1YEGL

Structure of igg2a fab fragment (d2.3) complexed with reaction product
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
219
structure length
219
Chain Sequence
DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIHLVSKLDSGVPDRITGSGSGTDFTLKISRVEAADLGVYYCVQGTHFPYTFGGGTKLEILRGDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of a hydrolytic antibody and of complexes elucidate catalytic pathway from substrate binding and transition state stabilization through water attack and product release.
pubmed doi rcsb
molecule tags Catalytic antibody
molecule keywords IGG2A FAB FRAGMENT
total genus 52
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1997-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yegL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yegL01
2X41A 1QFUH 4A6YB 1JZ6A 4HKXB 2NY3B 1MCEA 4GAYB 1YNKH 3HC3H 43CAA 1II4E 2AS5M 5D8JL 2CLRA 2KPNA 5D96B 4U6YA 4MXWL 4G8GD 3UTSB 4F57L 1B0GA 4UT6L 5A2FA 5FK9A 3B83A 3WIHH 5H37G 2R69H 2X4OB 4LPXA 1MF2L 4TULL 4ZO7A 3UTTD 3ZTNL 3D85D 1FH5H 1W0YT 5KN5A 5A2LH 4XP1L 2F5BH 5HHXH 1WLHA 4AH2A 2IANB 1ZVSA 4JKLA 1HH9B 1OGAB 3ME0A 3ARED 1PKOA 1KPVA 1QEWB 1FYTE 5CZVL 2PYEE 5HPMB 1LE9A 2Z8SA 3VFNA 3EYQC 1FV1A 4GXUM 4NM4L 1V8HA 1EEQA 4HAFA 3GIZL 2BSTA 1TQCC 3MRKB 2ZCKH 3PWUA 4U6XA 5I1HH 2BNQA 3I6KA 5JA9A 4P2RD 1I3GL 1NFDB 4GAGL 3WJJA 4XPFH 4W6XB 5EH1A 1MFCH 4FQ2L 1DSFH 1NSNL 5BVPH 3BKJL 3SDCD 2UYLA 4LVNB 1XGRB 2VL5A 5D1QC 1K8DB 3PDDA 3MJ7B 1HIMH 4KQ3L 4LASH 5C0DB 1LNUA 3C5ZB 4CMHB 1A6ZA 1RZJL 2IALA 3AMLA 2IBBA 2R4RH 5F9AC 2W9EL 5GSVA 3ULVD 1U95B 4HC1H 5H35B 4RNRA 2W9DH 4KQ3H 4XBGB 3WJJC 4HUUA 4HS6B 4JGMA 4HFUL 2C3GA 3K1DA 2N56A 3FN9A 5EZOL 4HC1A 1U8NA 4HIIB 4M5ZL 3O2WL 5GGRA 1H5BC 1D5XA 3CC5B 1JPFA 3VFPA 4ZODA 4V1DB 4YDIL 3VFVA 4JFQA 5DD0L 4DN3L 1K8DA 2NXZC 1BVKA 5F3HA 1NCCH 2N4IA 3SOBH 1ZGLP 5I1CL 4PREB 4CVZB 1Z3GH 4PGBB 1KTKE 3QEQA 1G7QA 4LKCA 2BXYA 1U8MA 1EH9A 1JZ2A 5ECJE 4TOYL 2DN7A 1FNGA 1JNHA 4NQEB 12E8L 2DJSA 1U36A 1S9KC 4BSVA 1G9MH 4OZFB 3WJLA 3REWA 2GUOA 4GAJH 3NFPA 1ZAGA 3LPGA 4RDQG 5KVGL 3QUZD 2DWDB 1GJIA 1KTLB 1G1YA 2JLLA 4G8GB 1P9MA 3RI5K 1YQ2A 5MHSE 3FJTA 3I3EA 4M6AA 4NIKB 4HGKC 3BYTA 3LIZL 1WISA 2VLKA 5ACMA 3R8QA 3C5JB 1DANT 4KMQA 4XMPL 4ORZC 3D39A 1HHKA 2APTA 1JUFB 4PJHF 1UH3A 3ZL4H 1NCCL 4J1UB 3HB3C 1QVOA 4D0CB 4G8FB 5DD0H 5AAMA 4QCIA 3KR3L 4JDTL 3CUPA 3F7RA 2R2HA 1U92A 4YDIH 3EO0B 5C0NC 4LQFH 4Y5VA 3L5XH 1PY4A 4Y2DA 4RFEB 3FAXA 3PDOB 2F8OA 3D0LA 4G6FB 2QHLA 2AI0H 2JE8A 4U1LB 1FFNA 4LLQA 4JEGB 2O5ZH 3K8LA 3WFEL 4L29A 4JRXB 3MZGB 4PJBB 5I2IA 3K7UA 1MJJB 2NY5C 3W39B 4GRWE 1HEZB 4HT1H 5CIPH 1IL1B 5IR1B 4NZUL 5EU5A 2FX7L 3A67H 3LQAL 4XCYA 4YH6A 3ECBB 3H9HB 1HIML 4PGEA 2XKUA 5D2NB 5BOPA 1IJ9A 4ODWA 1AP2A 5JDSA 2DM7A 2FIRT 3OZ9L 2XNAA 5HXMA 4NYLB 3U6RA 2QQNH 5L2KA 1KG0B 2FBJL 1JTPA 2A6IB 2X4RA 4OUUA 5CD3B 4BH7B 3UBXG 3KPRD 4KKLD 4KI5E 2WWKO 3REVB 3UCRA 4RX4D 1DVFD 3DV4A 1JGEB 1IBGL 1KIQB 2R0LL 5ALCL 1KJVB 3MV9A 4Z9KB 3RKDD 4M61A 4JPWH 5KAQF 1OHQA 4JFFA 2QKIA 2X4TA 3HCVA 1P84K 1JRHI 5D1XA 4R7DB 3GBNL 1ZKAA 4YR6B 4U1LA 5EOQH 3PNWB 5DD3H 4XC3H 5HD8C 5M95B 1NL0H 2NCMA 2VMFA 1MOEA 3O3UN 2APWA 3WBDA 1MNUH 1CTNA 1G0DA 1G6RL 2HRLA 1PD6A 5I1JH 3QFDB 3VXUE 2EICA 5E6ID 5E1AB 4FXKB 2FCBA 3QNZA 4HF5L 2HN7B 4RAVA 4W68A 3BKCH 5CJBA 4OZFH 5GJTH 4AYFA 2PUQT 4RQQA 4I3GA 2BK8A 1F4WH 3MROB 1AGEB 5JXAL 2OJZH 4Y4HA 1MCDA 4YC2B 3L9RB 3P73A 4F33B 5KAQG 3MV9E 3LRSB 5B39G 3IDMB 4CDGC 2QEJA 4W6YB 3LS5L 4KI5C 4D9LH 3S37X 1AD0B 4W6WB 3NA9L 3MRFB 3KPSA 2O5XL 4OGYH 1PVHA 1G9NL 4ZOCA 5I76B 1ZVSB 3C5ZC 3UROR 5C2BL 1X3DA 2WUBL 4OD3L 1BQHB 5E03A 2YPLE 1BD2B 1I1CA 1NFDE 2VXTL 5ID0B 5DRXB 4X7CC 1LE9B 5K9KA 5FCSH 1Z9SA 2DKSA 4JFXA 2YS4A 3DVIA 1F90H 4GG8A 2OLDA 2OMNA 1U2CA 4ZG1A 3IVKB 1MLBB 3ARTA 1B0WA 3VXTB 3VGAB 4JFHE 3EO9L 2C7UA 2H1PH 4ZFOL 3JWDC 5M94B 3V4VL 1U8MB 1ZANL 4JFPB 4JCMA 1I3GH 1F3RB 2H9GA 4GMSH 2KZWA 1UFUA 1S3KH 3RNQB 5E9DD 1JF1A 1TJHH 3LB6D 1N0LA 1DE4A 1IAKB 1VSCA 2Q76B 4QRTA 5TGBB 1JGLH 1U3HC 3KXFE 1KV3A 5BOZG 5FO8B 4GAJL 2WINB 3ALXA 1I1FB 1LNUB 2UY6A 3C5ZA 1QLFB 3BW9A 1ZHLA 4U1IB 4XCFL 2VABA 1XGRA 2VL5B 2W65A 3D1MC 3DYOA 1E27B 4DW2L 3D39E 4XBGA 4TOYH 4AY0A 1DBML 1YNTB 4DKFL 1XR9A 2H6PA 1MCJA 5INCA 2I9LB 4J23A 1IVLA 4WTZA 2FEEI 2XZQH 4NSKA 1QSEE 1Q8MA 4DGVH 4EOWL 3PP3H 1KPRB 3QUMH 1WAAE 5ERWB 2L7UA 4Y19E 4XRCB 1JI1A 4HDIA 4PJGB 4GRLB 3VRIB 5T5FL 1LO5B 3RHWK 1U8HB 3VFOB 5HPMA 5ESAB 1PDKA 1CE1L 2VZVA 3GBLA 4GSDH 4I0PA 4U4BA 5DJ0B 5IMLB 4G80B 3T0EA 2Q8BL 4JFEE 3HB3D 5I8KL 3RNKA 1VEOA 3HPLA 3NIDE 3FHQA 1WEJL 5DFTA 4CN1A 1RZJH 3EOBA 3VD5A 3D3VD 3TBSA 4YQXH 2WINA 4H26A 1WGOA 4XNZB 4OSUL 4RAVB 4DUVA 5E6IC 5HHPA 3GSXB 1OP5H 3BH8A 4X98B 2WWMC 1YNTA 1IGCL 2Z31C 1T03L 4ODSH 1R3LB 3V5DA 4P5TB 2MPAL 5GRVK 4Z8FH 1T1XB 3HMXA 3WFBL 4HK3N 1P2CB 3LD8B 3T0VA 5INDB 3BEWA 3I85A 4JY6A 2BVPB 3MLUL 4O5LH 5CJQL 5HBBA 1VPOL 2B1AL 5EU7C 2N1KA 4UV7H 4XPBH 3QUZC 5AWNH 4I4WB 1EEYA 3MV8D 1VESA 1B88A 2AXFB 5D70L 4XHJC 4MHHI 5ID0A 3CJJA 4XMKH 2E6QA 2OP4L 1ZOXA 3QBTB 2AQ2A 2EEDA 3MUZ1 4LCCB 1BD2D 2Z0BA 1SEQH 3SGDI 1JV5B 2DOCA 2EDHA 3VI4F 3RY6A 2NMSA 3VH8A 4X4ME 3RL1A 3VXTA 3BIAX 4Z76B 1PY9A 4L8SA 3HG1A 4G8IA 2APXA 1H8SA 4PP1C 2ZSVB 2VXQH 4FQJH 2DWDA 2UUDK 3CVIL 4JY4B 4MXVE 1OP5K 4JDZB 3KPMB 5F6HI 3LQZB 1OM3H 5FAAA 4I9WE 4IHOA 2YKLL 4YBLC 1G9NC 3KXFD 1TETH 2J2ZA 1S9VB 4JKMA 4MGXA 5ICYB 4FQPA 1QBAA 4Y0GA 3L3DB 2CR3A 5DF0A 3PQYA 2Q86B 2DAVA 4JFHD 1TETL 3MJ8A 4YXKH 1KNOB 3O9WC 3V52H 2AJUH 1WAAF 4PB9H 3H42L 3KPOB 2A6DA 4TVSa 3FO2A 3KPRE 1AHWC 1QBLH 5EU6B 3ZDYF 3MLPA 5IT2L 4RRPG 5CP3H 2DQCH 3DIFB 4HIIA 1KJVA 3MV9B 5FM5O 2CKBA 4U3HA 4FZ8H 4J1UA 1ZT7B 3L3IB 2VXUL 2WIMA 2BNRE 2C26A 3KYNB 2M26A 4HUVA 3MLRL 3O9WA 3MLWH 4LCWD 3W5MA 2X4NA 2BY0A 5BQ7A 5JUEH 1F97A 3GJEB 1CK0L 1H8NA 3OB8A 4LLMB 4FZEL 1EA9C 4JO3L 3U9PH 4S11A 1DZBA 4K7FB 4OBRA 1MRFL 1E4XH 1SHMA 4JHAH 4KMTH 1I7UB 1QZ1A 2DKMA 1ORQB 4J8RB 3GMRB 4HPOH 2AAVA 2OYPA 1MIEH 3UDWA 1RK0A 4DAGH 2YPVH 5CZXC 4X5XB 3W39A 1J1XH 1MJUH 4Y4KB 4EZMA 4ZDHA 1D7FA 4UB0L 2IAMA 5HYQB 5IHZB 1IQWH 3T4AA 1G9EA 4LIQL 1BFOA 4N5UA 3QNYB 3VGAC 1PZ5A 4XWGL 4WUKH 5C0BD 1IAII 4JZNA 4QF1B 3L3JA 4X9FA 4Y89A 5TQ0L 5FA4B 2IG2L 2I07A 4OZ4A 3HAEA 1NCAH 1RZGB 1WITA 5LGJA 4TTDC 1AGFA 4RGNE 4QOKE 4PP2B 3CDFA 4WFHE 4LGSB 2EE6A 3SGEH 1OGTA 2HWZH 3C9NA 4JFDA 2ERJC 5DK2B 4ODHH 3QNXA 3HCVB 4HQQH 3VXOA 1QVOB 5LGHH 4NNYB 4D0BA 4GG6E 4I0KA 1KIQA 1RULL 2WLZA 2DMBA 4PLKC 5E8OB 1LK2B 3S5LB 2CK2A 4M48L 4RZCA 9CGTA 1MJ7L 4KV5F 2VXVL 3G5YA 5DRNA 3QRGL 1UC6A 5D1XB 1JTTA 4MCYB 3GJFK 3HI6L 4YFDB 2VL4A 3BP4B 1Q0YH 1JJUA 3T65A 1I3RB 3PGCA 5HSFA 1IAMA 5GIRB 4KRNA 4N0YL 3ZKMC 3BHBB 3P0VL 3JVGC 1YEKH 5LGHL 5DTFB 1CFBA 1IC4H 3ECBA 2R15A 4QO1A 2P8LA 4NCC1 4FQIL 2GSGA 4DGYH 1MFNA 3H9SA 4XTRD 2FB4L 2LQRA 2HJKA 3NIFF 3BKYH 3ULUF 4DKDC 3ZO0A 5JDSB 1XR9B 4QHMB 1G7QB 3RHWF 3RKDC 3UTZA 3F7YB 5INDA 4PPTA 3THML 4Y5YB 4L4VB 1WZLA 3LQMA 2PYFB 1IQWL 3O4LA 1A7NL 1A6VL 1NMBH 1JK8A 5ADOH 3LN4B 2R0ZL 4U1GB 5JQHC 1MJ8H 5MP6L 1U3ZA 4PRAA 3MR9A 3THMH 5GS2H 2XPGB 3EDEA 1KB5H 1DQQA 4NN7C 3FFCD 5J1TC 4KVCL 5C92A 3RVXC 5LQBL 1PSKH 1BVZA 2F19H 2VERN 4Y19B 4XPTL 1Q9KA 3TJEH 4XHJD 2C7UB 4OIBA 1FIGL 3E6HB 2CRYA 4CVUA 4XNQA 2A9ML 3B5HA 4HXAH 5IIEA 4OQ1A 4NKIL 3WFDH 1C5CL 3S4SA 1WQVT 1JUFA 4WW2C 4DZBB 4YK4C 1R0AL 1ITBB 3OKNB 4L9DA 5FCUH 3DUUB 4OLZL 2X4SA 1J18A 2XRAL 5EUOB 3RVUD 1LWRA 4HKJA 4X98A 1G1CA 5BVJA 1W0WB 2NY5L 3F62A 1T6VN 3GBMH 4WENB 2FWOA 3UTZB 1U95A 3KYMA 2HH0H 3QI9A 2YK1H 2GK0A 2ZPKH 4RA3A 1RULH 4NQVB 4X5WA 1EVUA 5F9OL 1B90A 2OZ4A 5I73B 4MJIB 5T5NF 4HIXH 4NNXB 4OLVH 2PW2B 3T0DA 4ORGB 1EZVY 4TSAH 1CDUA 5IQ9B 2CRMA 5DJAB 2OJEA 3FQRA 2HWZL 1JBJA 4MA7L 1J10A 2CDGA 3AFLA 3ROOB 5DD3L 4LDEB 1NPUA 5IHLB 5KTEL 5IR1A 1ZLUK 3QO1B 2Z31B 2VAJA 1Y0LB 5DD6A 2DJUA 2P8PB 2DQEL 2BRRL 1AXTH 1PSKL 2IAND 3GO1L 4U6XB 4DJMA 4Q9QL 1JMZA 3R4DA 5CBAA 1ZT4B 2ED9A 1E0OB 5J4MA 5AZ2H 2NNAB 2H3NA 1H0DB 3PWJA 4MJ2A 3HS0B 3DUUA 3CFBA 43CAB 4WY7H 3U36A 2CDEA 4WU7A 3DV4B 3AC0A 4RFNB 5DMKB 3VXMB 4RIRA 4JKWA 1AIFB 4M62H 2Y36H 5GZOC 1K6QL 3PWNA 4M7KH 1OGAE 3EYQD 4TVPD 5IFAH 4LCUB 1GC1H 1C7SA 1UJTA 3BKYL 1OTSD 5LXGH 4LARH 3QPQC 2BDNH 2VLKB 4AL8L 2PTTB 4N8VB 1JPGB 3BSZH 5C1MB 3CX5J 3FB5B 5D1ZB 3VE0A 2G60H 5HHMB 1T22B 5CHNA 3O2VH 5ILTL 1VGKB 3N0PB 1YUHA 4BZ1L 3TGXA 3OL2A 3OB0H 3ARQA 3MROA 2G5BB 4IM8A 3I3BA 4HCRH 4OAWB 4EQ2A 1G7HB 2BNQB 3MLYL 3MO1A 4GOSA 4MX7B 5LCVL 5C0EA 4HFWB 4W70A 4CRPA 5C8JA 4KRMB 1XF2A 1OP3H 3G5YB 5J13B 2AEQH 2B5IC 1YEDB 2XN9D 4NO3B 3O9WB 4PJCE 4Y4FB 1FNEB 1JNLH 2BHYA 4RWYL 4UV4L 4U2YA 2ZUQC 2BSSB 3QDJB 3S3JA 5CGYC 4RIRB 4KTEH 4K8RD 3NCEB 5F7DB 3EOAA 5DUBB 3RY6C 4DKAA 4OD1L 5EZIH 3V79C 4R4BA 4KQ4L 5DURB 2FHBA 3T1WA 4MYWB 4OGAD 4G9DA 4Y4HB 3S9DB 4NZTL 4PG2C 2J6EL 1YYLL 4I3SH 1YDPB 2NY2C 2R0ZH 4NBXB 3CXHK 2VO5A 3MOBH 4O9HH 3TZVA 5DT1H 4Z0BL 3C5ZD 2ESVD 1CGSH 2F53E 3SDDB 4PB0H 4QY8B 4UDUB 1CT8B 3TO4B 2ITCB 5C09E 4QXTB 1P7KB 3VFUA 2WLYA 3IKKA 4XMLH 3ROOA 2L0DA 1DL7L 2W0PA 2J6EA 5MP6H 4U7KA 4HWBA 1AHWA 4Q9RL 4EDXA 2EXWC 3QDGB 5C0AE 1OD7A 3O6KH 2DLHA 4QGTA 4JKPL 3K74B 4CVZA 1BFVL 1X9QA 3DWTA 2X4UB 1RZKL 3WIIH 3V6ZB 6FABH 4C83B 1C16A 1KG0A 3A6BL 1MHHB 1JNJA 1MUJB 1HXMA 4X6DA 5EZIL 2I5YH 1JNNL 1FGNL 5JTWA 4PRDA 1N8ZB 3GSVB 5DJDA 1JZ4A 5JDJA 4H8WL 2VXTH 3MRRA 1IKFL 3SKOA 2R2EB 5CKGA 5D1XC 1BQLH 2PXYD 1INQB 5GGSB 1R24B 2VABB 4HUXB 4LCUA 3RTQA 4U1SA 4GO6B 3TBVB 3RX7A 2MCPH 1UB6A 1X5HA 2VISA 4KKAC 2HTKC 5J06A 1LEGB 1NJ9A 5LBSH 2R2BA 3I6GA 2OR9L 2E27L 2VLLA 3MMEA 2DYPD 1HQRB 3PWLA 5GGTH 3QA3A 4UT9L 5BJTB 1S5HA 4OV5A 4AENB 1EJOH 1E28A 3LDBC 4PRBB 4D8PA 5BRZB 4TSCL 3HE6C 1RJYA 3RVWD 3O41B 4KPHL 5HVWA 5F7EL 1U8JB 3VRLE 3D39D 2VQUA 4HFWA 4WO4D 2EXWD 4GS7B 4Q6IC 3MV8A 4I77H 3NPSB 2XN9E 1NANI 3I6LD 1ZLSL 5C3LD 2A9NL 1YY9C 1FRGH 3GM0A 2P8LB 2WV3A 1J8HB 4I0PC 2BC4B 4I4WA 3OV6A 5L2KE 5B39A 4N0CD 1FORL 3ARFC 3K46A 4MXWH 4UB0H 5F9JA 5T1LD 5B8CA 4U6TA 5KANG 5C07B 4AENA 1NMAH 2APVA 4NJ9L 4PY8I 2VQ1B 2XYCA 5GS0D 1JYNA 5L88L 4YDLB 1DQML 3P9MB 3D3VA 3P4NA 3DI3B 3UYRL 3WN5A 2ZCLH 3MUJA 1F5WA 1AI1H 1P7QA 4YQXL 5E8EA 1RJLB 4XP6H 5AG9A 2CIIA 5FM4A 1FHGA 4JHWH 3ZYOA 2B4CH 3SDXF 1D6VH 5GHWH 1UZ6E 3OKEA 4UTAH 1QFWM 1B0GB 4JG0L 3D5OF 4UOJA 4BFIA 3MRHB 3KPSD 1KJ2H 2NY4C 2AV1A 3FT3B 1OGAD 4OFYD 2HJLA 5TH2A 4S1RH 5TDPB 2HKFL 1LP9A 2Y7QB 2F58H 2FD6L 2NTFA 2QHRH 1DANU 1L0XA 2E7CA 3QDJA 3O0RH 1OAZL 4XNYH 3PWVB 4U1KA 2UV3A 3AS3A 5IVOA 1FV1B 3RBSA 3MNZB 1PX3A 2ENYA 3SKMA 1CL7H 5E2TL 1H3PL 1EX0A 1CE6A 2NX5A 5HGHA 1BWMA 5F71A 1JGVH 2OTWA 1D5MA 3VFMA 3KPNA 4XP9L 5HGAA 5HI4D 4KROD 1VADA 1Q9WA 1IBGH 5ALCH 1GGYA 1T5XB 4QHLA 5IB3B 1WWAX 1Q9LA 3PXJA 5SX5K 4K23H 5DFWH 2XZCH 4WNQB 1OPGH 3DIFA 2YOCA 4X6CE 1A6VH 1T20B 1FGVH 4BFIB 3NCBB 2WSKA 4UIKH 4GG6A 5IW6B 3L3KB 1QSEB 4A2LA 2N7BA 3BH8B 3IDJB 4TQEL 2NY1C 3CMGA 5D5MF 3QPXL 1N5YH 3WL9B 2KQMA 2CDEB 3T77A 1ADQA 1MI5E 1IAIL 2VE6A 1TCRA 3O6FB 4KK9C 1D5XB 2PXYB 3CC5A 2H3NB 5C08D 1WAAA 3PWNB 5C0BA 2Q8BH 1LDSA 1JRHH 3S3PA 5IJVB 2XTJD 1WZKA 4WHTA 2PYEB 4WU5A 3VXMA 2OL3B 3KXFB 1ZXQA 3EHBD 1I9RL 4CVWA 4KVNH 1JP5A 1FE8H 1RUPL 4H0HB 4IRZH 2CIKA 4M7LH 1HHIB 3X14B 3W11D 5DEGB 4ZS7L 3QXDA 1X5JA 4LLWA 4NYLA 4Z7UB 3TFKC 2HRPH 4LCYB 1B4RA 5JZ7D 5IVZA 3OR7A 4QHNA 3RVVC 3O81A 1BM3L 1R3HA 3KHQA 4WCYH 5T1KA 1J0HA 3TO4D 1KN2L 1NMCC 3L5JA 3GNML 2EECA 5E1HB 4KAQL 2YWYA 2GY7B 2CKNA 2BY3A 2IPUG 2KL6A 3DURB 5E2UL 2ICWB 32C2B 4LVOB 4P46A 4MQTB 4RMSA 4XC1H 2ZG2A 4PTUB 4UBDC 3QXAB 5ADPL 3FRUA 3GB7B 4PV9A 3WXWL 2XV6B 3NVQA 2F8VA 3K4ZA 3IFOB 4G8FA 3FMGL 2I25N 3JXAA 1CDHA 1S7UB 2ADJB 3OX8B 4LSPL 3V0VB 1IQDA 2LU3A 5D1QD 2VDMH 1HILB 1P7HL 2GT9A 1NC4A 2FNBA 4BQ6A 4CNIA 4PRIE 1NCDH 1E4XL 4JHAL 5F6IB 5D2NE 1FYHB 4QF1A 3GSQA 5LJYH 1XR8B 1FH5L 2R1YA 3B3IB 2MQCA 4HPYL 4GG6F 2R69L 4XPGH 4MQ7B 5JW4N 4LF3B 1S3KL 3MACH 2FD6H 3LQAH 3A67L 2IBZX 4GBXA 4S1SH 4Z7UA 3MJ6A 4WO4A 3RWIB 3GSWB 4L4VA 1C08A 1UJ3C 3TJHD 4HLZH 4JPVL 3WFEH 1IAOB 5EFIA 5DJYB 1N64L 2D7OA 4Z76A 3BEVB 1N6QH 4BUHA 4M1CC 4E41E 3SDXA 3QZWA 3DMMB 1AE6L 4F9LC 1CDBA 5CJ5A 3E3QC 3MBXL 3OJDB 3WNPA 3JWDH 2A6JA 2SEBA 2LVCA 4GLRH 4LAJH 5IBLD 2FECI 1LP9B 3EKCA 4ORGA 3ES6A 3WO4B 4R2GB 2ERJB 1KXTB 4EI6A 1QPPA 4JFDB 5K9QI 5CJOH 5DQDL 4HH9A 2EDXA 1F4WL 1MVUB 1ZHKA 2J8UB 5DEFB 3MRBB 2B0SL 1AQKH 3QO0A 4MWFB 3ZDYE 4JPWL 1BEYH 3LDBB 3IDIB 5F88B 3TNMB 5DVNA 4CU6A 5CEZE 4P9MH 5JIHA 1HHJB 1LDPL 4J4PA 1YPZA 4WTZG 5EU7E 1FLRH 5DK2A 5D6DC 2CRZA 2OP4H 3VXSE 3REVA 4Q97A 3O8XC 3PXHA 2YUZA 4DZ8B 1NC2A 4FMFA 2VLJA 1LDPH 1T80A 3EZ8A 4XPBL 1CXLA 2R2CA 1CZ8L 1F8TH 2ORBL 2R0LH 3TT3H 5FYKH 1Y0LA 2HFGL 3SGKA 2R0KH 4G6JH 4KJPD 5J0BA 1RQ5A 4NHUA 3PWUB 3UJJH 1A6TB 2ZUYA 1EBPA 1UZ8B 2MPAH 5ESAA 1RUQH 2OBGA 2GJJA 2Z92B 2ZSVA 1FZJB 3V6ZA 1RJCA 3P77B 3ARBB 1T22A 2BOBA 2ICEB 1DFBH 4ODXB 4U0QB 4G8EA 4JM2A 5EZOH 3U9UA 1BFOB 4EVNA 1HOCA 2CXGA 2GSIA 3HC0B 3LKRB 4L9LA 4EBQL 3SGKC 1RUMH 2VLJE 3O45A 4FFVC 1X6LA 4DN4H 1BQLL 3L3OA 5DC0A 3H2WA 3PL6D 4NZUH 3RGVC 5A2JH 3BD5A 4HT1L 1RZIA 1F4XH 1ND0B 3QULA 4L8CA 1FZMB 4OZIB 1S7TA 3KLAB 2QL1A 3BISA 4PJ5A 5SX4H 4OCNC 3RPIB 4YHYC 2Z91A 3F6IA 1P4BL 1KYOK 1YA5A 5EPMA 4PBWD 3IXAB 3RVWC 1A1NA 1KGCE 4RMUA 4XAWH 2HMIC 1I8MB 2NXZB 4L4TB 3KPTA 3QUML 3SKJL 1EHLH 3T2NL 4HKBA 1CG9A 2K1MA 4U3CA 4OF7A 2VNCA 4H25B 3W11C 4KUCD 5HHOB 3VWKA 3AS1A 4TUKH 5E4EC 2E5EA 3UZEA 1NCBL 4F7CB 2DLIA 2A83A 3QB7C 3GJFA 3PIQA 3PHOB 1CICB 1AO7A 2LV4A 4ODVH 5J3HD 1T21A 5JLZB 2A6JB 4Q9CA 4M5YL 5CINL 4OLWH 1KPRA 2UYLB 5FO9B 5FYKE 4Y4FA 3FOLA 2YD3A 3NH7H 3T0EC 3N85L 1SJEA 5ADPH 1FZKB 5CCKL 3SOBL 2QSQA 3TA3D 2FJGB 2FATH 3O3EA 4YEFA 3SY0A 4XP5L 3WFZA 4YK4B 4LFHG 4ZFOA 5JNYA 4XBEL 1SEBA 3NH7L 1XR8A 2LABA 3P0YL 4WUUA 4PJDA 5JIIA 5JO5B 1MCSA 1XF5A 3E8UH 5T1KD 2V9TA 2NY0B 4K7PY 1MHCA 1NGWA 1I8MA 1HHJA 2HTLD 1E4KA 4R90L 1Y18B 1NMCB 2HJFB 2NNAA 1FBIH 1JN6B 2Y07L 4FXKA 3QAZC 2Q7YB 1JHLH 3ZKQD 3UYOD 1PW3A 3RDTA 5SV3A 4E42B 1FDLL 5DXWA 4LASL 4RBPH 3D2UA 1YEEL 1ZT7A 2XY1A 3L3IA 2VE6B 4HS8L 3PHSA 5L8JB 1DVFA 1PLGH 5BCAA 4G42B 3FAWA 1HH6B 4LEOA 1J8HE 3LEXB 1EFXB 4JM2B 2X1OA 2ESVE 4APQD 2EDOA 1KIRA 3HMXL 4DGIL 1NCWH 4GW1A 3KPQB 2PETA 4H5SB 3SE3C 1RFDH 3CK0H 5IB2B 1KTLA 2I9TA 3H8NA 4QTIL 1OP9A 3HI5L 4N1CA 2WZPD 2K7PA 3KYAA 4Z95H 1A64A 3LKRA 5DGRA 2D0FA 5L9DL 2PXYC 3U4EB 5MEND 2HJKB 3O3AA 2W60B 2H2PC 5E5MA 5HHQB 1GZPB 3MUY1 1CFSA 4IRJD 1J8KA 5F7YC 3X11B 4WFGD 3RDTC 3VCLB 2VLRB 1G7JA 3QXDB 1QSED 3KPLB 2CDGB 3AY4C 1XGYL 4OBSA 3AM8A 4LU5H 5C09B 4XP1H 2D9QB 3V7MA 4LKXB 5KVDL 4J4PD 1IEAA 5B38G 2DQDH 3AROA 1MJJA 1IGJB 3SCMC 4C54A 2YXMA 4S1QL 2VLJB 2I9TB 3DX8A 2AK4E 1FAKT 4POZC 3IDYC 5I16A 4K71B 3U0WH 4IOFC 3SO3C 3D9AL 4HKBB 2EDJA 3HC3L 3DTXA 1KLUB 4DCQB 1U8KA 1DEEA 5FUZL 4RMWA 1X4XA 3UX9B 2J4WH 4Q6YA 3RWJB 1TZHB 1FL5B 4WWKB 5DZOA 2BHUA 1OAZH 3UTQB 5K33A 3W9DB 1A1MA 4PBXA 5FF6B 1RSFA 5IBTL 1KXQE 4U1JB 3WIFB 3RY4A 5C0GB 5JW3L 4NFDA 1NAMH 4DGIH 2APBA 5DHVB 5C0ND 5BO1H 4Z0XA 4L5FH 5ICXB 2O5ZL 4MD5B 2XRAH 1G7MA 1K3IA 2F74A 3SE8H 1NGXB 4YGAB 3LHPH 1QD0A 4LSDA 4UTAL 3EO1A 4JFOA 4WWID 5KVFL 4L8DB 3JWDL 4XH2A 4JHWL 1TJGH 5DHYA 3U1SH 1F42A 3GMRA 1FIGH 3DHMA 5I1DA 3KS0J 4L3EA 4NHCL 1A3LH 5ANMA 2XA8H 2QV2A 1BVLA 5CILL 2CUHA 5C2UB 3QDMD 4XVTL 1VEMA 2H26B 4JFXB 4UBDD 4J6RH 4X7SH 5HYJA 1O7SA 3GZKA 1XGTB 2O26U 1LEIB 4S0SD 1HQ4B 1ZHBB 2NR6D 1UM6H 1XIWA 3FB8A 3BFOA 3PV7A 5CSZB 1RPQA 1UA6H 4PJAF 3LN5B 2HT2C 5CWSA 5IIEB 3SKNA 4ZAKC 1OT2A 4LLQB 1EHNA 1ZGLA 1I8LC 2WBKA 2WW8A 1EGJL 3HKFA 5C08E 4PJHB 1WBYB 4PTTB 3VXPA 4KJYB 1HILA 3L3OB 4OF8A 2D7QA 3ARPA 2YRLA 1QO3A 1KYOJ 2A6KA 3MJ8B 1T3FA 4QRUB 1ZVHA 5HJ3A 3QH3B 4HH9B 4K7PH 3QNYA 2GSIB 4JQXA 3RVTC 3FMGH 4GXVH 4FHBD 3WFCH 4R2GD 3SDCA 5L8LB 1OF2B 1YEFH 2YA1A 4X9GA 4P4KB 3KPNB 5E6IB 4PJBF 5GRXG 2YD4A 2FYYB 4PY8J 1OAYL 1RUPH 4BH7A 2X1PA 3DBXB 2D7MA 5KSAA 4NCC2 3QRGH 4P2OD 4LL9A 4RFOL 1CQYA 3U7WH 4Y2OA 5C6WH 2NTSP 4K9EC 3PJSA 2HRPL 4Y4FC 1YEIL 4G8GE 4ZYKB 3BDYH 4PG9A 2CH8A 4JFQB 3PL6B 3PGFL 3HR5A 4A6YH 3MLVL 4X9HA 1ORQA 2BP3A 1L0QA 4YWGH 3SDAC 1T2JA 1IM3B 4P5TC 2NPLX 1O0VA 3IRPX 5B3JE 1QEWA 4TUJA 1TTFA 3UTTA 2Z93A 3QIUA 5DI8A 5T3ZL 3VXNA 2A73A 4YHZL 3CDCA 3SE9L 2Q6WB 1QO3B 2A6KB 1U3YA 1A1MB 1NSNH 1P84J 5I1EL 4Q58C 4YJZL 1MFCL 4NKDA 3Q2CA 1CQKA 2JB6A 2OL3L 3NIGE 4F33A 3HLAB 3S88L 1J1XL 1T83A 2JK5B 2OZ4L 2XTJE 4QWWC 4PJBA 3PP3K 3RJQB 4JM2C 5TE6H 1ZLUH 2R2BB 5IM7A 2VXSL 4KK5D 3GSRA 2J8HA 3G6DL 4KV5E 4NQSA 1NQBA 4G6JL 4ACPA 2DDQH 4PJDE 5HDQL 4Q0XL 1MI5D 3MFGB 3ULVE 1NBVL 1NLBH 3TBVA 4JO3H 4R4ND 2N7AA 3F12A 5JHLL 3P4MB 5IESH 5IJKA 1C5DA 5HD8D 4C56D 4YHLL 5CD5D 5CKAA 2XQBL 3RA7L 5DMIL 5C07D 3HMWL 2AXGB 2BFVL 4MXVF 2X89A 3TO4C 2AXHA 1ETZB 1OTSC 3D85B 4YAQB 2DTML 4X0KA 4WV1B 5F1SA 1D5BB 1RUKL 1BX2A 3S96A 1JF6A 3WIHL 5JOFB 4OGZA 4MNGB 1AGBA 1T0NA 2F58L 1YYML 3O6FA 3PF2A 3F7VA 1CICA 2X4PA 4D94A 3DSFL 1PG7H 3I50L 4KGJA 3VFPB 3OHXA 1T3FB 5HJ3B 5B38A 2FR4B 2HLAB 2PYED 5B39B 1QTYT 1A22B 3FFCA 3QUXD 5FA3B 3QUZA 1A1OB 4DKEH 3H7BA 1B3JA 2FH8A 4G6KH 4NQSB 4MJIE 1J1OH 3OPZH 1TPXB 3LKQA 4YZFE 3NPSC 4IS6A 2QBWA 3B3IA 3BPLC 4AH2B 1S9WA 4QY8A 1UB6B 4YO0B 5BXFB 3FO2B 1CN4A 3TCXA 3WEXA 2YA0A 5ITFB 1TQBB 1QOKA 3V6OE 2W0KA 1KC5L 3IDXH 3HE6B 4M43L 3O3BB 2RAMA 3IS1X 3MREB 3GHEH 4GRWF 4NUJB 4JDZA 2Y06H 3BAEH 5DRZB 4BKLB 2XPGA 3B9KA 5DJCB 4R3SA 1VGEL 4Y16C 4FFZL 4DVRH 2H2PD 4MA1B 1MRDH 4I3RH 4HZLB 2W59A 3ZMRA 3L5WA 1A4KA 2AJVH 2CK0L 5D7SL 2F5AH 1CLOL 4PJCA 1AY1H 4Y5YA 2BMKB 4LEXH 2OI9B 3TIDB 3RU8H 1X5KA 5TH2B 1B4JH 3S34L 3L7FA 3JV4A 5MI0B 1KB9J 1Y6NR 5C0EB 1EHXA 3G5VB 1IZKA 5A3IC 3MNZA 3KPLA 1FO0A 4C4KO 4FRWA 4P2CG 1KEGH 3VFVB 1IILE 5EIVA 3CCHA 3ZE0E 5CS7A 2A1WH 4QTHB 2Y25A 4MJIA 3L9RA 2VR4A 4HD9A 5BXFA 4N9GB 3UPRB 1SJHB 5IGXL 5E24E 5DSCB 4MNQE 2UZXB 1U8NB 2CKBB 1KCLA 1IZJA 5HHOE 4QHKI 4NQEA 3FRUB 4P4KC 2ZSWA 3ZSTA 4WHCA 2DM3A 4TSAL 2Y4SA 3QA3B 4KU1A 2FEDD 3MA7A 4TSCH 3T0XA 1EJOL 2RQ8A 2PO6B 3T04D 1IEBA 2G9HA 1YEGH 1BD2E 1BIIB 1EUTA 2QTEA 1IGIH 5IVXF 2L4OA 1IAIM 4X6CA 4YHML 1X7QA 4PJFB 1GOHA 1FL5A 2Z9TA 5C0RL 2YPLA 1FCGA 2IBGA 4LBEA 1K3ZA 1FPTL 3D87B 6FABL 2H2SC 3OMZA 3QEGL 3P4LA 4Q2ZB 4D9QE 3FQRB 4P59L 4EDWH 3IJSB 4HXBL 3MXWH 2X4RB 4OUUB 3LN9A 4QXGH 4FFWC 4G8EB 3K8MA 1IKNA 1MELA 5SWSA 1AKJB 3FKUS 5GS3A 4P2RA 1RZ7H 2EEAA 4OQTH 4XH2B 3TN0C 1YMMA 3V4UL 1TZGH 4S10A 1Z9MA 3MRIA 3U0TA 1NGYA 2Q8AH 4QRPD 3U7YH 3ILPB 3QXWA 4P23B 1MWAA 3MTRA 4LPTA 4YBQD 2P8MB 2LTQC 3Q3GA 4MA3B 4XXDB 3ZE1E 4BFEA 4CMMB 4OB5L 4X99A 3OXRB 5SX5H 1MFBH 2XT1B 2R8SH 2BZDA 4D3CH 3QWQB 2V2XB 2UWEE 5GS0L 1ZK9A 4OAWA 2FEDC 4XP5H 5CAYB 1X5ZA 2AK4A 3UYPA 1OAUL 3PV6A 4L4VD 5I1AB 1UXWA 1HCFX 3N1FC 2DQHL 3VDBA 3QEUA 3TCLA 2AV1B 3FT3A 4NP4L 1I7RB 2V2TA 4IMLA 4XPAH 2VZTA 3IFOA 2OTUA 1A5FL 2CDFB 2NY6B 4OZGF 3DHJA 3NABL 4P59H 1NCBH 3Q5YA 3QEHB 3OXSA 4FQXD 2EDQA 3O6LL 4U1MB 2A38A 4R26L 3EOBB 1FO0B 3BYYA 4Z7QE 1IGFL 4U6HB 4LPWA 4ODBD 1J9CT 2YA2A 5FYKD 3O0RL 2R23B 3C09B 5I74B 5C6TL 2L7JA 1HYRC 3TVMC 2ILLA 4MX7A 3BWAB 1FC1A 4S1RL 3GUTA 2AKRA 5EOTB 4OLYL 1WZ1L 1I7ZA 3MBED 1S7TB 4OLXL 3O4LE 2VDNH 2P5WA 4PJGE 5LVEA 3VXSD 5ILTH 1IGML 1OTUD 4QTHA 5I15H 2PN5A 2PYFA 1SMOA 4FFYH 2R9HC 2EYRA 3BVNB 3OKLB 4XVUC 3UO1H 1NGPL 5H2BA 3T09A 4UI2A 3PJSB 1RZFH 3CFCL 1F4XL 1HSBA 1UT9A 3QHTC 5LCVH 2ADFH 4XP6L 3VJ6A 1EJ6A 3GFUA 4MCYA 1INEL 5DJXB 2J7LA 1I85C 2AXFA 2A1WL 1E4KC 3W9EB 3MGTA 1CF8L 1LK2A 3BWAA 1X7QB 2GK2A 3UTTB 2ESVB 4WY7L 5EDXA 4QXUL 1WBXB 3G5ZA 3BP4A 3HS0A 2FBJH 5MEQB 2XICA 3S36H 4AMKH 3BD4A 5EORH 5BZDB 4JO4L 1S8DB 4ZS6D 2FH6A 1IQDB 5J13C 5H94A 4JG1L 3UTSA 4N90D 3FFCB 1IFHH 3K0WA 1JVKA 5JW4M 2EYSA 1A14H 5J57B 2HLAA 4JO4H 2R1XB 2P8PA 3MLRH 4ZPVB 4IS6B 1UJ3B 3RFZC 3CFKB 3EYFA 5D7JA 1YPZF 4TN9A 3O11B 2OXHA 5CSGA 4KKAD 2VWEE 3B2VL 3VWKC 1ZSDB 1QSFE 4NWUL 4PJ7B 3GHEL 4R9HA 5B22A 5KOVC 1ZS8B 1CFVH 4LRIA 1SY6A 4MCZA 3WYRA 4M6NH 5IB5A 1S7XB 4XVSH 3VFWB 4LSQL 2X70A 4U31A 2WBWB 5SWZB 5GGQH 1LQSR 1FG2A 2GQHA 5KJRL 2NXYB 5CEZD 4MJ5B 1PFCA 4LQFL 4R7NB 5C6TH 3WJLC 2X4NB 5MENB 3TV3H 3RWEB 4RFEA 4MAUH 4NFBA 1LK3L 1FYTB 1ADQL 1OCWL 4RX4A 1OAXH 1OW0C 4HIXL 2CPCA 3VI3E 1A6AA 2ID5A 4MDJA 3NABH 1Q72L 4QRSB 4G43A 4R0LB 3VRJB 4F2MA 5CBEB 5DUPL 5GJSL 5FYLH 1JMXA 3S5LA 3WLBA 5IB5B 1S7QB 3NAAL 4U1IA 2VIRB 1G9MC 2GJ6D 2YPKA 3ZKND 3EO0A 4PRHE 1RZ8B 4EI5B 1BQSA 2DQGH 4WI5A 2VDQL 4FFWD 4Q9RH 1YC7A 4E41D 5EOCL 1RJZB 4WI2A 4IHOB 3HAEB 4N5ED 3CSGA 4NNXA 4L8DA 3VJ6B 3WDHA 5JHLH 1EMTL 1QLRA 4Z7VA 3C2AL 2ZUTA 3NZ8B 4WEBH 3FQTB 1TPXC 3FB7A 1CBVL 5GZND 1M4KA 5IROA 3MO1B 3WNKA 1I3UA 1NBYB 2PO6C 4ONFL 2LE9A 1A7RL 3LMJL 4PJ9B 1WCQA 4FQIH 2ESVA 4R97C 1FYTA 2DM2A 2IANE 1A6UL 1TVHA 4XCNA 4LSSH 2CGRH 3P0VH 1GGBH 1XGQA 3MXWL 3E6FB 1N0XH 4PJ8D 5I9QB 3RI5F 3TESA 1UZ8A 2P5ED 2I60H 1A9BA 5F8QC 3X14A 4UT7L 3T4YA 3OKMB 1CXHA 1BAFH 3VCLA 4XBPA 1DN0A 2A83B 5CJXA 3VMNA 4HS3B 1JNHB 3MRQA 3HZMB 4WFED 5ID1A 4NNPL 4ETQA 3MCKA 3T8XA 5C0CD 1S5IH 3NAAH 3RAJL 3IJHA 3SDXE 3WMSA 4PLJD 1IGYB 3FQTA 1P1ZA 1AGEA 1W0VB 4M1CD 1NGZB 5F9WB 3UPAA 4F7EA 2XA3A 3EYFB 5D7JB 1KCUH 1FP5A 1UKQA 1MCRA 5JIPA 4FQXC 2FHFA 1BBJA 4WW2F 5IEHA 4PTUA 1JF5A 4MAUL 4I13B 4M8VA 4F3FA 4FQ2H 4LKXA 3O4LB 3TV3L 5DMJB 3D69B 1RUAL 4NZDA 4GBXD 1XFPA 1FE8L 2D03L 3MLTA 3O3BA 4UU9A 4I9WD 2C4FU 2OR7A 5L2KD 1OD9A 2E7LC 4MD0A 5ISZA 1R5VA 3FL7A 1KULA 2IALB 3O2VL 2MWCA 1Y6MR 1HCVA 3RWHA 5ICYA 1GGBL 4FQXA 3SKOB 4DW2H 5DFVD 1F6AB 5CZVH 2Y5EA 4HPOL 5FKAA 5J6HA 2OJEB 1KCKA 2V5TA 3EGSB 4JN2A 4G6AC 3IFNH 1REIA 1U3HB 4U1NA 3T8XB 2KH2B 3DSNA 5EOCJ 3TYGH 5T1DH 4LCIH 1T4KA 1K2DA 4F7MA 1Q38A 5JUEL 4WJ5B 4NQEE 5DJYA 3LKSB 5D2NA 1WICA 2DLFL 2ZP0T 4IRSD 4P99A 4OFKA 4PJFE 3STBA 4AMKL 1U3JA 4XCYB 1G7JB 5TDNB 5C0JB 4P23A 2EXYC 2H1PL 5E8PA 1Q9OA 3O3DA 4L1DA 4NNYA 4X0KB 3EO1B 1JZ7A 4DOHB 4WDIA 5ISZD 4P46C 2YD6A 1P7QD 5E08L 1CL7I 3D69A 4MQ7A 3RU8L 4PD4J 2CO6B 4Q9QH 2OQJA 2X9XA 3GMLB 4G8IB 2FWOB 1INDL 3IETA 3K4DA 1UENA 3WUWA 1KN4H 1T7ZA 1TFHA 4A6YA 2OS7A 4EIGB 3I2CH 5I1AA 5F72S 1HNFA 5KTEH 2YMXH 3Q6GL 2K7QA 4KXZI 1VGEH 3NIFE 1IRAY 1S78C 5DHXB 3CFJB 5HDLA 4J4PC 1BHGA 4YX2L 4IRSB 4U3XA 5F6HJ 2FJFA 2KDGA 3SPVB 5HYQA 1K4CA 3MBEA 4TRPL 1MRCL 3LS5H 1BIHA 4ESKA 4L4JA 2D4FA 4FMKA 5DD6B 3QI9D 3EYUL 3GMQB 5C0AD 3WNNA 1GL4B 3LKQB 5KJRH 4NN6B 1P9MC 1ZT1A 4D0DA 2D2OA 5IBUG 2IC2A 2SEBB 4P9HH 1U6AH 2VXQL 4FQJL 3TWCL 1AR2A 1ZTXL 2HFFB 2COQA 2C1OA 2Z93B 2NY7H 5DI8B 3F58L 2EDDA 3WUWB 5EULV 1JCKA 2YD5A 4F37F 4PJ8B 2RCSL 4GT7A 3S37L 3FOLB 1NFIA 1NGQH 4XRCA 4LRIC 3MRKA 2NY3C 1JWUA 2VQ1A 5I1IH 4LNVA 1YMMB 1OM3L 5B21A 1TVBB 1DTUA 4K3HA 4GBXB 1L6XA 1FNGB 4AIZA 2D31B 2W38A 5DMGD 1S7XA 1MREL 3BOVA 4OQTA 4K8RH 5EORL 2JJTA 5TE6L 1FC2D 3O4OC 5CUSH 2C1PB 4AQ1B 2WK2A 4OZGB 5D2LB 3BRDA 5FOBA 1FJ1B 4RA0C 1RI8A 1R5WA 1J1PL 1KB5A 4RSVA 2AJZB 3TNNA 2F53B 1G84A 5L9DH 1OAKH 3DXAE 1AC0A 1KGCD 2ZUUA 1A6AB 4KDVA 1LO3L 3C60C 4YHNB 3TVMD 1QSFB 1JGEA 4I77L 3ULUH 1CU4L 1AGDA 4RNRB 5IJKC 5D96C 4NUGL 1FL6A 1IC4L 1JZ8A 3R0MA 2NX5E 3O6MH 5I9QC 1CTOA 3ZKMD 2Y06L 3BAEL 2BXZA 1J0KA 3HMXH 1W8OA 1CGWA 4HV8A 2BVEA 1FL3B 1F4AA 1NEZA 2AJXH 3FONA 2JJTC 1PKQB 4NRYA 5FOBB 3RP1A 3QPQD 1ZSDA 3DXAD 4XCCL 1ZLVH 3U4EA 4TVPE 4PLJC 2XZQL 1HHIA 2VDOL 3CPLB 3CFKA 1B2WL 1JGUH 3O6LH 3CFEB 1ZA3A 5F97E 5TE4L 2FGZA 4FG6C 1RU9L 3OKKB 4JQIL 1BZ9B 1YEIH 1MY7A 1J88A 3MCLH 1OB1A 5KSAB 4Z18A 3RWEA 4CJ1A 2NLJA 4H8WH 4JFYA 3D18B 3MV7E 5L2JB 2D9CA 4OCSL 1F6AA 1U8OB 4EXPX 2V6HA 2DQHH 4HZLA 3J8F7 1T1WB 1YC8A 5BQ7B 1CD8A 3QG7H 4PJ9A 1OAUH 4Y8DC 1GHFL 4AG4L 5FIEA 4P46B 4FQCH 1DBBH 1N26A 5CCKH 3ZT5A 5F8RC 4BZ2L 3SDYL 5GRJL 5IMMB 2NW3B 1N0XL 3TM6A 5KSUB 5FF6A 3J7HA 5SX4I 1BECA 1E28B 4PRBA 3MRGA 3GKWL 1ZANH 1XGUB 3LRHA 2YPVL 5EO9B 3QIUB 3GEWB 5EUOE 1FNFA 4JFFB 4Z78B 2WNGA 3U7YL 5D4QA 3IXTA 4PRDB 4UILH 1PZ5B 2FO1A 4M1DH 4Z7VF 5L2JA 4LVOC 4PJDB 3WUWG 1JWUB 3I6LE 3SKJH 5IEKA 1MRDL 1R24A 4HUXA 3NGBB 4IJ3B 2MKLC 2B4CC 4FG6D 5B8CB 3FZUD 1ZHNA 3ARGA 3QHZH 2VLRD 2NY4D 4M6OH 3AB0B 5BV7C 3VW3L 1N7ML 3LSOB 4KQ4H 4U6HA 5HGBA 3E6FA 2BOCA 5C9JB 3SDAB 4ZTPH 3QEQB 1SVZA 3DRTA 3WIHA 3U83A 5CD5C 3I75A 5D7JC 2D7PA 2R29L 2PNDA 3DRQA 2NZ9D 1DUZB 1A7OL 2V5RA 4HUWA 1QFOA 1T7VA 4FQXB 1AO7D 3DV6A 4KRLB 1A2YB 5BZWB 3BUYB 4APQB 2C3XA 3CH1B 3WLWC 4H88L 1A9EA 1FG9C 1ROWA 3K2UH 1ZLVK 5IB2A 1E6JH 5ANME 4PJIA 1X4YA 1A8JH 2IQAB 3KDMA 5I1KL 3RIFK 4LVHB 3HRPA 3QDGE 5C0AB 4B50A 4X7TB 2AGJH 5FO7A 2ITCA 4GKOA 3ET9F 5JPMB 2R23A 2VQTA 2PTTA 1OF2A 2AJYH 2FIKA 4NFCA 3OTTA 5F7WC 4WVRA 5IMOA 1TQBC 4AZ8A 2MQ0A 1YEDA 4U1GC 3CSYA 5JOEA 3RNQA 3OJDA 5MEOB 5FUZH 3VXUD 2Q7YA 3IAQA 3JVGA 4IRSC 5T1KB 1ODAA 2V7NB 5I1LA 3MRRB 5DR5H 3BD3A 4ELKB 5IK3A 3CH1A 3ORJA 2LFGA 4PRAB 3C8KA 2FO4B 5HI5D 2XFXB 1HXMB 4X6DB 2AJVL 2CK0H 3MV01 1Y6KR 1DUZA 4OZHB 5E8NB 1XF3A 4HZAA 4QHLB 3TZVC 2VZ3A 1VFUA 1UYWL 4BUGA 5K9QG 2QQKH 3EYSL 1BQHA 1U8PA 2H45A 5FB8A 3DYMA 5HYSA 3FOMA 3JTTB 3ZHLA 2V7HB 2P8MA 1JE6A 2BNRA 3WS6A 1U3HD 3UBXA 4TUOB 4OSUH 1DBJH 4N0UA 2D3VA 2BSRB 5D7LE 1MCOL 4PJAA 4MMXC 1I1YA 2FIKB 3FFDB 4PGCA 2VDPH 4FQ1L 1I4FB 2IPUK 2P46B 3GSRB 4LHUG 2FZ3A 3AREC 3S35X 1I7RA 2V2TB 4OCRH 1Q9LB 3UPRA 1CE1H 4GSDL 2BCKA 4Z7WB 1YN7A 5HHME 2H2SD 2P47B 1FSKC 4MA1C 5HGAB 3MLTB 2YWZA 3DETC 3EOAB 5DUBA 3QNXB 4WI9A 1FDLH 2A0LC 3RZCD 2VAAB 5EZJA 3W9EA 5AAWA 1R5IA 3DRTB 3B9VA 4QOKB 5I19H 5ENWB 4NC1C 1UM5L 3KPRB 2Z8WC 4HXAL 1ZMYA 3QZWB 1A9EB 3MXVL 4F58L 2YD7A 1RHHB 3BXNB 1LEKA 4PJCB 3ISWA 3AU1B 2XQBH 3QI9B 4KRPC 4X5WB 4X9BA 4XNUH 3E8UL 3WO4C 4HWNA 1KBGH 4XPTH 3W0WD 1O5DT 2GHWB 3WXVL 1WTGT 5JOPE 4GH7B 2GITA 3P0YH 3ILQC 2BJML 1T0NB 1NKRA 5E9DB 1JZ3A 2AEWA 3P9LB 3V4PL 4F7PB 1A3QA 1QYGH 1JPSL 2ZUWA 4LLAA 2E8YA 5HHNA 4ZUTB 3VD7A 4ZFFA 1J87A 3DYPA 3VFTB 4LU5L 5F44A 2VAAA 4NT6B 3BIBX 5BV7L 2C4FT 4M5YH 5CINH 2VISB 3CFDA 4YO0A 3UPCA 2XG4A 5C9KA 2XZZA 2X10A 2D7TH 2P4AB 4HKZB 1A7BA 2GT9B 3I3DA 3DXAA 4WHYH 2R4RL 2C3VA 2DQFB 3VXRA 5J6GA 5KSVB 3UTOA 3AGVA 4NRZA 4UAOB 1A6ZB 1NCWL 4YIQB 5GRVL 3H9ZA 4JFFE 5EU6E 4OFIA 4PJIF 5DJCA 1P4IL 1M6OA 4YC2C 4JFYB 2E9WA 5KN5B 2A74B 4GAFB 5D72L 5IB3A 1Q9KB 3M07A 3P4OA 2VUOA 1BMGA 3O45B 3G9AB 4KJQC 3D2UD 1M71B 1I8KB 3G5XA 4Y16D 2BERA 1OSZA 5DJ2A 1GC1C 4HF5H 1KJMB 4EQ3A 2XTJC 1FO0H 4V1DE 3S7GA 5IB4A 4D8PB 4ZUSA 2X89D 3INUL 1UJ3A 5C0IA 4J12A 1RVFH 4ODHL 5JO5A 1GZPA 3DARA 1I3RA 1AD9A 3QRFM 2JIXB 4NZRL 4X7EC 3TZVB 5IHBA 4OKVA 3SDYH 1RUQL 3DBXA 1UM4L 3QIUC 4N8PA 5HHMD 3QUXA 2XQYG 1KLGB 4FXLA 4NPYB 1GAFL 1F3JB 3WFHA 2CJUH 3NFNA 4U1KB 2EDRA 2PXYA 3H9SE 3WXVH 5FKPB 4JFZL 3MJ9L 1ZHLB 5D8JH 4ZPTB 3MODH 4LOUD 4ODVL 4HULB 3U46A 2AJZA 1H3PH 1S9WB 2IGFH 1UM5H 1BFTA 4KMTL 5JORA 1DP0A 2A6DB 3K2UL 2QLVB 1XGUA 3P4NB 5D7SH 4P9ML 1WSST 2F8XC 5JQ6H 1IT9L 3WE6B 5IMMA 1WC7A 4ZFOB 1B0RA 1QKZH 3IFLL 1U6AL 1CYGA 1RIVL 5EU6A 5E4IA 3HZVA 4UNUA 1FZKA 1J05A 1NDMB 1V7ML 1QRNA 4JZOA 1AH1A 4G5ZL 4JG0H 1F6FB 5DVOA 4NWTL 3IGAA 1QBLL 2UY7A 4NQCD 3QDGA 4O02H 2X70B 4PJXE 3L6FB 3MACL 5I1DB 1SJXA 1QNZH 2C1OB 2YD9A 4HJJH 4PJ7A 4XPGL 1UKTA 4KJPC 1DFBL 1S78D 2NLJB 3GI8L 1M6OB 5JHDD 1YUHB 1P6FA 1S5HB 5CJXC 4OV5B 4JPVH 2IMMA 2BY1A 3HZVB 3QDJD 2YKLH 1BFSA 3IDGB 4YDJB 1HWGB 4FXGB 4WFFD 1AR1C 2P45B 3LN5A 2QADB 3GSQB 3S8WA 2B1HH 4HW6A 4D0DB 1QFWL 5I17A 4U1MA 1CZ8H 5F89A 4KY1L 3MA7B 4JM2F 5E2UH 2DTMH 1DBAL 3GM8A 1UQSB 2YPLD 4OCSH 3AAZA 4JAMB 4LSUL 5AYQA 4NJAH 2NY3D 3IXTB 1I4FA 4UNVA 1BBJB 4NN5C 4UAOC 1RVFL 4FABL 4MNHB 2ARJB 1J5OH 3JUZA 3L3KA 2O93L 3MCLL 5DVMA 1KCRL 3CDGB 1NBVH 1NLBL 3R1GL 5D7IA 3QUXB 1D5ZA 1CXKA 2GUOB 3IETB 4AEHH 1AQKL 1OT1A 4DEPC 2NY1B 1IKNC 1DN2A 4FTVD 3NACL 2BNUA 2VH5L 4GQPH 3MRNA 1R3HB 2V5MA 4Z77A 2OTPA 1ORSB 2YHGA 3HZKB 4KVNL 4G7VL 3VGGA 1CFQB 1KN2H 1S9VA 4QRPB 3QWRD 4M5ZH 5B3JF 1C12B 2C1PA 5D7LA 5EZLA 3BDBA 2JCCB 4NDMA 3FONB 2EIDA 3MRIB 4HS8H 4YE4H 3FB5A 2YMXL 4Y1AB 1BJ1H 3FQXB 2AV7B 2HTKD 4EDXB 1G7PA 3M8OL 5HTSA 1CIDA 4Y1AE 3MLVH 2FLRT 3NIGF 1N6QL 4ZTPL 3UJIH 2F9BT 3JV6A 2HFFA 3PWVA 1VCAA 1N7MH 2EDBA 1U8IA 1G7MB 2F74B 4UIKL 2ADIB 5LWYH 2D7NA 5IFHL 1EAJA 5BV7H 3C60A 4GAGH 3TCLB 4HX1B 1KF9B 5E99H 2HP4A 1P6AB 2DYPA 1VKXA 1OAYH 4J3OC 2O61B 1N59B 2BSSA 5HHNB 1MLCA 4U33A 2LU4A 1H15B 4H1LA 2ORBH 2GTWB 4ZO6A 2ZOKA 2HMID 2H32A 4PJ5D 4ZS6C 4X6BA 1CXFA 2M8XA 2EDKA 4RGMB 3ES6B 4K7PL 3VFSB 4Z7WF 4J7RA 3QCVL 4KXZH 3H9YA 3PGDB 4LSPH 1JWSB 5I1IL 1JFQH 2IAMB 2ICEA 4ONOA 4ZFGH 5J11C 3EJYD 5AUMB 1SM3L 3SE3A 1YYLH 1RHHA 5AD0A 2FJHA 3ZE0F 4MB4A 3FQUB 1A3RH 1HKLH 2BVOB 1MAML 1UB5B 2QQLH 2D03H 4P46D 1IM9B 5DK0B 2B2XL 3LV3A 3LKSA 1BPVA 3JTTA 3WNMA 1FAIL 4AIZB 3A6CH 4X7DC 2CUIA 4UV4H 4P57A 3TO4A 2NY1D 2UVEA 4TRPH 3BPCB 5EBWB 4DZ8A 4D0BB 4UQ3B 5KS9F 3ALPA 3LS4H 2ZCHH 4KHTL 4WTXA 43C9B 3QUYD 3DGGA 1TZHA 3RRQA 1MCWM 3D0LB 1YEHH 4U6VL 5A2IH 1RUML 1QSEA 4KKBD 2GTWA 5ICZB 5FHBL 2ZKHL 3C08H 4WW2A 1BAFL 3ZYZA 4F7TB 2E6JA 1H3VA 3ARXA 4OLUL 1OARH 4LPYA 3DX8B 1YMHB 5IHUH 3ARZA 5E1AA 2CD0A 2R0WL 3O3EB 2IH3B 3DX7A 3BSZL 1CWVA 3HRZA 4HWBH 4K3GA 4HMEA 1DUYB 3RTQB 5JPMA 4NKMA 4Y19A 1DEEB 1Q0XH 5LXGL 1N5YL 4XB7A 4BQCA 4HIHB 2CLZA 2Z8VC 4NC2B 5KSBA 4PLKD 4YEEA 5DD5H 1TVHB 3U6RB 3D0VA 4KHXL 4ODXA 4N1HB 1CGTA 4GW4B 4D9QD 3EDFA 4ETYA 5DZLA 3PE9A 4PJGA 2UWEF 2IPKA 2XZCL 4I48A 1NGZA 5AZ2L 5JR1L 1U9KA 2AERT 4KPHH 3M1BA 4JANA 4JR9L 4WI8A 4CAGA 4PR5A 5K9KB 1LD9A 1P69B 1T7YA 2ICES 4PYGA 2FSEA 4K7PX 2YBRB 3MNWB 4R96A 2DQDL 1BEYL 4MNHA 2V2WA 3BH9B 5DJ8A 5K9OB 1YJDH 4YPGB 1AFVH 1EFXA 3HLAA 4LF3A 4JRXA 1OSPH 4MSWA 1YJDC 4PGBA 3EYVA 4MAYD 4O2CB 4C56B 2ADFL 4M3KB 4KK8C 2QSCL 2NY0D 4TSBH 1F6LL 2VSCA 3SDDD 4TNVK 3KNBA 1AO7B 5JMRA 1W72B 4D9RD 3C5SB 4NM8L 1IGTA 4EN3C 5AD0B 3GMPB 5HVGB 2OSLA 2X4SB 3IRZA 4KFZC 3TYFB 2V17L 3GSXA 5I2IB 1S7UA 2ADJA 5E56A 3E1F1 4XNYL 5C07E 5KSVA 1K85A 4U1HB 4P5TD 4HGMA 5FUOH 1NFKA 2FX7H 2YC1B 5GGQL 4Z78A 1T66C 1KB5B 3PDGA 4WFFE 5I75C 4GG6B 3QP3A 3KPOA 4HK3J 3KPPA 3OAZK 4MQSB 1I9RH 4LCWB 1IEAB 4JE4B 3EYVB 4O2CA 1XF4B 2DS4A 5GGVL 1D6VL 5D6DA 4JRWA 4N9OB 1OVZA 4PBVC 4RGNB 3P11H 2DI7A 2PR4H 2P43B 4LSSL 5E4EB 5HI4C 4L8BB 1SYVB 3ZE1F 3MUGA 4F15B 5C0JA 1H8OA 4FTVA 4FQQB 4HDIB 1FQ9C 5JHDA 1G7IA 4HPYH 3MGOA 1IFHL 4JFFD 1FGNH 4PJ7E 3H6JA 2NXZD 4UILL 5I8OL 1KXVC 5C70A 5C8JB 1TVDA 4I1NB 2GFBB 1DQLH 2JB5H 4YHOH 5D93C 1MQKH 4UDTB 3AU1A 2WUCH 5DJ6A 4R3SB 3MA9H 1MFBL 3MOBL 4O9HL 1FORH 1OPGL 4I3SL 5DC4B 1KENL 5JMOC 4K23L 1C12A 5D9SB 3GMOA 4M00A 4PRPD 2YRZA 3P0GB 3U4BL 4U0RC 3H3PL 1FNLA 1KPUA 3BE1H 3QG7L 2Q8AL 3BI9X 4JGJA 3O2DL 3RGVB 3N85H 3QQNA 2DTSA 1GGCL 5I74C 3CFCH 3IF1B 5I17B 3HNTL 4I2XE 2GW5A 1UEYA 4ZFZB 3DNKA 5EUOF 1T1XA 3CXDH 3QUXC 1CL7L 3O8XA 1AGDB 4N0RA 2EO1A 1YPZB 1LGVA 3MLXL 4JRXE 4X4XA 3GI9L 5E00B 2NY6C 4X99B 5J7CC 5FGSA 1J0ZA 4ELMB 3BWUC 5T5NG 4Q6IA 4GRLA 2XWTA 3VXQB 1TJIH 3QIWA 3VRLF 3U48A 5BS0B 3ZKSD 4R7NA 1XIWB 3FB8B 4ZAKA 3BZFB 4C56A 1ND0A 3SGJA 3CD4A 2Z31D 4BZ1H 3TIEA 1UEMA 3QXUA 3STLB 4HEPG 4XVSL 4ELMF 4OF6A 3C87A 4RGMC 4K3DL 3L7EB 2DBLH 3OQ3B 4F7MB 3R06B 4HQQL 1XGPB 1TENA 1F58H 4WFEE 5IJVA 3MOAL 3TH3T 1EO5A 5D7LB 5EZLB 4GRLC 1GGCH 2NY0C 5TPWH 2X42A 3OXSB 3QJHB 5CEZH 1WIOA 3TF7C 3ZDZF 4K8RC 4AEIL 1CICD 1D3CA 4MB3A 1G7LA 2NYYC 4JB9H 1RK1A 3MZTA 4XVUD 2XWTB 3VWKB 3PGDA 3NN8B 4QOKD 1QQDA 4K94H 1BFVH 5D1QA 5DHVA 1CD1A 5GGRY 5INCB 1DEDA 1NMAL 1A6UH 4QXUH 1RJZA 1UYWH 5GRZA 5MEQA 3ULVF 4ZD3L 1B4JL 1MVUA 4JN1L 1U92B 2EH8L 4X6DF 2X44D 1MCFA 1LO2L 5K59F 3V4UH 4I5BB 4MS8C 2VSDA 4MB5A 7FABL 4YHKL 1GGIL 4I0PB 2P48B 4UNTA 2ADIA 2YBRA 5I18H 5HVFB 5DR5L 5EOCH 4P2OA 3BP7B 4WWKC 1M7DA 3KPSE 3QO0B 3C60D 2HVJA 1FLRL 2J6EH 3I6KB 5FYJU 4JO2L 4ZYKA 4JFPA 3FTGB 3UJTH 3HHRB 4M43H 3KG5A 4MZ3A 3CVHL 5FGCB 3RWCB 3QHFH 5L7XH 1AXTL 4P9HL 2DQEH 4U05A 5LAXB 3RGVD 1S7WA 1YEGL 2Z4QB 3L5WB 4QHMA 1PG7X 1XZ0B 5ICXA 3HRZB 4CW1A 1FZOA 1OCWH 1ADQH 2GK0B 5FHAH 5DYOB 1MSPA 2FRGP 3U79A 4LCWA 4N0FA 4HIJB 4GKZA 2HH0L 4MJ6B 1C5DB 15C8H 3T3MF 1I75A 4IIQA 3DSFH 4X6CF 2J3SA 3BW9B 3VGEA 2XZAL 5EIIA 5JA8B 2X4TB 1JNNH 3T0AA 1EEUA 3MRDB 3UJTL 3VW3H 5T1MB 3DLQR 5I0ZA 3RPIA 1XCTA 3G6JE 3BQUC 5TF0A 5DHVH 4KKCC 3WFDL 3F7PC 5CBAB 1MJ8L 4HUNB 2ICWA 32C2A 3NOIA 4L4TA 4MAYA 4XMKL 2YSSA 3KNBB 3CSPA 3TT1L 1AGCB 3OHXB 3M17B 4NC1E 2F19L 4LRNL 4UV7L 4GLRI 2IPTH 4QRSA 3MJ7A 3RZWA 4JG1H 3V0AC 5D7KD 4NRZB 3KWWA 2G9HB 5HDQH 4H26B 2PW1A 2DQTL 5E5RB 3G6DH 1M7XA 4G8GA 4HWZA 1MPAH 1SYSA 4DUWA 4BQ8A 3LH2L 3DUSB 1BBDL 5IB4B 3L3JB 4Z7OF 1PG7W 2E8ZA 5I76A 5IHUL 4MAYC 1MHEA 3H3BC 3NN8A 4F15C 3RZCC 4GW4A 5K59E 4N8CH 3HG1E 4M6ML 4L4TE 3RTQC 4Q2ZA 4OFDA 1EXUB 2DD8L 3ZYJA 4CADB 5DEZA 2Y1VA 5KZCB 1Q9WB 2MJWA 3MRJB 3U7AA 3VWKD 1YEHL 2FLBT 4U6VH 3CAFA 5FO9A 1J1OL 3S35L 1ORSA 1HHHA 1S7SB 2GY5A 3HZKA 3HFML 1RZFL 5I8EB 3CNKA 1KPVB 2NY2D 4R97B 1UH4A 2Q3ZA 4KHTH 1ACYL 3P9LA 4UQ2B 4QT5B 4NOBA 3FN0L 1MFDH 2X7LB 3U30B 3DECA 5FO7B 3LCYA 4ZOEA 2ITDA 1LE5A 1QLRB 4K3JL 5CGYD 5C0FA 2Y7QA 1KFAL 1A4KB 4IBLT 2I5YL 1NJ9B 4U1HA 4GMTH 4TUJB 1MAMH 4EI6B 3GDBA 4EI5C 4OLZH 4M6MH 1IGTB 3T2QA 4M93C 1BGXH 4BH8A 4PGEB 5I8EA 1WBZA 2MMXA 3NFPB 3IDJA 1W0VA 4BA8A 5IQ7L 1T1ZB 1R6VA 4OI7A 4MNGA 4PJEE 1QA9A 2QSTA 3T3PE 4JPIB 4MNGE 4PJEA 3VFMB 4MZ2A 5HYSB 4CW1B 4DK3A 4KVCH 3HZMA 5ID1B 4JZNB 4R0LC 2IEPA 1OY3B 3KLDA 5EBMA 8FABA 1MRFH 4OCXH 1OAKL 4DWHA 5H37H 1RIHH 3T0EE 1S7VB 2ED8A 1CGXA 1G7IB 1F4YL 5EO1B 3JBG7 4RRPA 3U0PA 4F7PA 5E8DL 3QUYB 4WO4B 1A6WH 2OM5A 4PRPB 1UWGL 2DQGL 4L8BA 4WEUD 1I7ZB 4TUOA 3EOYG 4YAQA 3B9EA 2JB5L 4YHOL 5ELIA 1JYVA 1FFNB 1VA9A 2HVJB 2XKSA 4Z5RA 4EUPA 3B4NA 1TZGL 1Z6JT 2XTJB 5F96H 3HE6A 2VDKH 4GRWB 5IEKB 3QFJB 4X6EA 1J0YA 4HKZA 3OKDB 4LFHD 2A0LD 2BMKA 3O8XD 4Z7OE 5IQ7H 4R2GC 4P5MA 4RQQB 4RWYH 2EDEA 4G6KL 5JIKA 4ZPVA 3Q48A 5GGVH 2VTFA 5FA3A 1DLHA 2YD2A 4PRPA 4JJ5A 3EAKA 4CNIB 4L5FL 3GSNL 1MCWW 1XMWA 2F53D 5AZEL 4HMCA 3DTXB 1NC4D 4PRID 5F7MC 5JXAH 3IU3A 3RUGE 1MAJA 5DK3A 2NW3A 3TT3L 3IF1A 1QR4A 2P44B 1QACA 5SWZA 3SKUD 5HHOD 1QBMH 3BXNA 3GSNH 1MCPH 4M61B 1RUKH 4JREB 3MV7A 1IC5L 5TDNA 1I9IL 2YR3A 3MUGB 1GVIA 3L1OL 4ZUTA 1HHHB 2B4CL 3HPLB 3C6LD 4G7YL 4I18A 4NHUB 4NQCB 5EC2A 3L7EA 3CDYA 3BO8B 1K6QH 3BEVA 3RY5A 5D7IE 5AWNL 2ZCLL 2GFBA 2IG2H 3TIEB 4MAYB 5F96L 2FEEL 4FP8H 4UMGA 1C16B 5IW3A 2CLVA 3N1GC 4YDVB 3IU3B 4JFOB 3QIWC 5MEOA 5E5UB 1LE5B 4QHUA 1NAMA 1J8HA 1RV6X 2VXSH 4ZD3H 5DJZB 4E41B 4Y1AD 1CGYA 2VZUA 4I0CC 4WU7B 1VACB 3ULSB 1HEZA 2KBGA 2PW1B 3AREA 2DRUA 5JHDE 1QPXA 4PGCB 2DQTH 5E8DH 3V6BR 2IH3A 4U49A 1KIUA 3BQUB 3EDKA 5CWSB 4PGZA 2BVPA 3TNNB 1P4LA 2WANA 1N2RB 5EIQA 1Q94A 1T04A 8CGTA 3TT1H 2P24B 4AEIH 4MSWB 1PEWA 1RZIB 1BQUA 5J3HC 2RB8A 3VXPB 3WFBH 3RPKA 2DI8A 1EXUA 4KTYA 4YHPA 3KJ6H 3TO2A 3O9WD 3QH3A 2DIAA 2DBLL 4X7TA 1OAQL 1KLUA 3PP4H 4G5ZH 2FL5A 1OARL 1UXSA 4X8XA 1WV7T 1ERNA 4I48B 3TJHC 3ZYIA 5KG9B 1T89C 2HVKA 2XZAH 1FFOA 2AK4B 3GIVA 1PEZA 4GMTL 2Q7NA 5LBSL 2AJUL 1S9XA 5D6CB 4UIMB 5FDYA 5AZEH 4FA8A 5HI3C 3L6FA 3U2SA 5IWLC 3LS4L 5FHAL 4KUCF 4AT6A 5GGUA 4LLWB 2CKBH 4MD4A 1DBMH 4YFLF 4LLYA 1R3IL 1NANH 2Z35A 2O5YH 5AUMA 5FOJA 3WD5L 3QQ9D 4M7ZC 3ZHDA 3H9SD 4BH8B 1HKFA 3CVIH 4JM4H 5HGGS 4NP4H 5SWSB 5JPNB 4NN5B 4X7FC 4S1QH 3C2SA 1KB5L 2QQLL 1WUNT 4NQTA 4YFLI 4IIQB 2APFA 1N5AB 5F70A 3RUGA 2DM4A 4XCEA 4O2EB 3O6KL 1UA6L 5FM8A 4N8VA 1LEGA 3N1PC 2B5IB 3V4VH 1F4YH 4XXCC 1FL3A 1X44A 1QRKA 2XQYK 3EFFA 1U58B 1A7RH 1I1YB 3N1MC 3EFDL 1QP1A 1YMHA 4NO0B 4AJ0A 3PV6B 4BSWA 5DGQA 2GJ6A 3NCJH 1Z3GL 4ZFFB 3KLAA 1S7SA 3ZT7A 3IYLW 5BV7B 3EJYC 4CL7A 4R7DA 3HI5H 2FB4H 5DJXA 5CILH 3AMKA 5CIPA 2GJ6E 5D1ZD 2PW2A 4MDJB 1PJ9A 3HG1B 4W81A 5DJ0A 1L0YA 3BIKA 5HY9A 1U8PB 1L7IL 1V3LA 3HUJF 4DUXA 2VLKD 2WWKT 4EDWL 1P53A 4V1DD 4F9PC 4NZTH 2HYMA 4QHUB 1A0QL 4OJFH 4ERSL 2IAMC 4HFUH 1V3JA 3DUSA 3QDME 3GHBH 4N90E 3QDHA 4NQDD 3JWOH 4AEFA 5C9JA 3IDNA 4MA8L 4OD1H 2W60A 5E5MB 2OJZL 3NFSL 4YHMH 2AKRB 4JPKL 4M48H 5EOTA 1IGIL 1VERA 4PB9L 2DJ4A 3ARDA 3PGFH 3FO1B 2ARWA 5FYLL 1V7NH 3QUYC 3ZLQC 1CDJA 2Y07H 5FGBA 5IB1B 5F7HA 2ADGB 3EJJX 2A77L 1G9NH 1X5IA 2OK0L 3X11A 4F8TA 3MNVB 1QSFA 3BPOB 1HXYA 1U58A 5EBLA 2DQUH 2EXYD 4K9EL 5D1ZA 3VE0B 2NZ9C 1OP3K 4KK5C 4KWUA 1JN6A 2CO7B 3JWOC 2MOVA 3NZ8A 2DD8H 3TYFA 2XY2A 5TQ0H 3CDGA 3VWJB 1NH6A 2HFGH 1CFVL 1M7IB 5F93C 4DKFH 5KVEH 5IF0A 3ZE2E 4PJIE 2VDRL 3QIBD 4UDTA 3V8OA 4GXVL 3QWOB 1BBDH 5DURD 2EKJA 3HPJA 3X13A 4AM0A 3MBEC 2HT4C 4X4YA 1JPST 3CPLA 3B8SA 2AEPL 5IKCA 1OWWA 2X1WL 3H9SB 1RK0B 2F5BL 1VACA 1DN0B 4XX1G 3WFHB 3SDAA 4C83A 2J1KA 4LRNH 4PJFF 2BSED 4ODTL 1ZEAL 1D5MB 4L9LC 1JWMA 5F1NB 4X5LA 1AKJD 1NAKH 3VG0L 2DLTA 1SEBB 3IJHB 5T1LB 4ODUA 5CSBA 2JKXA 3UTTE 1F2QA 4TPRL 4J3TA 1FZJA 1KACB 3U0PB 4CGTA 4MHHG 4PJBE 3T1FB 2DQCL 3CSYB 3PABA 2C3HA 1INEH 2IMNA 4DOHE 3O3AB 1YY8B 5ACZA 2DMCA 4I5BA 1KPUB 1F11B 3UP1A 1GOGA 1QFPA 1DBKH 1I8LA 1QLEH 2FGWH 3ZDZE 3ARSA 3IU4L 5I1GH 4XT1C 1U3HA 4YR6A 3C6SB 3PWPA 3BP7A 4GFTB 4OLVL 5D71H 4OCWL 2DYPB 4NZJA 5BO1L 4E0RA 1J0IA 4FNLH 3X3GH 1BJ8A 5F7FA 5B8CC 5J56B 3ABZA 1FFPA 5EU4B 3ULUE 5JW3H 1CI5A 3V7AG 1FAIH 1N3NB 3CVHB 4P2OC 4JAMA 3ARWA 4ZPTA 3LZFH 3H7BB 3PABB 3TVMA 3FO0L 2R0KL 3TBWA 5CLWA 5F7NC 1NAKL 3VG0H 4JVPA 1ZHKB 2J8UA 2EC8A 5E8PB 3IJYB 1T7WA 4W4OA 1HHGA 2HKHL 4N0UB 2IAMD 1R0AH 2ADGA 4P9HC 1DQJA 4G6MH 3UZQA 1NCDL 1QSVA 1TTGA 3CXDL 4R8WL 3NCYS 2I27N 3QCVH 3KPSB 4OFYA 4CU7A 1OSPL 1SBSL 4WDIB 3KLHC 5IVZB 1N8ZA 1L9MA 3BKMH 4RISH 2MKWA 3N50A 1TZIA 5DHYB 4P4RA 2NY4B 4QRPA 3WXWH 2V5SA 1J05B 1NDMA 1YEJH 3PWPD 1TITA 4O5LL 5E9DA 5TF1L 4TTGA 2DDQL 5T3XE 3W2DL 5AYUH 7CGTA 4KH2A 4GS7C 3RX8A 3WS3B 1EHLL 4IOFD 1IGCH 2BSTB 2PF6A 5HYSG 3MGOB 3NCFB 1WIPA 4IIQC 1I7TB 4MLSA 5EO0B 3FQNA 4ODWB 2VZ1A 2EEBA 4KHXH 5DQJB 2IADB 1V5JA 3K8KA 3TZVD 3OKMA 1MCQA 5E7FA 5FKAB 1CLYL 5IV2B 5KZCD 2BVQA 1AIFA 5EU5B 1I3VA 3HR6A 5CEZL 4PJ9C 3SQOL 5GSRB 5TPWL 5CMAA 3M17A 4P5MB 4KUZL 1WFTA 4QLRA 4GRMA 3TLRA 3TBSB 2JB6B 5FUCE 3FO9A 3VGBA 4OZIF 4MA8H 3N9GL 3DI2B 3WKML 1YDPA 5FK9B 3C5JA 3I02A 1OTUC 4M6OL 5CLTA 2O5XH 4OGYL 4EKXA 2W9LA 4GKNA 2A6IA 5I6XB 3NA9H 5EN2B 5D93B 2Q20A 3T0ED 4OZ4B 2VUYA 4IMLB 4D9LL 1T4KB 4PJXF 3U7WL 1ZGLB 4R4FH 3HUJA 3KJ4C 2WQRA 3EBAA 1K4DB 2OQJB 3MNVA 2EH7L 5KSAD 3NACH 1MJ7H 3WHE1 2X40A 4MNQA 1ZGLM 3ZKXB 4JVUA 1V3KA 3GI9H 2DQJH 3I75B 1KJMA 4ELME 1FBIL 1YZZA 1CDGA 3MLXH 5L6YL 3VD4A 2D7TL 2XXMB 4JRYD 4O00A 2FX9L 4F9PA 5K9JH 5HYFA 1QBBA 1YY8A 4NN7B 5A40E 3N1QC 3CFDB 2NYYD 3VFOA 4LKCB 2YUVA 3NBNA 3LIZH 3LV3B 4NQUA 4DFIA 3QWOA 5JLZA 1ZT1B 4PUBL 1CXIA 2FATL 1QYGL 4J8RA 4L8SB 3PGCB 4TULH 1QFWH 1CCZA 4PJHA 4PTTA 4GUPB 5JW5A 2OL3A 3KXFA 3OAUH 3FCTB 1M71A 3KHOA 4YHIB 1MHPH 2B20A 5F1NA 1LEKB 1PX4A 1WZMA 3DVNB 4YZFF 12E8H 1N5AA 5DEFA 3EOTL 2XKNB 1DQLL 3QDMB 5A16B 5C71A 4LAQH 4NO5A 1VHPA 1T1ZA 1Q94B 3V95A 5IUSA 5I8OH 5I19L 2IQ9H 2DQJL 2PO6D 3I9GL 1JGUL 4JRYA 4UOW0 3BMWA 3FO1A 3TN0A 3GSUA 4KI5D 1CS6A 3OR7B 4QHNB 1Q0XL 2EYSB 3DJ9A 3KYOB 1MY5A 2R9HD 3SQBA 3K2MC 4OTXL 5J8OA 4XAWL 5EO1A 3X3GL 5KS9A 3VMPA 1P4BH 3VXRE 4OCRL 3BPLB 3DGGB 3FFCE 5T3XH 1NGXA 4Y2DD 4OLUH 1RD6A 3L3GA 2WP3T 2FGWL 1G7PB 2ZOLB 3VH8B 4L1HA 3S5LG 1QKZL 3IFLH 5F1IA 1GPOL 4WWKD 5GJTL 4PRNB 2QQQA 4K2UL 4MJ5A 5DD1L 4ZSOE 4JY4A 3BHBA 4YE4L 3G6AA 4K7FA 1ETZA 3D85A 3B5TA 4NM8H 3OR6A 5D2NC 5CZKA 4NQVA 2X1QA 5ALBL 4ZSOB 5T1LA 3BZ4B 4PY7B 3LRSA 2P7TB 3A6CL 4Z7WA 4OM1L 4HIHA 1HDMB 2AXJA 4JY5L 3NCMA 3R1GH 4F3FB 3SGJC 4KDTC 1F8TL 3MRDA 5GZNC 2Y5TA 4RGOH 4X6BB 4RISL 1J5OL 3MV9D 3CUPB 4GG8B 4OM1H 2IJ0C 3O8XB 2QQNL 3OF6D 4NBYB 1NUDA 4QRRB 2AEPH 4UTBH 5IVXE 1MCIA 4PJXA 3UBXB 4BSWB 1H3UA 5IFJA 2X7LA 5IESL 3TN0D 1CDIA 2DMKA 1WBXA 1HZHL 2QADC 2B1HL 4K2UH 4EUPB 4J3VA 2KUTA 3SBWC 2CDFA 1MH5A 3QYCA 1G6VK 1EVTC 3ARBA 2OR9H 4U1NB 5E99L 4MLIA 5E95B 3QJHA 3GMNB 4KC3B 4P57B 3WUZA 2I26N 1CFQA 1NKOA 4WUUB 1S7VA 1UXSB 3VGHA 5HGHB 1GYAA 1BOGA 4OTXH 2EO9A 4MDIB 4ENEC 4DFHA 4YUEH 5F7LB 4KJQD 3V5HB 4LCCA 4NRXB 2RHEA 4P3DB 3G08B 4GBXC 4Z7VE 4O02L 5CP7A 1PQZB 2G2RB 3M8OH 5JORB 4P23C 4OD2A 3K1KC 4WI3A 1EEYB 5I8KH 3U0TB 1PKQE 4YNYB 1M05B 3B2UC 5GRUL 5D7IF 3TN0B 1QRNB 3QEQD 2ENSA 5GXBB 5GGTA 5BVPL 4PJAE 5D1XD 2C9AA 3C6LB 4JKPH 4DEPB 5BRZE 1U8KB 5IG7B 1I7TA 5EO0A 5KSAC 1WFNA 4HGWB 4ZFZA 1MEXH 2XWBA 1QSFD 2NTFB 4MJID 3MLSL 3Q6FB 1ZEAH 2ZCKL 1WWCA 1C5BL 4RGND 5EA0L 4Y5XA 2GCYA 4POUB 4LBEB 2J8UF 4OI9A 4L8SC 4M1GL 3IAPA 5E2JA 2BVYA 5GSRA 4E0RB 4LSTH 2IWGA 3EOTH 4LLUB 3UBXI 3DETD 1JGVL 2AP2A 3MRGB 4YNYA 4AEEA 2BOCB 3GKWH 2JCCA 4NDMB 4ZXBD 3IT8D 4OUOA 2FX9H 1GRWA 4OZFG 4HIEB 4I2XA 1L7TL 3DMMA 4K3EH 2OX5A 4M1GH 1K9TA 1D9KC 1I1AC 1FZOB 5DJDB 4TUKL 4E5XA 4PV8B 1TNMA 2BVOA 4HLJA 1KELL 5JPNA 1TJHL 4DN3H 3LEYL 2B8OT 1CDCA 3OKLA 1YPZE 4NC0B 2MCG1 1NGYB 3O11A 4LLVA 2EKSA 4DVBA 2HKFH 4LVEA 1XCQA 3CX2A 1I9JL 3O2WH 2ZZUT 3MJGX 1YNKL 4J3UA 1QFHA 3KYOA 2OK0H 2EDLA 4FNLL 5K9JL 2A77H 4G6FD 1AHWB 4JFDE 4N0CC 4OCWH 2LVEA 3IXAA 3X17A 3HC4L 1FO0L 2JJVA 1KCUL 3HI1B 3B8YA 1NFDF 1NCTA 1U8JA 1UQSA 4JLRA 1B2WH 4KROC 5FDWA 3CXHJ 1ZA6B 3GIVB 4ZNCD 1UACH 3CLEL 4NHCH 5BJTA 5IROC 4XCCH 5JZ7C 3BGFB 1CFNB 1SJVA 2P5EE 3JWOL 3BZEA 3PNWA 1KEML 1T1YB 5CEXB 3RVUC 4ALAH 4ERSH 1IAKA 2Q76A 3VRJA 1DQMH 4F2MB 2YEZB 5HPOA 5D9SA 2JIXA 2BVQB 3QFDA 4ZUVB 1H0DA 3N9GH 3PWJB 4TPRH 2DI9A 1UXWB 3LH2H 2XTLA 3LMJH 3ROLA 4QRQB 4CBPA 3ULUL 3BKCL 3W5NA 5CEYA 3TPKA 1QQDB 4XB8A 4MDIA 5FYKL 2Q86A 4TQEH 3SY0B 4NM4H 4ZTOH 1Z2KA 4NQXB 4R4NC 3MRMB 1P7QB 4OM0L 5BMFH 4CMMA 1NL0L 4Z0BH 5J1AB 3DROB 4Y5VC 4EIZC 4LMQE 1FCCA 2M1KA 3UAJC 3B9KC 4KKLC 3LKPB 3MODL 5CUSL 5DS8A 5DJAA 3QIWB 1IC1A 5D5ME 4NSKB 3D3VE 5AYUL 4G80A 3WDIA 1OL0A 3SJVE 5TF1H 4UT6H 4KI5F 4Y5XB 2DQFA 1MCLA 2B0SH 2CMRL 5C0CB 3D48R