1YEEL

Structure of a catalytic antibody, igg2a fab fragment (d2.5)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
219
Chain Sequence
DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLSWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAADLGLYYCVQGTHFPYTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural convergence in the active sites of a family of catalytic antibodies.
pubmed doi rcsb
molecule tags Catalytic antibody
molecule keywords IGG2A FAB FRAGMENT (D2.5)
total genus 49
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1997-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yeeL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yeeL01
2B8OT 4YPGB 2Z31C 3WNPA 1DVFA 1RPQA 3C8KB 3CU1A 2AEQL 1KSRA 2DI7A 4JFFD 1YEEH 5FM4A 3HI6H 4HGWA 3H0TB 3MFFA 2PO6B 5HGDA 1U92B 3MXVH 4P59L 1CDGA 2NY6B 5KJRL 3FT2B 1ADQL 5KSBB 4OTXH 3HB3C 5ERWB 2RHEA 3BEVB 4LVNB 3RBGA 5IW1A 3BXNB 4NBYB 1RZ8B 2AJYH 4GMTL 5KSAB 1OF2A 4I13B 5B39A 3CVIL 4NNYB 4KDTC 5EBWA 2ZCKL 5EOCH 1SMAA 3Q48A 3SGEI 1WT5C 1FO0H 1W0WB 2DWEA 3QDJD 3GNML 3Q6FB 1HCVA 3RTQB 5CZKA 1T0PB 5CEYB 1HHHB 4GKZA 5F9DC 2YSSA 4N68A 1WBXA 1QO3A 3PIQA 2UWEB 3CMOH 4U1IB 4YR6A 4NO0A 4ENED 5I8OL 2AV1B 5L2JB 2FIKB 1TTFA 4UT6H 2F19H 3OHXA 4J6RH 5DJYA 1GZPA 1KB9K 4HT1H 1MRFH 1I9IL 1F4HA 5E2VH 1AO7E 5SWQA 4K9EL 4Y7MA 4RX4D 4H1LB 1KCRL 3UTQB 5EZIH 1ED3A 1A7NH 1IC5H 4E42B 4QF1B 3EOAB 3UTTB 3DYPA 4RDQF 4JY6B 4U1MB 1V7MH 1F4YH 1CD8A 1KLUA 3LN9A 3PGCA 3RU8L 2V2WA 3H9ZA 3W0WB 4DKEH 3QUZA 2JB6B 2FGWH 1EEQA 5TE6H 3RUGA 2YD6A 5K9KB 2AKRA 1KJ3L 3HMXA 4ODVL 4CDGC 4IEFB 4LCUB 2OZ4H 4K71B 2HWZH 1XIWC 2IPUK 3TBSB 3LKRB 1A3QA 2XKUA 5C2UB 1N6UA 4GAGH 1KULA 4HK0B 3UJIH 5J1TC 1P2CB 4IOFC 3RVXC 3IJYA 5KTEH 1BF2A 3NBNA 3FO0H 3HHRB 2G2RB 4YHKH 3GIZH 5B38A 5BQ7A 1TVHA 4L8CA 3LPFA 3M17A 1D6EB 3I50L 2AJXH 2ID5A 2VE6B 1A7RH 4JFDB 4PY7B 2Q86B 1P4BH 1PZUB 4XC1H 3LN4A 2J8OA 3UTOA 5C08A 4M1CC 2Y4SA 2EYTA 1II4E 4Y1AA 1VADA 2Z8SA 1YUHB 5EC2A 1QFOA 2YKLH 1H3UA 3EOTH 4FZ8L 3A67H 4E0RB 1KTLA 3L3DA 5FGSA 3F7YA 1AXTL 5EO0B 1OGAB 2VLJE 2CPCA 4I2XE 4I77L 3VI3E 4Z77A 3BP7A 2ADJB 3WNNA 1WIOA 4KKAD 2Z92B 2O5YH 3WL9A 4PRAB 1T7XA 1DDHB 4FS0A 5ICXB 4DKAA 5F7LB 4YK4B 5ESQB 3BGAA 3ULVE 2R0WL 5F88A 5L7XH 3N85H 3QFJD 2R9HD 1MREH 2D0HA 3JWOL 2Q3AA 5ECJE 4YQXL 2MCPL 3SDAD 2AXHA 3EIFA 1LILA 3JV6A 3KHOA 4DZ8A 3WYRA 2D7OA 2DIAA 3DTXB 3LH2L 3MROA 4Z7QF 1U93B 3AS2A 1N6QL 2EDRA 3U2SA 1CFBA 2F5BH 1OAZH 1GZQB 2DBLH 2DDQH 2XACC 3MUGB 3MV9B 5F9JA 3T3ME 1YEJH 43CAB 2CDGA 2FYYA 4LIQH 5ESVA 1FN4B 4V1DD 15C8H 4R7NA 2ZG1A 5HI3D 3TT3H 4DN4H 4GKZB 3MV8D 4PJ7B 2Y07L 1JYVA 4NNPL 3C6LB 2KQMA 2OK0L 1A9BB 2XWJB 3MA7B 3I3EA 2EE2A 3GHEL 4M93C 3VG0L 5GPRA 3SKUD 4LL9A 3UTSB 3BPLB 5JPNB 3K1KC 5JW5A 1YECL 4TVPE 2V7NB 2C3XA 3G5VB 1MJ7H 2APWA 2EDEA 4KQ4L 4RGNB 5K9OA 5E7BA 4QWWD 2HT3C 4N8CL 5AWNH 2ZUXA 5DMKA 4P23D 1CBVL 1BZ7B 2OJZH 2OL3A 1KCVL 2FH6A 3MLSH 4Y5YB 4J3WA 3MBEB 3QIWC 3EJYD 3T08A 1JPTH 3N1MC 3SDXB 3ZZ1A 5T1KA 1C8PA 5T1LB 3HLAA 3LKOA 1MCSA 1N5AA 2V5SA 3BN9D 1OL0A 1MCFA 3L6FA 4MNHB 4P0DA 4OZHB 5D5MF 3OPZH 4YH6A 4P2QE 4QRUA 3A67L 5HVGB 5CJQL 5JORB 4XXCC 3OR6B 3WFEL 2J88H 3MLZL 4MAUH 5C70A 3I84A 5F9WB 4F7TB 4NKQB 5EUOE 4H88L 5GS2D 4PY7A 3LVEA 1JPGB 4LNRB 3FQNB 2BK8A 3L7EB 2Y5TB 3CPLB 3L3GB 1OGTB 4QXTA 4P9ML 1BZ7A 4WO4C 2A9NL 5DD6B 5DSCA 1BZ9B 5DJ2A 2XKSA 1ZA3A 2BHZA 3HCVB 2I25N 1J9CT 5KN5B 5ACZA 4OD1H 2DMBA 4TSAH 4RA0C 3GMMA 3S5LG 4POYA 5F6HI 1I75A 1NCUA 1DVFB 3KPQA 1LDSA 4NM8H 5DZLA 3QCUH 5D6CA 1CLYL 1G7HA 3VWJB 1MHEB 4GBXD 3HS0B 1P5VA 1J18A 1QPXA 3MGTB 4H5SA 4WI7A 5HI3C 3G5YA 5M95B 4W68A 3B83A 1QFPA 4KTYA 1M6OB 4RQQB 4QRQA 1HSBA 5DJAB 2DQEH 2OI9B 3C87A 4JPVH 5GJSH 1BHGA 5C8JB 3MUY1 4UV4H 3S96B 3LS5H 4Y5VB 4KKLD 1DQQB 2X9YA 3NCMA 5CEXB 2CDEA 1JK8A 3MUGA 4YDKH 1FZJA 1YY9D 4JCLA 3RGVB 1A7PH 4P2RE 3S4SB 1ZGLB 5IUSA 3OJDA 4RGMC 1D5IL 3KPPB 4PRPE 5E2UH 3FQNA 4LCIL 4QLRA 5HYQA 3MV7B 1NAKL 1U8IA 5L2KA 1W2KT 4L4VD 5IFAL 1DSFL 4LPTA 3HE6B 5D7IB 4GRMB 1JZ6A 3KHQA 2D4FA 2R69H 3FT3B 3NZHH 3L5WA 3OMZA 1CCZA 4X80H 1IM3A 3SJVA 3FTGB 1JHTB 3KJ6L 3TYGL 5MI0C 2Q8AL 4JGUA 4WI3A 1JGEB 1FIEA 4MXQD 1P5UA 3RY6A 4XHQA 3VFGH 4UAOC 5FYLL 4OCRH 3QUYB 1KLUB 1T1WB 1CU4L 3V0WH 3V4UH 5GGVL 1CDJA 1CL7L 4NO2A 3QNXB 1S78C 2X4QA 1I8KA 3H9SA 4RAVA 3ARXA 3FHAA 1PJ9A 4X6EB 3D85D 1KENL 5KS9B 3U0WL 5JDSA 1FNHA 5BZDA 1FN4A 1HIML 4DN3L 2ICEA 4M7KH 3CDCA 1K9TA 1RFDH 3Q3GB 4G6AC 4P9MH 1QLFA 1JPFB 3P73B 3ILPA 5KVDH 4XP6L 2FLRT 4FG6D 2P5WB 1BQHA 3OG4B 3TA3A 2R2BA 5FKPA 1ODAA 1PSKH 2P8LA 3AAZB 4G6FB 2VDPH 4G6MH 4R97B 3PGFL 4N90D 4NT6B 1PG7W 2EEBA 4HWBL 4LDOB 3MV9E 2V17H 3QUXD 1X7QA 3RDTA 4CMHB 3VFTB 1I8LA 3OKMB 4HPOH 4YHZH 1KELL 2BNRA 1G6RL 3ARDC 3LAFA 3DSNA 1PKQB 5BXFA 3FN0L 1S7TA 2CLZB 3ARQA 3VXUB 5FFLA 2CKBL 4NZTL 3V4PH 2AQ1A 5EC1B 3UZEA 1WCBB 3GJFA 4ODWA 1JHLH 4UOJA 4N0YH 2O5ZH 2F5AH 3ARWA 1TTUA 2JIXB 3N1QC 5ALBH 3ULVC 4G8GE 4L9LB 2NY4C 1IGMH 1VEPA 1A14L 1TNMA 3KR3L 5F7WC 3SE4A 4G8EB 2JJVA 3SBWA 5I16A 1MRCL 5CKAA 3D39D 1A3RH 3OHXB 5D93C 5KZCB 4GRWE 3D25B 4AM0B 2I5YL 2PTVA 2DLTA 5GSVB 4UTAL 3ES6A 5L88H 4DGVH 4I3SL 2NX5E 3IKCA 1EO8L 4E41A 2UVFA 4OGXH 4AENB 5CJBA 4X8JA 1PG7H 2E9BA 4BA8A 4RFEB 2IBZX 3P9LB 4XBGB 3PQYA 4DGYH 3J7HA 3IVKB 5DEGA 5BVJA 4CN4A 1OPGL 3QQ9C 2VDLH 1EVUA 1BOGA 5DFVC 5FHBH 2QHRH 5D1QD 2F54D 4PG2C 2HVJA 2FD6H 3WNLA 3V7AE 1YMHB 3HRZB 3NCEB 5C09E 1A2YB 1J0YA 3BDBA 2W9DL 3NN8B 2LU7A 1UEMA 3WNKA 5C0FA 4K3EH 2IF7A 4I0PC 4OCXH 3F65A 4YHIB 5D71L 5HD8D 2B39A 3B9EA 2ZUQB 4XBEL 4HUXA 3QQ3B 5IFJB 1JV5B 5DLMH 3RTQA 3THML 3IDXL 4ELKA 1ND0A 3FT3A 1T89C 2NLJA 3SPVA 2MQ0A 5HGAB 3MRRB 4YR6B 5DMGC 2JCCB 5LVEA 3LCYA 5DK2A 4GUPB 4NT6A 2NY3C 2PYEB 1R3JB 2Y23A 1FYTD 3I6KA 1NL0L 2V9TA 4NQCE 4BK4A 5KTEL 1EAPA 3ROLB 3FO0L 4FQ1L 3GKWL 3HI1A 2C7UB 5D7JA 1AXSA 4ONFH 1KEGH 3BKJH 3I50H 4N0RA 4M03A 5FAAA 4AT6B 1TZHA 3M8OH 2IQ9L 5EPMA 3WIFA 5CJ5A 4ZO8A 4JRYB 5INCA 5H35B 5CLWA 3DXAE 4KVNL 1DQLL 4Y2DB 2J12B 5SWSE 5TJWK 3TH2T 1P9MA 1JHKH 2JKXA 1D9KA 2P44B 3OQ3B 1WAAA 3L3KB 3BIKB 2OP4H 4RGOH 3RGHA 4MAYB 4HUUB 4WCYL 1YJDL 3B3IA 5DA0B 4Y5XC 1FORH 4TQEH 2XZQL 1P4IH 4CGTA 1I7UA 4Z76A 5I8CA 1I8IB 3RGVC 5I1CL 3QIUD 2R2HA 5IMKA 5HDLA 1J8HD 4G80B 3SDAC 3ZLQC 5T3ZE 1A6PA 3DVGA 2FHFA 5FYKE 1G7JA 1U8NB 1Y6KR 5FM8A 4DTGL 3GJFK 3VFTA 3D25A 4X5XA 1MFCH 4N8VB 1QRNA 4Y1AB 4XPFL 1EFXA 4XX1E 4OT1L 3HPJA 1S7VB 1UACL 2D03H 2F74A 1EERB 5DRNB 1XGUA 3SKOB 5MI0B 1KG0B 4UOW0 3AREB 3GSOA 4BUHA 2Z93A 1Y6MR 3DMMB 4G9FB 4C56E 1TTGA 4FQXC 2WANA 2XTJB 1XF3A 3MLWH 4GG6F 4P2RB 4F57L 5GRWA 3GDBA 4N0UA 1BFVH 2WUCL 4HUUA 3W9EB 4QRUB 4U1GB 3PV6A 2NW2B 1M4KA 4HG4K 3HMXL 1FYTB 3EBAA 3MLYH 5LG1A 3W0WE 4C83A 4DFHA 3QEUB 2EYRA 2FX9L 1VENA 2CIKB 5I71B 5EU4B 5ETUA 1F2QA 5ALCH 4NJ9L 4X6DA 5GRUH 3LKNA 3HC0A 3R4DA 4L8BA 3CLEL 5C0IB 2YD1A 4HKZA 3RNKA 1KPVA 1XIWA 2D31B 4AENA 1N8ZB 1A1MA 3CXDH 2DLFH 4U31A 1J1OL 5AD0B 3M8OL 3VCLB 4HS6A 5BV7L 1T6VN 3WMSA 1FO0L 5JW5B 2UY6A 2DOCA 2Y6SD 5DJCA 3LB6D 2X4TA 1NCBL 2HJKA 5B21A 4BFBD 1XCQB 4DUWA 5CS7A 2EZ0D 5ANMA 5EZJA 2OP4L 4FQIH 3RWGA 5CCKL 4LCUA 4IJ3C 5ICZA 3BUTA 3ARVA 4G7YH 1HHJA 1FZJB 4PB0H 3ARBB 2F54E 1T1YA 3BSZH 1QQDB 2I27N 4FNLL 3B5GA 1DEDA 5FUCC 2NR6D 2UYLB 2H1PH 8CGTA 1YC7A 2A9NH 1SJHA 1U41A 1E4WL 5BCAA 1LO0H 2K7QA 4X6DB 4PLKD 2VIRB 1JPSL 4UOW1 4EUPB 2NY4B 2QADB 5F3BA 5GGSY 3IJSB 4ZDHB 1NFDB 5KZCD 5GGVY 1BWMA 1NUDA 3PXJA 1AO7B 2Z35B 5DTFB 4Z7UA 4PJFA 5HBBA 3KXFA 3GSWA 5E94B 1DN2A 1IBGL 3DX6B 2VKWA 5HHQB 5CBEB 5DD6A 2IALA 2MQ3A 1F6AB 1IARB 4LPUA 1QVOA 2EE3A 1BX2A 1A6WL 1UB5B 1VFOA 4KY1H 5BS0B 3D48R 4CU7A 3W5MA 2JB5H 3IDMB 1N5YH 1F3JA 5IMOB 2DQIH 2BVPA 3O2DL 1WZKA 3HZVB 3QIBC 3QG7L 3QXWA 4NZJA 4NNYA 4PJDA 3W9DB 3BZFB 4GBXB 3G5ZB 2AK4E 1N0XL 5SV4A 4LVHC 4P2QA 3SGDI 2JJTC 1MHHB 1NANH 4KI1A 3U2SB 4JPIA 1HYSD 5L9DL 3HS0A 3MGTA 1MY7A 2XXCB 4LCWA 3SDDD 2D9QB 2P5WD 1MCWM 3HE6D 4QRSA 3FO1B 1W72A 5DRZB 1YEEL 3U6RB 1S7RA 3IJYB 3HUJF 4JZJB 1QSFD 2BOBB 4N0UE 4PJEE 3KPMB 3QWQB 4U1NB 4UZGA 1K8IB 4DAGH 1IJ9A 4I4WB 5LCVL 2CH8A 2XKNB 1RVFH 3ZYIA 1DN0A 2A6KA 1CLOL 3OKMA 4TVPL 1NJ9A 3PDDA 5E9DD 1JYNA 5IKCA 3IKKA 3VXUA 3ARFA 1P7KB 1V8HA 4JFOA 2L7UA 4J4PD 2XTLA 4LBEB 4XNXL 5JW4R 5GGQL 1S9WB 4TUJA 1KIRB 5EZJB 3JVGC 2AEPH 2X4NA 1LO0L 3MRMA 1ZSDB 4XVTH 1SVZA 2APFA 5DT1L 1N6VA 5CZXD 2GJ6B 5FYKH 3K4DA 1CD0A 4DEPC 1A7NL 4NNPH 4JFYA 4OJFH 1J11A 4ZPVA 3U1SH 2VLMD 1KTDA 1VCAA 3ZKXC 1KCUL 3Q6FA 1U8PA 1JGUL 3BAEH 1C16A 3EFDL 5D2LF 4IMLA 1T3FA 3T0BA 1OM3H 2FGWL 3RZCC 1I7UB 2FATH 3WSQL 1UJ3C 4YGVA 1OLZA 3AU1B 1ZVHA 1GJIA 1BZ9A 2Z92A 4M7JH 4X7EC 4ZPTA 3R06A 3FQXB 4U6XB 3HE7A 3IDGA 1R3IL 4HXBL 4OF7A 4R4FL 4O9HL 4F7CB 1MFEL 5AZ2H 3IVKA 2ATPA 2HJKB 4I18A 1EZVX 3V0AC 5IESH 3BHBB 4UQ2B 3OGOE 1XF2A 2QHLA 3GI8H 1MPAH 2B4CC 5IIEA 2RCSH 3GSOB 5E00A 1P7QB 1C7SA 4I48A 1A22B 3WV0A 1GGYA 3S36X 2GQHA 3T04D 1SJVA 1UZ6F 4OZHE 4PJXB 5AZEH 1AI1H 5A2KH 5ILTL 2COQA 3VXTA 3ULSA 1IFHH 3S7GA 3G6JE 3B2VH 2AABH 4ZFOB 3TBSA 5F71A 1PGRB 3LPWA 1HI6B 3O2VH 2A6JB 2VITA 1P6AB 2FZ3A 1DBBL 5BO1L 3OXSA 4I2XA 3MRGA 1RK1A 4F7CA 3DXAD 1RUPH 5IB4B 3TN0B 3MODH 5FCUL 5JPMB 5I16B 1DP0A 1MHPL 4R90H 4Z0BL 1S9YB 3TFKD 3CK0H 3ZSTA 1LHZA 4R96A 5BOPA 1EEYB 4BH8A 4HJ0C 4QGYA 5DVKA 3ZKND 5DT1H 5JQHC 3O3DA 4ZOCA 5ID0B 3L95A 4OCXL 4JEGB 3SO3B 1ZA6A 5EPMB 3WIFB 3BQUD 5C92A 4NSKA 5SWZA 4JGMA 5DJXB 1ZKAA 4MAYC 3I85A 3VWJD 3ZL4H 4UUJB 4PRDA 4OCMC 3V5KA 1W72L 5HHOE 5JIIA 5LKNA 1AGBB 2GJ6A 4U6VL 4W6YB 3LEXB 2R2EA 4WEBH 1YECH 4WUUA 4LASL 4KMTL 4LLUA 4X6CF 4ZFOA 1LDPH 4KROD 3JV6B 2DKMA 5IBUB 3ALPA 1CXIA 3NCYP 4X80L 3RGVD 3C09C 1NAMH 3WS3A 4NN7C 5BOZG 4L3EB 2FO4A 3BP6A 3UTQA 2PCPB 1ZVSA 1DUZB 3MTRA 4XTRC 4NKMB 5SWQB 4HUXB 2IPUG 4H25B 4PJ8B 1H5BB 2L4OA 5FYLH 5HDOA 1MEXL 2R4RL 1KC5H 4FZEL 5E5RB 1JF6A 5KOMC 3MUHL 1IGCH 1NGWA 1CE1H 3N9GL 3QNZB 5SX4I 3UC0L 5CJQH 4P2OB 4RGOL 1AI1L 5CJOL 4WU7B 3NIGF 3BPOB 2J88L 3CDGB 2OSLB 4GT7A 3DHJA 3DROB 3B5HA 4PP1D 3DIFB 3IFLH 1TDQA 2F8VA 1G9EA 3LKPA 4XHJC 5ENWA 4EUPG 3BKMH 5IW1B 1VFUA 1OOAA 1IT9L 3DVFA 1A0QH 5ICYB 4LVEA 4MJIE 3CSYA 3X14B 1CFVL 3ALWA 3B6SA 4WW2B 1NUNB 2IG2H 2K1MA 6FABH 2VLKD 3HUJB 3MODL 1IC5L 4OSUH 4EXPX 5JOPE 1E6OH 3P4NA 4TOYH 4IRJA 5GISL 1F3DH 1YN7B 2DQUH 1QR4A 1AGDB 4U1JB 5K9QI 1ZLUH 1EZVY 1PAMA 4WHYH 1JWSB 5FGRA 1C5BH 5F8RC 5KBNC 2F8XC 4MA7L 1MIML 5I8EB 3QI9B 4PRBB 3ZL4L 2D7TL 3D2UA 3SEPA 4UT7H 1R5WA 1IE5A 1I9JL 4PJBF 3RWIB 4AZ8A 3FQTB 5C9JB 3BZ4B 3DURB 1X5XA 3GMMB 5F1IB 3JV4A 4LLYA 1SBBA 5I74B 1X9QA 3O0RH 4I8DA 1IGML 3QI9D 4UBDD 3FRUB 2YZ1A 4JR9H 1XGUB 2Z31A 2MNUA 4JFQB 4OI9A 2GT9B 3ARBA 3MOBL 4O58H 1KIPB 3C60C 1RHFA 2ARWA 2YKLL 1S8DB 5TQ0L 3KJ6H 3MV8B 5D8JH 3HI5L 4JY4A 3G6AB 2A73A 1E4XH 1K4CB 4ZFFB 1KJ2L 5GGTL 1OWWA 3KLHD 1WWCA 5T33L 4LOUC 1X44A 4NQDD 1D6EA 1F3RB 3CNKA 3CH8A 3LMJH 2WBJD 1BQHB 1OAUH 2CMRL 3F7PC 5EU6D 1T20B 1VGEL 3STZA 4KAQL 1W8NA 2P24A 2CLRB 1OAKH 4NO3A 1S9KC 2F53A 4DKDC 3RWIA 4ZAKD 2D31A 1L9MA 2DTSA 4OCSL 3U0WH 3PWPA 4OKDA 3OX8B 5I74C 4N1HB 1WZ1H 3MJ8B 1QVOB 3Q1SL 1HCFX 2F5BL 1T66D 3S5LB 4NQEA 3WO4C 3IETB 4O02L 3PNWB 1OGAA 3WUWB 5C6WH 4DQOL 4Y89A 2B0SH 3SE4C 3TZVA 1FFNB 4PG9B 1I3GL 3VXSB 4MCZA 2M2DA 3GMPA 2MPAH 2R0LL 2OBGA 4GG6A 1F13A 1BVKA 4KKCD 4HHAB 3OJMB 3HC4H 2MSPA 1YQVL 1ZAGA 1RK0B 1DBMH 4JQIL 3ARYA 4PJIE 2D7PA 1SYSB 4JQVA 1Y6NR 3JUZA 1A6VL 5IHZB 3QAZC 3WE6B 2YRZA 3EO1B 2CDFB 3HUJE 1BJ1H 1KCVH 2X4OB 1XZ0A 4F3FA 1WFNA 3C6LA 3PWJB 4W6XB 1UGNA 4XCYB 1OTUC 5HYSG 5C0AA 3ARFB 4EI5D 4C56D 4GAYA 4RNRA 2HAZA 5FXCH 1LEKB 4IOSD 5ESAA 4WI6A 1HK6A 3HNVL 4MJ2A 3RL1B 1F4XH 1X4XA 3V6BR 1CT8A 3EOAA 4Z95H 1PY4A 1P7QD 2ZUQC 4HLJA 1N4XH 1XGYH 3V79C 2FL5B 3V6ZB 4U6YA 4O2CA 5C7XL 5DQDH 5KSAC 2X40A 4M1DH 4M5ZH 4GRWF 3E3QC 4MZ2A 2E9JA 1RVFL 4MA8L 1IKFH 4CNIB 4NRYA 5D2LB 4H1LH 5D70L 1VGKB 1CICD 1FLRL 2RQ8A 3KXFD 4DGYL 5EUOB 4TUKL 3EZJB 2A73B 4HEPG 3QUMA 2DWDA 3UZVB 1FV1B 4FHBD 2CDFA 3KXFE 3IFNH 3DWTA 4NM8L 2XFXA 4CL7A 4PJ5E 4TSBL 4O51B 2DTMH 2VLRD 4PLNC 3OKNB 3RI5F 1JE6A 1RZ7L 2DM7A 4HS3B 4XVTL 2JCCA 2HFEA 4DFIA 1LK2B 2NNAA 3DVGB 1VERA 1HWGB 4PP2A 3MFFB 5JHDB 1PZ5A 1L0QA 4HXAH 5H37H 1QRNB 2R0LH 4NQCD 3BE1H 2WUBH 1I1CA 3DGCR 3UPRA 1IM9A 3EYOA 5IVXA 4DVRL 3QNZA 2CK0H 4IRZH 4Y4FD 4M4RA 5FO7A 2AQ3A 2NX5D 2Q8BH 3SE8L 3VXPB 4Y2DA 5A40E 4JQIH 3W82A 4P5TD 3TPUB 1UYWL 5IM7B 1YMHA 3HRZA 4XPHH 4X7SL 3G6DH 3VXTB 3D0VA 4XCCL 3FJTA 5D7SH 2NXZC 1FHGA 5LXGH 3BZEA 2BFVL 4TVSa 2HG5A 3HI6L 3MACL 2DQFB 4AJ0A 1ZS8A 4GW4A 1EK3A 3AAZA 3MCG1 3O3AB 5M94B 2I60L 3QDMA 5FOBA 5TDOA 1VSCA 3GEWB 3GJEA 4PJ9B 1C08A 3DGGB 1GZPB 1Z9OA 2EYSA 4FQXB 1MWAA 4PJIB 2GI7A 4CVZA 3DX9B 1PEZA 5HGAA 4XPTL 4HWZA 1NGPL 4RMTA 1UA6L 3QEHA 3T0VA 1BQHG 2XIDA 3CMGA 3O9WD 4XVSH 3FFDA 5J6GB 1A7OH 3OF6A 1Y0LA 4LKCB 4F7PB 1NFIB 1F58H 4HT1L 1KPRB 4BQBA 2HJLB 1EEZB 4M7ZC 4D0BB 5E2TL 1DBKL 4R2GC 4HIHA 3NFNA 4ZOBA 4XVJL 3WBDA 5KSBE 2PYFA 2AJVH 1EFXD 5IEKA 2EYRB 3ULVD 5IW6B 2J6EA 3KAAA 1I1AD 3BPNB 3SQBA 1MY5A 2EDHA 2Y7QA 4CW1A 2G9HA 5T5FH 1EIBA 2GY5A 2MWCA 3OAZK 4X6BB 1U95B 4I9WE 4RMUA 5CGYD 1NEUA 1NBVH 4DKEL 3MNWB 3BEWB 1DQDH 4U1IA 1M7DA 1KB5B 3IKCB 4QRTA 4JANB 2YSSB 1NCCH 1X5JA 3GSQB 1XIWB 2PXYC 1U3HD 2ICWA 1ZHNA 2CXGA 2O61A 4CU8A 1WISA 3ARZA 4M8VA 5D72H 2BXZA 4P5TB 4XCFL 1NC2D 3BO8B 1H3PL 1MCPH 3QPQC 2BVQB 1GPOH 5C0BD 5ITBL 1UH2A 5FYJE 1DSFH 5ICXA 4IRSC 2DQGH 2XZCL 3QIWB 1YNKH 2BVOA 4U49A 5I2IA 1KEMH 5BW7A 1HHGB 2B5IB 3RHWK 1CG9A 3EOYG 3W0WA 1NAML 5JOFB 5E24E 4MNQB 3VXQA 1WCBA 2I5YH 3LV3B 4X4YB 1JNNH 2PKDA 3NACL 4WEUD 3BN9C 1REIA 4OZGF 3BP4B 3FKUS 4KMQA 5J11B 1FNEB 1S3KL 4GQPH 4LEXH 3EYVB 1C12A 1HHKB 4HLZG 4OGXL 4TVPH 1D5BA 5DJDB 2D2OA 4AEHL 4GG6E 4U1JA 3KYAA 1XF4B 5IBTH 5F9WC 4LLMB 4JRWA 4IBLT 2VR5A 3VJ6A 1E6JL 3V9FA 3QIBB 4LLQA 3B9KC 2EEAA 4E5XA 2QHRL 4YDJA 1UWGL 3T4YA 1AD9B 1RJCA 4TRPH 3CX5J 3IU3A 5DFWH 5I17A 1SYVB 1KUMA 4WJ5A 1A0QL 4YJZL 3WIHL 2E27H 4K7PY 2FBJL 1MQ8A 2C3VA 4I3RH 1ZEAL 2EKSB 4KHTH 2G60H 4Y5XA 3C6SA 4DN4L 1YZZA 2OK0H 3RY4A 1G7LB 4M43L 1UXWA 4ELMA 4HDIA 4L9DA 4U0RB 3OAZH 3GSNA 4NM4H 4OF6A 4Y4HA 5F7DB 1D3CA 2CGRL 4XB7A 5BZWB 5KS9A 3MV7D 2EECA 4OZFG 2NCMA 5HVWA 2VDOL 1NUFA 3MLSL 5D72L 3E3QE 1KXQE 1HH9B 4MWFA 5DR5L 1MFEH 3O2DH 5DQJA 3WCYA 3L7EA 3ZDZE 3EJZC 3CD4A 4JO2H 4NFDA 3OZ9H 1BAFH 1IMHC 3DX8B 3TWCL 1KB5L 2NTFB 1WITA 3CFKA 4UNVA 4Y2DD 1UXSB 5CINL 3DX7A 1CQKA 1MCWW 2GCYB 4JFOB 3U0TA 3TNMA 1QLEH 4K7PH 4ZFGL 1FFNA 5LWYL 1L6XA 4OGZA 4FFVD 3CX2A 3O8XC 1X5HA 1XAUA 4CN1A 5D2NB 2HKFL 4PGEB 5I1DA 1Q0YH 3RDTD 5E8DL 3ZTJH 4AQOA 1KXTB 3IFOB 1FE8L 1ZGLA 4A6YA 1TQCB 4PJ9D 4V1DE 5TQ2L 1AIFB 3SGEH 3RKDC 1MHPH 4R90L 2QKIB 3ROOA 3C5JA 2EIDA 3PG2A 4OB5H 5IG7B 8FABA 3LEVH 4PJIF 5FO9A 1CIUA 3WIHH 4HV8B 4XNQA 4RIRA 3OAUL 1JI2A 5ESAB 5E70A 1UEYA 1XR9B 4PGCA 1ACZA 1F4AA 4Y16B 3L5WB 1S9XB 3QFJE 1WEJL 2B2XH 3D85A 2HTLC 1A9EB 3UJJL 4G9FE 4QHUA 3DYOA 5DHVB 4A2LA 4KRLB 3CFDA 3QP3A 4U33A 5DS8B 3GMRB 3CPLA 3L3GA 3ZTJG 3C6SB 2V7HB 1P7QA 3T4AA 1OM3L 4H26B 1MUJA 4URTB 5DRWB 2CGRH 3PP3K 2YR3A 3D3VD 1BFOB 1MCRA 1HYRC 4PBXA 1WC7A 5HDBE 4LSPH 3DO7A 4RAUA 4CDHA 3RHWF 3MROB 3N50A 3TN0C 1KJVA 4ZYKB 1ZT7A 1M05A 1XGTB 1E4JA 1ZT4A 1J0KA 3MXVL 2ITCB 5E8PA 3QFDA 1QBML 1EHLL 4JFEE 3MRKB 4QTHB 1F11A 4WI5A 4GW5A 2BCKB 5BV7H 4FZEH 1T7YA 3LHPH 1ACYH 3MREA 2P42B 1LEGB 4X9HA 1MCHA 1QRKA 2RCSL 1HINL 4DGIH 1T3FB 4FXKB 1NCDL 4XP4H 1TJIH 4O4YH 4FFVC 2K9UA 4QOKB 1UB6B 4ZFZB 2JELH 3AC0A 1XZ0B 1I8MA 4OZ4B 1HSAB 4M8QB 2BSED 1MAJA 2E3VA 1DUYB 2RJMA 5J56B 5MEQB 1XEDA 3DUUA 2JTDA 4MSWA 3VXMD 2VQ1A 2X7LB 4LSTL 1JNLH 4R4NC 3R0NA 4MCYA 1X5KA 4LARL 2HTKD 3JWDH 3GSRB 3NFSL 2NX5A 2NY7H 4JHBA 3LRGA 4QRPE 2YUWA 4GBXA 1RZFL 3VFRA 2QSCH 4M3JA 5IVZA 4K3JH 4JVUA 1WFTA 3MLRH 4UT9L 4PUBL 1JTPA 2BDNL 4LPXA 3STLB 3PDGA 3QUKA 4LP4A 1DE4A 4LIQE 1Q8MA 3IDJA 4NUJB 1CFSA 1UG9A 2VL5B 2HLAB 2WINB 1NFDE 4LCYA 5HYJA 4OV5B 4JO3L 2WBJA 3C6LC 5L8KB 3NIGE 3CLFL 1C5BL 1WFUA 4W81A 5B38G 1DN0B 3K8MA 3TF7C 4WW2F 5IG7A 5CEZE 1I9RL 1NC4A 5J1AA 3V4VL 1EXUA 4YHYB 2R39A 3RZCA 3G08A 4NKOB 1KTLB 3QG7H 4PRHB 3FO9B 5DEZA 1G1YA 1H8OA 3KPLB 4LHUG 1IGIL 3K8LA 5ADOH 2FHBA 1RZKH 1IC4L 4L3CB 4XP1H 1MAMH 2QLVB 1CICA 1T22B 3HCVA 3QDME 4F9LC 1DDHA 2AJXL 3G5XB 1LE9A 3LN5B 5DJYB 4Y5YC 3QDGD 5TF1L 2WM0A 4U6TA 3QHZH 3BRGC 1NMBL 2HFEB 1ZHLA 4YHNA 4Z9KB 1FL5A 2J8UB 3AMLA 5I0ZA 4LLDA 5TQ0H 3QDAA 4ERSH 1HNGA 3E1F1 1Q0XH 2WBKA 3I6LD 3HB3D 3W9DA 4ONGH 4X99A 4FQPA 5JXED 1EHNA 1LEIB 3V6OA 1NBQA 4PRPB 1X6LA 4QHNB 4F2MB 4BYHA 1G9MH 4HJGB 3QXDB 1G0YR 1WBYA 1QACA 1TXKA 1YQ2A 4PBWD 2W0FA 5DMGD 2JIXA 4M7LL 4NRXB 5IQ9B 4AIXA 1MWAH 2I07A 1HEZA 3SY0A 4ODSH 5I1LA 2JELL 5FO9B 1WTLA 4OCSH 3MJ9H 5FCSH 1OPGH 1AO7A 3G08B 4NKOA 4L4VB 1U42A 2NY1C 1HZHH 1N59B 4LRIC 3P30H 3W81A 3OB0K 5IF0B 4NBXB 4PJGB 3BGMA 1U3HC 1I7ZA 1FCGA 1LEGA 4HEME 3JWDL 4QRRD 1RZJH 4XGZA 2GKIA 5K9OB 3GSXB 4JKLA 4PJ8A 2HFFB 5E5MB 3U46A 2FECI 3EDEA 5D7LE 2NZ9D 4MD5A 1FZKA 4ODHL 5CGYC 3O3EA 3HI1B 5C1MB 3VG0H 3THMH 3E6FA 3QJHA 1F00I 3TNMB 1MJUL 4RMRA 2VDKH 3UJTL 1OGAD 3CC5B 1GAFH 5GRVK 5I1AB 1FG2B 3IXAB 3KPSE 3EDFA 4HX1A 3BRDA 3OJVC 1U6AL 1D5MA 4HG4J 4HWEH 4G42B 3LDBB 3G9AB 3K0WA 5HPMB 1UZ6E 4HULB 3WFDH 1MF2L 4YHOL 3VXRB 1Q94B 5GS0D 4DZ8B 2C1PB 4YHIA 4MDIB 3ULVL 4PJAF 5EN2B 3S35H 2VWEE 4RWYH 5C08D 3VFVB 3WIIL 1T2QL 1EEYA 3MJ9A 1EPFA 1IAMA 1RIUH 1QLRB 4JY6A 2DD8L 1TCMA 1A47A 2VZUA 2GJ6D 3CDYA 1ED3B 4L29A 1JI1A 3H7BB 5AZEL 2H26B 2P1YA 4LEOA 2QQNH 4KKAC 1J1XH 2WV3A 3QDJB 5I30L 4GQ9L 3INUH 3I9GL 4ZUSB 4IS6B 4OLXL 4Y5XB 3KPRD 2Y72A 2BP3A 2EZ0C 1FH5L 1N64H 3SDAB 5I19L 1ZXQA 3WHE1 1BQUA 4LLUB 4M1GL 1VGEH 4UDUB 5FKAB 4H26A 5IBTL 4FFZH 3KPOB 1AXSB 3TEUA 3CVHL 3D87B 5T3ZH 1K8DB 1WUNT 2DMKA 4J3VA 1RUKL 1MVUA 5HHPA 1SJXA 4K3DH 5DMIH 3FONA 3BXNA 2AP2A 4ELME 3NZ8B 4K9EH 4PJXE 1SJEB 2E27L 3VMPA 4YEFA 3CFCL 3GSUB 4ORZC 3PF2A 1KJMB 5MENB 1MJJA 2G60L 3HC3L 1AGFA 4Z7UF 4LVOB 4JPWH 2YK1H 4JLRB 4L4JA 3F7VA 3BW9B 3GO1L 3RQ3A 3BE1L 3TJHD 2B20A 3DI2B 4W4OC 3DRQA 1W72H 4KUCF 2A0LD 1BM3H 4PRPD 3MRJB 3QXUA 2W07A 3KNBA 2VOTA 3O81A 1N0LA 2ZCHH 2K7PA 3FFCB 1VFBB 3IB4A 3JWNC 3VD4A 3TO4B 4MJID 3RVVC 2EDDA 3OR7B 2ITDA 2A38A 3P11H 3SBWC 1FIGH 4LRIA 5F6IB 5KVGH 3O45A 3WFDL 4GW1B 4GXVH 4Q2ZB 2R2CA 5AYUL 5HDQL 3HE7D 5AZ2L 2IANB 3MV01 3H8NA 3K8KA 4ZG1A 1HYSC 4MD4B 1CXFA 4WO4D 3S4SG 5EUOF 5I1AA 4NHCL 3RWEB 1J1PL 4NKIH 4XAWL 3TWCH 3VFGL 1RIVL 1FCCA 3V0WL 4Q9CA 5FUOL 4KDVA 12E8L 3KPSA 4OF3A 3MLTA 2DLEA 5A2LH 4K2UL 4RFOL 1DQQA 5CEXA 4KFZC 5F1KC 1NDMB 2VXVL 2IWGA 5KSVA 3TH3T 2ESVB 4OCWH 2XA8L 3HG1A 1W0VA 1MHCA 1A6UL 1ZHBA 4RBPH 4EIZC 4Z7OE 5C0DA 4QT5B 2A77H 1FJ1B 1Q9LA 1O5DT 5E8DH 5KVDL 3WKMH 3PJSB 4OCNC 3S98A 2ATKB 3VI4F 1VACB 2GTWB 5KANG 3VI3F 2VDPL 4NQVB 4G8GA 3L7FA 4Z0BH 5GZOD 4JAMB 3ZE2E 1D5XB 5CUSH 2IBZY 5GSRA 4F8QA 2QR0B 4K23L 3X13B 1F45A 5F7YC 4KJYB 4PJ8D 4CMHC 2GUOA 5FA3B 1FNLA 3HC3H 2ILLA 4QRRA 4S10A 3BH8A 1BEYL 1QR1A 3UTSD 1XH3B 1YC8A 9CGTA 1N5YL 5D1XA 5DWUH 4P57B 3DXAA 5DMJB 1RAMA 2ARJA 3RVVD 1JUFA 4RMWA 2NYYC 2VC2H 1QLFB 1MJ7L 3I6GA 5EU3A 2P5WA 2V5YA 4LCWD 4XNUL 3ZHLA 5BRZB 4U1KA 4PJFB 5IT2H 3TBTA 3PHQB 3MRCB 1MHEA 3QZWA 5D7KE 5L8LB 5E8OA 3RWJB 1JNNL 4MXQC 4Z5RA 5FGBC 2BY2A 1HH6A 2H2SC 2HJFA 3KNBB 5DMKB 2DYPB 1UM5H 1QYGH 1T4KA 1XGPA 3NFNB 3O6MH 3VXNB 4GRLD 4JKMA 2JJWA 4NRZB 1SEQH 5I1EH 3GMNA 4PRNB 1NMCC 1RZIB 3CVHA 3QDGA 2LQRA 1CYGA 3IDJB 5FUOH 1CLOH 4R4BB 1SQ2N 2ADIA 1BFTA 5ISZB 1PG7L 4XNZC 3U79A 3HR5A 3MR9B 4OKVA 4U3CA 3SKNA 3IDNA 2ADFH 2FHCA 2VDLL 1AKJD 1HXMB 1P4LA 4J3XA 4GKOA 1ZT7B 4IRSB 5I1JL 3UYPA 2CKBB 2ZZUT 4OFYD 4LK4A 5HYJD 2HH0H 3EYUL 5EOQH 4CADB 2APVA 1INQA 3BVNA 2JK5A 4OQTL 4QNPE 2LVCA 2J8UF 4OUUB 2A6DB 4PUBH 2P4AB 5GGUA 3VH8A 3AM8A 1FGVH 5FA4A 3TBWB 4KU1A 1L9NA 2C1OA 5FECA 4OIAA 2DQEL 1YEIH 1CGXA 1A4JA 1RU9H 3E2HC 3D69B 3MOAH 3WSQH 3QWRD 2BVUA 2XTJD 4MDJA 5JIKA 2AVGA 3EW3B 1WBYB 1K85A 2H3NA 4DKFL 1TZIA 5D6CB 5HHXL 4GSDH 5DEFB 2FR4A 2OR7A 5HVHB 1IGIH 5ADOL 2BMKA 2NPLX 1KJ2A 5CZVL 2LU3A 4WFED 5C6TL 4PS4H 1NAMA 1YNKL 4GO6B 2IQ9H 3QHZL 4TN9A 1T21B 5E6YA 3TVMB 5AAWA 1RK0A 4KWUA 2XQBH 3HNSL 2VQUA 3Q2CA 3H42L 4JRXE 1JV5A 5DD1L 1Q9OA 1OP5H 1KTKE 1RUAL 3OJDB 2YD4A 4LP5A 1OAYL 3MZTA 2ARJB 2AEIT 2WK2A 3T09A 3L5XL 3DJ9A 4YBQD 4ZUUB 4TULL 2D0GA 3MLUL 4K7FA 2AJYL 4Y4HC 3MMEB 1JWUA 4U7SA 5I1HL 3V8CA 4Q9QL 4JANA 4BSWA 1LD9B 5D70H 1PW3A 1K3IA 4GKNA 5CLTA 2GAZB 5K33A 1CR9L 4Z7UE 4I0KA 1LE5A 5C9JA 4WW1B 1I85A 4NQSA 3U0PB 3V5HA 2HMIC 2Y36H 5E8OB 2A6IB 2VSDA 3TNNA 1JN6B 4JREC 4XHJD 5D7LA 5IBLC 3RWHA 4NCDA 5EOCJ 4P46A 5E4IA 4MNGE 3K4AA 4N0UB 1U8QA 4XTRD 1S5HB 1SM3H 2R1YB 5F9OH 2YWYA 3CH1A 4I9WD 3E6HB 4JFDA 1F6LL 2VMFA 3O6FB 3B9KA 1TVHB 4OZHF 3SO3C 1IAIH 1UWEL 2B2XL 1WBXB 4HWBH 2WUBL 3MO1A 3JWDC 2XG4A 1QEWB 2E7LC 2DKSA 3QQ9D 4QOKA 4WDIA 4LKXA 5J13C 2Q3ZA 1UYWH 5ALCL 3RL2B 1TCRA 4XPHL 4FXGB 3JUYA 3NH7H 4KI5C 1ZLSH 5LXGL 3GSWB 1DBAH 1JHLL 4TPRL 4LFHD 4EQ2A 5CGTA 5TFSH 4NPYB 5F96L 4AEIL 3BH9B 4KC3B 5HI5D 1KNOA 5F7NC 5F21B 2R1YA 3IDYB 1PVHA 5BRZE 1MQKH 3TZVB 4EBQH 4XC1L 3REVA 3O4OB 5EZOH 3HA0A 3UBXA 4FA8A 2AJUH 2VXTL 2OL3L 1EH9A 4YXHH 2XZAH 1XGYL 4M6OL 1IKNA 3QEQD 4FTVD 5IK3A 3BPOC 3MLUH 4XZUA 5KAQF 2P7TA 3DRQB 4J7RA 1WLHA 4NYLB 4JZOA 2GTZB 3DECA 3F7VB 4V2CB 3BKML 3TJHC 3DO3A 3LN4B 3LSOB 4FXGA 5ELIA 5HJ3A 2CO7B 5E8NA 1F97A 1RZFH 4F9PC 4Z7WB 4HCRH 4ODUA 1U8OB 4PJHB 2BJML 4NDMA 1YPZA 1U3YA 1NEZA 3EO0A 3VGGA 4AH2B 1U8JB 4PREA 5GISH 1BWWA 1OP3H 1JGDA 3BT2H 3PQYD 2V2XB 5GS1A 4M1CD 5MP6H 5DEFA 3CFCH 1RJLA 2EXWC 3FRUA 4GS7C 4B7LA 1ZWIB 4L8SB 1JRHI 4NRZA 1C5CL 4E41D 1MOEA 3D3VE 4P5KB 1I9RH 3O4LA 3MZGB 5D5ME 3ZYZA 4LSUH 5DDHB 3B3IB 2BSRA 4OF8A 3VE0A 1BOGB 5TDPA 4IOFD 2AV7A 4N5EC 2QQLL 1G0XA 2ITCA 1DEEB 4KI5D 5E8PB 3VD9A 4K8RL 1MNUH 4OZFB 3STZB 1U3JA 4ZXBC 2DLIA 5JUEL 4LSPL 5SX4H 5GRZA 1CD1A 3I2CH 2P47B 3H3KA 4JDVA 3HPJB 2X4SA 1ZHNB 2BC4A 3VMNA 5AYUH 4YWGH 3RIFK 3ULUL 1JYWA 4YIQB 4J8RA 1A1NA 3NACH 2I24N 4WHDA 4LQ1A 1YNLL 4NDMB 3K2UL 1U8HB 4IDJH 4YZFF 2X1PA 1P84K 4LF3B 2XWTA 2NXYB 1FL6B 4OIIL 3MRHB 3MA9L 3O11B 1OAUL 2CMRH 1GGBH 3REWB 5T3XD 4XP4L 2GY7B 4XP5L 2YPLE 4YDIH 3VFNB 5ACMA 4B7IA 5B3JF 2D0FA 4RFOH 4EDWL 1I3RB 1ORQA 2VXVH 4PJGE 3CFJA 4NQDE 4QXGH 5DUPH 1F58L 5HHOA 3D0VB 4D3CL 4NNXB 2VERN 4DQOH 4LCCB 5EO9A 1C16B 4OD1L 4G6KL 4N8PA 3DUSA 2VLJB 5CP3A 5BV7B 3SOBH 4QHKJ 3ZE1E 4CN6A 5CWSB 3DV4B 1GXEA 4OJFL 1IM3B 3SJVB 1UACH 2EIZB 3I02B 4OAWB 5L6YL 3CZFA 3GHBL 4FP8H 1JNHA 1INEH 2GCYA 3P0VL 1A1NB 5AAMA 2YXFA 3V6OC 4UB0H 2A83A 1GAFL 3VXOA 5MHSD 4WJ5B 4TSCH 2VNCA 1DQDL 2LU4A 1CFQB 4UV4L 4X6FB 3QRGH 3HZMA 5BVPH 5IIEB 4PRID 3BHBA 4R4BA 4I1NB 2DYPD 2ICCA 3KYOA 3OF6D 4GRLC 4MYWB 5D1QA 4X7TA 2NY3B 5HI4C 5IB2A 1BECA 3GSNL 1F3DJ 3ULVH 4JY5H 3H9SB 3S3PA 1U3HB 3HR5B 3QYCA 3KYMA 5EULV 4JO2L 4LCCA 4RQQA 3CLEH 2BSRB 1UZ8A 5DJ8B 4FABH 1T2QH 4PD4J 5BV7C 3GI8L 1F4XL 1CF8L 3C5ZA 4KGJA 5SWSB 1YMMA 2VLKE 4L4VA 5IB3B 5C07E 4NWUH 4RMSA 1AXTH 5D5MA 4LGSB 5EO1A 2V5TA 1IAOA 2WWMC 2X41A 4ZPVB 1LO2L 1KIQB 1JUFB 2Q76B 1JZ7A 5IQ7H 3E8UL 4PGDB 4APQB 5LWYH 4OCRL 3U36A 4MMXC 4MA8H 1KFAL 1N64L 2OMBA 4OBSA 3IDUA 1INDH 4MHHI 2BVTA 1GGBL 1AC0A 1IZJA 3T0EE 1IL1A 3O2VL 2VDQL 4D8PB 5FYJH 1UM6L 1X7QB 1RJZB 4Y1AE 4HAFA 4GAYB 4WU5B 2BOCB 2QSVA 1IM9D 2NY2B 4PR5A 4DN3H 3QJHB 3LEYH 3MRNB 2DJSA 3ROLA 3LRSA 5EBMB 2F8OA 3GI9H 4NWTL 4YFLF 3SO5A 3WFHA 5DDHA 3U9UA 1LVEA 2BNRD 4YNYA 5GHWH 5I1KH 1F4WL 3V7MA 4MLSA 3OXRB 5GZND 3PP3H 4MVBD 1ZMYA 1MCCA 2VLRA 4XMPH 4KZEH 4LMQI 1Z0NA 4ZSOB 2IJ0C 4HW6A 2GITA 2KPNA 4OLVH 3P0VH 3IS0X 2IH1B 2J2ZA 3GK8L 4E9LA 1ADQA 4NQDB 3KYNB 4U1NA 4XVUC 4M3KB 4S0TD 2F53E 3O2DA 3D0LB 1SJHB 1N2RB 4HWZB 4QTIL 2VITB 3PWPE 1DQJA 3MMEA 3IF1A 5JTWA 5F7FA 4S1RH 4CVZB 4F37F 2YXMA 1AGFB 2UWEF 2H32A 2YPVL 3IXTA 3V2AR 4W4OA 4JFZL 3PXHA 5J6GA 1LO3L 1LK2A 2ZUYA 4WNQB 4IOIA 4N0YL 2OS7A 4K8RD 4PLJC 5KANI 4M6AA 3S35L 4JQXA 2W9EH 2Y25A 2UZIL 2HT4D 4NHCH 3VXSD 3IDMA 2EKSA 1A3LH 1Z5LA 4HKBB 4KJQD 4X6FA 3LHPL 2DJ4A 2IFGA 4E41E 1KC5L 3D18B 4RCAA 3O2WH 4LU5L 3RVTD 5F70A 3CH1B 5C0AD 3SGJA 2EICA 5GGRY 4DAGL 2YUZA 4CW1B 1AC6A 2CDEB 2NTSP 3EJJX 5FO8A 1V7NL 3C6LD 4GXUM 4ZFGH 2PW2A 2CR6A 1FAIL 4Z7VF 1UCTA 3W5NA 1I4FB 4LGRB 4UIKH 1FAKT 3ARBC 3BX7C 2HMID 4GW5B 5HHNA 4M1GH 4OD2A 1S5IL 1AP2A 2NY7L 3FB8B 5F1NB 3RBSA 4FG6C 1ZTXH 2JJUA 4KV5E 1F02I 1MLCB 1N3NB 5JXAL 5K9JH 1FFOA 4X5WA 3ARDA 3BRFA 5DVLA 4WW2C 1CL7I 1T5WA 1CI5A 25C8L 4JFHE 5F3HA 3QULB 3FQTA 1ZLVK 3RWJA 3QO0B 4NFCA 1Z3GL 2J8UA 1MCDA 1OGTA 2OTWB 5EU5B 4QHNA 3CSPA 4ELMF 4K3GA 4XMPL 1X5AA 2GJ6E 3FT2A 3FQUA 5E08H 3BYTA 3CXHJ 4HIEB 1S9WA 3OV6A 3QO1A 3MRLB 4R7DA 5B8CB 3NA4A 3PWPD 2PXYB 3BAEL 3RWEA 4PJXA 4AMKL 5I66B 4M7LT 1RUMH 4U2YA 1NGZA 4X4YA 5HHVH 3VD5A 5JDJA 4XZUB 2ZCHL 2Q6WB 1JTOA 1TVBB 4OZIB 3UMTA 4KQ4H 1R6VA 4ODXA 5GRVL 4FXLA 4L3ED 3ILPB 4M7JL 4NQDA 3R1GH 1A7QH 2XKNA 3NA9H 2X89D 5TE7L 4R4FH 4Y4KC 5EO9B 3W2DL 3F12B 1BJ1J 3MBXL 3RFZC 2ORBL 4WFGE 3VH8G 4PJ5D 3ZE0F 4V1DB 4IIQB 1NGYB 2A6DA 2ZUWA 3HI5H 3NAAL 5ACZB 5IW3A 4I0PD 4XC3H 3ARRA 2ZCKH 1AGDA 1J10A 2EC8A 1ACYL 4XMLH 3SGKA 2OL3H 5D1ZB 3TJEH 2R23A 3SDCD 2VZ1A 1TCRB 3ZDZF 2GFBA 2VSCA 3MJ6A 2DMCA 3DVNA 2H8PB 1CXHA 4EIGB 3CFIC 3QFJB 1P2CA 4GRLB 1AHWA 1RZGB 4LHJB 4ZXBB 1HOCA 2IH3B 2WSKA 1KXVC 1I9IH 2XNAA 4BSVB 1HQ4A 5T5NF 4LARH 3FFCE 5ISZA 5KAQG 3F12A 3RWFB 2AJZA 4I0PB 2KZWA 4IRJD 1AR1D 3EFFB 3IRZA 4XPFH 2EXWD 1QHOA 3U4BH 5M7QA 1QSZA 2UZYB 3U7AA 1YMME 2VLKA 4PP1C 4V1DA 4MAYA 1NBYB 4Q74A 3DMMC 1T5XA 4MA1B 3QDJA 3MJ7B 2EDOA 3KDMB 5GJSL 4JO3H 1G6VK 3RL1A 4QXUL 4Y8AA 4XXDB 4X9FA 5TPWL 1OTSC 4MXVE 2GYSA 2V6HA 3QAZB 3U30B 1IILE 5DWUL 2CXKA 1ZANH 3MPCA 1NQBA 3MV11 3QFJA 4HS8L 1YEGL 2BOCA 4HMEA 4JFFA 1BD2D 1KN2H 1B3JA 2PN5A 5JR1L 4G7VL 4G9FA 3MRLA 3C9NB 5A16A 2ZPKH 3HNVH 2W0FB 4UBDC 1RIUL 4F33B 1T80A 1R24A 3AS0A 3FQUB 2AEQH 4HF5L 1FVEA 3E6HA 3HKFA 1P4LB 5B3JE 3BDYL 2V2TB 3V5KB 3EOTL 4ZS6C 1E4KA 8FABB 3MCKB 3UO1H 3X13A 1ZT1B 2IPKA 4MA1C 3ZE2F 2JCCE 3IDIB 3I9GH 1LQSR 2PR4H 4X5LA 4ZSOA 5HY9A 5SV3A 1WAAF 4PV8A 2O93L 3KLAA 2OJEB 2VISB 1HH9A 4MWFB 3F58H 1BF8A 5IJVB 3AGVA 3KS0J 4HFUH 4RISL 3D1MC 5EOCL 1CL7H 5BZWA 4X4XB 4OAWA 1A6TA 2HKFH 1LP9E 4LLWB 4WTWA 3ET9F 3MUJA 4KROB 3KPLA 1G6RA 4WTZG 3BSZL 5EO0A 1MI5E 3MBEA 1P1ZA 3IDGB 1T04B 2YPKA 1K6QH 1MRFL 1CT8B 4LOUD 1CFVH 3PWVA 2QADC 4G8IB 4R3SA 2IMMA 3BPNC 3AB0B 2IADA 3HAEA 3RAJL 4HGMA 5DD5L 1FG9C 4F33A 1PDKA 1TQBC 4F7PA 4AG4H 2VXSH 2EO1A 3UYRL 1DL7H 1ES0B 3VFPB 1Q94A 2AQ2A 3KPOA 3TT1H 3VMOA 2H2PD 3OTTA 4WW2A 4KTEL 2JJSA 4B0MM 4PJDE 2N56A 4PG2A 4R26H 1NCAL 2X70A 1L7IL 3IDNB 3PWNA 5F7MC 3H3PH 4EI6B 2AERT 3A6BL 4LLMA 5EIVA 3PHOA 1DANT 3I3DA 1B0RA 4Z0XB 4H0HB 1GZQA 2UZXB 3MV9A 1QFWI 1RIHL 4X7SH 2UY7A 1C1EL 5HHNB 1S7UB 1H0DB 3BD3A 3RKPA 2DJUA 1W0VB 3OKLB 5F44A 5IFJA 1IGTA 1GGUA 1S7WB 4LVHB 3SE9L 5IOPA 1OTUD 3OAYH 5D6DC 4WI8A 3ILQD 5JPMA 3BD5A 4G7VH 3EDDA 1O0VA 3KGRA 1J1PH 1P4BL 1JN6A 3HZMB 4HF5H 3MRIB 5FHAL 2G75B 3TO2A 1OHQA 2NY0C 3UX9B 2VH5L 4X4ZA 4NIKB 3HMWH 1FVDA 4U1HA 2EIEA 4JN1H 4OLZL 4BSVA 5J11C 1LO2H 4JFYB 4S1DC 2XZQH 4X0KA 2PTTA 2VO5A 3UPRB 4BQ8A 2VQTA 4B50A 3WFCH 4GW1A 1K2DA 1FVCA 2P5EA 3S88L 5T1MA 4W4NA 4LSTH 4RRPA 1ZGLP 1MJ8H 4X6CB 3U4EA 3V6FA 3KPPA 2NY4D 4XPAL 4LSQH 4GW4B 4AY0A 5DD0H 1FNSH 1T21A 5IFHH 5SWSA 5SWSD 3Q1SH 4AIOA 4U7MA 2YS4A 3IFPA 1J5OH 4UT9H 5CUSL 3VFWB 1XF4A 1AQKL 1EA9C 4O02H 5KSAD 4JZOB 1EDQA 4CVUA 4Q6IB 4ZPTB 1A64A 1F4WH 4PJHE 4IIQC 1VFBA 2GK0A 5B3NA 5E2JA 4DUVA 5BMFH 3QIWA 4NN5C 1R5VA 2AK1L 1ZLWK 2H9GB 3IGAA 2X1QA 4OZGB 4Y4FC 2IC2A 4OM0H 5IHUL 4PJ7E 1VB9A 3GK8H 4MNQA 3IDXH 1ZOXA 3LRSB 4PREB 4UTBL 3D3VB 1MVFA 4S1SH 4HGKC 4QRPB 1RZJC 4PGBB 3IFOA 3IRPX 5JMOC 4PJDF 3S36L 3BFOA 1U8LB 1A6VH 1QZ1A 4LPCA 5GGSA 4S1RL 3ZSSA 1T03L 2XZCH 1M71B 1K4DA 4PLJD 1NMAH 3O3BA 1IGYA 3V6FB 1X5YA 2XFXB 1WT5A 3GUTB 4YFLI 2FWOA 5L2JA 2NXZD 4FQ1H 3EDKA 4KJWC 2GTZA 1CDCA 4P2YA 2DLFL 1R5IA 5D1XB 3T8XA 4P59H 3EYSH 5DUBB 4BFGA 1UM5L 43C9B 3K2UH 1XH3A 1VEMA 3QULA 1QP1A 1MPAL 1A7BA 1M7DB 2DICA 2WIIB 3KYKL 3ISWA 1G9ML 4OD3L 3RVWC 2ZCLL 5E94A 5IHZA 1XGQB 3GB7A 5ID0A 5E4EC 2DQCH 3VWKC 4M7LH 5AUMA 5I6XB 2AXGB 4PRHA 5IMLA 3O9WC 3QR2A 1JBJA 2EE9A 3QZWG 4HH9A 4G7YL 4KXZH 2KUTA 1A4JB 5DGQA 5MHSE 4G8GB 3SN6N 4JFXB 1P4IL 1IFHL 3EYQD 4OFIA 3FB5A 2LE9A 4PIRF 1HH6B 5E99H 4CAGA 3QISA 4DZBB 1RZJL 4FQJL 5BO1H 4OLEA 5JOFA 1KF9B 2HLFC 4XCEA 4LSQL 5EOQL 4HSQA 3CZJA 4JFEA 4KK9C 3A6OA 4HJGA 3S3SA 3PDOB 4L4TD 5SWZE 1NPUA 3TCLB 3QCUL 3GHBH 1I1RA 2J5LC 2V2TA 3K3QA 1HXYA 1S7SB 3TVMA 1AHWC 1QFWH 43C9A 1RI8A 5IMMA 2NXYC 2IANE 1EX0A 1T7WA 5E4EB 3SJVE 2EO9A 4FQXA 3VFUA 2DRUA 4KK5D 3QIUC 3RI5K 3VRJA 4M48H 3ZYOA 4ETQA 2I9LB 3CFKB 2P7TB 1L6ZA 4ZS7L 4D8PA 5DFTA 4DVRH 1B9ZA 4LLWA 2A1WH 4U0QB 1DJSA 4W6WB 2Q8BL 5DR5H 1MF2H 4YHOH 5DTFA 5LGJA 4OF0A 1H15A 5D7LB 3RWHB 1BBDH 1I7TB 3GSXA 5BS0D 3V5HB 3U0PA 4Y4KD 4AH2A 3G6DL 1A14H 3BPCA 1BD2A 3REWA 3TBWA 1D5ZB 1U8OA 4PJHA 2GHWB 2XQBL 4P5MA 3OXRA 4ISVA 4XNMB 2H3NB 5C86A 5C0GB 3Q5TA 4FZ8H 5CP7A 4NHUB 1B2WH 1DE4B 1OAYH 5TGBA 3CXDL 1QQDA 1XIWD 3ROOB 4GJTB 2GJZB 4P4KA 2HFGL 4MHHG 4R7NB 4BQ9A 3SDCC 4JRXB 2CKBA 1OARH 2CDGB 2V5RA 5DC4B 3BGFB 1CR9H 1WWAX 2F15A 3MA9H 1D5MB 4WHYG 4MAYD 1IGYB 3PWNB 1KB5A 4EN3D 4O51A 4BH7B 4OCLC 5IB1B 3KXFB 2XV6B 5HYQB 4N5UA 1MWAB 2QQKH 2J8UE 2OTUA 2Z35A 1URLA 5HSFA 1NCTA 4FMFA 1A02N 3LQAC 2AEPL 3M45A 1M7IA 2IALB 1QKZL 3RWDA 4XVJH 4P5MB 4KZDH 3QDJE 1FL3B 1BGXL 5F1IA 3BUYA 1KT2A 3UXFA 4CMMA 4EDXA 4GG8A 4M00A 1PYWB 3T2NL 1MFAH 1SY6A 4LSDA 4PTTB 1NFIA 3DMMD 1X5FA 3GHEH 3CUPA 3FO2B 3PP4L 5DLML 2Z91B 4S2SB 2NY5H 4FP8L 1C12B 4JDZA 1QFWL 3VXUE 1WJ3A 4PRIB 1EJOH 5ICZB 1HOCB 5DRZA 2IGFL 3WHE0 1RZGA 4JFFE 1HEZB 3SY0B 4P49A 4QEGA 5JZ7D 3QCVH 4MGXA 2LV4A 4KROC 3L5JA 4LSRL 4PV8B 1DBAL 4TPRH 3HZYA 3GKWH 1ONQB 1MCLA 4LRNL 3BESR 4ZOAA 4H8WL 1OW0C 1HXYB 2Y06H 2IEPA 4PJ7F 2CLVB 1S7QA 3PQYE 2EIZA 3Q0HA 2PNDA 2XG5A 3FN9A 1I1FA 5EZOL 4G3YL 1T0MB 2EXYD 2VQ1B 2X7LA 3NCFB 4PJ8C 2VZOA 1S7XA 4PJ9C 2ADGB 5JHLH 2BVYA 3QNYB 3LQAH 1KGCE 2SEBA 3HRPA 1NFKA 4YXHL 2EDNA 3EO9H 1KT2B 4CMMB 1UM4L 2OR9L 4Q7DA 1IRAY 1QSED 4PV9B 2V2WB 3NABH 4PGJA 1NMCB 5CEZL 1E4XL 3JV4B 3LD8C 1S3KH 2CQVA 3MLZH 4MAUL 1ZE3C 1U8QB 3N1FC 1EGJA 2R0ZL 4Y5YA 4JKWA 3F58L 1J87A 4NPYA 1MI5A 5FGBA 2DQDL 4MDJB 3S96A 3OKKB 1FDLL 1NGZB 1GIGL 2Y7QB 2X4PA 1WC7B 5EIIB 5HGBB 5EU4A 1WBZA 2YBRB 4RAHA 1T1XB 4JGJA 5CIPA 1T2XA 2BRQA 3QUML 2EEDA 2EC9U 1T0NB 3GIVA 5HYJB 3RUGE 5EU3B 2CLVA 1IEBA 1VEOA 1CFNB 4K3JL 4GLRH 1S7WA 3FMGH 3O6LH 3WXWL 3S9DB 2EYTB 4J8RB 2DM4A 4KVCL 4HIJA 3QNYA 5HVFB 3WHXB 1NDMA 1X3DA 4JPVL 3WDJA 5FYLE 4BH7A 3MYZA 4J2XA 3T1FA 1ITCA 3TYFB 2DI9A 4EZMA 5GSVA 1MLCA 1G9NH 4JKKA 3DX9A 4PJCA 4F7TA 1YNTA 3MNVB 3ABZA 4HQQL 2FECL 1OQOA 3DROA 4LLDB 4LQFL 2P49B 4MJIB 1NCWL 3VFOB 3KLSA 4PJBA 4MS8C 1RZIA 3QCVL 3AFLA 3BUYB 1OSZA 5FM5M 2ERJC 5D2NA 3NA9L 4P4RA 1OLLA 2EH8L 1DLHB 4P3DB 5AG8A 3BISA 4U6HA 1A2YA 4M02A 3QUKB 1OP5K 1TMCB 1WWWX 4Q6IC 2FZ3B 4CU6A 1LP9A 5IHBA 2NY0D 4XC3L 4JFHD 2NW2A 4F15B 5KG9B 1QOKA 2LTQB 3MUZ1 3LIZH 4PBVC 3WFZA 1IGCL 3VRLE 4GMTH 4JM4L 4WUUE 3GZKA 4QCIB 1UJ3A 3WE6A 4S1DD 5GS2H 2VH5H 3F6IA 5IWLC 1T2JA 3HZYB 4NP4H 1BOYA 4KKCC 1S78D 1KENH 3MYJB 4KTDH 4U1GC 2V7HA 3EO0B 1V7NH 3B9DA 5TE4H 5IVNA 1A4KA 3O8XB 3E6FB 5DUPL 1JHTA 1ERNA 4NGHL 3O3EB 3FB7A 3WEXB 3DPBA 2G75A 2C5DC 3TO2B 5CSGA 2Z31B 1MFCL 4LGPB 3CVHB 3FB6B 2EE6A 2M26A 5DHVH 4JQXC 1BVZA 3LEVL 4OT1H 4RRPG 2E7BA 1INEL 4WUKH 1LO5B 5EBLB 3MX0A 4OZIA 4DVBA 4YHZL 3KPSB 3KPTA 2ICWJ 4L8BB 3QRGL 2I07B 4MDIA 1RHHB 5C0EA 1NKRA 2AK1H 4NQXB 1I4FA 2YN3A 3O41A 4JCMA 5KVMC 2N7AA 3T1WA 1GGCH 4FTVA 1I9JH 2PCPA 4MX7B 3QEHB 4BSWB 1QO3B 3ARGA 1BMGA 1QFWM 1KN2L 1B4RA 4BFEA 2BSTB 1A4KB 1E27A 4NOFA 3BYYA 3FCTA 4YFEA 2Z4QB 4YHPA 4PYHA 3VXOB 1KIRA 1MI5D 1T83C 4ORGA 4XCCH 5D7SL 3KR3H 2B1HL 5D7IE 2EH8H 1KB9J 4ODUB 3VW3L 3PWVB 3FOLA 4MB3A 2H9GA 3IGAB 3V6OE 2D4DA 3DNKA 4LSSH 4ZXBA 4R96B 5F7EL 3JTTB 1LO5A 3L3IA 3NIDE 5EBLA 1UVQB 1F90L 1AHWB 3UTTD 1T1XA 1YNLH 1I8LC 3PUCA 4LPVA 2GITB 3TPUA 4JM2A 5JW4Q 1DLHA 1MCBA 1JZ8A 4NNXA 2H32H 4U6HB 5BJTA 5D1ZD 3VE0B 2VB5A 1WZLA 5L2KD 5D2NC 3L6FB 4PJFE 1MRDH 5MEPA 4IMLB 1Z9MA 5GS1C 2Q6WA 1TQCC 3KDMA 3FCTB 3GI9L 4PRBA 4JFDD 1ZVSB 2FNBA 5GIRA 3NIFE 1XGQA 4HWBA 4HZAA 2VTFA 4LIQL 3BWAB 2WIIA 4G6KH 6FABL 5EORH 3W39A 3DX8A 5J57B 2XTJE 3F5WB 4P46D 5H94B 2NY6D 4UQ2A 3D18A 4X8JB 2NZ9C 5J3HD 5LJYH 4YXKH 4ZUUA 5D93B 5T3XH 4TOYL 3TO4A 4KJQC 2MHAA 3ORJA 5D96C 4P2OD 3SDCB 4GS7B 3QXDA 4J3SA 4JFFB 3ESVF 5CMAB 2IAMD 4WFFD 3BIAX 1UT9A 3RVTC 4M4PA 4X7FC 5E7FA 5DUML 2YA1A 5EBWB 5T1LA 4F7MB 3C5ZB 4MA7H 3Q6GH 1QBAA 5BJTB 1ZLSL 4C58B 2X1XR 2CRYA 2OJZL 3QHFL 2ENYA 3KLAB 1WBZB 3QDGE 4X6DF 4F7EB 2IQAB 3QH3B 4LNVA 3TBVB 4Z7NE 1AFVL 1IAOB 2HT3D 2IPKB 1BVKB 3KPRE 2EDYA 1K8IA 3L3JA 3ESUF 2IFFL 3UYOD 1XGRA 3B9AA 3L3HB 4M9PA 1RUQL 4LAQL 5LGHH 5CSZB 5E8EB 5IB4A 3TZVC 4ONHA 3SCMB 4QT5A 4JLRA 4X9GA 2ZKHH 1CDUA 1MJJB 1U8JA 1KYOJ 1DANU 4NWUL 5C7XH 1E27B 2X09A 3FB7B 1Q72L 3MJ8A 1KLGA 1R3LA 1PKOA 3L9RB 2BVQA 3FZUC 1KJ2H 3R8BB 3QWRA 4QHUB 3DV6A 3H9HB 1MLBA 3ZT6A 5A3ID 2Y9RT 3R0MA 1FLRH 3BP5A 3SKJH 1INDL 1VFAB 1J0ZA 1H3TA 1YDPB 5FDYA 3TGXA 5BS0A 1ZHLB 5TDPB 1IAII 4P23B 4JFPA 4OGAC 4JVPA 1HN1A 2R2EB 4U4BA 2QQKL 5B39G 4DVBB 5BQ7B 2IANA 4QRRB 5FCUH 2W60A 1HZHL 4OZFA 3HLAB 1XGRB 1HNFA 2UUDH 3SGDH 3QUZC 5C0BE 3LEYL 1AQKH 4UIMB 4N1EA 3SDXA 4HBCL 4XNXH 3MV8A 3VA2C 3NCCB 4NWTH 4RWHA 3G04B 5DD3L 1Q9KB 4M62L 4UNTA 5E2VL 5FEBA 5EN2A 1EXUB 2ZSVB 4WV1A 5JO5B 5DQJB 3GMLB 2JF1A 2NY0B 3QXAB 1PX4A 2PF6A 2Z0BA 1HHKA 1T0MA 1I3UA 1N59A 4B41A 2IMNA 1NGWB 3BKYH 4OFDA 4Z76B 1U8HA 3WXVL 2EXYC 2PXYD 2CLRA 4JFED 2HJFB 1G1CA 1ZHBB 1D9KC 2IAMB 3MYJA 1YDPA 4E42A 3FT4A 3IU4H 2BY3A 4R6UA 5IHLB 2FATL 3RY6C 4XCNA 1AGEA 1U6AH 5F7HA 3FFCD 1LEIA 3BJ91 4XRCB 4JN2B 3MLXH 5CMAA 3U7YH 4JJ5B 5EU5A 1RMFL 1R3IH 1QSEA 1FZMB 1UWXK 4HXBH 4JHWL 5DHXB 5T1MB 5EWIH 2Y06L 1DVFC 5E6IC 2Q8AH 5KVEH 1GVIA 1JIBA 1UKQA 4MA3B 4IDJL 3HUJA 3HAEB 3ZDYE 1VGKA 3ARGC 5JW4M 3DV4A 3QRFM 5FHAH 1CGUA 1H8SA 2GUOB 4K07A 5FA3A 4YAQB 4OQ1A 4QOKD 1CFTB 3HNTH 2ZWLT 2IQAA 3QH3A 5GZOC 1T83A 1KPUB 4GQ9H 1B6DA 3RP1A 3MJ7A 4DJMA 1IQDB 4Z0XA 3SCMA 1CZ8H 2ADFL 2CKNA 3VH8B 4D2NA 1PG7X 3PHOB 4KI5F 4H8WC 5FA4B 4M6NH 2ZJSL 1ROWA 4MQTB 5LGJB 4EXKA 4OLUH 2R0WH 1B0GB 3KS0H 3OKDA 3WD5L 2MCPH 3LY6A 5CEZD 3PWUB 1BIHA 3QQ4A 4AEEA 3RPIB 5A16B 4HS6B 5IMLB 4JO1L 1CG9B 1F8TL 1RUKH 4MMZC 3FFDB 1MHHA 3BP5B 4JJ5A 5DMIL 5JHDE 4AK1A 4XWGH 5JW3L 5L6YH 4LF3A 4MQXC 3G5ZA 4NO5A 2RIKA 1NBVL 3IJHB 3P4MB 5KVFH 3CDFA 1FVEB 2X4TB 4HCRA 1EUUA 2P48B 2CIIA 1VPOH 1RU9L 4BQCA 4P46B 2FJFA 2Z9TA 5E0QA 3HG1D 3OJ2C 4XCEB 1VKXB 1MIMH 5L2KE 3DVIA 5ABDE 4JFEB 5TPWH 2X4PB 5TDOB 2QBWA 3MRKA 4QTHA 1Q9KA 1CFTA 1GGIL 4QWWC 3DSFL 2O5ZL 2UVEA 2YOCA 5JNYB 1B6UA 1FGNL 4JKPL 4R0LA 3EFFA 1JF5A 3IYLW 2YD5A 3S36H 1YPZE 4LEOB 5F97E 3MOBH 4O58L 3AS1A 3MRBB 5I0DA 2KDGA 4UINL 4PJCB 3DV6B 1WQVT 4WFEE 4BZ2L 5DEGB 2HKHL 3AREC 3MRJA 1KPRA 4XCNB 3NFPB 3MRNA 4MJIA 1V3KA 2D7MA 3M1BA 3VFPA 5J9PA 3T0EC 4JHAH 4JHZA 4WTZA 1NLBL 3P4OA 4ODTH 3X14A 4GH7B 2DQCL 5FB8B 1TZIB 4EI6A 2W59A 3TCXA 1DQTA 3BH8B 1G7PA 5I15H 3BZFA 2LFGA 4QRPA 35C8L 4G5ZL 3HE6C 2IH1A 4QY8A 1U95A 2VLJD 1LP9B 2C4FU 2ZJSH 5TDNA 1T5XB 4NQUA 2ZUUA 1JRHH 4OFYA 4PRHE 3LRHA 2HT4C 3TA3C 1IT9H 1GC1C 4I3RL 1X5IA 4K3EL 5IB3A 1U2HA 3L3HA 3G5XA 3V8OA 3BI9X 1LE9B 2ZP0T 5K59F 5IOPB 4X6DE 2GSGB 5SX5H 3MRBA 2HRPH 2R0KH 5MERA 4AG4L 2BNUB 5DXWA 3T2QA 5C0DB 1UC6A 4IIQA 5CZXC 4PRIE 1NJ9B 3TC9A 4M43H 2YPLB 4JZJC 2NY5L 2ATPB 4YO0A 1FSKB 3RJDA 4HKBA 3U4BL 1MHCB 3H7BA 5D2NE 1YQVH 4Z77B 5J4MA 4PJCF 1RQ5A 3TBYB 1MCNA 3L3IB 2VXUH 2RBLA 3K46A 1NCNA 4QXUH 4M48L 4S1QH 4YXLL 2OXGA 3C08L 4MCYB 4ZO6A 5JA8B 5GS1B 3EGSB 5HHMB 4X6CA 4QHLB 1YYML 1OAQH 5JA9A 4NJAH 2CJUL 4PRHD 5IFAH 1K4CA 2E5EA 2DM3A 1Q1JL 1CFNA 4ZD3L 3WJLC 1I9EA 3Q5YA 4I5BB 2DQGL 4Q0XL 5GIRB 1BPVA 3LQAL 5HJ3B 3VW3H 4OD2B 4X83A 4LHUA 1G7JB 2WAHA 3JVGA 5FUZH 4MNGB 4BZ2H 3O6FA 5DURB 3QO0A 5DQDL 1F42A 1RZKC 4D94A 1DZBA 3MOQA 4M1DL 5D8JL 2R0ZH 4J23A 5D1ZC 1FORL 5GGUB 1M7IB 5GGVH 2WZPD 1JGLL 2AJSH 1A6ZB 4XNZB 4G9FD 3QZWB 3LMJL 2ICWI 4XXDA 5FUCE 3QPQD 3MXWH 2H6PB 4BFIA 3PHQA 3K80A 1S5IH 2Z4QA 3ME0A 4AL8H 4G8GD 2XWTB 3U48A 5HTSA 1OB1A 1K4DB 1FL6A 3HPLB 4L8SA 5FYKD 1UWGH 4UT6L 4L9LC 3FMGL 3P30L 5I1JH 4YC2B 1TFHA 3T8XB 2CD0A 3P9MA 4ZTOH 1YYLH 5F9AC 1W0WA 1KCRH 4DOHE 3GJEB 2B0SL 5EZLB 5E2WH 5D4QA 1Q9OB 5EORL 5D5MB 5KSAA 4QOKE 4HJ0D 2BERA 4O5LL 3M17B 5E08L 4NQTA 2GK2A 1AO7D 4JY4B 2OQJA 5LQBH 4BKLA 2XT1B 1EJOL 3OL2A 1IEHA 1I1YA 1NFDF 3DHMA 5HXMA 1BQSA 5KSVB 4ODVH 2H26A 2YPLA 1JF1B 1OTSD 2P5ED 4NQSB 3ETBF 1Z9SA 5F8QC 1OCWL 2GSGA 5JUEH 2YUVA 1EEZA 1FZKB 1JFQL 1I7RA 5I1GL 4D9LH 4NJAL 3MACH 4YHKL 1F2XK 1CFQA 1TJHH 3HAEG 5J1SC 3SDCA 2V2XA 2C1OB 5A43C 2RAMA 4J1UA 3X3GH 1YPZB 4TNWF 1A7RL 3ZT7A 1K2DB 3VWJC 4UIMA 1G7LA 5FDWB 5TF0A 3KYKH 1BAFL 2J1KA 4PGEA 2W60B 3P4MA 1A3RL 1HXMA 1F6FB 3H42H 3CSYB 3W9EA 4OIIH 3OB0H 4M93B 3F7RA 3FONB 4CBPA 2OX5A 4YGAB 4PJ5A 1TVBA 4OFKA 3DUSB 2QQNL 5C9KA 3HFML 2OR8A 2NLJB 4XVSL 2Y6SC 4K7PL 3INUL 3LB6C 2EDLA 3X17A 4DGVL 1NGXB 2XN9A 3FAWA 3OKNA 3ZT5A 1GHFL 1GH7A 2DQFA 4C4KT 1FDLH 1TETL 1IEAB 5L0QB 5I71C 2NY1B 4KRPB 3L3JB 3ARPA 5E2TH 4IOIB 1CK0L 4FXKA 3HAEH 1FBIH 3U36B 2NXZB 1BIIB 5FHBL 4YHNB 3HR6A 3ZDXE 2AEWA 1HHIA 5T5FL 2MTPA 3Q5OA 1N8ZA 1OTTC 3BZDA 4JRYD 4NHUA 1UVQA 1U8KB 1QRNE 3P77B 4L4TE 3RA7H 4R8WL 4I0CC 4JFXA 5DK0A 4PJAE 4N9GA 4LVOC 2AAVA 2B7DT 3PQYB 3VFNA 5E6ID 3KPRA 3QUYC 3VDAA 1TNNA 2W91A 1A6WH 3VU2A 4JPIB 2XNAB 4OLWH 3D39E 5I1DB 5FKAA 4WTXA 5EU7E 1GSMA 2DQIL 2M8XA 4BELD 3BJLA 3V0VA 1IC4H 3G6AA 4FQCL 1CDBA 1QSEE 4LQFH 3IU4L 2FX7H 2XN9B 5HVHC 43CAA 5JORA 4NO3B 2HN7A 3QIBD 2FB4L 2DWDB 3MO1B 3MLPA 3HTLX 1CWVA 2J7LA 4U3XA 3VFUB 1SYVA 2QADD 5FYLD 1FIGL 3KLDA 1I1AB 4HAGA 4UDTA 5KVGL 4QNPF 1MELA 2EDBA 3TA3B 3QQ4B 4G43B 4JHWH 1A6ZA 1FZOA 3QEQB 2F74B 3CZFB 3DETD 5CJXC 3EYSL 2OTWA 3MRRA 2R8SH 1P1ZB 4L3CA 3D85B 1DUYA 1EHLH 4LKCA 3FT4B 1D5XA 4NSKB 5C2BH 3PNWA 1OT1A 3FAXA 4D9RE 4AEHH 2KKQA 3GNMH 2YD2A 2XZAL 1I7RB 2RR3A 3AY4A 4KHXH 2WBJC 4RGMB 3QI9C 4MD0A 1CFSB 2QQQA 2VL5A 3IAQA 5F7DA 2W9LA 3NPSC 4J6RL 3HZVA 4TRPL 1A7OL 4U1LA 2BZDA 2W38A 2NQCA 4JM2C 1VFMA 5J89A 2EKJA 2GW5A 1YY9C 4NN7B 4J4PC 4FFYL 4DTGH 5LBSH 2VR9A 3SDYH 4ZFFA 4ZTPL 1IGJB 2P5EE 1NAMB 1J88A 4GLRI 3AB0C 4QRRE 4W70A 3T2NH 1MFBH 2D9CA 4Q58C 2JCCF 3NOIA 3LSOA 5C3TA 4NO0B 1C08B 4D9RD 5KVFL 3RX8A 4A2MA 5ISZD 1KIQA 4NN5B 1UB6A 3UTTE 3HE7B 4Y0GA 5TE6L 5IVXF 5J13B 2DQTL 2MKLC 4IJ3B 2WUCH 5F1SA 4WVRA 2ATKA 4OV6F 2XWBB 1NGQH 2FJGB 4OLWL 1I3RA 1ORQB 1J8KA 1T66C 5IKCB 2CRIA 5HHMD 3MCLH 2YPVH 4U05A 4ZS7H 4H0GA 1YEKH 3CCHB 4JM2B 1Y0LB 2PYED 3GIZL 4NBZB 1NC2B 4O9HH 1UKTA 1RZKL 4RWYL 4S0SD 3LS4L 2PYEE 3OZ9L 4OLYL 4HIHB 5EA0L 1R0AH 1H9VA 2UYLA 5TF1H 4F8TA 4I0PA 4Q6YA 4PLOB 1NGXA 4Y19E 2E7MA 3O4OC 2A74B 3OXSB 4I2XB 3STLA 3EO9L 5EZLA 3TYGH 2DIJA 3HN3A 4KH2A 1ZVYA 5GJTH 1A9BA 2XWJA 1IGFL 3MV7A 4OTXL 2X89A 5HI4D 4ZNEE 2AW2A 5ILTH 1YMMD 4M5ZL 1ITBB 4M61A 5E6ZA 4L3EA 3ZKSD 3RWCA 5I19H 4JRXD 3LQZA 1IVLA 1Q0YL 2H32B 4FFZL 2ICWB 5B4MD 4YO0B 3D69A 1CD1B 3IT8D 4GAJH 5AD0A 3IF1B 4GG8B 5I15L 3ARSA 4RDQG 3EYQC 3L95B 1UH3A 4MZ3A 4QXGL 4N9GB 2CK2A 1N26A 4KJWD 3BN3B 2DYPA 5H2BB 1U8LA 2F19L 4PRIA 3BMWA 4HZLB 1KNOB 4Z5RB 1OQXA 4PV9A 3BPCB 2DQJH 1MH5A 3C60B 5ESQA 5DJZB 2EC9T 3B4NA 3EYUH 3VXRE 3RVWD 3QCTH 1ZEAH 3REVB 4JPWL 4LCWB 1BGXH 2CIKA 2J5LB 2HRPL 2R0KL 3WUWG 5GZNC 4JG0L 4G42A 3VDBA 1G7PB 4NZDA 4KKBC 3QNXA 2R29H 3BP6B 5FYJU 1V7ML 5B38B 3CFJB 3ARDD 3MFGB 3KPMA 5IJVA 4X6CE 2ZUTA 1IBGH 4UDTB 2RB8A 1VADB 2ZOLA 2YD9A 1NCWH 1CIDA 2R4SL 5AEAA 5IQ9A 2BC4B 5HHOD 1JGVL 5CEYA 4NYLA 1SEBA 5HYSB 4ZFZA 3P11L 1J0JA 1WFOA 3Q6GL 1JNHB 5CP3H 1IAIM 2HFTA 4HV8A 5C0RL 3R1GL 3B9VA 1DFBH 4N0FA 3DX6A 2XQYG 3FB8A 5F1NA 1ZHKA 4GXUN 3W11C 2YA0A 5ALBL 4H8WH 1X4ZA 5KVEL 4YC2C 4IS6A 4Y16A 4FMKA 4PJHF 5EOTB 3L7FB 2A83B 5DJZA 5FECB 3VFSB 2R15A 2CO6B 4JAMA 3WDHA 1OSPH 3VGBA 3ZHDA 3FL7A 4EDXB 3VXSA 5ACLA 1PKQE 4OZGA 2DD8H 1J0HA 1NGPH 1ZWIA 4X98A 4G6FD 5DYOB 5I9QC 4KJPD 4Y16C 2OXHA 3WJJA 5C0EB 5IM7A 1BD2E 4JG1H 4HUNB 2Q7YA 1CDYA 3P4NB 4Y4HB 5TE4L 4OLXH 1KFAH 5DRXB 5CBAB 4XT1C 2YZ8A 4F7MA 5CD3B 1TITA 4YE4L 3V0VB 4MXWL 2N4IA 2RFXA 3N85L 4IDLA 4GAJL 1ORSA 3JBG7 5EU7C 3T1FB 3G6JA 3MLTB 1U2CA 3ARFC 3QUMH 4LLVB 5C08B 4RNRB 4NC0B 1QFUL 2IPTL 1H3GA 1WSST 4R2GD 4K94C 3JWOC 4FFWD 4PJ9A 4YHPB 3ES6B 4HIXL 1SM3L 1E6OL 1I8MB 3I3BA 5CSZA 4LLAA 5E8EA 2PO6A 3ZTNH 5J8OA 1MSPA 4HH8A 4RA3A 4LMQE 3O6LL 5DD3H 3VGAB 3QT2A 1SVCP 1YEJL 4KVCH 3C2AL 1GCFA 1CE6A 1P7KA 1H5BC 4ISVB 4XNMA 1NUGA 2VKXA 1UCBH 4KV5F 1KV3A 4O5LH 4JG0H 1GGTA 2GT9A 1G9NL 1GGCL 3O9WA 2H6PA 1BZQK 4BFIB 2B4CH 4PRAA 3C60A 5DYOA 4ZSOE 2HVJB 3BMVA 5HPOA 4YBLB 3BP4A 2C3WA 1U36A 1N5AB 5JHDD 2XYCA 1MH5B 3H7LA 4NUJA 3K2MC 5DRXA 5CBAA 4DW2L 2WBWB 4OGYH 3MRGB 5TDNB 3U4AA 3QEQE 3UZQA 2VLRB 4OBRA 5FIEA 1U0QA 1DFBL 4KXZI 3MLXL 1KJMA 2ENSA 5MENA 4JZNB 1A6TB 4YGVB 4ONGL 3WLWC 3MNZB 4WDIB 4WWKB 4YUEL 1HILB 3C5ZD 4IRJB 4HUVB 1QEWA 1CU4H 1G0DA 4P46C 4Y19B 4P5TA 1R3HB 1HQRA 1OARL 4Y4HD 1QBLL 3VGHA 1IC1A 3BGFC 1HINH 4DGIL 1G7IA 4N0FB 1A21A 4GFTB 5DK2B 4Y4FA 4KQ3L 4WCYH 3HZKA 5FYKU 4PGBA 4TNVK 3SQOH 1D5ZA 4X99B 4UI2A 4OCWL 3BZ4A 1GHFH 4MXWH 1DEEA 1JRHL 1HSBB 5J0BA 1CDHA 3AVEA 4P4KC 2HA1A 2X5PA