IJHB 4H25B 4B7LA 1H8NA 3FOLA 1E6JL 3ISWA 2WAHA 4DKFL 5BO1H 1DLFH 5DVLA 4ZDHA 2IH1B 3CVHB 3KXFB 3OR7A 3UYOD 1UGNA 2Q3ZA 5CILH 1BFVH 3VDAA 1X3DA 4W4OC 1UFUA 3G04A 3C87A 1XGUA 2ZKHH 5FB8B 2C1OA 1Z9LA 1P7KB 4GRMA 2CJUL 4PRNB 4YNYB 1Q9KA 3QWRD 3GIVA 1RIUH 3QDGD 3FN3A 3G5YB 2IMNA 3P4NB 1TIUA 1JUFB 4K3GA 5B8CC 1BGXH 3LB6D 3MC0A 1T1ZB 4L3EE 4HEME 4Q0XL 3H6JA 3GHBH 4XHJC 4ZO9A 3TESA 4CMMA 3OKOB 4NM4H 1Q9OB 3WIFA 3SDYL 5I19H 2C3HA 2PTTA 4AH2A 5C6WH 2VZ3A 5JOFA 1FIEA 2BSSB 5F7EL 3GRWH 4LCIL 1S78D 4M3JA 1BLNA 2CO7B 2IQAA 1K2DA 4PRIA 2GJ6A 1FO0L 4G42A 3WXVL 4PJ8D 3HKFA 1TFHA 1QFWH 4HIEB 3LEXB 1A7BA 1IGYA 1YPZB 5CUSL 1NBVL 1NGQL 1T1XB 2PXYA 1AFVL 1IAIM 4PR5A 4C4KT 3L3JA 3SOBH 4EIZC 5BRZE 4WUUA 3FRUA 1IQDA 2JKXA 1AGBA 5JHLH 3W39A 4IJ3B 3RDTD 3L5WB 2NY2C 4O58L 1QYGL 3HE6C 5A2IH 4U4BA 3PL6D 2SEBB 5DD3L 5EOTA 9CGTA 1AJ7H 2H2SC 3V4UL 1OD9A 1NSNL 4LASL 5INDB 4Y4FB 4HUXA 3TBYA 2VWEC 3UTPD 4R0LC 4WW2F 1A9EA 1FNEB 3B4NA 1HSBB 4W6YB 5BZDB 3T0EE 4MJID 3P9MB 2A6IB 3GZKA 1I9JL 1EEUA 1PEWA 2KUTA 5ICZB 3MRBB 4X8JB 2XWJB 2JJUA 4ZPVB 4AENA 4M7LL 3WDHA 2X4SB 4OV5B 4I18B 3GJFA 2A6DA 3GSQB 5CZVL 4HD9A 2C3GA 3U4AA 3EDEA 1JGUH 1DQLH 3TT1H 4GAJH 1HQ4B 3WUZA 3T0AA 4OZHB 4JDZA 3MLXH 1KNOB 2Q8BL 4QHLB 3VU2A 1K4DA 5E2UH 4FQ1L 2GW5A 1RK0B 3QHZH 5IB5A 3KJ4B 1TJIL 1PSKL 4XH2A 3D39B 5TJWK 5IHUH 4XVTH 2YUVA 3L7EB 5C0ND 5D2NA 4HPYH 4PGCA 3HG1A 2MTPA 3G6JA 4WIQA 3ZDZF 2NW2B 3E6HB 4FRWA 2ADIA 2NTFB 1U2CA 5DYOB 3QPXH 4ODUA 1KXTB 2Y06H 3OMZA 4S2SA 5E56A 5F1KC 1BVKB 3SO3C 5IMMA 3BZ4A 4HC1H 5C9KA 4J4PA 1DCLA 3QUXC 2DQGH 1XR9B 3DMMD 2BY1A 3CU7A 2XA8L 2NY5H 3HPJA 4PJCB 2P5EA 3MRIB 1ITCA 4Y5XA 1J0KA 4KFZC 4ELMB 1EFXB 1V3JA 1FZOA 3SDAC 2ARJB 3GMNB 2ED9A 4NQCA 5T1MA 1ZAGA 3GB7B 4M6OL 4M61B 1G6RB 1CICC 3TCXA 5I1GH 1MCRA 3AS0A 1DP0A 2PO6C 1S7TA 4ZS6C 2DWDA 4Z7VB 4DZ8A 4XBPA 1LO5B 2DQCH 4NNXB 2Q7YB 2XT1B 2DYPA 3BMWA 2VR5A 2HJFA 5IF0B 3BHBB 4PRHE 5LGJB 4HUWB 4F15B 4H1LG 2ICEB 4GG8B 5CJOL 1KLGB 4HZAA 5IJKC 5ADOH 4QXTB 4EOWH 4YDJA 4BQ8A 3A6BH 5C0CD 5DHYA 3WJJC 4KPHH 4UT9H 1FNGA 1FSKC 5F9JA 2F54E 3RGVD 5IHLB 4J3XA 5IB1B 4FA8A 3WNKA 1NFDA 3BI9X 1B0RB 3P4OB 2N56A 2X9XA 5JHDE 3P9WB 4PLOB 4QTIH 3QJFB 1DUZA 4Z5RB 3VFMA 2CXGA 1QOKA 4NZTL 3LRSA 1NEZG 3SY0A 4P23A 3QEUB 2VZUA 4UU9B 3RWFA 1BEYL 4YEFA 1S8DA 1XIWB 3V6FA 5JW4N 1IILE 1QRNE 5CGMA 3RA7H 2DQDH 2BJML 1NANH 3MRQA 3SE4C 4M1DH 4WI2A 1N5AB 5DJ8B 2BY0A 4XPTH 5E00B 1R3JB 1NCCL 4NBXB 5GS0D 4JPVL 3VRLE 3NN8A 4U2ZA 4K3JL 5JW5A 4LEOA 3QNZB 1S78C 2IALB 5D7IA 2ADFH 2NW3A 5FYKU 3VXUB 4UTAH 1WWWX 2VDML 4PG2A 2W0LA 3QIUD 1JPSL 1U3ZA 3CNKA 3K4DA 5DT1L 3T1WA 4PJ8C 4WY7H 3R06A 3ARDD 4XPBH 1IGFH 3MXWL 2V2XA 4G43B 2XTJE 3I84A 4WENB 3LN9A 5HGBB 3WFBH 4AT6B 3GSNH 4GO6B 4XTRD 4M7ZC 5D71L 5JIHA 3RDTC 4OFYA 4APQB 3HC0A 2EEBA 1A22B 1S9YA 2NY1C 4U6XA 4BZYA 3PL6C 2X4NA 3BVNB 3ALPA 3C08L 3MV9B 3LHPL 5AYQA 3HZYB 4OZ4A 5TFSL 3UTZA 2PR4H 25C8L 1MY5A 2HJKB 4OLVH 1YN6B 4RAUB 1S3KL 3IFPA 4DOHE 4U1IA 1EEZB 5JPNB 4F9LA 5E9DE 4M03A 1JGLL 4JFYB 3O3EB 1N2RA 5B3JF 4BJLA 2A74A 5I15L 1BWWA 5I71C 5HVGB 4JFQB 1R3HA 5EO1B 3I3DA 2CQVA 3H0TB 5C92A 1DFBL 2XG5A 1S9XA 1YEFL 4YHPB 3PQYE 5F93C 5HY9B 1HEZA 5CEZD 4LVNC 3R4DA 4G8GA 4F2MB 3S5LA 4F7EB 5AAMA 1DQDH 5HHVL 5BRZA 2VXTL 1PYWB 5L9DH 4P4RB 4NQEB 1BJ1J 5DJ6B 2R2HB 2YKLL 4KMLB 1UZ6E 5T3ZE 3LN5B 5I1CH 1EO8H 2O5XL 2OX5A 5CMAA 1YNLH 4UTBH 1JHLL 1UA6L 3CSYA 4FXKA 1SEBB 3NOIA 2GK0B 1AXTH 4WI3A 4XBEL 2V7NB 3JWOL 4O02H 4UZGA 3DX9A 1A4KB 5C0NC 2AJYH 5GGQH 4F57L 5EU3B 2YUZA 4LP4A 2QHRL 5DF0A 4JFZL 2EH8L 4MLSA 3GSWA 4LLQA 5E99L 5GJSH 2H8PA 3PF2A 3CC5B 2D7OA 2DN7A 3NIGF 2Q6WA 2GAZB 2ESVB 1R3LB 3DMMC 3GMMB 5MEPA 4G7VL 1J1XL 4KZEL 3N85L 3VGAB 4U3XA 2AXHA 2DQHH 2MCPL 1T5XA 3MR9B 5DLML 3WV0A 1KGCD 3ZTJH 5E4EC 1LQSR 2ICWB 4V2CB 3QUYD 4RA0C 4X4YB 1IAKA 3EZJB 1F3JA 5EZIL 5FOBB 2IANA 2NX5B 2CMRH 2W60A 1GIGL 2J1KA 5CHNB 2KL6A 1NCUA 4HJJH 1S9WA 1ZXQA 2R2EB 4X0KA 4MNGB 4AY0A 4JO2H 5C07B 4I4WA 4OD3H 5ETUB 5EPMA 4WI4A 1FH5H 1XCQB 4XGZA 5D6DA 2X4QB 3K2UL 1YEHH 1D5BA 3WBDA 1IEAA 4XP1H 3ARTA 4G6JL 4KKCD 4X9BA 5SWZE 1JGVH 1S7RA 2NXYD 3RGVC 1P6AB 1MFNA 8CGTA 4YDVB 1K8IB 3T4YB 4OCRH 5F1NB 2H1PL 4LCYA 3PWVA 3TH2T 3KG5A 1RZGB 5IUSA 2X1XR 1P4BL 3V5KB 4XPAH 3DO7B 1VADB 2FGWH 3KXFE 1I3GH 1D5IH 1X5IA 3MLYH 4GKZB 2CRYA 2AV7A 5EU4B 3VXSB 4D3CL 1EDQA 2J88H 3W81A 1NCBL 3FFCD 2R23A 2ZCLH 2Z92B 3LRGA 4XRCA 1E28A 5ESVA 2BX5A 3MV8A 3GBNH 2JIXB 1I8MA 3WXWH 1XR8B 1DTUA 1N4XH 4URTB 1XF3B 4OLZH 4HQQH 3TIEA 5GS0C 3ULVF 4PJ5D 5ID1B 1TJHH 4YZFF 3VG0H 5DK0A 1KEML 1X7QB 1C08A 2DIBA 3ARDC 1BQHB 1JYVA 1A1MB 1DBBH 1HOCA 1LO3L 4Y2DA 2X4RB 4P9MH 3F5WA 3QA3A 4M5ZH 1AR1C 2APBA 4Z0XB 3PABA 1NUGA 2BXZA 5IBLD 3KHQA 3RVTD 4KUZH 3BGMA 3ARFA 3V6OC 2VDRL 2X9YA 4ZG1A 4LSDA 3MRPB 4XP9H 3RKDD 3MTRA 4QXUH 1QBAA 1A6UH 4LCUA 1DBMH 3OZ9L 4YEEA 5I1LB 5J12C 2RHEA 2EH7L 4HIIA 4L8SA 4MWFA 3UAJC 1F02I 3O6ML 5AZEL 4QRRD 4Y4KA 5IW6A 1E4JA 5MENB 2EKSA 4LAQL 3ROOB 3HE6B 2V7HA 3UTSD 3UJJL 1OD7A 5GIRB 3HNVL 3HZVA 4IRJD 4DGIH 2Y36L 3REWB 1FFOB 5EU7E 5EBMA 3OGCB 3RWHB 3NIFE 3S34H 1DVFA 2B4CL 1LWRA 3LKQB 1LMKA 3T2NL 1TVBA 5GHWH 3IFLH 1GCFA 1JK8B 3PGCA 2WIMA 2R0LL 2MQ0A 4BZ1H 1U8LB 1OGTB 2LE9A 4ZAKA 3X3FH 3ZT6A 2ITDA 3W11D 3U9UA 5FKAA 1MUJB 1RQ5A 2WLYA 3WEXB 3O41B 1X5YA 3O9WA 1YUHA 1WIOA 2X09A 1I9EA 5LGHL 4LSVL 4NJAH 3GMQB 1I9RH 5DJZA 1VEPA 4OZHE 2HWZH 1H5BB 3ALXA 1YNKL 2VZSA 3BOVA 4H1LA 3VXNA 3DOSA 3VGEA 1OTUD 3AU1B 2ZPKH 3P73B 4MVBC 4TOYL 4L8CA 2DLFL 3NZHH 2W0PA 1JGDA 1H15A 1Y18A 1LDPL 5E9DA 2P42B 2OCFD 2GJZA 3O2WH 4GKNA 5L7XH 3UCRA 2IBZX 4QHMA 3NABH 4DQOL 5J6HA 2NY4D 2FWOA 4YX2L 4AG4L 2I24N 5KZCB 3V0WH 1OGAD 4P57A 1WV7T 1S7XB 4B53A 4M1CD 4U0RC 3QPQD 2DMCA 3PQYA 4J8RA 1UCBH 4ODTL 4RCAA 5IB3B 1EA9C 35C8L 2F53B 5FYLE 5EU6D 1U3HD 2C4XA 1NEZA 5HBBA 5DK2A 4LL9A 1A7OH 4PJCE 2FIRT 2W65B 2HRLA 2KPNA 4OD1L 3UTQB 2XZQL 1AD0B 3SO3B 4ELME 3QUYC 4UUJB 2DDQH 3QUXB 4TULL 3RAJL 3D0VB 1FV1A 4ODHH 4LHJB 4Y8AA 5DMGD 3WFHB 5GRJH 2VOTA 4Z7VE 5FHAH 4JPWL 1KCRL 1NGWB 4PUBL 5C0AD 4G3YH 3SDAB 1GJIA 1T22A 1UVQA 5DQ9B 5DQJB 4R2GD 1CICB 4PP2A 2X70B 5I1EH 2PO6B 2XNAA 1U6AL 3NPZB 4Y16D 5K33A 4FABL 3MACL 3M8OH 3TBTB 1HXMB 4S1RH 1I8IB 4DN3L 2VAAA 3DNKA 3LZFL 4KKCC 1B0GB 4PJ9C 4PTTA 4BK4A 5L8JB 2H3NA 2NXYC 4HLJA 4RGNE 4D9QD 1K85A 3RWCA 1HCFX 1IGIH 3I02B 2FD6L 1JWMB 1KPRA 1O7SA 1HINH 3L5XH 5DSCB 1YEIL 3QDAA 4M6ML 4JHZA 2AJSL 2YN5A 4JQVA 1R0AL 3IGAA 3ES6A 5B3NA 1OTTD 2MWCA 5BS0B 4JKPL 4AEIL 3QEQD 4I3GA 4M1GH 5CLWA 1KLUA 3SKOA 5IV2A 4MYWB 5D1QD 3EZ8A 3ULUE 3OKDA 3VI3E 5ESQA 3O6FC 1G7MA 2LVCA 1Z9SA 5BV7B 1IQWH 1ZEAH 2YD3A 3LH2L 4KJQD 3NFNB 3B3IB 1FP5A 4ORGB 5EN2B 2EIZB 1U8JB 4QCIA 3PDOB 1KENL 4G5ZL 4K9EH 3RTQD 3WFCH 4Z7NE 1RUPL 5IR1A 5DFWH 2Y25A 1JGEA 3TJEL 1CFTA 3C5SA 4PV9A 1EUUA 4ODWB 1D6VL 2GTZA 3V95A 4H25A 2D0GA 3IJHA 5C8JB 1SVCP 3LQZB 2DQEL 1GC1L 1A6TB 4BFGA 4P9HH 4YO0B 1N6QH 4IS6B 3C8KB 4N0YL 1QVOB 2DICA 2EKJA 2IH1A 4XZUA 3CVHA 3KXFA 4NC1E 5DJDB 4BUHA 1M05B 2CUMA 3H7LA 2J3SA 3QUZD 3U7AA 4N1EA 3RVTC 5FB8A 1Q0YH 2E7MA 1P7KA 1B2WH 3BJLA 4LPWA 4PRNA 2YD8A 4R97C 4YNYA 3GI9L 4WDIB 3RKDC 3G5YA 3SGKA 3P4NA 2OTWB 3BGFB 4W6WB 1XF1A 3AM8C 4OCMC 1CFSB 3MV9E 1JUFA 3MLPA 2Z31D 3HI6H 4R9HA 4NNPH 1T1ZA 5GS0H 4TVPL 1LEKB 4AL8L 3GSXB 2D7TL 2J4WL 4DFHA 5D2LB 3OKOA 1Q9OA 2NY1B 4H26A 3MYZA 5GJTH 3CFDB 4ZXBD 3BKYH 3BWUC 2L7JA 1MI5B 3HZKA 1IVLA 3HCVB 4M93C 4S0SD 2IPTH 2ZCKH 4GRWF 5F71A 4HIEA 1PDKA 2IH3B 2JB6B 3LEXA 4OGZA 1YPZA 1AQKH 4RGMB 1N64L 3B9KD 4HXBH 1T1XA 5DTFB 2KDGA 4NC0B 4JO1L 2JB5L 5I71B 5F7HA 1IC7H 3W11C 1MLCB 1H0DB 1SEQH 4OI9A 5C3LD 1XAUA 3L5WA 5EWIH 3SKUD 2NCMA 2VTFA 4LVNB 3I2CH 4X6CA 1WLHA 3T8XB 1OQOA 3RIFK 2FLRT 2ZOLB 4NC2B 4WNQB 1SVZA 1OTUC 1KEGH 3ZYIA 3EO1B 1OW0C 3KNBB 4RISH 1YEEH 5INDA 3MLSH 4LVHB 4Y4FA 2APWA 1JIBA 1IGML 1KN4L 2YPKB 4DZBB 1GZPB 2IBZY 1OF2B 2D4FA 3AY4A 4X6DB 1BX2B 1U8IB 3BP4B 4N90D 2NY4C 4C54A 5MEOB 1HSBA 5BZDA 2YK1L 3P9MA 1Z2KA 2FX9H 4N1HB 2A6IA 1MHEA 1PJ9A 3A0OA 5AG8A 5HVHB 1FHGA 5DVNA 2YPLD 3QPQC 4HUKB 5CEZH 5ICZA 3NACL 3MRBA 4X8JA 2I27N 2XWJA 2VDQH 4ZPVA 1HHIB 4TYUA 4C56B 3KWWB 3L5JA 1U3HC 2ESVE 5FXCH 1PG7H 4OZFH 3KLSA 3IFNL 2X4SA 4OV5A 4I18A 1BJ8A 4J3VA 1BQHG 4LU5L 3VGHA 3OJ2C 3GSQA 4FXLA 4BKLB 3LRHA 1T83A 1INDL 4OZIE 2IAMD 5I18L 4HXAL 1HQ4A 2EZ0C 4OZHA 1KJVB 1KNOA 2DF3A 2M2DA 2J6EH 2NX5E 5DMGC 4XPFH 5LGKA 2DQIH 4QHLA 3N1PC 1X5FA 4FHBD 3D39A 1D5ZB 3SGDH 4Y16C 2VDOH 2V9TA 3L7EA 2W0FB 1DANU 5F3BB 3E6HA 2NW2A 2NTFA 3QCVH 4XWGH 5D7SH 1OM3L 4Z77B 5DYOA 1Q8MA 3WNMA 1WTLA 1RVFH 1BVKA 1JNNH 3BGAA 4JKWA 3PXJA 3KJ6H 4YK4C 5DJ2B 1XR9A 1G9NH 2R29L 2EDYA 4PJCA 3MRIA 5C0CB 4P2QE 4K2UL 3L9RB 1EFXA 4M9PA 1OTTC 2ARJA 1NKRA 3GMNA 3FHQA 3GB7A 1W72H 4M61A 1G6RA 4U7SA 1MAJA 3ULVL 5EDXA 5J8OA 5D1QC 5I75C 4GSDL 4Z7VA 3QYCA 2XQBH 3VXSE 4HT1H 5TE7L 3CZFB 1ZANL 1ITBB 1LO5A 3CPLB 2YD4A 4NNXA 1A6WL 2Q7YA 2VDPL 2NXZB 4K94L 1L7TL 3DUUB 2NTSP 2JLLA 5IF0A 3BHBA 5EC1B 5LGJA 2EXWD 4HUWA 1F5WA 2ICEA 4GG8A 1T7XA 1BZ9B 1KLGA 4FQPA 5SWSB 4QXTA 2YMXH 2A73B 3EYVB 2J8UE 1C5BH 3C60B 5HDLA 5HHOD 3QUMH 3RTQC 1TQCB 4HUNB 3ZTJG 5A2JH 5FV2A 1UEYA 5FYKL 4NOFA 3V6BR 4YE4L 5JA9A 5IB1A 1UQSB 1K6QL 5FUOL 4D9RE 4LCWA 4X5XA 1B0RA 3EYSL 3P4OA 4MXWH 3EDKA 1A9BB 3N1FC 2DWEB 5MEQB 4OQTH 4PJAB 4OT1H 4TSCL 4Z5RA 2CK0H 3U1SH 4U3HA 1T89A 2MOVA 1F3RB 3C5ZC 1AGDB 3QEUA 2DM2A 3ARDB 3QUZC 4R4BB 3WIHH 5DMYA 5FGSA 4I3SH 1XIWA 4F7MB 1DE4A 3MV7D 4LHUA 4PP1D 1A02N 5IW1B 5DXWA 1N5AA 5DJ8A 1IAIL 4JG1H 5LJYH 3MRNB 2Z31C 5T5NG 1QBMH 4X7TB 5IG7B 3VFNB 5E00A 1R3JA 1U8PB 4YFLF 1E6JH 3B6SA 2VXVL 3QNZA 4ZXBC 1HH9B 4W70A 5CZKA 2IALA 4YPGB 2BXYA 1BIIB 1WK0A 4ZNEA 3RFZC 3VXUA 2FATL 2FYYB 4DJMA 1WBXB 1YMHB 4P2OC 1VENA 4CAGA 2CJUH 4G43A 2WWKT 3B9KC 3HNSL 3K1DA 5HGBA 1WF5A 4RWYL 4AT6A 1QFHA 2VLJB 1DEEA 4J6RL 1YY9D 4KKAD 2D03L 3SQOL 1U8HB 1EV2E 2ICWJ 4IM8A 2P47B 5IT2L 4APQA 3ZL4H 4WFHE 1KOAA 5GISL 3HZYA 2XN9D 1EFQA 4U1SB 5F7EH 5FM5M 4LCIH 1I1FA 3DUSB 4QNPE 2CD0A 4NO5A 1CXFA 2F5AL 2HJKA 4D94A 1YN6A 4RAUA 5MHSD 4JEGB 5E0QA 2FJHB 3TO2B 3G5ZB 2WW8A 1EEZA 5JPNA 4ALAL 4JQXC 5CUSH 1RURL 3O3EA 1NBVH 4BQBA 2XA3A 2HFGL 2PF6A 5E08L 5EO1A 3QDHA 3H0TA 3QDMD 1YPZF 2XTLA 2WBJD 1URLA 1WCQA 4MXVF 4YHPA 5HY9A 3QULB 4O58H 4F2MA 1LDSA 1VERA 5E6ZA 1CDBA 2IPKB 5GGRY 5HPMB 4ZOBA 5DD3H 5IQ9B 1PYWA 1VACB 4P4RA 4KHXL 5IROA 4U0RB 4NQEA 5DJ6A 3VE0B 2R2HA 3O4LB 3V4UH 1RJCA 4LSSL 4LASH 2IAMC 3LN5A 4X6CF 2GSIB 4AQOA 5I1DB 3JWOC 4HC1A 3P0GB 4POZD 1SEBA 4QHKI 3AGVA 1FGNH 4LSPL 2GK0A 3AFLA 1FLTX 3OAZH 4PREB 5E6IB 2V7NA 3DI2B 3MJGX 5DO2C 4MJ2A 5GRZA 3TZVD 4NZUH 4GMTL 3NTCL 1I9JH 1ES0B 1A4KA 4UILL 2NY6C 3I6LE 3RQ3A 2BVOB 2J5LC 4JY5H 3GSOB 5EU3A 3KPMB 1FDLL 1VFOA 1MHCB 4KHTL 4M7LH 5D8JL 5GGRB 4FXGB 4NO3B 4IMKC 2DBLH 4MCZB 1II4E 3JSSA 4UT6L 5CZVH 2Y7QB 4J3TA 3CC5A 5IVZB 2CRIA 4XXCC 3GMMA 1R3LA 2ESVA 1ZT1B 2ZJSL 3QXWA 1CXEA 3MR9A 1IJ9A 4PJ9B 5I74C 1W8OA 3EOTL 1U95B 4KJPD 4LRIA 2ICWA 4XPGH 1U8NB 2AI0L 4FQLL 3ZDXF 5TPWL 5BS0E 5C0FA 4X4YA 4HAFA 3QEGL 5FOBA 2GK2A 1IAOA 2NX5A 3BD3A 4FQ2L 3QHFL 5CHNA 2JCCB 3F6LA 1CS6A 5L2KA 1J11A 2K3TA 2R2EA 4JR9L 5IVXB 4MNGA 5C0BB 5DUBB 5C07A 4L9LB 5ETUA 2VSDA 4E5XB 3D6GA 1WT5A 3JVGC 2EXWC 3OG6B 4MNHB 1XCQA 3O6FB 2X4QA 3FFCB 2OJZL 4ZFFB 1S9KC 1NC4D 2XA8H 4O2EB 1XGYL 3HE7D 4ZO8A 1VSCA 1J5OL 5C0IB 4ZS7H 3V8CA 4HMDA 5KSVB 4I3RH 4YDVA 2R4SH 5K9JL 1K8IA 2H26B 3T4YA 5F1NA 5F72S 5JDSB 4PJCF 4Q58C 1C16A 5C3TA 2VZ1A 2EDTA 5LBSL 5KSAB 1RZGA 3MBED 4JDTL 4UDUB 2UZYB 3C8HA 5D72L 1PKQB 3KPQB 3EYUL 3V5KA 5EULV 3HFML 4K7PX 3DO7A 1VADA 5B38A 4H0HB 1PD6A 2HFTA 4GKZA 1N59B 2CR3A 3FB6B 5EU4A 1RIHL 5CJOH 3BXNB 4LF3B 5HHPB 1NUNB 1OY3B 2Z92A 1D5MB 4DGVL 4TNWK 4QYOA 4KY1L 5H35B 2V5YA 2P44B 3F8UB 4R7DA 2JIXA 4TN9A 4W4OA 3WLBB 2P8MB 3GSNA 1XR8A 1XF3A 4OIAA 1JI2A 4NBZB 4R97B 4NJ9L 5M7QA 2OJEB 1B88A 4WFGE 5BW7C 3KPRA 3M07A 1BFSA 1CLZL 5ID1A 2P24B 3O45B 1BZ7B 1JWUB 4FFYL 3PUCA 3UP1A 1G7QB 3K74B 4KTDH 1I7ZB 4QRRB 5L0QC 1X7QA 2P8LB 1AO7D 1RK1B 1MI5E 4XP6L 5IQ7L 2CLZB 3GKWL 4YXLL 1BQHA 2Y4SA 1BEYH 1A1MA 1E0OB 2CDGB 2X4RA 4ZFGL 1OWRM 1HZHL 2GJ6D 2XFXB 4DK6A 1BQLL 4Z0XA 5H2BB 5D7LD 3V0AC 4KKAC 2P45B 4M93B 3ME0A 1BJMA 2ZSWB 3H9SB 3HN3A 3ETBF 1NCCH 4DCQB 4TVPD 3MRPA 4JPVH 1V7ML 2PXYD 3DVNB 1A6VH 3IKCB 4NRZB 3VRIB 3ABZA 5I1LA 4K3JH 2AV1B 2K7PA 4JVPA 4WUUD 2R15A 1DANT 4OLUL 4HV8B 4XVJH 5MENA 1JPSH 5DT1H 4TPRL 2B4CC 3ROOA 4Z7UF 1RZJL 3HE6A 1UC6A 1INEL 1CT8B 1FFQA 5JXAL 5GIRA 1HI6B 4F3FB 4PTUB 3REWA 4RGOL 1FFOA 3SDXB 3RWHA 1Q38A 2FGZA 4PJHF 3LKQA 3QAZC 2VN4A 3CLFL 2IMMA 1FE8L 2WBJC 3MLZL 3N1GC 2BMKB 3TA3D 3VXMB 5CJ5A 1U8LA 1OGTA 1MJUL 2NY4B 3KYKH 4NRYB 5C2BH 4JRYD 1OGAB 3LHPH 3DXAB 4V2BA 2MHAB 2FZ3A 5ICYB 5TFSH 5M95B 3WHE1 1MUJA 25C8H 1DQTA 3WEXA 1XF2B 3O41A 1QACA 4QRQA 1S3KH 1H3UA 4POZC 1H5BA 4PGBB 1CR9L 3VXPB 5A2FA 1JGLH 3OG4B 4OF7A 1FPTL 5CIPB 3P73A 3WE6A 3O2DA 1MOEA 3D3VD 3LS5L 5FKPB 2QL1A 2GKIA 3TZVC 3BPNC 5T3ZL 1DFBH 4CBPA 1YEFH 5HGAA 1U9KA 1K5NA 1UM4L 4OM1H 2CIKB 2DL9A 5HHVH 2VXTH 3FB7B 2BRQA 1S7XA 4PJDB 2R69L 3HG1D 5IB3A 3MJ8B 1JFQL 4OCXL 1E4WL 2F53A 4QT5A 2O5XH 1GAFL 3OKNB 1JHLH 1UA6H 1IGTB 5DUPH 4ISVB 1MWAB 5F7MC 2W65A 1U8OB 2Y5TB 4XBEH 3X3GL 5I16B 1G7PB 5T1KB 1AD0A 3JWOH 4BH8B 4KJPC 2QQLH 4PY7B 2PW1B 4OBRA 4L5FL 2IADB 4UUJA 3QUXA 4YK4B 3WSQL 1AD9B 4WO4B 5GRWA 3D0VA 1P5UA 2P5ED 1L0QA 1SYSB 3WFHA 4FP8L 4F57H 1LEGB 1NGWA 2QHRH 4HBCL 2BNQB 3SDAA 1A7QL 3CDCA 5DQ9A 5DQJA 2GCYB 1CICA 5JW4R 2X70A 4ENED 2PO6A 5JNYB 5I1KL 3ZT5A 2X05A 1KYOK 3TBTA 4FZEL 1HXMA 4LRNL 4G7VH 2DYPD 4KZEH 3N85H 5SWSE 4LDLB 4DVBB 3HE7C 5FGCB 1B0GA 2BRRL 4JREC 4Z7QE 2QV2A 3RWDB 1JPTL 1OT1A 1FG2B 2JF1A 3I02A 5IJKA 2FJFB 1JWMA 5EZIH 4JFDB 5FF6B 1QLFB 5DSCA 3RPIB 4EXPX 3RTQB 1GIGH 2OLDA 4NGHL 1OVZA 1MRDL 3MBEC 4K7PY 4EDWL 3K4AA 2HTKC 3NZ8B 1TDQA 1MCLA 3D69B 4QWWD 3RIAF 5BS0A 1WVZA 1VFBA 1CXKA 4WTXA 2VJXA 3KS0H 3R1GH 4NUJA 3UC0L 3WNOA 1MFAL 5ALBH 2ZOKB 2KQMA 3ZDYE 3K2UH 5DUMH 5FM8A 3QDJE 4PJBB 1CGSL 2H2PD 3UTOA 4G6JH 3NFNA 3WNPA 2ENYA 4P23D 4RQQB 5SX4I 4ORGA 3C5ZB 3QFJD 5EN2A 3VFOB 3P40A 4M4RA 2DM3A 2WZPD 2EIZA 3QUZB 1U8JA 3DX7B 3CVHL 4DUWA 4ZTOH 4NBYB 5FYKD 3DIFB 4Q9CA 3PDOA 1HSAB 5E5RB 1MRCL 2P5WD 2H1PH 3QWRA 4JRXE 4NT6B 2A38A 5CEXB 1KG0B 2OK0L 4JKLA 3ZYZA 1E4KC 1Q72L 3SE4A 1P4BH 3FQNB 4G6FB 5JR1L 4JCMA 1GC1C 2QQQA 2VXSL 1P6FA 3K46A 1JMZA 5IFAH 1EZVX 4ORZC 3QO0B 2E3VA 4OV6F 5KW9L 5C8JA 3V4VH 2MCG1 4D3CH 3LQZA 5CKAA 1A6TA 1NCBH 3CDGB 4YO0A 5I30L 4J23A 2C26A 4IS6A 3C8KA 43C9B 1QVOA 1ND0B 3QUKB 3O11B 5DJDA 3ESVF 5DC4B 1M05A 3EYOB 4ZNCD 2VLJE 1YY8B 2CDEB 4P2OB 5IVNA 1VESA 3VWKD 3ZKXC 3E1F1 3BUYB 2LAAA 4WDIA 3VD4A 4PLKD 1J10A 2YPVL 2OTWA 1MHHB 4MA3B 3LCYA 1CFSA 5ITBL 5C08B 3CXHK 4OFYD 4PJXA 1LEKA 3GSXA 1KEMH 5D2LA 4RMUA 1JCKA 1FYTB 1WEJH 1RI8A 1LO3H 4WHYH 3DSFL 4L3ED 1GSMA 4CN6A 4CJ1A 3CFDA 5KS9F 1P4LB 5FUZL 4X8XA 1MCKA 7CGTA 1IGCH 2FEDC 1MI5A 1T7YA 4PRBB 3HCVA 4XNZC 3WHXB 3HUJF 1F13A 4R90L 2IH3A 2JB6A 3PXHA 2VDRH 3VFUB 3U2SB 3TA3C 3O2VL 3C2SA 2F8OA 3TP4A 3GGWB 5DTFA 3LPFA 2QADB 2R1XB 1MLCA 1H0DA 4ZQKB 3D48R 4OZGF 1KIPB 1L6XA 3PNWB 1WBZB 5AZEH 3UBXA 3O4LE 4KMTL 4LAQH 4LLVB 5BRZD 3T8XA 3WO3B 3QH3B 4PJEF 4NM8L 2Y36H 2VITB 2WQRA 4WNQA 1IC5L 2DQUH 1WBYB 4M6AA 2B4CH 3EO1A 4FQIL 3KNBA 5I9QB 1ZA6B 4DZBA 1GZPA 1EHNA 2V17L 4QRPB 2DIJA 1OF2A 1KFAL 4X6DA 1HH6B 2R0LH 3A6CH 1BX2A 1U8IA 3BP4A 5MEOA 4LARH 5BVPL 1H3PL 3LEYL 5EC2B 4GQ9L 1ZT4B 1EGJA 3N1QC 5D2NC 4L8BB 2NY6B 5EUOB 2J5LB 3LN4B 2BZDA 1QR1B 3T0ED 5FIEA 3OB8A 1HHIA 2R0KL 4JVWA 4C56A 1I8LA 3KWWA 2QSTA 5F7DB 2P8PB 2ARWA 4JGMA 4NO0B 3VGGA 4KJYB 4AQ1B 4HSQA 4BKLA 4TOYH 2DLFH 2F5BH 4NUGL 5CD3B 4GAFB 3CD4A 4WJ5B 1KJVA 1ZVYA 2AXJA 1LDPH 5TF0A 4Y5XC 1H3XA 1OLLA 3MRFB 1EVUA 1IARB 2JCCE 3QRGL 3QXTA 1IAII 3AMLA 4AG4H 4AEHL 1U8KA 4OCYL 2P4AB 5IVXE 5C0BE 3BWAB 5E2WL 3TN0B 2NY0D 2I60L 3LAFA 3W0WB 2BHZA 3NPSB 5JUEL 4ODTH 2VDLH 4HS3B 35C8H 4JO3L 3ALWA 1G6RL 2AK1L 4U1JB 2G9HA 3DHJA 5F3BA 5E94B 3LSOB 4NKOB 4Y5VC 4EBQL 4Z77A 1JP5A 3NVQA 4Y19E 4RFNB 4OD1H 2XZQH 2IQ9L 5ICXB 4YUEL 5BO1L 4ZD3L 1DLFL 3PV6B 5DJ2A 4ETYA 1VKXB 3IRPX 3P30H 5DURB 5C0CA 4GS7C 5CILL 1QSFB 3L9RA 4JPWH 1KCRH 4PUBH 4X80L 3RGVA 4QWWC 1TCRA 1PKQE 3HI1B 4WV1B 3OAZK 3DSNA 5GGTA 3FQUB 5T5NF 1U6AH 3QXAB 4FABH 4XCNB 3MACH 3TPKA 4M02A 3VW3H 1KYOJ 3JWNC 3CZFA 4UOJA 3CPLA 4DN3H 3FB5B 1MFEL 3BZFB 2KKQA 2H2PC 3LZFH 1RZKL 4WUKH 3T3ME 3DUUA 4KV5F 4P23C 2O61B 3CIQA 5EC1A 2FD6H 2BVTA 3ULUL 2A73A 3EYVA 1YEIH 1NFKA 4PRHD 1F45A 2BCKB 5I17B 1R0AH 3PP4L 2YWZA 3QNYA 4YHIB 2G60H 3IRZA 4JKPH 3TVMD 4AEIH 4XP5L 1J0ZA 1UQSA 4FTVB 2QKIB 2O93L 2F54D 2WLZA 3DURB 4F8QA 1A9BA 2DWEA 4PJAA 1KXVC 4FQCH 3LY6A 3GMOB 4PG2C 5L0QB 3DO3A 3NCMA 1VFAB 2PN5A 2C7UB 5JHDD 2QQNL 1C7SA 5LAXB 3ARDA 4R4BA 3VWKC 2NZIA 1KENH 2AEPL 3O0RL 3H9SE 1AJ7L 3FCTB 3PHOB 4MAUH 5I6XC 4Q9RL 4FG6D 3MRNA 3BYYA 1CU4L 3ARSA 1QRND 4PJFE 4X7TA 3ARFD 5IG7A 3BISA 3FONB 3MRCB 3V6OA 1U8PA 4J2XA 1D6VH 2DRUA 12E8L 2DQEH 5FM5O 1GC1H 1GOGA 5EZJB 2VC2L 1HH9A 3BD5A 4YPGA 1BIIA 3KYNB 2OYPA 5T3XE 3SDXE 4FOMA 4HUVB 2FNBA 1WAAA 4M00A 1CQYA 2FYYA 1WBXA 1YMHA 4HWEL 4S1DD 1FGVL 4PD4K 1OB1B 4LPUA 4WHDA 4U1LB 5CJQL 1DQLL 1DVFD 3VXME 4GAJL 2VLJA 4H88L 1U8HA 3DXAE 2XTJD 1D9KB 3CXHJ 4YR6B 3QDMB 3TWCL 1GGIL 4TVPH 4M6NH 4AL8H 4DUXA 2J4WH 2YWYA 4JY6B 1UXSB 3L95B 4FZ8H 3FN9A 3HA0A 1KB9J 4MD0B 4U1SA 1YMMB 4PJXF 4OZFA 3DUSA 4P5KB 3O9WD 5D2LF 4FMFA 4GW1B 5CSBA 2JJTA 5GRXG 1LE9B 3HC3H 1B6UA 1SBBA 2FJHA 3TO2A 3G5ZA 2PYFB 4KJWD 4NKMB 1QO3B 2AQ1A 1IKFL 1MVUB 3R8QA 2W07A 3U83A 3AROA 4U6YB 4JO1H 2ZZUT 2DQGL 2B0SH 2XRAH 3BDYL 3TZVB 1Z5LB 5E9DD 3CH8A 3V0VA 3BPNB 3INUL 4PJDE 4YHML 5CP7B 3T0EC 3QULA 5C0DB 3SGJC 1IFHL 2IPKA 5HPMA 3RL1B 3H3PH 1VACA 4GW4A 4XNXL 3PQYD 5JPMB 4HLZH 3VE0A 3O4LA 3EFFB 43CAB 5MERB 5I1DA 2GSIA 4KK5D 1J18A 2ZUUA 1J12A 1IGMH 3C2AH 1KN4H 2I26N 1AY1H 3KPOB 2NNAA 1M7XA 4LQFL 1J8HE 3GSRB 3PWNB 1W0VB 4YBQD 3ARGD 5T3ZD 4PREA 5ISZB 5E6IA 1XGQB 3DGCR 3UTTB 1HCVA 3IDNA 1I8KB 2BNQE 2YK1H 4S10A 5EUKB 4NN5C 5ADOL 3A6BL 1ZE3C 1ES0A 2X1QA 3NACH 4X6DF 4UT9L 3GSOA 1U92A 3DHMA 3KPMA 2M8XA 1YEJL 4XPHH 1MHCA 1M7IB 4MX7A 5DEZA 1NPUA 1TTGA 1OSPH 4FXGA 4HWNA 4NO3A 5FGCE 2ORBH 5D1XC 4MCZA 2ZP0T 2Y7QA 3NCEB 5EZLA 4NP4H 5IVZA 2WBWB 5E8PA 3G5XB 4HXAH 1AE6L 3MUJA 1ZT1A 1L9NA 3Q6GH 3K80A 5KN5A 4JFDE 4EDXB 4TQEL 3VH8B 4JREB 4PJ9A 3MGTB 2Q86B 1U95A 1LP9B 1WUNT 4OKDA 5ACLA 1J1OH 1NKOA 1U8NA 4ZFOB 2NR6D 1N5YL 3RA7L 2DQDL 4MQ7B 4M1DL 1MHPL 2JCCA 4U1NB 1KPUB 1KN2L 4JO4L 4LMQE 3FFDB 2UWEF 1EJOL 1QLEL 5IVXA 5KVGH 5C0BA 5DUBA 4YGAB 4OQTA 5FGBA 4L9LA 4NN7C 1OP3H 4E5XA 1KIQB 1H3WM 4MNHA 1GGTA 3O6FA 3FFCA 5F9DC 2VNCA 3LS4H 4HH9B 4P3CH 4ZFFA 3WIHA 1JZ3A 4O2EA 1A8JH 4KRMB 2QQKH 4TSAL 4K2UH 2O5YH 4JN2B 5KSVA 3TVMC 2HMID 3JXAA 4RA3A 4JB9H 4EXKA 2H26A 1MIEH 1KPVB 3LMJL 4HIXL 5JDSA 4NZDA 4GSDH 5SWZD 5IESL 1ZGLP 1J05B 5KSAA 3BN9C 3D1MC 5TE7H 4UDUA 4S11A 3L3GB 1BAFL 1PKQA 3KPQA 3IJSB 1F4WH 5TDPB 2P1YA 4KDWA 1BM3L 1L7TH 2DLGA 1N59A 1EBPA 3FB6A 3BXNA 4LF3A 5HHPA 4R7NB 5DFTA 3CX5J 4I8DA 2PR4L 3KXFD 5C7XL 1D5MA 1CFQA 1JWSB 2BOCB 3DI3B 3MUZ1 5H35A 2V2TB 4N9OB 1KJ3H 1RUAL 5D7LB 5EIQA 5FYKH 5J13B 4FG6C 4YE4H 3WLBA 3QJHB 2P8MA 5ALCH 3ARFC 3TNMB 3V9FA 2HVJB 5C08E 4JCLA 3ZKXB 2AAVA 5FUOH 5D96C 2OJEA 3EYSH 3G08B 3NIDE 4DUVA 2VABB 2P24A 3O45A 1BZ7A 1JWUA 1FYTE 4L8SC 4TSCH 4CN4A 2WANA 1G7QA 4K3HA 1HWHB 5D5MF 1I7ZA 4QRRA 1XGTB 2E27L 2P8LA 5ANMA 4DK3A 1RK1A 1AIFB 2CLZA 3CFBB 4PJAF 4IRZL 4P48A 2AK4B 1S7QB 4MDJB 1DVFC 2XFXA 3S96B 5H2BA 1FLRL 3MRKB 4LSQL 1DQJB 1EEQA 1IAIH 3C6LB 2XTJC 2ZSWA 1NCAH 3H9SA 1AXTL 1L0YA 3MLWL 4JY4B 3TA3B 4DCQA 5JW3L 2X4PA 4KVCH 2AJXL 4O02L 3DVNA 3IKCA 4NRZA 3VRIA 2VXVH 4JRYB 3UJTL 2AV1A 1RZJC 3CSPA 3Q3GB 1EPFA 3GEWB 4U6HB 4HV8A 2AJYL 3O9WC 1MCOL 2FATH 4I9WE 4GAYB 4HKBB 2CKBB 4MA7L 4OM0L 3NCJH 1A0QH 3RX8A 1CYGA 2C1PB 3JV6B 3U46B 1CT8A 4PD4J 4KJWC 1HI6A 4F3FA 1QQDB 3DARA 4PTUA 3HNSH 5AZ2L 4QRPE 3SDXA 4RWYH 1WAAF 3F58H 3H8NA 4XVUC 4RMSA 4RFEB 1OW0A 4Y4FD 4X6FB 4CVZB 3D3VB 4J6RH 3SQOH 2DQHL 3HB3D 1X5JA 2XV6B 3LDBB 5SV3A 3ZMRA 3O2DL 5IT2H 5E2VL 4POYA 5EUOE 1CTOA 1MH5B 2BMKA 3VXMA 5IWLC 4Z7OF 2EYTB 2VLRB 4NRYA 2X42A 4K71C 2OR9H 4ZO7A 2GTWB 5LWYL 1F4YL 1OGAA 3DXAA 3BPOC 2MHAA 5ICYA 4NQSA 5HHQB 1BOGA 4HJJL 2F5AH 1XF2A 2HT4D 4F7TB 4TUJB 4KK5C 3BT2L 3D25B 1QSEB 3BKCH 3UZEA 3BIKB 4XCYB 4ALAH 4PGBA 4Q7DA 3VXPA 3G6AA 4YBQC 1RURH 3ARGC 4NWTH 1FH5L 5CIPA 2EIBA 5LKNA 5TF1L 4GRLB 4MQSB 5FKPA 5F89B 3B43A 4L4VE 3W0WE 1A7RH 4R3SA 3LVEA 3IU4L 1JGVL 1MRFL 3MSPA 1OAUH 4HS6B 4PLJD 2CIKA 2A6JB 4MSWB 3FB7A 2HJLB 4PJDA 2N7AA 2X89D 2CK2A 2W9LA 3IT8D 4LSSH 1LEIB 3MJ8A 1T04B 4XVSL 5DMKB 4XPAL 1V3LA 3KR3L 3OKNA 4OCSL 1CN4A 1JTTA 2FH8A 1IGTA 4Y5VB 3MJ7B 5EB9A 1MWAA 4NYLB 3O3AB 3MLYL 4LSPH 1RIVH 1U8OA 2Y5TA 3R0NA 5I16A 1G7PA 3L3KB 5T1KA 1QSFE 4BH8A 4YJZL 4PY7A 4OTXL 2PW1A 4OCLC 3I75B 2ZCLL 2IADA 2VLKB 1NLDH 2NR6C 3PWJB 4WO4A 4GMTH 3NTCH 6FABH 2EC9U 1O7VA 4UILH 1OOAA 3SDDC 1SYSA 3KPNB 1EFXD 4GS7B 1LEGA 3M17B 1PX4A 3A67H 1FDLH 2BNQA 1QUNA 4KHTH 1I3RB 2GCYA 4NHCL 5JNYA 5D1QA 1T1WB 3ULSB 3Q1SH 3RUGB 3FO9B 5E5MA 4AIOA 2ZJSH 3VG0L 4XWOD 2PYEB 4JFFB 3QT2A 4DVBA 3QFJB 5BV7L 1FCCA 5IJVB 3EOTH 1BD2E 2HMIC 1DBBL 2AI0H 4FQLH 1QKZL 5TPWH 1X5GA 1FG2A 2O26U 2FJFA 3CDYA 3QEGH 4JFDA 4YHLL 5FF6A 1JRHH 1QLFA 1QPXA 3RPIA 3RTQA 4FTVE 4FQ2H 3QHFH 4RGND 1CIUA 3D69A 4JR9H 3FOMB 2Q20A 4JZOB 3IS1X 1WICA 5KAQG 4QRTB 3MNVB 1MPAH 3FN0L 4CGTA 4QXUL 4C59B 2J8HA 3S35L 3VFTB 2ZOKA 2ZSVB 4ZODA 4WTZG 1MCFA 2OJZH 4PJBA 3B8YA 1XGYH 1EHAA 3ARPA 1KJ2H 1U8QB 3ULUD 4PJGF 4CU8A 2YBRB 4HCRA 4RQQA 5TE6L 3C5ZA 4K8RD 2PTVA 3VFOA 2Y07L 1KJMB 3QUZA 3IU3B 3DX7A 4LQ1A 3DIFA 1HSAA 1C8PA 3P0VL 2XY2A 4JM2B 4UV7H 2MPAL 4NT6A 5CEXA 1KG0A 1AC0A 1SJEB 5LBSH 4CVWA 1LD9B 1TPXC 4JDTH 5GHWL 2VXQL 3FQNA 5D72H 3EYUH 4FFZH 3HFMH 3QQ4B 4Z78B 3IFLL 2HKFL 3B9EA 3QO0A 4XBGB 3T3PF 2W1NA 1P84K 1G0YR 2CRZA 1RIHH 3IS0X 4DW2H 1NGZB 3Q48A 3CDGA 3DPBA 2IC2A 4L3EB 5I8KL 43C9A 2V5MA 1ND0A 5JIIA 4JN1L 3V6ZB 3QUKA 3O11A 4KY1H 2ID5A 1CIDA 1SMAA 3EYOA 3VH8G 2CDEA 4P2OA 1I9RL 1GXEA 3EOYG 1Z9OA 4TUOB 2Z9TA 4NJ9H 3BUYA 1NMBL 2ZPKL 5FOJA 1PVHA 1CLZH 1MHHA 1T0MB 5ESAB 4MA3A 2OR7A 4FFYH 4F37K 3U7YL 5F88B 1DQMH 3GSVB 5C08A 3GM0A 3O2WL 1YMME 5L7XL 1FZJB 4APQD 2BY2A 3NABL 3WNLA 4B5EA 1RULL 3MUY1 4YXLH 3MV9D 3QSKB 3V0WL 3V5DB 1LK3L 1FYTA 3ZE1E 2R2BB 3MNWB 1MJJB 4ZFGH 1P4LA 1UCBL 4PGZA 1HZHH 4Y4FC 1BQLH 4I5BB 3RZCB 4MJ4A 2GY7B 4LKCB 1PBYA 4M8VA 3WHXA 1S5IL 3B9VA 3HB3C 5EU7C 5GS1C 1A7OL 4UAOB 5MI0C 4JQXA 5KJRH 3H3BC 5CEYB 2AKRB 3U2SA 3VFUA 1V7NL 1EHLL 1V7MH 2ZUTA 3GGWA 5MP6L 3D0LB 1A1NB 5I8OL 5KSBB 5DS8A 3ZT7A 1PLGL 2DDQL 2PW2B 1XH3B 2R1XA 1UB5B 3VFVB 5J0BA 5DJ0B 4ODHL 4ZQKA 3HS0B 1KIPA 3PNWA 1WBZA 1RPQA 2HT4C 5GGVH 4ZPTB 4G3YL 1EGJL 4S1SL 3T0EB 4TPRH 4LLVA 3NA9H 3VWJD 1AKJB 1RZJH 1INEH 3E6FB 4I18C 3QH3A 4WW2C 4Q9BA 3UTPE 1FBIL 5I1EL 5JXAH 2HFFA 1QBBA 1MF2H 3VCLB 3M8OL 4TUKH 2H41A 1WBYA 1R3KB 5ISZE 5CAYB 3UTTE 2FCBA 4F9PA 4GLRH 4H1LH 5D4QA 3CLFH 1S7WB 3U4BH 1ZA6A 4FFVD 4NDMB 2APFA 3FAXA 4P2RB 1SY6A 1FE8H 4BFEA 4I13B 3SDXF 5DHVB 1HH6A 1MJUH 1IGIL 1WC7B 3K4ZA 1QFWI 2GHWB 4NN5B 5EC2A 1HINL 1ZT4A 3C8DA 4LLYB 3KHOA 1KIUA 3IDXH 2A9NL 4L8BA 5EUOA 3UYRL 4OCNC 1WWAX 3LN4A 4OFPA 4EN3C 1QR1A 3I50L 3NCFB 1TNMA 3FTGB 1MCPL 4X98B 5F7DA 2P8PA 3VD7A 4NO0A 2RCSH 1EAJA 3BKJL 5D1XB 1FPTH 3STLB 4P3DB 3BKMH 5DVKA 1IQWL 2ESVD 4XXCA 5CD3A 1F3DJ 2BOBB 4UQ3B 5T3ZH 3V8OA 1LNUB 4HKZB 1EXUB 3ROLB 4Z76B 2YXFA 3MRFA 1KTKE 1UM4H 3SKNB 3UEZA 4OCWL 2BSTB 1DJSA 2NX5D 5EOCH 3BWAA 3TH3T 1N26A 3WFCL 3TN0A 2R69H 3W0WA 1IRAY 2AJUL 4HS3A 1AHWB 1E4WH 4OCXH 4U1JA 2RBLA 5GGTL 3U0TB 3LEVL 5E94A 1GAFH 3LSOA 4XWOC 1KBGL 4NKOA 5A2LH 4EZMA 5CSZB 1NAKL 4NN7B 3X3GH 5DD5L 1KJ2B 1A3QA 3JVGA 4HMEA 2EDRA 3SE8L 4L5FH 3PV6A 4QGTA 4Q9QH 3KYOB 5LCVL 1OQXA 3T1FB 4RGNC 3MODL 3ILQC 4FP8H 3P0YL 1QSFA 3LQAL 4HBCH 5E8DL 1W2KT 3QR2A 1A7QH 3RL2B 3TVMB 4Y5YC 3HI1A 4WV1A 3VG9B 1O5DT 3FQUA 5I1KH 1RZKC 3QXAA 4KAQL 1TETL 1UJ3B 4XCNA 2F54B 1WQVT 4FZEH 2W59A 4G6KL 4XNYL 1X5AA 3HI6L 4LRNH 1AP2A 3FB5A 4NNPL 1CF8H 1T89C 5D7JC 3BZFA 3ULUC 4O9HL 5DC9B 1OAZL 2NY3C 4JVUA 4K8RC 3VXSD 4OUOA 2O61A 4YHYC 3VXRE 3DWTA 5E7BA 4BYHA 3UO1L 5GZND 1IGJB 3MV7A 2YD7A 4HUUB 2BCKA 1MRDH 2FHBA 2APTA 5I17A 2JIXD 4EDWH 3F7YB 2VN7A 1YC7A 2FEEL 3HPLB 3D85B 1QRNB 1VPOL 4BQCA 4ONFL 5E7FA 4FTVA 3UC0H 2QKIA 4QHUB 5BW7A 1CGWA 1XEDA 1XF5B 5IW3A 5K59E 3DURA 1T3FB 4QF1B 3MLRL 2DL2A 2YC1B 2DM4A 2AK4E 1CGSH 4D9RD 2I5YL 5HGDB 3WL9B 4PRAA 1NH6A 4LAJH 1VFAA 3SDCB 3I2CL 4PJIB 2XIDA 4LKXB 4PJBF 3P11L 3VFWB 4NC1C 4HKJB 3FCTA 4U33A 3ZE0E 3PHOA 1KEGL 4Z95L 2OK0H 4ZYKA 4WU7B 3TYFB 1Q72H 1YEEL 2LU4A 3MLSL 1CD9B 1QA9B 4MA1C 4KRPC 1BMGA 4HPOL 1UG9A 1CFNB 1FVCB 4KC3B 4ONHB 3FONA 1U58B 3MRCA 2H6PB 5C0JB 2GT9B 2ICWI 4WWKB 4FFWD 5KW9H 1QFPA 1BBJB 2BSRB 1WZLA 1TTFA 4S1QL 3GK8L 4CADB 4G6AC 5EZJA 5BOPA 1DBJL 1YNTB 3DETC 3GNMH 5D93C 3KYNA 4HUVA 2WQ8A 4OI7A 2WWMC 4ZSOB 1JF6A 3HE6D 1IT9L 4TTDD 4Y2OA 4Y4HB 5K9OB 3S37X 1NL0L 4X4ME 1OB1A 3CH1B 4CW1B 5BXFB 3IXAB 4U1LA 4Z7WE 3U48A 2ITCB 4ONGL 3GM8A 2EC9T 2OMNA 2VLRE 3W9DB 3B9AA 4MB5A 2D3VA 4JANB 5ITBH 4F7PB 4YR6A 2BVYA 3QDMA 4XPFL 1NANI 4G8FA 3X12B 2WBJA 4LPYA 4Y88A 1UXSA 3L95A 4U0QB 3VWJC 3E3QE 2LQRA 2NMSA 3DSFH 1P5VA 1QSEE 3BPOB 4MD0A 1OLZA 1YMMA 1KIRB 4WFHD 4GW1A 5B39B 1LE9A 5D7SL 5CP3A 4FFVC 4YAQB 2PYFA 5IB2B 5J6GB 1JNNL 1QO3A 4J12A 3O2VH 1MVUA 4U6YA 2LV4A 1ZHLB 3KJ6L 4EVNB 3TZVA 3P9LA 4WI8A 3G6DL 5CP7A 3VDCA 5BMFL 1QP1A 5C0DA 4KMTH 1I1AC 3ZTNH 5KZCD 2E7HA 4LLAA 4KMQA 3ZE2F 4NM8H 4XC3L 4MD5B 5JPMA 4WTZA 5EOQL 1ZHBB 2XQBL 4EUPB 3EKCA 3EFFA 5DWUH 43CAA 4FQIH 5MERA 1CLYL 3VGAC 3CFKB 2VLKE 4ZOAA 4OF5A 3E8UH 2V17H 3OL2A 3PWNA 3RP1A 1KFAH 2XXMB 1RUML 3QIBC 3ORJA 5ISZA 4LRIC 1XGQA 3BEVB 4MQTB 5F44A 1H3PH 5BVPH 1KUMA 1I8KA 1FL5B 5EUKA 2WUBH 4GQ9H 5HYJB 5DEGB 2BK8A 3DX8B 1C5BL 5DRWB 3V4PH 1YEKH 2B2XH 5E70A 1NBQA 2EDJA 3SDDB 1A64A 5D9SB 5FA3B 3HNTH 3SDAD 3I3EA 4KI1A 1M7IA 4HX1B 1CICD 1KF9B 3MFFB 5GSRB 2PYEE 4JFFE 3I6LD 5E6YA 4GG6F 4D9LL 4ERSH 1G1YA 4RWHA 4C58B 4NUGH 3H3KA 3G5XA 1NC2B 3U1SL 3S3PA 2GUOB 3HE7A 4EDXA 5C1MB 5J9PB 3BD4A 3VH8A 3EOAB 5FYLH 3MGTA 3P4MB 5TQ0H 2Q86A 4Y1AB 1LP9A 3WIHL 2I07B 2AEQL 2OS7A 2LAGB 4OCYH 4ZFOA 3HMXL 1KTLB 1HKLH 1YQVL 1ZS8B 2OXHA 5E2WH 4AZ8A 2I60H 5IOPA 3AUVA 1JBJA 4MQ7A 5FYJE 4JO3H 1G6RH 2AK1H 1KPUA 4JG1L 3MBEA 4U1NA 3EO0B 5BS0D 2V9RA 1QBML 3O8XB 4LLWB 4R6UA 3FFDA 1DDHB 3RY5A 4EBQH 2HKHH 1ZSDA 3U9PL 3HHRB 3DVFA 1C1EL 1KIQA 2IQ9H 2FO1A 4YUEH 2F19L 4ZD3H 4HH9A 2GFBB 5GZNC 2RQ8A 4HAGA 5KVFL 5FDWB 4X80H 3I6KB 4JN2A 5IFHL 1A2YB 2NPLX 5BVJB 1KV3A 1RJYB 5CGYD 4PYGA 1KPVA 1PZUB 1J05A 3P4LA 1E4KA 1TPXB 3MJ9A 4LNVA 1D6EB 3GHEH 1CD1B 4P2YA 1MFEH 3IJSA 3M45A 5TDPA 1UXWB 1RZKH 1IZKA 3ZL4L 5CJXC 1AO7A 5KBNC 4XAWL 1JYWA 3FKUS 1K9TA 1XGPB 3GMLB 5DDHA 3PV7A 1IL1B 4R7NA 3ULUH 5B4MC 1G84A 1RZFH 4CDGC 4K8RH 1J0JA 4M5YH 1N7MH 5T33H 3RKPA 2BOCA 1OP5H 2V2TA 2LFGA 5D7LA 3PP4H 3QJHA 3AREC 4XP5H 3MLVH 3TNMA 2HVJA 5LQBL 2AJVL 4YHNA 4AIXA 4FFWC 3VDBA 5FCUL 3WYRA 1ZT7B 4IHOB 5K93A 1JZ8A 1M7DB 2VABA 4BK5A 4JHBA 1T1YA 4WFGD 5KTEH 1H3TA 1XGTA 4YXKL 4OKVB 2NY1D 4YDIH 2MKLC 2QQNH 5FECB 4TTDC 4RMWA 1QEWA 3CFBA 4DKDC 2AEPH 3O0RH 2AK4A 5F9OH 4BFBD 1S7QA 1PQZA 4OF0A 4MDJA 1MI5D 3V5HB 4HIJB 3S96A 3LKPB 5KSBE 4BH7B 3MRKA 1DQJA 4Q9RH 1Q0XH 4MXQD 1CU4H 3OJDB 1HHGB 4BSWB 3AXLB 1FGNL 2CH8A 3RY6C 2K7QA 2UUDH 5GS1B 5MI0B 3GSUB 3TA3A 12E8H 3CUPB 3FT4B 3OPZL 5D1ZD 3VI4F 4JRYA 4NZUL 3F7RA 3Q3GA 1PAMA 1Y6NR 2VC2H 1QBLL 3GBLA 4U6HA 3PGFH 1JZ7A 4LP5A 3OR6B 4JY5L 2OQJB 2ZUVA 2N7BA 4GAYA 4HKBA 2CKBA 5ACZA 2FB4L 4AEFA 4HWEH 5B21A 1H5BC 1FGVH 1U91B 1PX3A 4WW2B 1QQDA 2DBLL 4P2RE 3T0VA 5CJQH 4C4KO 1UEMA 4W4NA 2XKUA 1BFTA 4RFEA 1EIBA 4X6FA 3V7MA 2VRAA 1QPPA 3D3VA 4H88H 1B3JA 1TENA 4OLXH 3TWCH 1GGIH 1Q94B 1HHHB 3WD5H 1B4JL 4N0UB 4YBLB 4G8IB 1MH5A 2EYTA 2VKXA 2VLRA 4XPGL 1CGTA 1CBVH 2VDKL 1FN4B 2GTWA 4RFOL 3ZSTA 4W6XB 4LLMB 3MRHB 5HHQA 4JDVB 1ZGLB 4QTHB 4JPKH 4TUJA 4C56D 4EN3B 2ICES 3D25A 1QSEA 3CGTA 3P77B 4FQJH 3BIKA 4XCYA 5DR5H 5HSFA 3VXOB 1IKFH 2IEPA 2Y1VA 1WITA 2PNDA 1MWAL 4GRLA 1JPGB 1CXHA 2K1MA 3BDYH 5DD1H 5F89A 2ILLA 5IIEB 4EJ1C 3K8KA 1PY4A 3INUH 4YHMH 1T7WA 1BVLB 4ZS7L 4G9DB 1WIUA 4I3RL 2R4SL 2D31A 4HS6A 1IFHH 2ZG1A 2A6JA 5I8CB 4MSWA 2HJLA 4XNXH 5EIVA 4GKSA 1FL6B 4Z0BH 1V3MA 1LEIA 5DMKA 2CLRB 1BECA 3MV11 4Y5VA 4LQFH 3MJ7A 3O3AA 4HGWB 1PZ5A 4NHUB 4HULB 3L3KA 5JORB 4OIIL 3V52H 1EEYB 3I75A 2VLKA 3PWJA 1KTDB 2MMXA 3DYOA 4XT1C 3TO4C 3J7HA 3Q5OA 4RGNB 1FAIL 3KPNA 3M17A 5DJAB 1YEJH 1L6ZA 1T20B 4JM4L 4KI5E 1I3RA 4Y5YB 1N0LA 1QZ1A 5DA0B 5F7WC 1FCGA 2CIIB 3ARZA 1OAXH 1T1WA 3ULSA 4J1UB 5BV7C 3RUGA 1AE6H 3LKSB 2IBGA 1F2XK 3UBXI 2NXZD 4DVRH 2PYEA 5D7JB 1JPFB 4JFFA 3O6KH 4KTDL 4TQEH 4DKEL 3CSBA 5B39G 2NY3B 3QFJA 2M26A 2VLME 5IJVA 4YHYB 2VKWA 3B2UD 5CGYC 5SWSD 3C60D 1N5YH 4HCRL 1OCWL 2P5WA 1MCQA 5GZOD 3BUTA 5EU5B 1MHPH 4F37F 1LP9F 1KN2H 4JO4H 4XMPH 4G8EB 3OB0H 1EJOH 1CXLA 1QLEH 1MNUL 1CCZA 1DN0B 1A3RL 3FOMA 4JZOA 1N0XL 4FQHB 1CVRA 4QRTA 2RB8A 2CGRL 3MNVA 4K7PL 2VO5A 1A6VL 2P48B 5HDOA 3VFTA 4PJIE 4RIRA 2ZSVA 5ERWA 4EUPG 2X41A 1JYNA 2NZ9D 1UWGL 3NGBB 1OWWA 3MA9L 4XVJL 3LKRB 4TSAH 4RAHA 2FHCA 3S3SA 1FVEB 1UH3A 3RRQA 1ZLSH 3QDJD 3IU3A 5J1TC 4AM0B 3VWKA 3FAWA 3LPGA 3LMJH 4HIXH 2FX8L 5TQ2H 2X1WL 5T1LB 2EICA 4XNUH 5IESH 3BGFC 4I77L 5FK9B 1AR1D 1F4XL 1FJ1B 1SJEA 2A1WH 1LD9A 3VFPB 4MA1B 5FYJU 1BAFH 4KRPB 1CGXA 3QQ4A 4Z78A 3ESUF 1BM3H 1ETZB 1JL8A 4JRXD 2KBGA 2EXYD 3KYKL 3DJ9A 2JJVA 2CXKA 4ZSOE 5C2BL 4WHCA 1J87A 1NGZA 1OAQL 3ZKND 2YS4A 5HPOA 4L3EA 1DQQB 3UAJD 5C7XH 3V6ZA 5AG9A 5D93B 1X5XA 3O4OC 1FORH 4I0CC 4IOIB 1RUAH 1ORQB 2NYYC 4GRMB 4MXQC 4LVOB 1K8DB 4RGMC 1VGKB 1G7JB 2VB5A 2Y23A 4TUOA 3TFKD 5J11C 1JYXA 5D1ZC 2VLJD 1JN6B 5EO0B 5ESAA 4RX4A 5F88A 3IF1A 1FZJA 3TLRA 4H5SB 2E27H 2EIDA 2PTTB 3V79C 1RUKL 4OM1L 3VWJB 4IRZH 3DROB 3H7BB 3MNWA 1MJJA 5T5FH 4PRIB 2I9LB 2X1OA 3IDMB 3RZCA 4LVHC 1FLRH 5EBLA 3IAPA 4LSQH 4LKCA 2OP4H 4GQPH 2ERJC 5DUPL 2P46B 5E8EB 2W0KA 1ZA3B 2D0FA 1SQ2N 3MLWH 5CEYA 5JW3H 2QQLL 3D0LA 1A1NA 2G5BB 4MVBD 5KSBA 2AJXH 1R5VB 2E9IA 1SY6L 1XH3A 2PW2A 3UJTH 1UB5A 3VFVA 5HVHC 5DJ0A 4YH6A 5GPRA 3DVIA 3HS0A 5I8EB 1MCOH 4RMTA 1I8LC 3T0EA 1BPVA 2BSED 4MA7H 4OM0H 1I1AB 3SGJA 1AKJA 3B5HA 5IMOA 3E6FA 1F6LL 1F58H 5AZ2H 3O4LD 1R3KA 4HUXB 1A14H 3TBYB 4UNTA 2XKSA 1U8MB 5EG6C 4MHHG 5HYJE 1S7WA 1MEXL 1TNNA 3GKZA 2FECL 4NDMA 1C5DB 4P2RA 3OKKB 3O2DH 5E2VH 5E6ID 5DHVA 4OZIB 3QIBB 2FEEI 1WC7A 4OD2B 2JJSC 2UYLB 5LWYH 5DD0L 1F4YH 2UVEA 4LLYA 4UIKL 3L5HA 3IFOA 4XAKE 4E41B 2Z8WC 1HHKB 1Z3GL 3BT2H 3FTGA 3MXVH 4X98A 3R1GL 3HRZB 1HDMB 2VUOA 1FRGL 5D1XA 3EYFA 5ALBL 3G6JF 3STLA 2D0HA 2KZWA 4P3DA 4Y1AE 4PGJA 5DUML 1AGEB 1MQKL 5TF1H 3U0WL 4XMKL 2BOBA 4UQ3A 3VA6A 1NFIA 1LNUA 4HKZA 1EXUA 3ROLA 4PJ9D 4Z76A 2NLJB 1B6DA 3IU4H 3BRDA 2D7MA 3FQTB 1UENA 2YUXA 2R56L 1MRFH 3QCTL 4ZTOL 1U2HA 4B7IA 2BSTA 4M8QB 2R39A 4J3OC 4P2QB 1ERNA 1UWEL 1TTUA 3T0BA 1AHWA 5HYSB 4XVSH 2E5EA 3IETB 3KR3H 5C0BD 2NXZC 4OCSH 4CKVX 1H8SA 3S35X 5IFAL 3MJ6A 5CSZA 3V4VL 1HYSD 4O00A 1KJ2A 3BP7B 4QXGL 3BIBX 3O6FD 4PIRF 3LQAC 3B2UC 4OTXH 3QXVA 2DBJA 4HWZA 3C60C 4XB7A 1TQCC 2EC8A 2RIKA 5GZOC 3KYOA 1ZLWH 4Y19D 1U3JA 3EDDA 3T1FA 4PRHA 5T1MB 1YEGL 5K9QI 1FNFA 1FNSL 3RL2A 2PTUA 1U36A 3TVMA 4XXDB 1RJLB 2J8UB 2QTEA 4NKIL 4D8PB 4NHCH 4DZ8B 3VD9A 5KSAD 4M7KL 1UJ3A 1B90A 2F54A 1NAMH 3S8WA 1KELL 1I7UB 3QEHB 3SGDI 1NFDF 4BQ9A 2NZ9C 2DQTL 3C9NB 1JZ5A 3EO9L 5E2TL 5BV7H 4KQ3H 5JHDA 4ETQB 1AGFB 1JF1B 3RUGF 1WEJL 4YDJB 3S4SB 1QKZH 4U1HB 3EOBA 4YHLH 1IGJA 2Z0BA 2VLLB 1IGCL 3GJEB 4HUUA 1BWMA 1WISA 1TZIB 3GIZH 4X7FC 3F7YA 4MCYB 4G7YL 1L0XA 3EJJX 3HPLA 1HNGA 3H2WA 3AREB 1QRNA 1LO0L 3D85A 3B5GA 2EXYC 1MSPA 3FN0H 5EO9B 4RBPK 5DJYB 3S35H 5EOCJ 1XF5A 3ZKNC 1T3FA 4QF1A 1CDJA 3DECA 2YC1A 2B20A 1C7TA 3BIAX 1DSFH 5HGDA 3WL9A 5HYEA 5ILTL 5TE6H 3WKMH 3SDCA 1MFCL 2Y07H 4PJIA 1F00I 4LKXA 5D7IF 3P0VH 3VFWA 3TFKC 4HKJA 3DYMA 2DQUL 3HR6A 2MPAH 1FFNB 4WU7A 5GRYA 3TYFA 3NCCB 1QA9A 2VXQH 1CD8A 5SV4A 2BNUB 3H9SD 1CFNA 1FVCA 2Y6SD 2HKFH 4ONHA 3W5MA 4P0DA 5C0JA 2H6PA 2X4OB 4TTGA 4WWKA 3A6CL 4KVNL 1BBJA 4I1NB 4LARL 5FHBL 4XMLL 3SCMC 4LEOB 4B0MM 2KZ1B 4CADA 5I1AB 5I8KH 4KUCD 1YNTA 4I2XE 4G6ML 4JN1H 3KPPA 3JUYA 4JRWA 2OL3B 2JJTC 3IXTB 5K9OA 2EDFA 5CD5C 3CH1A 4CW1A 5BXFA 3IXAA 3HZMB 1NMBH 4N0UE 1RY7B 2F5BL 2ITCA 1AI1L 3LV3B 5JMOC 2M1KA 3W9DA 4JANA 3U7YH 4F7PA 3CX2A 1OP5K 3THML 1G9EA 3REVB 5HJ3B 6CGTA 4P3WA 3X12A 1RULH 3VXMD 4NQXA 5AUMB 5IWLA 1RZ7H 3F12B 4OUUB 1LK3H 3DXAD 3U6RB 3HLAB 5GS2D 4JFPA 2DI7A 1KIRA 3OJMB 5H94B 2VDLL 1BZQK 4RDQF 1QSZA 1WWBX 4IRSB 1K3ZA 5DC0A 1CFBA 5B39A 1S5IH 4YAQA 1E4XH 3PGDB 5J6GA 5E6IC 4NRXB 3ARGA 4P46C 1V7NH 1EHLH 4JG0L 3ZDZE 5MP6H 5I8OH 5I73C 1PLGH 1ZHLA 1VHPA 4EVNA 2EZ0D 1IC4L 5ID0B 3P30L 5IKCB 3OTTA 2WV3A 1EGJH 4QRSB 4S1SH 2UUDK 4WI7A 1YA5A 5F7YC 3MX0A 3GMRA 3F62A 1FBIH 4MD5A 4XCFH 5C86A 1ZHBA 3VW3L 4EUPA 3A6OA 4KTYA 4FXKB 1HYRC 1F8TL 3CFKA 4WUKL 3GO1H 1ZGLM 2GITB 4ZMAT 5T1KD 4N8VB 1ROWA 3BEVA 1FL5A 4WO4D 5DEGA 3DX8A 5DRWA 1J8HD 4H8WL 4MJ6B 4YIQA 1EMTL 4W68A 3TO4B 2A9NH 4X7CC 3SDDA 3UYRH 4UIMB 1ED3B 5D9SA 5FA3A 5JOPE 2BNQD 4ZFOL 2G60L 3I50H 1A47A 4L3CB 1MCPH 5FGBC 1NAMB 4L9LC 3MFFA 5GSRA 1PEZA 2C4FT 3TT3H 3SPVB 1HYSC 3CSGA 3BKJH 2Q6WB 4QHKJ 4D0DB 1MAKA 3KDMB 2GQHA 4GFTB 4FQCL 1X5KA 1NC2A 1T21B 1WCBB 2J2ZA 2GUOA 3IDGB 5J9PA 3BQUB 3EOAA 5DMIL 5F70A 1FNLA 1PY9A 3P4MA 4JFEB 4Y1AA 3HAEB 3MBXL 4LHQB 3PDDA 1GYAA 3SJVB 3B9DA 4JFDD 4OCWH 2H32B 3HR5B 5SWZA 5KSAC 1I3VA 2AJUH 2JK5B 4MAUL 5KG9B 5GGTH 1JNHB 3EO0A 2X4TA 3LEVH 4LLWA 1DDHA 5E8NB 1KBGH 1MCDA 3Q5YA 1HILB 1NAKH 4IDJL 3MJ9L 4ELKB 5DD5H 4LDEB 2Z8SA 1D5BB 3SE8H 5LG1A 4MDIB 5GQBA 2GFBA 3F65A 5DJCB 3I3BA 5LCVH 1S7RB 3MODH 5FDWA 2HTLD 3C5ZD 3P0YH 3LQAH 5FO7B 3I6KA 3OKEB 5E8DH 1A2YA 1BFOB 1OAKL 5BVJA 1RJYA 3T0WA 5F9AC 5FO9B 2Y72A 1XCTB 4KAQH 3RVXC 1TETH 1WZ1H 3P2TA 5HXMA 4G6FD 1TZGL 4G6KH 3QO1B 4XNYH 1F6FB 1D6EA 5IVOA 1C12B 2ZUXA 1CD1A 3VD3A 5F1IB 1I9IH 2C3XA 4JAMB 4M6NL 1UXWA 4O9HH 3WFDH 4GBXB 1OAZH 4FZ8L 2R23B 2WINB 1XGPA 3GMLA 1WFOA 1IL1A 1IC1A 2BSSA 3UO1H 1E28B 5DRNB 2HRPH 3O4OB 4IIQC 1RZ8B 1UKSA 4X9GA 4P2OD 4HBQA 3HC3L 1VPOH 2Y6SC 2G75B 4NN6B 4CRPA 4ONFH 2EIEA 1TQBC 3ARUA 2WSKA 5J11B 3FT3B 5DRXB 4ODBD 3UPCA 5D1ZB 1ZT7A 4IHOA 2B0SL 1M7DA 2XRAL 15C8L 3CFIC 5C08D 2R8SL 3MLRH 4PGDB 4OGAD 3UZVB 5B3JE 4M48L 1VA9A 5HYSG 4PRIE 2I5YH 5GSVB 3OB0K 4OKVA 4Y2DB 4GRWB 5FECA 1FYTD 4OGXH 1EAPB 2CRMA 2SEBA 3H3PL 3QA3B 5C6TL 5SWQB 3P11H 4HIHB 4IOFC 2CKBL 5IEHB 4Z95H 3VRLF 3CFJB 4MB4A 4UBDD 4HIJA 1NCNA 3LKPA 4ZUWB 4V1DB 4BH7A 3C2AL 4HPOH 1AY1L 2QSCL 4BSWA 3OJDA 1HHGA 2ERJB 4LSTL 4CDHA 3AXLA 4QXWA 5GS1A 5I1IH 2XKNB 4ODXB 2FBJH 4LCUB 3GSUA 1FNEA 4X6BB 3FT4A 4S1QH 1CL7H 2VIRB 3GK8H 3KPSB 3CVIL 2QADD 2FLBT 1JHKH 5JTWA 1DBJH 3MOQA 2BVEA 3Q0HA 2PKDA 3CAFA 3CLEL 3OR6A 2OQJA 1FC1A 3HI5L 4XPHL 3MRJB 1EX0A 1IT9H 1QR4A 1I1CA 2E9BA 2VDNL 1OSPL 1NL0H 1U91A 4WW2A 2ORBL 1JF5A 4LMQI 4I9WD 3S4SG 4KROC 4NP4L 3KPLB 4ONGH 1DEDA 4OLYL 3Q6GL 5HI4C 3QG7L 2AJ3B 4QRPD 1FZMB 1Q94A 3RZWA 1A21A 1HHHA 4XB8A 3ZZ1A 4N0UA 4LPCA 4G8IA 4E41E 3NIGE 3N9GH 3TM6A 2IBBA 1J1OL 1RHHB 1RK0A 2DI8A 1CDIA 1FN4A 5DO2D 1Q9LB 3WMSA 2FR4B 3QXUA 3OAYH 4LLMA 3MRHA 2NY6D 4RAVB 4JDVA 4IOSD 3TYGL 2X89A 4KZDL 1ZGLA 4QTHA 5DJZB 4EN3A 1A7NL 2GI7A 4GJTB 4R4ND 5IK3B 4A2MA 5KVGL 4EI5B 4NO0D 3P77A 3VXOA 3ECBB 1JTOA 1NQBA 2YD2A 2DTSA 1DLHB 4NSKB 1JGDB 4P3CL 3LS4L 4GXVL 5KSUB 4WO4C 1R24B 5IIEA 2QQKL 1ADQA 1UZ6F 4F58H 3LKOB 5H37G 2O5YL 3G6DH 4ELMA 1BVLA 1IKNC 4G9DA 5BMFH 4JB9L 5J56B 1CDHA 1MIEL 3BESR 1ZK9A 3TN0D 4XC3H 4L4VD 4PGEB 2ED7A 2OBGA 3W0WD 3QQ9D 4KRNA 3BYTA 5EOQH 1FL6A 2W9EL 4WFEE 2G2RB 4O51B 4I0PB 1CLYH 5DK2B 2CLRA 2O5ZH 1F4WL 4HGWA 4NHUA 1RUMH 4NQCE 5JORA 5KANG 1EEYA 5C9JB 1KTDA 1T2JA 1SMOA 3OF6A 2VZVA 5DURD 4LSUH 3MGOB 4ZUSB 1KJ3L 1QSFD 2V6HA 1UVQB 4YXHL 5BQ7B 2RFXB 5DJAA 3TIDB 1H8OA 3OXSB 5ALCL 5JQHC 1T20A 5FO8B 4Y5YA 1BQUA 1LE5B 3WDIA 2CIIA 3DLQR 3FT2B 4D9LH 4J1UA 3WS6A 2IG2L 3QJFA 1ULVA 4PTTB 5FYJL 5D7JA 1JPFA 5L2JB 3ULVE 4CN1A 3RWGB 1KCSL 2HTLC 4U2YA 1BBDL 4UU9A 3QDJB 4K23H 4OI8A 2AEQH 4YZFE 5J7CC 2R0ZL 4G9FB 4ODSL 4MAYC 4JHAL 2W92A 1KCLA 3HMXH 1VCAA 1YQVH 5C09B 3SGEH 3ZSSA 3L3HB 3IGAB 3ES6B 4O2FB 2ATKB 3ILPB 4JZJC 5EU5A 4G8EA 1NCAL 1DN0A 4YFDB 4JRXB 3BPLB 4FTVD 3U9PH 4A6YB 1UKTA 4E42B 2NQCA 4FQHA 4OAWB 1C1EH 4KVCL 4P5TB 2Z8VC 2R2CA 1W8NA 2F19H 4OJFL 3IDYB 1RJZB 4OF3A 3PIQB 2Q7NA 4L8DB 4O5LL 5KVFH 1MCHA 3LKRA 1JNLL 4WI9A 5IFHH 2Y5EA 3NCJL 1A0QL 2IWGA 2FECI 3PE9A 4AM0A 4N8VG 1KLFA 1J0HA 4PLNC 5T1LA 2GIYA 1GGBH 3ZHDA 3F58L 5FK9A 1CFTB 3VFPA 4PV9B 3VMOA 1ZLWK 4MA8L 4OGAC 5M94B 5JO5B 3MRMB 2B5IB 2J7LA 2OTUB 4XAWH 2OR9L 3MV9A 3BVNA 3SCMB 4MNQB 5DVOA 4GAGL 4XZUB 5JW4Q 1DQQA 3AS2A 1J0IA 2HH0H 2DB8A 3SKMB 1FG9C 4UBDC 1ZVHA 2YSSB 4IOI