1YEEL

Structure of a catalytic antibody, igg2a fab fragment (d2.5)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
219
Chain Sequence
DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLSWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAADLGLYYCVQGTHFPYTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural convergence in the active sites of a family of catalytic antibodies.
pubmed doi rcsb
molecule tags Catalytic antibody
molecule keywords IGG2A FAB FRAGMENT (D2.5)
total genus 49
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1997-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yeeL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yeeL01
1FNSH 4QXGL 4I5BB 3AY4A 4NP4H 4PJCB 3NFSH 3FN0H 2PCPB 1U8LA 5DD3L 4L8DA 2VLRD 4HXBH 4OLZL 5TDOA 3ULUF 2DF3A 2EO9A 3DV4A 5HPOA 4JHAH 3V4UL 5DJZA 3MJ6A 4K7PY 4ELMB 4U1KA 5IEKB 1N2RA 1YY8A 3NABL 3IRPX 2KL6A 1TQCB 5HI3D 1RZKH 3UPAA 1J0JA 3MLVH 4NPYB 4NM4H 5FOJA 5GSRB 1OARL 2EIDA 1I7ZA 4JZJB 2G75A 4H8WC 1DDHB 3PHSA 4RGMB 5AD0B 3QNZB 3WS6A 4FOMA 3FT2A 2RFXB 3I6LD 5GRXG 4NZUL 4PLOB 3IF1A 3I75B 2H1PL 3DMMD 1FV1A 2CQVA 4LFHG 5CJOL 4PGDB 5KVDL 3VFOA 4MJID 5C0IA 2F5AL 1U8HB 2Y36H 5CSGA 1X9QA 4H1LB 1MLCB 5DMJB 2AEPL 1D5BA 3GSVA 1HXYA 1BFTA 3M17B 2FRGP 2DQCH 3BN9C 4L29B 4M00A 4OLXL 5GGTA 4LDLB 1UXWB 1AGEA 1I3RA 3WL9A 4ONHB 4JM4L 3I50H 1G7JB 2CKBH 5I1HH 1NFDF 2R4RH 3DXAE 1WFTA 2VLMD 5HGDA 4U2YA 5BJTB 5J8OA 5T33H 5HGBB 4WI9A 1MRFL 2GIYA 3EBAA 4NQUA 3QDJA 4XWOD 1QRNE 3X3GH 2JJWA 1HKLH 5HHPA 5ALBH 1KULA 1T1YA 4Z7UE 4UNUA 3KWWA 3U0PB 1AO7B 2C7UA 3HAEB 1ZSDB 3Q6FA 4UQ2B 4L3EB 1U91B 3LPGA 2BX5A 4A6YL 4KVCH 2VABB 4OF7A 4PJ8C 4JVPA 5HGHA 1D5IH 1U3YA 3ISWA 5DRZB 3DVGA 2OTPA 3B3IB 4X7SH 2HAZA 1IGJA 2BNRE 2NTSP 1IAKA 4U1KB 4UV4L 3QUXB 1RZGA 3IDGB 2R23A 4CMMB 5BZDB 2CO6B 3LB6D 5F7YC 3TH4T 3RTQB 2Q76B 5IB3A 4YXLH 4DWHA 1C08B 3W5NA 4KVNL 1HHHA 5JR1L 3V7MA 3UTTE 1DBAL 2HKHH 4QRTB 5F7EL 5IOPB 3RVVC 4F8QA 2V2TB 3RUGA 2MHAB 1N5YH 2BNRB 1WVZA 3IFPA 2BHZA 4P46A 4I3SL 1OHQA 3QZWB 4JO4H 1A6WH 1KPRB 5FA3A 1RUKH 1NAMB 4PRAB 5EUKB 1JF6A 3VXUE 5I8KL 5TDPB 1S9VA 4PRPB 3D3VA 4MAYD 2A83A 1HCVA 2VDNH 5D7SL 3HNVH 1A3LH 5SWSA 5DI8B 1YEFH 4F3FA 2J7LA 2P7TB 4LAJH 5GISL 5DEGA 3HUJA 2AJSL 5ICXA 4NNPL 3TH2T 3MLYH 1T6WA 2PW2B 1G6RL 2BVYA 4YHMH 3QUZC 3T2NL 1SY6A 2NY1D 1MJJA 1F97A 4FTVA 4JJHA 4L4VA 4LSTL 4GRWB 3ZDZF 1KYOK 2WP3T 2R15A 3ZMRA 1UM6H 2GW5A 4XBGA 4ONGH 2LVCA 1NAML 5DMIH 5LXGH 5HVGB 4JY6B 4PR5B 3U0TB 1DBKL 5C2BH 1KGCE 4K3DL 3UTSA 4E42B 1ZA6A 4JFQA 5B38A 4GKZA 1K85A 2FO4A 3KYKH 4MD4B 4GW4A 3MV8A 4WEUD 1P84J 4K71C 4H1LG 3BRFA 4OUUB 2P44B 1KIQA 4NQXB 3L95A 5TDNB 2VZ1A 4Y5YA 1ZHLA 1MF2L 4L4TD 4JKMA 1L0QA 3JWDC 4NJ9L 4POZC 4XNUL 5JO5B 5FUZL 2IGFH 3MFGB 1UJ3B 1F6LL 4RNRA 4QNPE 4BUGA 5EU7E 1RD6A 4NKOA 1YQVH 5CFHA 1JL8A 4P23C 5IP4A 4EN3B 3OPZH 3IDMA 2G75B 5C0ND 5H37H 2DN7A 2WNGA 2HKFH 1ZE3C 2R23B 4CMMA 1ZWIB 5FXCH 2DTML 1QLEL 5KSVA 2A73B 4UU9A 4U33A 2IGFL 3VFGH 2EKSA 4P5MB 4R26H 4LOUC 1FG2B 3C8KA 1S7TA 5IGXH 2EDDA 3LQAH 3NZHH 3D3VB 1YMMA 1G7HA 2GEEA 4XBPA 5IJKC 2WUBH 5EORH 4KHXL 4U1NA 5TDOB 2V9RA 4QRUB 4F7CB 5M95B 5GHWH 5LVEA 5FO8A 2R0KH 3KDMA 3EYSL 5ISZE 1T5WA 1XGYH 1LMKA 2PTTB 4M3JA 1ZXQA 4PJBA 5FOBB 1E0OB 4D0DA 1TZHA 5GSRA 4X99A 4RWYH 5CEZD 5JXED 3T0EA 5HYEA 1P4IL 3QZWG 3C8KB 1OGAB 3GMLB 3O4LD 4JDTL 3AM8A 1FZMB 2YPKB 2Y4SA 1Z5LA 1HI6A 1SJHB 5TQ2H 4D3CH 2V5TA 2X42A 3SY0A 3MNWA 5C07B 4E0RA 4M8VA 1QO3B 25C8H 3PGDB 1FN4B 4WUUA 3HC0B 1CS6A 3KWWB 1JYXA 1HXYB 3QHZL 4JE4B 4RGOH 3U6RA 5A1AA 5IMLA 4AM0B 3QCVH 4LU5L 4X5LA 5I2IA 2W59A 1JUFB 1HYSC 1I1FB 3VD9A 3QIUD 3VXSB 1BIIB 4CW1A 3WD5L 1J9CT 1RZ7H 3S4SG 5BOPA 1U3ZA 4H8WL 3KLHC 1E4KA 1HSBB 1G7JA 4PRBB 1AGBB 5MERA 3FQUA 4MQXD 5C0DB 4YHIA 3BP7A 3O6LH 4RQQA 3W0WA 3PGDA 1EO8L 2JJUA 5EO9B 4DN4L 1F3DH 3IFOB 3DURA 2NY5C 3BSZH 4FHBD 5L2KE 3SKNB 5KTEH 2C7UB 1IGTA 4PJ7E 1HZHH 2JIXA 4NRYA 3M8OL 5T5FL 4PREA 3G5XB 1A64A 1BIIA 2R2BA 1MCOH 4FXLA 4X7DC 4R90H 4JY4B 4L5FH 5LCVL 4CMHB 1FZJB 4K7PX 3GUTA 3SHSA 3P4MB 5I1EH 3CFDA 4AY0A 2XTJB 4LKXA 2RBLA 4PJ9D 4UINL 5ISZA 3D18B 4DFIA 4JN2A 4LCYA 3P30L 3BPCA 2F19L 2BVUA 2E3VA 2EXWD 2R1YA 2BVQA 1J11A 5A16A 2YC1B 4G8FB 5I8EB 4HWBH 5HXMA 3GO1H 4G8GD 4P46B 1DEEA 1PG7H 4XCEB 3UTQB 3WN5C 3K4AA 1NCBL 3E3QE 4PJ7F 2F54E 4GXUN 4LGSB 1OSZA 3BD5A 1J8HA 4X7CC 4YGVA 1CDHA 4JY4A 3F7RA 3N85L 3QIBD 3FN3A 3F65A 2XT1B 4HWUA 4B7IA 5DDHA 2X5PA 4QLRA 1XCTA 3VD4A 2CPCA 1SYSB 5ADOL 2BVEA 5HHOA 2EDOA 2A0LD 2O61B 4ETQB 4F7MA 2F9BT 3AAZB 4KXZH 4LKCA 3RWHA 4OLUL 2N7BA 1JPGB 1UZ6E 5DR5L 1K6QL 4HIHB 3VCLA 2F74B 2DKUA 5EO0B 4DOHE 2IBGA 4JQIH 3EYOA 2VR9A 2ZCLL 3MNZB 4QXGH 3VXOA 4FQLH 4NHCH 3QULB 5CEXB 1R3IH 1UYWH 4KVNH 2D2OA 4XMKL 4P4KA 3TBTA 1IQWH 1ZVYA 3G5VB 3KLHD 4X6CB 1QR4A 3NN8A 3BESR 4EN3D 4MJ6A 1YEJH 3MRPB 2R2BB 4LCIH 1CGVA 2BFVH 2ZUXA 2LQRA 2GSIA 1ES0A 1QLFB 4NQCE 1EBPA 2QR0B 2VTFA 2VSDA 4IMKC 3WFBH 4ELMF 4UTBL 3BZFB 1P6AB 5K9KB 1IEHA 4L29A 3G5ZA 4CKVX 1CE6B 1ZV5A 1Q72H 2PYEE 3ROOA 1FYTE 5DO2D 5GRZA 3NFNB 3W9DB 1CN4A 3EOBB 4KJYB 2D7OA 3L5XL 3ULVH 3MRNB 3FONB 4OD1L 3VFRA 5D72L 3D0LB 2R0WH 1C5CL 3REVA 3BT2L 3V8OA 4XGZA 5HYFA 2WQ8A 1GZPB 1KPVA 2AK4A 4PJGE 3DPBA 4AL8L 5SWSD 4MAUL 1SM3L 1VEMA 4M6OL 1F5WA 1F6AA 3QO0A 5BV7B 2DQJH 2JJSC 3NACH 3RBGA 4YDLB 5GGRB 4Y5VA 4J3XA 4U1NB 3UAJD 1BQLH 2VQTA 3CFKB 4JO2L 1I75A 3MLYL 1QLRA 3BT2H 4U6XA 2G9HB 4X4YA 1ZOXA 3DVIA 4M6OH 3DVGB 3E1F1 2Z0BA 1RZJL 3IAPA 4PJIF 5JW5A 5J12C 4WDIA 5BMFH 5DD1H 1CIUA 1OAXL 4J1UA 3QIWD 5EUOA 1EPFA 4M93B 3QH3B 4O58H 3WFHA 5F3BB 1UWXH 2HT4C 1N3NA 5FO7A 4NKDA 1A4JB 3G9VA 5CS7A 5IMKA 2X89D 1R24B 4P2OD 3O11A 4PRIA 5CBAB 3HAEH 3HZYB 2H3NA 5A2LH 3V6ZA 1TIUA 2AV7B 1S9XA 5DEFB 5DRZA 2F5BL 4RFEB 1WWWX 3IU3B 4WJ5B 3ZL4L 2VRAA 4LEXL 3RGVB 4G9DA 3W9EB 3IGAA 3V6FA 1RZKL 5CJXC 3QWQB 4KK8C 5IHLB 3PP3K 3F12B 1NCWL 4OAWA 3CNKA 5LGJB 1T2XA 4MA8H 3X13B 3BP7B 2J3SA 5E4EB 4M43H 1KB5H 1YPZE 1HSBA 4JQXA 5JMRA 4JO4L 5E8PB 1I7RA 2QL1A 2CXKA 4UOW0 4KDTA 2X7LB 5DRWB 3NA9H 4WVRA 1C12B 4Y1AB 5DMKA 1QKZL 1WGOA 3FFDB 3MUY1 5LWYL 3FFCE 1BVKA 1VKXB 5FB8B 4LSQH 4M02A 3GEWB 1DQMH 3K0WA 3MYJA 3GK8H 4ZFGH 4NNPH 5CD5D 4Q9CA 4HDIB 5IVNA 1WBZB 3EFFB 4OAWB 4CN1A 2HTLC 2YR3A 1GH7A 1DN2A 1HKLL 4GKOA 3RZCC 4BFIA 4XZUA 2O5YH 2O61A 4TULH 1T20A 3UPCA 4PJHE 2OTUA 4M93C 2XZQH 4GMSH 4YFEA 3EYFB 1EHAA 4HWNA 5AEAA 4KZDL 2CUIA 1VFMA 1IQWL 5GGQL 3HE6A 4MSWA 1C1EH 2CKBL 4Y8AA 5I1HL 3HNTL 4ZDHA 2VZ3A 2AV1A 1LO4L 3TC9A 4M43L 2CDFB 3MJ9L 4XWGL 3FQRB 1NGYA 4KQ4L 4XP9L 4CU8A 2MNUA 1BFOA 2Y06L 4XAKD 1S9KC 2J6EH 1FVEB 3I9GL 2H2PD 2OZ4L 3SDXE 5F6IB 5GGSB 2ICEB 3WNKA 1NUNB 1EVTC 3ALWA 4BSWA 4KHTL 3SPVA 1ACZA 3L5HA 2XV6B 2GAZA 3MFFB 3PQYE 5DQDH 4IOFC 1FGNH 2P42B 3MTRA 3OG6B 2CR6A 2H45A 1J1XL 5SV3A 1GGIL 3IXTA 4G6MH 4X7SL 3UTPD 3ZKQD 4JFHE 4M1DH 2XRAL 5ERWB 2CRYA 4NO2A 3QDGA 5MENA 4NWTH 2OLDA 3BKMH 4S0SD 2D7PA 2B4CH 1J18A 5ADPL 2YPVL 3MGOB 5HSFA 4AG4L 3T1FB 3UJIL 1MAMH 1VSCA 4OCWH 1H8NA 4HC1L 5TGBA 5GS0L 4LARH 1U3HD 5DZNA 5EBMB 3SPVB 4PRHD 1QBMH 1QYGL 3SO5A 3RKPA 5BZWA 3L3GB 2VR5A 5HI4D 1SYVA 2GK0B 2IQAB 1XGQA 3ARUA 3QUKA 5E5MB 4Z7WF 1H3XA 1A4KA 3MRQB 2ARJA 2NTFA 4HCRL 2Z4QB 3AB0B 1D5MB 3BGFB 4LFHD 1X5XA 3HFMH 3L6FA 5K9KA 4M9OA 4HWBL 1QYGH 3WJJC 3C6SB 4ZFZB 1OWWA 4KMLB 1MWAB 4U6VH 1LP9A 3FZUD 1AI1L 3WS6C 3ZYOA 3OR7A 4KRPD 3ULUE 4FQXC 5EZOL 3CFJB 4ZPVB 4XGZB 1AD9A 4V2BA 3I3DA 5C09A 3VG0H 5JQHC 2NCMA 1NDMA 5F9DC 1BECA 2VQUA 5EU3B 3NVQA 1GIGH 3BVNA 2DYPD 4PP2B 4X0KB 4NNYA 1INEH 4F7EA 1WBXB 3UBXA 3P40A 2DICA 1A7BA 3BZFA 4FFYH 3NGBC 1JRHH 4MA8L 1OTSC 4H8WH 2NYYC 4R26L 3MJ8B 2IPUK 3CFCH 4N9GB 1CIDA 4HD9A 1FYHB 1RZKC 5E56A 1T7ZA 3WFHB 3T1FA 4H26B 5HTSA 1U8NA 2PR4L 4LCCB 1QHOA 1YMMB 2P4AB 3IAGC 2XWJB 5JDSA 3T0XA 1B4JH 1H8OA 4I18B 3UTSD 3S88H 2D31B 4UIMB 5BO1L 2XY1A 3FB7B 1FZOB 3CVHB 4FZ8H 2JB5H 3L3GA 1M1SA 1E6JL 1DBJL 4ELMA 4U6HA 1TTFA 3L3IB 4FS0A 2B0SL 2EIZB 2XN9D 1ONQB 4NO0A 4L8SB 5HD8D 3RIAK 2WUCH 2UWEF 4OSUL 4JO2H 1FIGL 5K9QG 2XZAH 4HZAA 2E9IA 1YMHA 3KS0J 3KR3L 1KB5A 3ZYIA 3T0EE 5HGBA 1FFNA 1PG7L 2PXYC 2EICA 5C08D 1MCFA 4RWYL 5EBLA 3HE6C 1BZ7A 3TO4D 5AAMA 3PV6A 2OBGA 3UX9B 4WFFE 2I5YL 4XMLL 2F53D 5JHLH 2G5BA 3NOIA 5EFIB 4OQ1A 1FQ9C 1U91A 5C09E 4QRRA 3WNNA 4ENEC 1IM9A 4JFEB 5EH1A 3GSXB 4RMUA 2A6JA 1A7RH 3M17A 3K1KC 3O2VL 1FGNL 4MXWH 3KLDA 2ZUWA 1K2DA 3QAZC 5IFHL 1U2HA 3KPQA 4ETYA 1DSFL 2IH1B 4RRPA 3MBED 3JTSB 3T3PF 2FIKA 4X6BA 2DLHA 1IJ9A 3HE6B 4MSWB 2BC4A 3RWIA 3RPIB 1IBGH 2PXYA 5CEXA 2DLTA 1UENA 1T2JA 5BQ7B 1IGTB 4LARL 5IFJA 1FL5B 4QTHA 3ARDC 1T1XB 3ARBA 4GAGH 3O4LA 4KK6C 4YHZL 2LAAA 5GRUL 3OKNB 1R3JA 5C0AD 3EZJB 2A77H 2BVPB 4LL9A 4EIZC 4XP4H 3PP3H 3EO0A 2BDNH 3NCMA 5KSUB 4E41D 3SBWC 2VITB 3ECBA 4CNIB 1VKXA 3MJ7B 4Y16A 3RNKA 1KJ2B 4Z95H 3UXFA 2FEDC 2R9HC 5KJRL 3IYLW 2GTZA 4H20H 4UB0H 3WS3B 2O5XH 3HZVA 4J3UA 3VU2A 4Z76A 1Y6NR 3I6KB 3FHQA 2P7TA 3V0VA 3HB3C 3QUXA 4JKPH 4WV1B 1NCUA 5CP3A 1U3HA 3VGHA 5C07D 3CLFL 1AR1D 4OTXH 1MUJA 4LCIL 5FGCE 1I7ZB 5C0FA 4HUXA 3BWAA 4YHPB 1FSKB 3ESVF 1S8DB 4H0IA 3RWGA 2ZCHL 1ZS8B 2FATL 2NZ9D 4PLKC 5EUOB 1AFVL 5L7XL 4HGMA 3T65B 5DUBB 5GRJL 1U8PA 1JN6B 4PJ5E 3ARED 1YY9C 3BI9X 5C0AE 1TNMA 3CH1A 1JYNA 4EZMA 4L9LB 3DV4B 1EHLL 3V4PL 2A6DA 4KKBC 5GGRA 2BDNL 2X1XR 3S96A 2OR9L 4HBCH 4OD1H 3N85H 5I1LA 2FHBA 4WWKA 1JGDB 4Y2DC 1XF2B 5I16A 1GRWA 1JI1A 1G0XA 1ZT1A 4HH8A 4Y4HD 1JPTL 4I0PB 1DANT 5DJ6B 1OAXH 2P43B 5E70A 1FSKC 3VFUB 2L4OA 1KNOB 1EFXA 2WBJA 3WKMH 1C5BH 4BZ1L 3KPPA 4JCLA 2DL9A 2VIRA 3LEVL 1CDUA 1DN0B 2GJ6D 3LAFA 4ZTPH 4NFBA 4WW2B 2EC9U 1A6PA 4NFCA 2NY4C 5DC9B 4ZTOH 2MOVA 3MUJA 4ZPVA 4DAGL 4P3CL 3U9PH 5INDB 4UBDD 1FIEA 4PJIE 3BGMB 1CT8A 4G6FB 3VD3A 1MCKA 2ZUTA 4MCZA 5IQ9A 3DMMA 4BQ8A 3HS0B 4NM8H 1N6UA 4JFDA 1D5MA 4NGHH 3PJSA 4AIZA 3VFNB 1LILA 3IU4L 4D94A 1ZLSL 2NY0B 4JZOA 2HVJB 3ORJA 2VZOA 4QHKI 4DEPC 1TQBB 5D2LA 1LDSA 1T4KB 3LSOA 3CVIH 3R4DA 3OPZL 4AMKH 4N0RA 3TA3A 2XICA 5EWIH 1BQHB 3NPZB 5IF0A 2NY1B 4NN7C 3TLRA 2DJSA 4MYWB 3JWNC 2IALA 2XNAA 1B0RA 4J2XA 4Y4FA 3HC3L 4XC3H 1CWVA 1KJ2L 1C5DB 2J5LC 4ODXB 3DHMA 3U6RB 5FO8B 2HN7B 4KKCC 2X4UA 4R7NA 4L1DA 1ADQL 5HI4C 5DDHB 4PTUA 5EC2A 2FWOB 4BK5A 2NZIA 3QNYB 2A6DB 3BPOB 3O9WC 5I76B 2ZKHL 3A67H 1ITCA 5D2LB 5KVMC 5DS8A 4DEPB 4O00A 5I19L 2YD6A 2MJWA 1X5JA 5ACZA 1I9RL 4K3HA 2H8PA 4EVNB 2AJYL 5AWNH 1OP3K 5IJVA 1NGPH 4Z7WE 3C60B 3VGAB 3IETA 2CKBB 1XF3B 3HC4H 3HAEA 2W65A 3ARBC 4LPXA 5IBTH 2OXHA 4OM1L 1I7UA 4UV4H 4G3YL 5BS0B 4GMSL 5J1SC 1MHPH 2R69L 1GOHA 3FRUA 4LSPL 2HRPL 4KRLB 4F7PB 1I8KA 2Y72A 4U3CA 2F5AH 2R0ZL 2Y36L 4XC3L 1JI2A 4Z7WB 3GUTB 1MFDL 3L3HB 2BY0A 2P47B 1EMTH 3K2UH 2HP4A 4KROC 4X4MA 1MAKA 1PQZB 1RMFL 2WP3O 4KK9D 2HA1A 1R6VA 2HLFD 4OFDA 3A6CH 4UT7H 1RUKL 4KK9C 3QPQC 1OGAE 5DRXA 1DVFC 1QLRB 3I9GH 4U6XB 1CE6A 3QWRA 2AABH 5FV2A 3F58L 2JJTC 3L5WB 1S9YA 5EPMA 4U1IA 5C0DA 1XR9B 1FL5A 2FSEB 1FVDB 4KV5E 1BPVA 3KPLB 4GRWF 2APFA 1FC1A 4DVRH 3MUZ1 4LK4A 3PXJA 1L9MA 2AK4B 3UBXI 3AC0A 1MQ8A 1QPPA 2V5MA 2ZNWA 4KC3B 4FP8H 1P4LB 4NQXA 4KMQA 5CKAA 1DLHA 3T4AB 1K2DB 1QKZH 4BSVB 1VFAB 2KH2B 1NAMH 4JFHD 2ZG3A 4OGXH 1DQML 3TN0B 4WU5B 3L5WA 3DX6A 5JXAL 4XPAH 2P24A 3VXMA 5KSBE 4QHUB 1RUPL 4NWUL 5F72S 5C0FB 5HVHB 4F37K 4XX1G 1RJZB 4LRIA 1BLNA 4OZ4B 4FN0A 1JZ8A 2P8PA 3UP1A 2CDGB 2DQGH 2EZ0C 1CGWA 4OCRL 1IM9D 1A0QH 1CXIA 5HDQL 3WIFA 1KLGA 3QIUC 2FD6H 2OCFD 2BRQA 5DQDL 3OKEB 2A6IA 3OKOA 2KZ1B 2R2HB 5E6ID 3BOVA 5ELIA 3PL6C 1F02I 2D7NA 5DK2A 1A4JA 5GRUH 4BA8A 1OPGL 2PW1A 2F8OA 1KACB 4XXCA 3U46B 2NNAB 2HKFL 3OAZK 3HI6L 4RRPG 4U7MA 3V5KB 5HDQH 4LVHB 1JK8A 1WAAA 1N8ZA 3BQUB 3DUSA 3HI5L 2DI8A 4NSKA 1YNLH 5I1AB 4LKCB 5HI5D 3I3EA 3PHOB 5FB8A 5CZVL 2HVKB 5HGAB 2FL5B 2ITDB 2XQBH 2Z9TA 1ZWIA 4ODHH 4JZOB 2YPLE 4R2GB 5F7KC 3OKOB 1OF2B 3RVUC 4NQEB 4F57H 1CXEA 4OM0L 5BZDA 4NWTL 3V6BR 4FZEH 5IK3A 3S88L 1Q0XL 5E8PA 3VWJC 3VGAC 2KZWA 3BZ4B 4M5YH 1CF8H 3KPLA 1BQUA 4CDHA 4U1JB 4O02L 4OF5A 3RDTD 1IGCH 4R97B 2BCKB 3VXQB 4LOUD 4ERSH 4MB4A 4WNQB 2ZOKB 4W4NA 2ICWB 2CUHA 5B3JF 1FBIL 2RIKA 1D9KB 4NDMA 5I0ZA 1Y0LA 5EA0H 3FQTB 4QWWD 2IPTL 4ODUB 1LP9E 4XNZC 4YDIL 5CIPB 1Z6JT 2C4XA 4NKDB 4XTRC 5HI5C 4S10A 1U3JA 4JANA 5K93A 4YH6A 5DHVB 4ZO6A 4LSPH 1WV7T 2NY7H 3LEXA 4OZGB 1ZVSA 3VWJA 5HGGS 1ZTXL 4RIRA 3UBXG 2VO5A 4LLVA 5EO9A 1W0VB 1IILE 3F7VB 4MHHI 3V5HA 1J8HB 4GS7C 2I9TA 3S34H 4YQXL 1J86A 3JV0A 2OMNA 2WK2A 4JJ5A 5I30H 2VDLL 1EO8H 4DN4H 2R8SL 3WNOA 1LE9A 1S9XB 1F3JA 4PJDA 1HXMA 3F58H 4XMLH 2NNAA 5HY9B 1NGQL 2R1YB 2SEBA 5TE7L 4GBXB 4XNZB 4Y5YC 5DJ0A 3RWHB 5BXFA 3QT2A 5E8EA 4YNYA 5F1SA 1UGNA 3MV9B 3EDFA 2HWZH 1NMAH 2CKBA 4BELD 4PRNB 4TYUA 3EO9L 1DQQB 3LZFH 1JPST 2CLVB 2NQCA 1DJSA 3THML 3IJSA 1OF2A 1MCHA 1VEPA 2W1NA 3NA4A 5SWSE 3S3PA 3PIQB 2W91A 4EDXB 3ARGB 3PL6B 2LTQB 3H0TB 4YHNA 5F9WB 5B39B 2A1WL 2EKJA 4KUCD 4N8PA 4NC0B 3HG1E 4HS6B 3DBXA 4ODSL 3VRIA 1NGZB 4NYLB 5CMAB 3STLA 4JKPL 3O3BB 3O6KL 3QDGE 3WO4B 1CR9L 1S7WB 1BBDL 2BVOA 4LCUB 4YC2B 4HKXB 3PWVA 1IEAB 1HEZB 4PB0H 3D69A 1NCAH 1RVFL 7FABL 5M94B 4PFEA 3KPRB 4XBEH 4PTTB 1URLA 4JPVH 3EO1A 2VLLA 1K4DA 5BJTA 2O5XL 4UAOC 4KROD 4R0LC 1BZ9A 4DN3L 4QHNB 5SWZB 4LHUD 1INQB 3ELAT 1Q9KA 1XEDA 4PJ7A 4UMGA 4PRHA 3T2QA 3V95A 3QEGL 4P3DB 5KTEL 1FL3A 2C3VB 4DCQA 4E0RB 2UY6A 2EEAA 5H8DA 4G3YH 1FHGA 3IJYB 1N7MH 1KB9J 2FR4B 2NLJA 2B4CC 2AK1L 2VE6B 1VFAA 5LWYH 1MCOL 3BEWA 3KS0H 5FUCE 2UWEA 3MA9H 5JQ6H 4P5TB 5JIKA 4C55A 1CR9H 1V5JA 1K4DB 5MENB 4RX4D 4NZDA 1I1FA 3WKML 2F8XC 4D0DB 3FRPG 3L7EA 1J0KA 2R56L 4C56B 5LJYH 4XNQA 2DQFB 5C0GB 5BOZG 3X3GL 2EDRA 3L3DA 3HKFA 2Z35B 5FM8A 4JR9H 5FGBA 4Z7UF 1CF8L 5C08A 2BHYA 1HSAA 1S7RA 5EZJA 2AEIT 2CRIA 5F3HA 5L6YL 3HNTH 1AE6L 1W2KT 3TIEA 2FGWL 4TRPL 5GSVA 5EUKA 3MNWB 2VUYA 3GSRA 1HDMB 2OTWA 1VCAA 3QISA 1B6UA 5FM4A 4M7ZC 4U1JA 2FJFA 2APWA 4PJBE 3LN5A 4AZ8A 2PW1B 1PFCA 1YY8B 2CRZA 4HLZG 4PJAF 1MCDA 2AK4D 3DMMC 2P5EE 4EDXA 1CGSL 3O11B 3I6GB 5ID0B 3BRDA 4NC1C 4M1CD 1KXVC 5F1KC 3MCLL 3S5LB 1KTDB 1WSST 4O5LH 1UVQA 4MNGE 3CFEB 4XPTL 2CMRH 3PWUB 2DAVA 5F1NB 1CL7H 3BZEA 5HGAA 3QEHA 3RU8L 1HK6A 5F44A 1U8PB 1A5FH 3CVIL 4AMKL 4NZJA 5H35B 1BF2A 5T5NF 4I8DA 3X17A 4JQIL 1XR8B 3MRDB 4LSTH 4ZAKC 3QQ4B 4Q7DA 4WDIB 4W68A 1BQSA 1TJIL 1LO2H 2B1AL 2HFGH 2YC1A 3FOLA 4M7KH 3TT1H 3P77B 1WTGT 5C0AA 4PJFB 1AGDA 1GHFL 3DTXB 4JDVA 1N2RB 1BOGA 1LQSR 4F15C 3ZDXE 4KI5E 5BMFL 3MREB 3VJ6A 5T3XE 2I07A 3FT4A 3MRHA 3CFEA 1TDQA 1TJHH 1VACB 4AEIH 3G5XA 2OJZH 5DK0A 1FNGA 5CD3B 2UWEB 4HWEH 1CLZH 4P5TA 4LGPB 2XN9B 2OR7A 3RKDD 4X4ZA 3UDWA 1N26A 4DAGH 1YNLL 4ZFZA 1PKQB 4P9HL 5FUZH 4XHJD 4XPTH 2G60H 4OQTA 4BJLA 4CBPA 3MV8E 4WW2A 5A16B 3N1FC 3LHPL 4HK3N 1CFBA 3O0RH 3MA7B 4NQEE 4X83A 3L9RB 1KCLA 2L7JA 4BZ1H 4HF5H 3SQOL 3OXRB 1KPUB 1T3FA 2YA0A 3MNZA 4YEEA 1B2WL 1G7PA 3OQ3B 3V8CA 2CIIA 1NFDA 1Q0XH 2E5EA 2O5ZL 5SX4H 1BWWA 3O6KH 5GJTH 4NHUA 5IEHB 1A3RH 1V3JA 1R5IB 3C2AL 1H3PL 2IQ9H 4XNUH 2IAMD 3O0RL 4BZ2L 3NIDF 2D0FA 1JGUH 1QFOA 4S11A 4DKEL 2V6HA 3A6CL 2CD0A 3QNZA 1OL0A 4OFYD 3IT8D 3O3BA 2LU4A 1INDH 5CEYA 2CUMA 3VXME 5KSBA 4NM8L 1TTGA 5I1LB 4MJIA 1S5IH 5FCUH 4EKXA 4D9QD 4MA1C 2VZVA 3R8QA 4IIQC 4W6YB 3GRWL 1AHWC 1MHHB 5D2LE 2GCYB 2WBJD 5JHDE 1WWAX 3Q2CA 3X11B 3QEQA 4LAQL 4I18A 1S8DA 3RWGB 3BIBX 4UZGA 3B9EA 4GLRH 1NFKA 3T65A 3RJDA 3SE3C 5FCUL 2Y07L 4PGBB 3WXWL 1DQJB 4HJGB 1N6QH 4BKLB 3CCHB 1B4JL 6FABL 2AJ3B 4ONFH 4LLQB 4KZDH 4J3WA 3P9MA 2P8LA 4RMVA 4KMTL 1AR2A 1F8TH 1KJ3H 2YPLD 2DM2A 3NCJH 4M3KB 3H3KA 1HXMB 3O4OB 5JW4R 3ARDD 3BD4A 2N4IA 1RUPH 2E7LC 4GO6B 3QUXD 2LE9A 3PNWA 4NWUH 3VRIB 2P5WA 3HE7D 1HHHB 4RDQF 1QVOB 4FFVC 4LSDA 5IM7B 3QUXC 4P9MH 4JR9L 1BLNB 2GUOA 4OZ4A 4X6EA 5FAAA 1MRDL 3N9GH 5L6YH 5CWSB 4ZXBA 2E9BA 4WUUE 4XCCL 3C6LC 3RVVD 4YPGA 2ICEA 2DLEA 2JB5L 4PJAE 4WI3A 2X1PA 1CYGA 4CDGC 3JV5A 1QQDA 5INCB 1U41A 2DMKA 4YQXH 3S34L 4J3OC 4U6YA 3MLXL 5I18H 1R5IA 4NQTA 2XZCH 4LIQH 3DRQB 4WGWB 3TA3C 1ZHLB 2AXJA 5GS3A 4JFZL 2LFGA 5FDYA 4GLRI 4LRNL 5T5FH 3HMWL 4MNQD 5LQBH 1QSED 4NIKB 4PRDB 3D2UD 4MXWL 2XG5A 3PWNA 4KAQL 5JIPA 1QR1B 4NN6C 4N90E 4XB8A 4K9EC 2Z8RA 2FX8L 2VXQH 2NW3B 3CMOH 4ODTL 2UY7A 4FZEL 3U83A 1TETL 2A6KA 5B38B 1TJIH 1OAKH 4M7KL 4W70A 3V6FB 5H35A 5E5UB 4WCYH 1EGJH 3CUPA 1JBJA 1H0DA 1I8LA 3ZTJG 3GMLA 5E99H 3WV0A 4XBEL 4HK3J 5DJ8A 1N59B 4NZTH 4V1DD 4GAGL 4IRZH 1U92A 4YXKL 4CUCA 4ODSH 3QXDA 4D0CB 2NY6D 4X5WA 5E5MA 2I07B 3FT4B 1N64L 4XCFL 3RY6C 1I3GL 4XI5C 3LN5B 4BFBD 3SE9H 1NJ9A 2ICCA 3MR9A 5I66B 4ZUSA 4PB0L 3WXVL 4GW5B 2WV3A 3H9SD 1SJEA 3BDXA 5C0BA 1FFRA 1AC0A 2GFBB 2NX5E 5ADOH 5J89A 4KK5D 1MI5E 1JF1B 1YC8A 3OKMA 5MENE 2X4PB 3RL1B 1AO7E 1CGXA 5CCKL 3P0YL 1CXHA 1J88A 2ZP0T 2NXYC 5EBLB 1ZLUH 1IAIL 2I60L 1I8LC 4D8PA 1A2YA 2FHFA 2LABA 3MBXL 1J87A 1UH2A 1MI5B 2Q8AH 1U8NB 1NUGA 1QSZA 2W0KA 1K4CA 2X4OA 2YMXL 3O2DA 3NPSC 2X4QA 1T7XA 1YN7B 4JRYA 1CDYA 5B3NA 3DROB 3AB0C 4YGAB 3U4EB 1ONQA 2HFTA 2QQKH 5F9OH 3NZ8A 3CD4A 2GFBA 3UC0L 1D7FA 4LCWB 3DV6B 1ZHKB 4Y88A 4OLYL 2NXYD 2DYPB 2EO1A 3HZMB 3QIWA 3S8WA 4YR6A 2EECA 4P5MA 3C5ZB 1GSMA 3TZVC 3AFLA 5JDSB 1MREL 2BNRD 4TTDD 2DQIL 1HILB 2X7LA 4TSCH 1A22B 5CP3H 4OB5H 1Q8MA 3FT3A 3TBWA 4A6YA 1UJTA 1UEMA 1SY6L 2R0WL 1IT9L 3B2UC 1R0AL 4OV5B 5EA0L 3RY4A 1KG0A 3I6LE 4JHWL 5FYKU 4RGMC 3KJ6H 2E7BA 1T66C 5B4MC 2B1AH 2HFGL 5F7UA 2VABA 1JHKL 4M7LT 4WO4B 5DK0B 1CLCA 1OW0A 4Z7VE 1XH3A 4Y5XC 3PL6A 4OUUA 2VDKL 2UWEE 3PDDA 3RBSA 3MRMB 1CDIA 2OJZL 3G5YB 4LLMA 4LHUB 5KVGH 4DGYH 1P5VA 3LKRB 1KFAL 2C1OB 1JWSB 1UACL 4IJ3C 5KANG 1JNNH 3EO1B 2X70B 3ARFA 4P2RA 2CJUL 4AM0A 3U30C 5T3ZL 4FXKB 1WZKA 4OGYH 3O45B 4JHAL 3V4UH 4NKMA 1ZHNB 5SWQA 2BOCA 1YQVL 5HYQA 1F3JB 1JGVH 4PJDB 4FQXA 4JDZB 5TE4L 3GZKA 4GMTH 4K7FB 1IKFL 5SWSB 5EC1B 4ZXBD 3LRHA 5ACMA 2C26A 5DT1L 1HINH 4JB9H 1IC5H 1TTUA 3TBYB 2AV7A 2GK0A 5LG1A 1V7NL 4EXKA 3C6LD 4UUJA 4E41A 3LRSA 5EBWA 2ADGA 4PJ9C 2PO6B 4YO0A 2DLGA 4HKJA 1J1PH 2YS4A 4QTHB 3ZL4H 1B88A 3D25B 4CU7A 3P4NB 4HAGA 5KBNC 4DGIH 3A67L 2A1WH 3NIFF 4WFEE 4PJ8B 3VGDA 4DQOH 2KUTA 5FEBA 3I85A 5CJOH 2VJXA 3R06B 4XBPB 4XNXH 3OXSA 3QJFA 1XF4B 4G9FE 4I2XA 5DVOA 3CLFH 2CR3A 1GGCH 2R39A 4J4PC 2R56H 2MMXA 1DTUA 2C9AA 4ALAH 1A1NA 1QP1A 3FKUS 3ZKMD 1L0XA 1HDMA 5GRYA 5C70A 3AREA 3E8UL 4JQVA 4C58B 3QCTL 1G9NH 4RAVA 2FJGB 2YHGA 1WBZA 3EFFA 3FB5A 2W0FA 3K81A 1QNZH 2ID5A 3I2CL 3MLZL 1UB5A 3VWKD 2EYSA 4MS8D 5CGMA 2IFFL 1BZ9B 4HG4K 2BRRH 3MV7B 1KN2H 1MSPA 4G42A 3QG7H 1N7ML 3QFJB 5E2UH 4ZDHB 1QA9B 4LCCC 1UZ6F 5GS2H 5KS9A 1FORH 4PV8A 1JPTH 4QRPB 3LY6A 1NDMB 5H2BB 2P5WD 1WC7B 3CXHJ 3VXSE 5DQJB 1V3LA 4PG9B 4YPJA 1RHFA 3QFJE 5HYSA 5JW4Q 4LSSH 5EFIA 1NC2A 1T0MA 4PJ9B 3BP6B 4QWWC 3C5ZD 4NBYB 3FTGB 4TULL 3SDAC 5KAQG 5BS0D 2AABL 2FZ3B 1WFOA 4KV5F 3GB7B 4K9EH 1MRDH 3QIWC 5K33A 1U8OB 2ADJB 1R5WA 4Z0XA 1FPTL 4M03A 1EIBA 3WDIA 1KLFA 3WKNA 2F58L 2B5IB 3GM8A 2GKIA 1KIPB 5C09D 4IRSD 1S78D 5T5NG 1KEGL 4OF8A 3T0AA 3LH2L 3HC0A 2XZCL 3IDJB 3PQYA 2DJUA 4ZG1A 1FPTH 3BQUD 3DROA 5DTFB 1JZ2A 3RWFB 4OGXL 5E00B 5BVJB 4X9IA 5TQ0H 2EDKA 2CK0L 4JPWH 1IMHC 1BAFH 4X4XB 1ZLUK 4XCFH 3TO2A 2D9CA 5SWZD 3HI5H 4LGRB 2Y1VA 5DO2C 3GBMH 4MX7A 3V9FA 2XN9E 3TT3L 2BNQB 3FQWB 3ZLQC 2Q6WB 4ZO9A 1CL7L 2LU3A 3CSGA 3DO7A 5FUOL 4O2FB 5JOFA 1IAIM 4X7FC 3AROA 3PL6D 5EIQA 3MXWL 3F7YA 1AQKH 4AIOA 5JMOC 4YUEL 1T1XA 3O4LB 4R3SB 2W0LA 3PGCB 2XFXA 4Y89A 5MEPB 4PLNC 1WC7A 1A1OA 2X40A 6FABH 2NY3B 5DQJA 3VWKC 4JPKH 3EJZD 3S35H 3X11A 4NRXA 3MRLB 4EI6B 2V7HA 3QHTC 4EI5D 1JVKA 4PJIA 3L3HA 4WNQA 2Q8AL 3MOAH 4UTAH 1HN1A 4WO4A 5F7NC 3LKOA 3FOMB 4H0GA 1EUUA 1H3VA 4YWGH 2J6EA 3UCRA 1UFUA 2NY1C 3K74B 3MJ9A 3WS3A 2GSIB 4ODHL 3DO7B 3DUUB 3T0ED 2ZZUT 1R3KA 4HHAA 4JGMA 1JCKA 1XF3A 4TN9A 3O8XD 1F2QA 2BJML 1P6FA 3OKNA 4WI6A 5TF0A 3HNSL 1S7XB 3MLXH 4DGVH 1JGLH 1MCNA 3OXSB 3MV11 2YBRB 3ZZ1A 3LS4L 5FIEA 5TFSH 5JZ7C 4Z5RB 1E4XL 5E8NA 2AJXL 4K07A 1PX3A 4X8XA 4YDKH 3OZ9H 2BNUB 4PJ5B 5D2NC 3QPQD 3WUZA 3QUMH 5J57B 4HKJB 4Y7MA 4FNLL 3MXVL 1MFBL 3D25A 4M6MH 3LRSB 2Y07H 3WXWH 4W6WB 3CDCA 4QHMB 5L8JB 3U7WL 1RK1A 5FDWB 4XPFL 3WIFB 1JZ4A 2MTPA 4GT7A 4PD4K 1UB6B 5EU5B 4OZFB 1S7SA 5LQBL 3ET9F 3L1OH 4QNPF 1IKNC 5TDPA 1B0GB 1X4ZA 1T83A 1QBLH 3A0OA 3PG2A 5TJWK 1JNLH 5CP7B 4BQ9A 4HIJA 2VDQL 4GUPB 4GJTB 2RR3A 5EIIB 1I9JH 3V4VH 5HHQB 3UZVB 2X4QB 1B0RB 4HJJH 4M4RA 4M7JH 5I8CB 1TPXC 5B3JE 3H7BA 3LKPB 4KWUA 5DYOB 2V5YA 3I02A 4LVHC 2UZXB 1F4HA 1NGYB 4FQQA 4R96A 4FNLH 4ZQKB 5DLMH 3VFMB 2EYSB 1YDPB 5I6XB 4K8RC 3QFDA 3CXDH 2ED7A 3CMGA 4PJXB 4E9LA 4K23H 3HPJB 3CFJA 1R3JB 4OLXH 5AUMB 4PPTA 4QTIH 3ARBB 2VL5B 2BSRB 1DLFH 2ZJSH 5F9JA 4C56E 5T1MB 4PV8B 4OV5A 4R90L 5LCVH 3LS5H 1N5AB 3MCKA 4F57L 1EAPA 4IRSB 2NTFB 3TVMC 3E2HC 3EFDH 5A2IH 5MEQA 4XPBH 1NFIB 4ONOA 2DIAA 1MCPH 3IKCB 5HHMB 3BPOC 4PY7A 3T77B 3RDTA 1S5HA 4G8GB 5TE6H 1GC1C 4NQDD 4ONHA 3JSSA 1NBZA 2DOCA 5IG7B 1CI5A 2GJ6A 2I27N 4I13B 1YEIH 1IL1B 3MLTA 1AIFB 3X13A 1EEZB 1T1WB 1EO5A 4PIRF 3QQ4A 2DBLL 2NX5B 2QQKL 1F4YL 1HI6B 1SJHA 2E8ZA 3SY0B 5K9QI 3H3BC 1F4XL 1N0XH 5JUEL 1UWGL 2XPGB 1MPAL 1IEBB 3TN0D 4Y8DC 4GSDL 4IRSC 1U8IA 1FRGH 1NKOA 3B5GA 1TZIB 4J6RL 2E7HA 3GSNB 3QHFL 4PJEE 1BFVL 3QDME 2YD7A 3KJ4C 2RAMA 3FQNB 4GRMA 5D1QD 4RGNB 5IB2B 3MREA 4JM2F 3OJ2C 3MJGX 3GMNA 3VWJD 5FV1L 2J4WL 2H26B 3VFSA 5BVJA 4L8SA 3MJ9H 4XWGH 4DOHB 4R4FL 5GZND 4Y4HC 5HGHB 1A9BA 1FVCA 5D1XA 3RVUD 4K2UH 5EO0A 2NX5A 4QHLB 3WO4C 2O93L 4JHWH 5IESL 1JWSA 3C5ZC 4KGLA 3KLAA 1I1AC 1DVFB 4O5LL 4WU5A 2OK0H 2HJKB 2ZCHH 4XMPL 1EFQA 1AO7A 2FYYA 4IM8A 3SDXA 3LMJL 2AJVL 1J10A 2H9GA 3BKCH 1FNAA 2ZUUA 1HHKA 3OR6B 4I18C 5TFSL 4CN6A 1WWCA 1WF5A 5HYJA 4LQ1A 3MCKB 4PJBB 2RB8A 3EJYC 4PREB 5DJCA 4QOKE 5GGTL 5CGTA 1MREH 4JRWA 3V79C 3PP4H 3MRFA 2LVEA 4Y16B 1MHCA 3EYVA 3LZFL 4AG4H 5FKPA 1ZMYA 1Q72L 1S7QA 1SMAA 4L8SC 3D0VB 3MPCA 3JVGA 1KENL 1T7YA 2VQ1B 2OJEA 5CINH 2EZ0D 4IMLB 3REWB 1MCLA 3ULVD 3SDDD 3MR9B 2H2SD 3FONA 1NANI 1ND0A 2QADC 3T77A 2W9EH 5T3XD 1DR9A 2VSCA 1M6OA 1A6VL 4XNQB 1CXFA 2VDRH 4ZTOL 1GGUA 4R3SA 1JWMB 3SGJA 1FCGA 3BKCL 4P3CH 3U9PL 1T89C 3AXLB 5CINL 2Z31D 3QBTB 3TJEL 5C9KA 5DJ8B 2X9WA 3C8HA 4Y19A 3QJHA 3SGEI 4PRID 4PJCF 1RVFH 1ZTXH 5KZCD 3HE7C 1WBYA 1OAYH 3IJYA 1GGYA 5ITFB 1W0WA 4P4RB 3ZHLA 3S35L 1AI1H 4JQVC 4XNMB 3MROA 1AP2B 2HFFA 1BGXL 4GBXC 4Y5YB 4PJDE 1FNEA 1HHGA 4N1HB 3QWRD 3VFVB 3MOBH 3IXTB 4NCDA 3LQZB 1XGRB 2FECL 3PV6B 3BGAA 1TZGH 2ZOKA 4OD3L 3PDOB 3MV8B 3S36L 2VXSH 1FH5H 1I3UA 1IKFH 1L4IA 3SJVB 1L6ZA 3B9KC 3DRTA 3ULVF 2VLJD 3V5DB 4EI5A 2VB5A 1JNNL 1KN4L 3E8UH 2VAJA 3T3MF 1H5BA 4G6KH 3CSYA 2JK5B 4X7TB 1GCFA 4X98A 4JCMA 5DK2B 3WCYA 4HIJB 3CFCL 2YXMA 1BMGA 2DM7A 2CK2A 4X6CE 4QRSB 1L6XA 5E8NB 2VLKE 5EB9A 7CGTA 1GYAA 2JELL 2X6MA 2C3HA 1OP9A 2PXYD 1UCBH 3ARWA 5DHVH 2ADGB 4UT9H 3FB7A 4OLZH 4MMZC 3BVNB 5TE6L 3ALPA 3VFWB 1ERNA 3ARBD 3FO0L 2E27L 3PWJA 1X6LA 1YYLH 2AP2A 3EHBD 3MGAA 5C0CD 1ED3A 3AGVA 5J9PB 1FYTD 1M71A 2CLRA 5HJ3B 3QHZH 4PY8J 3IDXH 5JW3L 1NKRA 1LGVA 5IW6B 1MOEA 2V2XA 3QDJB 5FCSH 2CH8A 3W11C 3FFCB 3EYQD 3WLWD 1MCQA 3P4OB 5ITBH 2X70A 5CGYC 1PAMA 5C9JB 3DNKA 4ZNEE 1G7HB 1G7LB 5MI0B 4OCXH 4M7LL 4PRPD 4TNVK 3MO1A 1U8IB 2IFFH 3RKDC 1M7DA 2YEZB 4JLRA 1EMTL 1A3QA 4JHZA 1RFDH 3BW9A 3WUWB 3DXAB 4PJHB 1IGFH 3BH9B 3DETC 5J6HA 3L7FA 1NUDA 1QRNB 1ZT7B 3FMGH 4HKBB 1CICA 3W0WE 4KGJA 3TN0A 4HJJL 4DZ8B 4P49A 5EUOF 4XPGL 5IG7A 4YBLC 3HMWH 3QDGD 5F88A 4GRWE 1PSKL 4GKSB 1WZ1H 2Q6WA 3CSBA 4XPAL 4TSAH 4L4VB 3MXWH 2EC9T 1MFCL 2IH3B 3P0GB 3WN5B 4UDTB 1RZIB 1K5NB 1NGWB 4J12A 4JKKA 2ZUYA 5IMKB 3U4BL 1WISA 4TVPD 2EE9A 5L2KD 5GJSL 2FH8A 3BSZL 2VLKD 4JFZH 2UZIL 4H25B 5K59F 5FYJU 3KPSB 3CXHK 1U36A 5FFLA 4RA3A 4LDOB 2YUWA 3GSXA 1RUQH 3RIFF 1CICB 1ZHKA 2F54D 4OIIH 1PLGL 1OP5K 4HPOL 3GSOA 4KKNA 4LSUH 3IU3A 4WJ5A 1PKQA 4IS6B 2EH7L 3B9DA 3GI8H 1QG3A 3MBEB 2Y5TA 4WU7A 4MAYB 1I1CA 1PQZA 1VHPA 3JUYA 4NRZA 2X1QA 43C9A 1MHEA 1A0QL 1A6UL 1SBSL 4FABH 1SJVA 5D8JL 1MCPL 1EGJL 2F19H 5T1KB 2IQ9L 4MNQB 1TJGH 2NR6D 5B38G 4IBLT 4YGVB 3BXNB 4TUOB 1NBQA 2ZUQC 2DB8A 1A21A 3GI8L 4CNIA 1UM5L 1X6NA 4ZO7A 1O7VA 1B6DA 5IW6A 2B1HH 5D1ZD 4DW2L 3UTTA 4OZIB 3ZE0F 3SDCD 5FUCC 5IB1A 5MHSE 4JFXA 2OP4H 3TT3H 3L95B 4HV8A 5TDNA 3DBXB 3RWCA 5GGVY 3V0WL 2NY3D 1U8KB 2EDYA 1FRGL 1R3IL 2M2DA 4RGNE 1I8MB 5EZIH 3TYGH 1F13A 2X4RA 4HPOH 3EOAA 1IVLA 5D7SH 3UTOA 2CIKB 1GC1H 2NY4B 1HNFA 3GBLA 2LU7A 3JWOC 3CDFA 2IH3A 1CQKA 5IVXF 2DQDL 3VH8G 1C5DA 1B9ZA 3VRJB 3OHXB 4EBQL 4YWGL 3QCUH 4NUGL 3H9ZA 3TBWB 4A6YB 4DK3A 2OK0L 4MA7L 5EOTA 3VD5A 4N8VB 1VFBB 5D6DA 1JNLL 2BY2A 4P9ML 4HF5L 4KRMB 2FBJH 3HCVB 4K3DH 1RK0B 2COQA 4LPWA 3DIFA 4O51A 2CGRL 1SQ2N 2ZSVB 5DVLA 4R4BB 4JJ5B 4OLVL 4QT5A 4RMSA 4HXAL 4XXDA 4FA8A 3X14B 3LEVH 4KK6D 4K2UL 2OJEB 1JPGA 4HBQA 2ADIB 2HJFA 4LEOA 2UVEA 5E7BA 2MHAA 1ORQA 4X7EC 3O6FB 3ZHDA 4ELKB 5F1NA 5J12B 1FZKB 4WFHE 1RU9H 3CC5B 3H3PH 4CVUA 2WSKA 4K3JH 3D2UA 1KEML 4TNVF 5ISZD 1NMCC 3B43A 4ELME 4OCNC 4ZUWB 1F45A 1EGJA 1FZOA 5CJQL 3WFEH 5GGTH 4JM2C 1CZ8L 5C0AB 4DGVL 4I2XB 4K7FA 3MO1B 1XFPA 4HEME 3ZKXB 4MB5A 4S1SL 3MRIB 5FOBA 5ETUA 32C2B 5GZOD 1G1YA 1MY5A 3O6FA 4GMTL 3SBWA 3NABH 4JFFA 1RV6X 1FE8L 3TPUB 2P45B 3EO9H 1HOCB 3BIKB 1CFQB 1J8HE 4P46D 4HMEA 1K8IB 1B0GA 3B5TA 1X3DA 4QRRE 1ADQH 4XTRD 5HD8C 5DMGC 1T4KA 5IWLA 4L4TE 2ESVA 5BRZA 1KC5H 3NTCL 2JIXB 4JO1H 2GCYA 5C09B 1P7QB 4DQOL 5C3LD 5HYJE 3DX6B 5F97E 2C3VA 5FGBC 4DCQB 4DN3H 5EC2B 1N8ZB 1OAZL 3BQUA 4I4WA 2EH7H 3BH9A 1ADQA 4YK4B 5E9DA 2XN9A 5FYLD 3GIZL 1VADA 1WFNA 3HC4L 5T1LD 5D9SB 2NY0C 5EOCH 2QQLH 4NO0D 3U7YL 3ALXA 2FO1A 2AK1H 3FO0H 1I1AA 4XPHH 5IIEA 3KYMB 4P9HC 1QEWA 3LMJH 1YJDC 4G42B 3OKLA 5ACLA 5C6PB 4G9FB 3BKJL 2VR4A 4J3VA 5T1MA 2PO6D 1I85A 3ROLB 1BBJB 1MVUB 4QRPD 1M05A 3K2UL 2JE8A 3JV6A 3OG4B 2BVPA 3MC0A 3LN9A 3GMMB 2OP4L 2F15A 3R0NA 2QSCH 2XKSA 4C83A 3U4EA 4ZS6C 4H1LA 1Q9LB 3VXUD 4HIIB 4UB0L 1S7UA 5D7IF 4F58H 2W38A 4PJHA 3MRPA 3DYPA 3O3AA 2FECI 2NXYB 4BSJA 5BW7A 4U7SA 4X99B 3VXRD 3FQTA 4KRPC 2YD9A 3GMQA 1FLRH 4LSRH 4LSSL 1MCSA 4KZEH 5FO9A 1MHEB 1NUFA 2MWCA 3P9LA 3UTTD 3RIAF 4CADA 3VXTA 4ZOEA 3EZ8A 5EOQH 1JGEA 5HHVH 4XNYH 4UI2A 2YZ8A 1XR8A 3MRDA 1G9ML 4KQ3H 1OAUL 3TGXA 3W81A 5CCKH 2OX5A 1S7SB 5GGSA 1EHLH 4YE4H 2GSGB 2R2EA 3EDEA 1XCTB 1ZLVK 1OAYL 2E6JA 2H26A 3VFSB 1RIUL 4YHYB 3CX2A 4KRPB 3ZTNH 4P2RD 3RTQA 1TZHB 3BKML 4L3EE 3QHFH 4JFYA 1UWXK 4U6TA 5HDBE 4LVNB 4PB9H 3CH8A 5DJDA 1RSFA 3GHEL 1DBKH 3Q48A 2QKIA 3KNBA 1E4KC 5GGVH 1WCBA 2FGZA 2CDGA 4HK0B 1P53A 2VLRA 4GOSA 2HJFB 4K3JL 1YEKH 2F58H 5C0JA 4NSKB 1KTLB 1NAKH 1EZVY 3DURB 1IC4H 4KUCF 4MA3A 4NN5C 3ZE2E 1I7TB 2I24N 4PB9L 1VA9A 5HPMB 5D7JA 4NQSB 4PYGA 1CBVH 1F00I 4ZD3H 1HSAB 1IGMH 3RI5K 4HS8L 2W07A 5HHMD 3KPOB 3W2DL 1TQCC 1J1PL 1TCMA 2DD8H 1TJHL 4RZCA 3RL2B 1D9KC 5FM5O 2HLFC 4JFDE 3U2SB 2DDQL 3GSQA 4JPWL 1IEBA 4MGXA 4PBVC 5GRVK 3C60C 1JPSH 2VXTL 1KLUB 2W0FB 3C6SA 1IRAY 4P9HH 3UPRB 3IFOA 1DFBL 2X44D 4NQEA 1G6RB 4FFWC 1QRNA 1ZT7A 2FX7H 3AREB 2YXFA 2Z4QA 3F7PC 3IGAB 5J4MA 3T1WA 3TYGL 3QXAA 5I74B 1SVCP 2ITDA 4HH9B 3HFML 3QXVA 1X5AA 4XCNA 2QHRH 4LBEB 5I75C 1DVFA 5ESQB 3HI1B 4YAQB 2D0GA 2QEJA 1G9NL 5BVPL 5CD5C 4S0TD 1EVUA 4YHYC 3K8MA 1HH6B 4PJ5D 3B2VH 1J0YA 5E1AA 2D7TH 1I7UB 2X4NA 4NQVB 1BZQK 4UTAL 3P9MB 4YBQC 3ZSSA 1X5KA 5IGXL 3DECA 5D7LD 5I15H 4X6FB 1W72B 1FJ1A 1FP5A 4JZJA 2GJ6E 2X10A 4DUWA 3UTZA 2EDQA 5C07E 3VI4F 4MMXC 1AC6A 4QCIB 5BVPH 3SGKC 4CJ1A 2DWDB 4WY7H 2FL5A 3HZKB 3SDCB 2Y25A 4JFDD 3OJDA 1YDPA 5J3HC 4M7LH 3H42L 4PJFF 2FX7L 4NM4L 1HNGA 4F9LC 5D7LE 5E9DD 5JLZB 5EU4B 3IJHA 1RZJH 5GSVB 4HT1L 1X5GA 2FBJL 3N9GL 5KS9F 3MV9A 4M6AA 4K3EL 5F7DA 2NY2C 3QFJD 4NBZB 4D3CL 4P2OC 4UAOB 4X9BA 1JGDA 4F7CA 2X1WL 2P5WE 4U1MA 2ICWI 1NGWA 4MXVF 3WFCL 3SGJC 1DE4A 3BPLC 1T1ZB 1YPZB 3OB0H 1U8OA 2ADJA 3N0PB 1G7IB 4UT9L 4ODWB 3D3VD 4MAYA 3NFNA 4Y4HA 4OLWL 4MDIB 3QCTH 3IDYC 1E27B 3MROB 2P24B 1S9YB 1CGTA 2A6KB 3L3OA 3UEZA 1YEEH 3MLZH 4PJGB 3UPRA 1BJ1H 2NW3A 4ZYKB 4B50A 2WAHA 2RCSL 3MRGB 5IJKA 5DHVA 1YUHB 3NBNA 4P2RB 1M7DB 2A9ML 3QQ9D 1BBDH 3IFLL 1BFSA 1JWMA 5T33L 4OLWH 2F53E 4NFDA 3QXDB 3H9HB 4FTVD 3VXSA 1YNTB 3WHXA 3GBML 1NCAL 7FABH 4LRNH 2E6PA 3SDAD 3QUZB 1WWBX 1SVZA 4ZFOA 3TH3T 4N8CL 3BDBA 1EFXB 2V7HB 2W0PA 3UJTH 5D5MF 4C4KT 3LS5L 2VH5H 4YUEH 2Q8BH 1FNEB 3NFSL 1T80A 4JRXB 4POZD 4GG8A 2HG5A 4P46C 3BHBB 4R8WL 1ZANH 4OGAD 3AREC 4XVJH 2OSLB 4KJPD 3RZWA 1T0NA 3D39B 4W4OA 2ICES 5E99L 3ZT5A 2GTWA 4N8CH 1DBBH 5GS2D 4QRPE 2VLLB 1X5HA 1LEIA 3M07A 4S1DC 4DK6A 5FYJE 1DBAH 2IAMB 1HHKB 3OR6A 1H15A 1JFQH 3F6LA 3SKUD 1NCBH 4R8WH 3BKYL 3ARPA 2R2EB 4PRPA 5JA8B 5DVNA 4WHYG 4NT6B 1A8JH 2IBBA 1TVBB 1X4YA 3QQNA 3DUSB 2X9XA 4GUPA 1WTLA 4CGTA 1L9NA 4HIHA 5I8EA 3QUZD 1YQ2A 3NZ8B 1FVCB 5GIRA 2PO6A 4YO0B 1EBAA 4LCWE 3FO9A 5IT2H 2VLRB 1E27A 2YZ1A 4KHTH 2GJZA 4QGTA 3VW3H 1P4BH 5B39G 1VESA 5IB4A 1KT2A 1BJ1J 2AI0L 3B6SB 4P57B 15C8L 1UT9A 2DMCA 1G7IA 4Q6IC 5DRNA 4PJBF 1Q1JL 1WZLA 4H5SB 3SCMC 3MLUH 2ZCKL 4TVPL 4U1HB 1OGTB 2ATPB 2P5EB 2IAMA 2OM5A 1JWUA 2OS7A 1MFEL 3FAWA 4OFYA 3SJVD 2GTZB 3G6AB 5EU7C 4Y19B 4HFWB 2HMID 4JM4H 5J0BA 1AQKL 3ECBB 5DHYA 1AGEB 1I3RB 2DQIH 2ITCA 3GSRB 5DC0A 4GG6B 5CILL 4X8JA 4F2MA 1ZT4B 4JPKL 4MD5A 4F7EB 1D5IL 5GS0H 4LPVA 3UTSE 3KYOB 2FDBP 2MCPL 4NJAL 4H25A 1DVFD 3O4OC 3BPLB 3MOAL 1VGEH 3W9DA 3SGKA 4GKNA 3T3ME 2IC2A 1MF2H 3HG1B 1TENA 2Z8SA 1NCNA 3QUYC 4ZPTA 1CLYH 1RIHL 1QFWM 1R5WB 4Z0XB 5HDOA 1WT5C 3ZDYF 4HCRH 4N0YH 3HPLA 4YE4L 1H9VA 1NC4A 3MLUL 1ES0B 5IKCA 2EYRA 2APBA 4EBQH 3WNPA 4WUUB 3GMMA 2AW2A 4XXDB 4EUPB 4P2QA 3L5IA 3GHEH 1YEFL 1KBGH 3O8XC 1NEZA 1QR1A 4GKNB 3K4DA 1KXTB 5DWUH 4R0LB 1H3TA 3VWKA 3T0EC 3UTPE 1RZFL 2BVTA 4R96B 4WTXA 4CW1B 1IC7H 4LCWA 4ZS7H 2NR6C 1G6RA 4S1QH 2KKQA 2KQMA 5DT1H 1ZGLP 1AQDB 1JZ5A 3FT2B 5KVDH 1HHIA 5LAXA 3QWOB 3GSNL 3SDYH 1MFBH 2AEPH 4OCWL 3F5WB 3THMH 4QRQB 4ZYKA 1FN4A 5FYLE 3S37L 4MNQA 3S36H 5ALCH 4D8PB 4GRWH 2K7QA 1IC7L 4HS3B 4L4JA 4Y2DA 1OB1B 2ZG2A 1FE8H 1YECL 1X5YA 2J8UB 2NYYD 2XTJC 2IG2L 3WBDA 3OF6A 1UEYA 3RWCB 2DBLH 3U36A 2UZYB 3MRJB 5F8QC 3TPUA 4P23A 2FWOA 4FQJH 3ARRA 5ALBL 1J8HD 1FG9C 3O6MH 5F89B 3SO3B 4FQHB 4HIEA 5LGKA 4PJ5A 2AKRB 3GMQB 4LMQI 4MQSB 4Y4FB 3P11H 3SDAA 1A14H 1U92B 5FO9B 1W8OA 1B3JA 2A38A 5CJBA 4ZOCA 1QSEE 4GW1B 2FHCA 1YEGL 1WFUA 3PQYD 4FQJL 3GGWB 3LQMA 1AD0A 2YSSA 1MRFH 4AENB 5F9AC 3GJEA 1UB6A 5I15L 2ZJSL 4R2GC 5E7FA 5JHDD 4U0RB 2NY0D 5C8JA 5IW3A 2EDFA 5DZOA 3QSKB 1CG9B 2E6QA 2DQEL 3DX9A 4XAKE 4EN3A 3VG9B 4O9HH 4TPRL 3E3QC 1MHCB 3EYVB 4OCXL 4XI5D 1T83C 4IDJL 2IAND 5I1CH 4JM2A 1G0DA 1WLHA 5C0EB 5JOPD 2MQ0A 3N1GC 1UJ3A 2XY2A 4J8RA 4IHOA 4WFHD 3QWOA 2IANB 4HX1B 3TWCH 3L7EB 5C0NC 4Z7OE 4PJXE 3QUMA 3V52L 5DRWA 2V2WA 5A2KH 3OB8A 1CXLA 1PVHA 4RMRA 3SCMA 4KKBD 4XVSL 3EOBA 1YUHA 5ITBL 1MIEL 3SDXF 5SX5K 1KF9B 4C54A 3AY4C 4DTGL 2VIRB 2FJHB 4YPGB 3G04B 5TPWL 4D9LL 3WNLA 2NMSA 3PQYB 4HW6A 1J1XH 5F6IC 2DYPA 2YN3A 2ZPKH 2D9QB 4PLKD 4PS4L 1CK0L 1CGYA 3IFLH 2ITCB 1JRHI 3LH2H 1UM6L 4M61B 4BQ6A 5EOCJ 3UYOD 4U4BA 4JAMA 2Y7QB 1PGRB 3OKKA 3E2HB 1FNGB 4G43B 5CD3A 3PE9A 3T0EB 3C8DA 5T1LA 4X4XA 3B9AA 1MJUL 1EUTA 2AKRA 2X4TA 3B9KD 4NZRH 4P4KC 3CVHL 4TQEL 3TEUA 3TWCL 4EOWL 3E6HB 3HRPA 4J4PD 5IR1B 2DQTL 1BM3H 3L3IA 1JF1A 5EU4A 1CD0A 2EXYC 1EJOH 1GOFA 1XGUB 2YA2A 3PGCA 3RGVC 2WLYA 2OQJA 5B39A 1LE9B 3A6OA 5MEOB 3VG9C 3WIHA 1MCJA 4P2YA 5HVFB 5DJZB 5KVEL 1YPZF 2VLJA 2YD4A 4M8QA 4R97C 1Z9LA 1N4XH 4DVBB 4P2QB 3CFKA 5T1LB 1CD1A 3PDGA 5E8OB 4X5WB 2X4TB 5AZEH 1TZIA 1WITA 1EAPB 1CBVL 4ODBD 1E4XI 1I1YA 3PF2A 3LRGA 1JPFA 1WIPA 3IDMB 3O3AB 4X6FA 1UB5B 3B6SA 1LP9B 5HYSG 2ADIA 2LTQC 2BXZA 5L8LB 3CX5K 4WFGD 1GZPA 1KPVB 1E28B 3PWPB 2WINB 2GY5A 1GIGL 3D0LA 3STBA 3QEQD 3CVHH 4TQEH 3RX7A 1S7RB 3Q1SL 5KS9B 3LV3A 2IQAA 5IV2B 3FO1B 1FYTA 3T0VA 2IPKA 5GJTL 5E2TH 1GL4B 1J0ZA 5DFVD 1OAQL 2YPLB 3GDBA 1C12A 4H20L 4BZ2H 5AZ2L 1NCCH 1F58L 4GS7B 3EDKA 3WFBL 5D71L 2J1KA 5IT2L 1FAIL 2HJLB 5J7CC 1NMBH 2AJUH 4JY5L 2L0DA 4ODUA 3LEYH 3HLAB 2CSPA 3C9NA 4YDKL 2PW2A 3DGGB 4MNGB 5DRXB 4NDMB 1DBJH 1IGYB 5L9DH 1TZGL 5I8KH 3TM6A 3W0WD 4X80L 1C7TA 5DC4B 2VDLH 4QRPA 3EIFA 1L7IH 1CLOL 1P4IH 4HXBL 3ZKNC 3U0WL 3D9AL 4PRIB 2XI9A 4WY7L 1UKQA 4A2MA 35C8L 4AEEA 2VISB 3ULVE 1F8TL 3ARDB 1JUFA 1WZ1L 4ODXA 2VLJE 4U6YB 3GFUA 5I16B 3CK0L 4Z78B 2YK1H 2GY7B 4J23A 4LLWA 1WEJH 3KYAA 4WHTA 3U36B 3WLBA 2M8XA 4EVNA 1CD1B 3SDDB 4OGYL 3OBAA 5D93B 3HMXA 3LD8C 5IB4B 4KJWD 1FIGH 5FYJL 2EYTA 4O58L 1XGRA 3HTLX 1NC2D 4PJCE 4AJ0A 3P77A 2IJ0C 2OL3B 2EH8L 5HYSB 3Q6GL 3OAUL 4X6DE 5SWQB 1CDBA 4L3EA 5LBSH 2VLKB 4NJ9H 2FJHA 3O81A 4FQ2L 4PJ8A 2CLZB 3ZDXF 4XH2A 1XIWB 3O3UN 5J1AB 2DQCL 3M8OH 2GI7A 1S9WB 1TJGL 1OD9A 2FH6A 2YPLA 4JRXD 4JVWA 4IRSA 5CSBA 2UUDH 2D4FA 4NP4L 3JWOH 3VE0B 1UH3A 2BY3A 3SDYL 1EFXD 3RQ3A 1KELL 4KJQD 4UOW1 5A40E 3SKNA 1XAUA 1EEYA 3TBVB 3B8SA 4L4TB 4XCEA 3UTQA 1H3UA 1YJDL 1JHTA 1EJOL 1XR9A 4QCIA 1T03L 4AEHH 2OMBA 3OAYH 4XVUC 4QRRB 1XCQA 1MVUA 5FYJH 1DLFL 4FMKA 2IMMA 1FZKA 3MCG1 1OGAA 4AENA 5EZLB 1RUAH 5SWZA 3INUL 1E4WL 4LSQL 3LKOB 3U4BH 4NQDE 5J06A 4I0PD 1M7XA 3S4SA 4PD4J 2BMKA 4DVBA 3EOAB 4OI8A 3C08L 2BERA 4UDUB 1ZK9A 4OF3A 4F58L 4F9PA 3UJJL 3QIBC 2JCCB 4IOFD 3KLAB 3P3YA 4TUJA 2IF7A 5IJVB 1Z9MA 3QA3B 3L7FB 3OJVC 2OL3A 4PRHB 5KSAD 1VERA 3TA3D 4DKAA 3KGRA 3BO8A 1RJYB 4I3SH 5K9JH 3QEUB 5I71C 1A6WL 1ROWA 8FABB 4LPUA 4Y19D 1R24A 1FV1B 4PBWD 1BJ8A 4Z76B 3FO2B 3MRBA 1D3CA 4F7TA 1Z9SA 4QOKB 2WLZA 2WWMC 2ZSWA 4A6YH 3RNKB 3GJFA 5MI0C 3C5SB 3MRKB 1DL7H 3CFBA 3O8XA 4UT6L 5I1CL 3ULUC 1CCZA 5FGSA 5BV7L 4EUPH 5EU6A 2HMIC 4GXVH 1MH5B 3LEYL 1JV5B 3SKOA 5CSZB 3ILPB 2NPLX 4L8BA 3RZCD 4MXVE 3DVNA 3MRIA 3NA9L 1Y6MR 1JTOA 1MUJB 2E8YA 4IOSD 5F3HB 3LIZH 4ZNCD 4R0LA 3JZ7A 5I71B 5CBEB 1SEQL 3ULUH 4XP1L 1P4BL 1IGIL 3NFPA 4YBLB 5ADPH 5L88H 1X5ZA 3MZTA 2QJDA 5F96L 4ZUVB 4OT1H 4F7TB 2EEDA 1BJMA 2PYEB 4ZUTA 3CZFB 1V3MA 2FEEI 4OFKA 4M9PA 1BWMA 1LO3H 2Q86B 1U8QB 3F5WA 1JYVA 1HQ4B 4HGWB 4LHQB 2C3WA 2DLFL 4MCZB 3H2WA 4P2OA 4EI5C 5L88L 3DX8A 1T5XB 3CLEL 1UM4H 2OL3L 4FFZL 4AQ1B 5C7XH 4GFTB 1CTOA 4KKAC 3UBXB 1AXSA 1T2QL 1Y0LB 3MRNA 1L0YA 1IAII 3PWLB 4AQOA 4J4PA 1G84A 2PETA 2X9YA 1I4FA 3LQZA 5ICZB 1TVDA 3HC3H 2QV2A 3L9RA 5JW4N 3OKYA 1BM3L 3RX5A 3RI5F 1WAAF 1KPRA 4NN7B 2E9WA 3SJVE 2BNRA 3IFPB 4HS8H 3FB8B 2C5DC 1QRKA 1BD2D 3RNQB 4V1DB 4PLJC 4CJ0A 4NRYB 1I1AD 1QBML 1A7QH 2QHRL 2NW2A 4JFEA 5D7LB 3FOMA 2R0KL 4HS6A 4IDJH 4RFEA 3B2VL 5I73B 1PY9A 3GJEB 1IGJB 3TBYA 2AJYH 2FIRT 3O9WB 5AWNL 1KELH 1JNJA 1V8HA 3PWJB 5CUSL 3U48A 4M5ZL 2M26A 1S78C 5AYUH 4XMKH 1T2QH 3H9SA 4DKEH 3VXUA 1TQBC 3IF1B 5DEZA 1QHPA 2YRLA 4MCYA 2Z91A 1INDL 1MCBA 3UAJC 4JDTH 3WNMA 3ABZA 4XBGB 4YHOH 2V2XB 2Y6SC 2VZTA 4W4OC 2XXCB 4D9LH 2VLKA 3N1MC 4KUZH 3WO3B 1AGFA 3EGSB 2JELH 3IDNA 4DKDC 4F3FB 1KJ2A 1T22B 4Z77B 4YX2L 3P4LA 5EOQL 3U7WH 3AS3A 2AXGB 4FFYL 4NO3B 3ARXA 2EIEA 2IG2H 5LGHH 4BFIB 4XCCH 1AIFA 4JEGB 1PEWA 4Y5VB 1T0MB 3GHBH 4DVRL 4XP6L 4WW2C 4XNMA 3WIIL 1CTNA 5J6HB 1C7SA 4MJIB 3QIBA 1ITBB 4F37F 1R3KB 4HHAB 4GQPH 1QACA 1MVFA 4YDIH 5C0GA 2G5RA 4K55A 3P0VL 3ZTNL 1UC6A 2Z35A 3DJ9A 4FG6C 1DQJA 4HJGA 1NSNH 1AQDA 1MFNA 1ZEAH 4ESKA 4P5TD 2NY7L 3SJVA 4FQCL 4YHKH 3AS1A 2XKNA 4NNYB 3SE8L 1HZHL 4MJ4A 5HHXL 4MJ5B 1FG2A 2BY1A 1KIQB 2CLZA 3GMOB 3DIFB 3QXWA 3GBNH 4R4BA 4JM2B 1WJ3A 4YBQD 4BUHA 3QI9D 5D7JD 4Y5VC 5DUML 3HMXH 3LN4B 2VC2H 1D5BB 1KLUA 4BQBA 5IHUH 5HHOB 5KN5A 2CRMA 4Z95L 3KR3H 1HKFA 6CGTA 1K8DA 1CFNA 3W39B 5B8CB 5IMMA 1QSFB 1OARH 5EU6D 1YYMH 3V52H 5A3IC 4H5SA 1NC4D 3O3EB 4Q9QL 2MCG1 4XVJL 3LV3B 3BE1L 2B4CL 2FJFB 2F8VA 3RA7L 2FD6L 3DTXA 4JDVB 4DZBA 2J8OA 3C2SA 4OSUH 2XFXB 5F9JB 4HUVA 2V7NA 4IJ3B 4P2QD 2DTSA 3QP3A 5I66A 3DX8B 1AE6H 1T21A 1ZT1B 3MRKA 3T8XA 3VFWA 2VMFA 4L1HA 3QI9B 4MVBC 1TCRA 1KJMB 5E94B 4M4PA 1DE4B 1UVQB 5B8CC 3KAAA 3FQNA 4GRMB 4WHTB 5C86A 3IJSB 4OIAA 3QDMB 1N59A 5E4EC 4NHCL 5C2UB 1ACYL 1OQOA 4FQHA 2JK5A 2Q20A 4PJCA 4X7TA 1P7KA 3SN6N 1QOKA 4X98B 3MODH 1AGDB 3MYZA 5IFHH 1INEL 15C8H 2UV3A 4X6DA 2AXFA 3NAAL 3S97C 2DQDH 3EOYG 3H7LA 4YIQA 5JLZA 5D72H 4IEFB 3OX8B 5I74C 5D7KE 2O5YL 5KJRH 1CXKA 2NY2B 3MBXH 1T66D 3BGFC 4LKXB 4WHDA 4Q9RL 1ZHBB 5B22A 1I9EA 1NFIA 2AAVA 4KRNA 1BF8A 1QFWL 4OZGE 4ERSL 3TNMB 4OLVH 3U0WH 3GB7A 1RZGB 2XA3A 3IDGA 1SY6H 3WE6B 3MRFB 3KLSA 4WUKL 4LF3A 5DQ9A 1ORQB 5C3TA 3G08A 3BIAX 2NXZD 1CLZL 3KJ6L 4FTVB 2FATH 4I1NB 5AG8A 2WMPA 2WQRA 3TO4A 1NFDB 4XXCC 5CWSA 4ZXBB 2IMNA 5D7KD 3J8F7 1EX0A 5F7EH 1YEJL 3GSVB 2DLIA 5FF6B 4HWBA 3TCLB 3DXAA 4NQSA 5FYLL 4GW4B 1T1ZA 1YPZA 4PGDA 1IAMA 5IWLC 4U0QB 5CJQH 5F7FA 5IB1B 4IRJD 4LASL 2A74B 1LEKA 1T7WA 4IOIA 1VEOA 2H6PB 2NY6B 4LLYB 2APXA 3B9KB 2GK2A 4LVNC 4YNYB 2I5YH 3BQUC 4UBDC 1QFPA 4P2RE 1G0YR 1MJJB 5DFWH 4AEHL 2C4FT 3F12A 4GRLA 4U1IB 2ADFH 3C60A 2AJSH 1X5LA 3WEXA 5T1KA 4HLZH 1RZ7L 3QQ9C 4HC1A 2DIBA 3TBTB 3VI4E 1HYRC 2G5BB 4UQ3B 3TVMB 1G9MC 5J11C 5D7JB 3ARGA 3ILQD 5I1DB 3GM0A 4APQB 3OX8A 3MOBL 1WAAE 1W0VA 3DWTA 1DSFH 4RDQG 4WFFD 3V4VL 1I85C 4E41E 1WIUA 4WW2F 3NTCH 4HZLB 4LHJB 1D6EA 5IBLD 1G1CA 1OLZA 3VXRE 2ARJQ 5E6IB 4HKXA 3D39E 4YLQT 4N0FA 3GKWL 4PGJA 2HT2D 4PJEB 4TSBL 5C0RL 5L0QB 3MUGA 3T0DA 4UUJB 5AYQA 3LKRA 3T0BA 4Z7VF 1W72H 1K8DB 4I3RL 1YY9D 3LKSA 3BP4A 3PDOA 4OF0A 3I3BA 3QYCA 1G7MA 5KW9H 1YEEL 4FQXB 4JDZA 2VAAB 5DD5H 1A6ZA 1GGTA 1B2WH 1YYLL 3O45A 3BYTA 2BNQD 1OAZH 4QEGA 3TO4B 5CLWA 1U8LB 4X5XA 5MEND 5F9WC 3T2OA 4YDVA 3KXFD 2DQUL 2Z8VC 1S7VA 1WBYB 4U1LB 3HS0A 4WEBL 4NQVA 5HHME 1I9IH 3PWNB 3NCFB 1CT8B 2ORBH 1UZ8B 3G6JE 3J7HA 3BRGC 4OZIE 3OV6A 5FKAB 5E8DH 3ZKMC 4HEPG 3TV3H 5F1IB 3QRGH 3I50L 5I19H 1FDLL 4WHCA 2AXHA 5I17A 4XPHL 3LSOB 3VWKB 1UG9A 4HX1A 1IARB 1IEAA 5L8KB 3INUH 3HNVL 5KN5B 2VH5L 3N1PC 4TSBH 3CUPB 1BX2B 1MFAH 3EO0B 5FGRA 1ZGLB 1K6QH 3IAQA 3KYNA 4MAYC 5IW1B 1ZANL 4JFXB 1BD2E 1FL3B 1UKSA 4OZIF 4L3CA 2B5IC 1CFVL 4HUUA 2K3TA 3UTSB 4YHIB 3QRGL 4E42A 3G04A 3BZ4A 1INQA 5D7IE 4XNYL 3M45A 3WSQL 1JZ6A 4L3ED 1SYSA 2ESVB 3VFOB 2W9LA 1KV3A 2WUCL 3MBEC 3CZFA 5EUOE 3QNYA 2V9QA 3DLQR 4QF1B 1KTDA 3KYKL 4Z6AT 5I8CA 2MQ3A 4IRZL 4POYA 3VMPA 1XGQB 3X12B 2AJZB 2OXGA 3VXOB 2Z93B 3PHOA 4JFFB 5GGRY 3H9SE 2X4PA 4KTEL 3IETB 4HUKB 2WBJC 2Z8WC 3FB6B 5ENWB 5DUBA 1QBBA 3GSOB 3V7AG 2P1YA 5GGVL 3K80A 3IJHB 5IBUB 2VAAA 4KY1H 5IR1A 2EYTB 3DSFH 3TO4C 4ZFGL 5JNYA 1P7KB 1LNUB 2ZCKH 4TVPH 4R7DB 5F93C 4G8EA 4QOKA 2K7PA 4WUUD 2J6EL 4L5FL 4PS4H 1MI5A 4Y2DB 1RZIA 1FNFA 2BSTA 2J88L 2VDOH 3NIGE 4EJ1C 3PNWB 3P0YH 4ZTPL 4HIXH 2NY3C 1WUNT 4KDWA 43CAA 3PP4L 1LEIB 1B4RA 4KTYA 5CUSH 2Y5TB 3MJ7A 2Z92A 4NO0B 2EDLA 2FSEA 1CE1H 5EO1A 1HIML 3JUZA 4KFZC 4LRIC 2V5SA 1PDKA 2ED9A 3S98A 2Y5EA 3B2UD 5ESAA 4JRYE 4OCLC 1VGKA 1EEUA 1BEYH 4G9FA 3UJIH 4O4YL 3OXRA 5C0IB 3RVXD 4FXGB 4XP1H 4X4ME 4Y19E 3WN5A 1DLHB 4QO1A 4LLVB 4Y4FC 3FQRA 2JIXD 3A6BL 1MLBB 3RWEB 1ZVSB 4ACPA 2EDHA 3GMPB 4ZSOB 2VL4A 4AYFA 4CMHC 4GRLD 2WWKO 2ZOLA 1BP3B 4V1DE 1CG9A 3DX9B 2H6PA 5DMIL 5LXGL 4QHUA 3STZB 3S96B 4FZ8L 1UM4L 4QRRD 2GJ6B 4JGJA 2XQBL 3HPJA 5DWUL 1AHWB 3G5YA 2CO7B 3NIFE 3OMZA 4GXUM 1FH5L 4XT1C 4I3GA 1MRCL 1U8MB 1Q94A 5KS9E 5JIHA 3EYOB 3OAYK 3VDBA 3Q1SH 3O41B 2DWEB 3HRZA 4WUKH 4XB7A 3UMTA 1T04B 1DQQA 2XTJD 3R06A 5BS0A 1IQDB 4MNQE 5HHXH 4M5ZH 1OT2A 5DURD 3Q0HA 2GHWB 3OHXA 4RA0C 4LPCA 3DETD 2IBZY 4ODVH 4JGUA 4X5XB 4RX4A 3NMEA 2B0SH 2QHLA 3NCYS 4RISH 8CGTA 1KIRA 3EYUL 4JFYB 4EQ2A 3HUJB 5ICXB 1Q38A 2Q76A 5HHOD 5IB3B 5EBWB 2ARJB 3L5XH 3ULVL 3RL1A 3WLWC 5E2WL 4KMTH 2GUOB 3OAZH 5IQ7L 1TVHA 3GI9H 5T3XL 3KPSE 1RK1B 1ETZB 3RAJL 2G9HA 2DI7A 2K9UA 3BUYA 3C6LB 3P2TA 4UT7L 5FA3B 3ES6A 3MRCA 4LNRB 5J6GB 3EYUH 3OKDB 5TQ2L 2BVQB 4PG2A 5BQ7A 3GSUB 5MHSD 1HHIB 4I5BA 1JRHL 1P4LA 4JREB 4QRUA 1XIWD 3T04D 3H9HA 3DARA 1D5XA 2YRZA 4NGHL 1A7RL 3O2VH 2Q3ZA 3IDIB 3OAUH 4Z5RA 4PP2A 4ISVA 3MV8D 5HHNA 1QFWI 1ZEAL 3Q3GA 1LO5B 4OKVA 4I9WD 1HHGB 3REWA 2ICWJ 1FVDA 1W0YT 3BE1H 3SE8H 4DZ8A 2EDEA 1A6TA 3AS0A 4GG8B 4JO1L 1OLLA 5F21B 1ACYH 4L4TA 5BRZE 4PJXA 3HAEG 1ZGLA 4JRXE 4YXKH 4JPVL 4FXKA 1JYWA 3HPLB 4YHZH 1IFHL 2XACC 2H32A 4KI5D 1I3GH 4UDTA 3KPRE 4NUJA 4I3RH 2UUDK 5DD1L 5HYIA 1T03H 3RL2A 4FQIH 5J13B 1NBVL 5EN2B 2QSTA 3WD5H 5ABDE 4GAJL 1T3FB 4U1LA 1RZ8B 2J5LB 4IIQB 1UYWL 5F7DB 3BFOA 3MRLA 4EI6A 3MLRH 1A02N 4HV8B 4L8BB 3MGTB 3V4PH 4JFDB 2QR0A 2ED8A 4NO3A 5B21A 4KI5C 4M62L 3BDYL 1B90A 1HE7A 2BK8A 3BEVB 1DP0A 3HE7B 3RUGB 2BNQA 3CU7A 1CDJA 3RPKA 2H2SC 5J13C 1I1AB 2ATPA 1BHGA 1ODAA 2P5EA 4JKWA 1C08A 1UJ3C 2AVGA 4ORGA 5JW4M 2BZDA 4ENED 2XOTA 2A77L 3JWDL 4PRPE 2X89A 3HA0A 4OLYH 4BQCA 1FO0A 4D0BA 2HLAB 5FA4B 4G8EB 1FBIH 1S9VB 5IMLB 3KDMB 4NRXB 1S7WA 1QFHA 4Z0BH 4Q97A 4GG6A 1JV5A 3RHWK 3SKOB 4GH7B 2VUOA 5EO1B 3FAXA 2F54A 3U9UB 4BSVA 4G6AD 3RDTB 2BC4B 3UZEA 1V3KA 3B4NA 4B41A 1A7NL 1NLBH 4AEIL 2NXZB 1QVOA 4PRIE 1A2YB 3OKKB 5KAQF 5K9JL 4OLEA 4CN4A 5CHNB 4C57C 2HT4D 3GSNA 4X9HA 5GRJH 5KOMC 4R7DA 3IU4H 2GSGA 4Z7QF 5KSUA 3MMEA 1N3NB 5FO7B 2FGWH 4TRPH 3S6CA 3ARDA 5C1MB 1RIVL 1P9MA 3NACL 1M7IB 1J05A 2JB6B 3ARSA 5D2NE 5K9OA 1O7SA 1MJ8L 1BQLL 1NAKL 4PJIB 3RDTC 3GIVA 2VDOL 2DLFH 3MRMA 2DQFA 1RZ8A 4IIQA 3S4SB 4ONGL 1AHWA 2ZUVA 3MV9D 4X6BB 1MAML 1KTLA 4OV6F 3SKJH 1H3PH 4U31A 3D0VA 4QOKD 3QUMB 4W6XB 3TJHC 3FFCA 1FGVL 4LLUB 5FYLH 5JPMA 1T0PB 3MMEB 4NQCA 4MQ7B 5AD0A 1MCWW 2XZAL 5C6TH 3EOTL 1NGQH 5DD5L 2W60A 1KFAH 1MWAA 1NCDL 1GVIA 5IVZB 1BGXH 3I84A 1NMAL 4LP4A 3RHWF 3NN8B 4F33A 3TVMD 4EQ3A 5DA0B 2NY2D 5L2KA 1CLOH 1N6VA 3MYJB 4L9LA 3CLEH 1T6VN 4TNWF 5JA9A 1P9MC 4Y4HB 1XT5A 1OB1A 1H3WM 4Y4KB 3TF7C 3B5HA 1JGLL 4M1CC 1KB5B 4X8JB 3AAZA 1Q9WB 5JOPE 3LKPA 5DYOA 2NXZC 5J3HD 2YUVA 4PRNA 3QEHB 3LOWA 5CSZA 2I9LA 4HG4J 5IHBA