1YEGL

Structure of igg2a fab fragment (d2.3) complexed with reaction product
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
219
structure length
219
Chain Sequence
DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIHLVSKLDSGVPDRITGSGSGTDFTLKISRVEAADLGVYYCVQGTHFPYTFGGGTKLEILRGDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A FAB FRAGMENT
publication title X-ray structures of a hydrolytic antibody and of complexes elucidate catalytic pathway from substrate binding and transition state stabilization through water attack and product release.
pubmed doi rcsb
molecule tags Catalytic antibody
total genus 52
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1997-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yegL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yegL01
2YPLB 4OF3A 2IH1B 4PYHA 4JVUA 1FZJB 3U46A 2WBKA 1NGPL 2WWKO 1XH3B 3RWFB 4JFYB 4POZD 5HHOD 2NZ9D 3ARBC 4J1UB 4LCIL 4FFVC 4X5XB 3MOBL 4D9RE 4KKCC 4LGRB 2YUZA 3HNTH 4X8JB 4GRWE 5IMOA 2WZPD 4XAWH 3GIZH 2R29L 4OKDA 3U83A 1U92B 4PJ8B 1QVOA 3ULVC 3QDJE 1ORQB 3BKML 1M6OA 1GAFH 1P69B 4BH8B 1UT9A 4HFUH 3G5YA 3OJDB 5IJKA 5JUEH 1UC6A 1MRDL 3ARFD 3Q6GH 1GZPB 3TH2T 5E6IB 2AJVL 3DGCR 1T7WA 3RVTD 1RZIB 3MBXL 3TPKA 3DLQR 3CSYA 5B8CC 5JXAL 2ESVE 1YZZA 1NSNH 3KPRE 4HUMB 3GJFH 1FC1A 2GTZA 4CGTA 1DQML 1FNFA 3S3PA 2VO5A 4M3KB 1UKSA 2VLJD 2CKNA 5HPMA 4MVBD 4EBQL 1GGIL 1FL3A 1FLRH 3HG1E 2HT2C 3NCYP 4PJHA 4NQCE 1JWUB 4YGVA 5D7IF 5CJXA 5FYLE 4I0PA 3SDCA 3VFTA 4OM1L 5MEPA 4KQ3L 1A5FL 1G7HB 2JCCE 2C1OB 4NYLB 2O26U 2VN4A 3WLBA 4QHNB 3A6BL 3K46A 5EC1A 5GIRA 4MNQD 5HDBF 1ZGLB 2X70A 1U3HB 1RFDL 3QIUB 1WT5C 2ATPB 1WAAA 3REWB 3I84A 1AQDB 1A9BB 2VDMH 3B5HA 4MSWA 1UM5H 4EDWH 5F7FA 2AP2A 4QGTA 3K8MA 3VFGL 1OAKH 4YDKH 3P4OA 1G7JB 4PB0L 3O4LB 5HHOE 3UPRB 5DQJA 1CBVL 1NC4B 1OWWA 1IC4L 1CE6B 4HGMA 3WFBH 2PXYC 1H3UA 1ZSDB 3STZB 1KTRL 4M6MH 3K80A 2AXFB 2ADJA 3VFPB 4KWUA 4E42A 3G9AB 3K7UA 3TCLA 2D4FA 4L3AA 3T4YB 2APFA 4M6NL 12E8H 4PJDE 4TNVF 3ARDC 4G9DA 1JWMA 3CDCA 5LWYL 2CRYA 1CGXA 4ZO6A 3PABB 4FTVA 1LDPL 5MENA 1ACYL 3FB6B 1N2RB 4OLWH 4JY4B 1LO0H 5JHLL 2PTTA 3WLWD 3DO3A 4M61B 5GGQH 2D7QA 1EIBA 1MWAB 2C3WA 4HKJB 1LO3H 2ZSVA 4P46D 2CPCA 2V7NB 3QIBC 5DT1H 3TA3C 1YEHH 5BVPL 1G0DA 1V3JA 3CPLA 1KPVA 4XPHH 1OP3H 3EOTH 2F19L 2VLJE 4Z0XA 1NANH 5C9JA 3BH8A 4N0CD 3IDNA 3OKOB 3INUH 1BZ7A 1K4DA 1D5IL 2X9XA 1ZHBA 1CI5A 3RRQA 3V7AG 2AXGA 1JMZA 2HMID 3P40A 3UJIH 4RMRA 4GAGH 4I3SH 4XH2B 3D0VA 3P4NA 5I8EB 1WBZA 1V3LA 5C0GA 4DFHA 2EDOA 1IAIH 1S7QB 4R90H 4U6VL 3T2NL 4XVUC 3BP5B 4MNQE 4KK8D 4MHHG 3FO1B 5F96L 2ZOKB 1N59B 4JZJB 3C6LC 4GQPH 4ZPVA 3LQMA 3RTQA 3E2HC 2VR5A 1UZ8A 4JRXB 5GXBB 2WP3T 3ZE0F 2ZCKL 3QUZA 1LILA 2Y4SA 4AIOA 1OW0A 5IF0B 5LBSL 1YMMA 3MPCA 1CDUA 5GGTL 2C9AA 4PPTA 1P7KB 2QTEA 2MCPH 3AAZB 2D03L 4LCUB 3CFKB 1WICA 3BP4B 4Q58C 3BJLA 4W4NA 1IC5L 2WINA 1QRKA 4D3CH 4L3CA 3HZYA 1KT2A 2RB8A 5C6PB 2NQCA 1K2DA 3IAPA 3QYCA 2KZ1B 2E27L 5DUBB 2G9HA 3C5ZC 1MHPH 4YHYC 2DQDL 1W2KT 1U36A 3OZ9H 1TZIB 2XKUA 4MD0A 4XCYA 1FDLL 3UTQA 1IGYA 3CC5B 3SCMD 1IGTB 3LKRB 3FHQA 3HE6A 3QNYA 4OIIL 4RQQB 1GOFA 3EYUL 3K4AA 5DF0A 4GRWH 1H8OA 4HK0A 1IGFH 3RGVC 2P47B 4X5LA 5EPMA 3H3PL 3CFCH 4HWZB 2CRZA 3S97C 1J1OH 2GTWB 3HPJA 4HXAL 3WIIH 1DBKL 4YUEL 5AYQA 1ZK9A 3BGFC 1CD9B 4M48H 4Y4KC 3UTSB 3L5WA 2ZNWA 4PB9H 3CJJA 1N5YL 4PRPD 5JDSB 5C08B 5EN2A 3R4DA 5HGHB 1UA6L 5DTFB 1S7UA 2CLRA 3JTTA 1VEOA 3CFJA 4APQA 2VXTL 2LQRA 4U1GC 2AEIT 3QUYD 3I6LD 3S98A 4ZXBA 4MAYD 3HI5H 3QXDA 5C0AD 2ENSA 4PJXF 2HA1A 3FRPG 1IGIH 2AV1B 4A6YB 5J57B 4XX1E 2OR7A 2Z91B 2GJZB 1QLEH 3FONA 2R1XB 4KRPB 3FO9A 1D5MB 5F7EL 3PWJA 4QY8B 2LTQC 5GHWL 5ALCH 5I73C 3K8LA 3LEYL 4J3VA 5DJ2A 5FYLH 4FQ2H 1VGKA 2GUOA 3B9KA 2VLRD 4JZOB 4X80H 2XWBB 3MXWL 5HVGB 4Q9RL 4XNUL 4RMQA 5I0ZA 5B38B 3MTRA 4IIQB 3IKCB 1MQKH 2R23A 5EO1B 3TC9A 4X4XA 1XGPB 3CXHK 5DRZA 1T1XB 3LKPA 2RHEA 3CH1A 1BQHB 4XBEH 3UTOA 3VXTA 4G8FB 4FN0A 2Z93B 5D2LE 4WI7A 3ZYIA 1KB5L 2G60L 2Q7YA 4MNHB 3KYNA 1IT9H 2OP4H 3CD4A 4KTYA 1KCKA 3ROOA 4HHAA 4OZFA 3H7BB 3LEXA 3LD8C 3LQAC 3QPQD 5DUML 1BZ9B 4DKEH 3QAZC 1KXTB 4YO0B 4KKAC 3LB6C 4ZFGL 4ZPTA 5CBEB 3GBML 4WUUD 1RZJC 3S88L 1F42A 4TSAH 3QEQB 3WV0A 2FO4B 4NKIH 5TQ2L 2YA2A 3BD3A 3UP1A 3I6LE 3CSPA 2X1WL 5C0AE 5F88A 2XFXB 5D1XA 2BVOB 4LVNC 5FHBL 4WWKB 1RZKL 4WVRA 4L4VB 3VXRA 1OP5K 1X5GA 1GXEA 1KIPA 2ZPKH 3VXOA 1TCRA 1CD0A 1SYVA 2DWDB 4ELKB 3BP6B 5FM4A 5B39G 4H1LB 5IQ9B 1DR9A 3E3QC 1NUGA 1NUFA 4L4JA 2AEWA 1S9YA 2FWOB 3OAZK 3OKMA 2VLRE 3UDWA 5TH2B 1EGJL 1M7DA 2QHLA 3O3BB 2WW8A 4LSPH 1YN6A 1N0XL 3FQTB 5A1AA 2NXZB 1EZVX 3O41A 5EU6B 4FFYL 3ILQD 3U36B 1MUJA 1N8ZB 4Q2ZB 3ES6B 2WWMC 5DD0L 3WEXB 2FZ3B 3NIDF 4JGMA 2IJ0C 5B3NA 5DZOA 1J10A 5BV7H 5C0CD 2HJFA 4EN3B 4HIIB 1DANU 4PV9A 1BIHA 2EYRB 1RU9L 5DRXA 5D2NA 3QJFB 2NW3A 5IR1A 2BVQA 1Z3GH 4XVJL 1BLNB 3R06B 1K3IA 2EEAA 6FABL 5IG7A 1YQ2A 4IRSA 5EOQH 4U0RC 2KZWA 3ULUF 3VWKA 2CXGA 2QKIB 4O5LH 3DV4B 3MJ7A 3BZ4A 4WUUE 4XMKH 4ZTOL 3WD5L 1IL1A 2HT3C 3TGXA 5A2KH 5EWIL 4P2OA 2HTLD 1H15A 2J8UA 4NKQB 5BOPA 4MNGA 5C0JB 5IJKC 4CVXB 1FC2D 1I8IB 4PYGA 4PJEF 1PG7W 1J18A 3EYQD 3MZGB 4OCLC 5GS0L 1J12A 2JB5H 3CMOH 4JY6A 3VGHA 3DSNA 1YEGL 3OPZL 1I7RA 3AS0A 1KCUH 4RIRA 4KTDL 2D9CA 1G0XA 3U30B 5BJTA 4K55A 1LVEA 2EE3A 1CF8H 1GH7A 4G8EB 3GUTA 2YD2A 3AS2A 3GSNH 5DSCB 5I75C 3GB7A 5ICYB 2OSLB 3MLPA 1MCEA 2Y5TA 2DBLH 1OD7A 1KLUA 2HVJB 4UIMB 3HMXA 2J88H 2JELL 4M62L 4GG6B 1YNTB 5CJXC 3ARGB 1UADC 1SEBB 4I0PC 4Z7UE 3SDCC 2YD7A 2P5ED 3EZ8A 2VE6A 3MGTA 1RUAH 4ETQA 3D85B 5C0CE 4LPUA 3WS6C 5LG1A 1PG7X 1QLFB 2OJEA 5FF6A 2YS4A 4O2CB 3D2UB 5GGVL 4F33B 2HRPL 4X6CA 4X9GA 1JZ6A 1XF4B 5DJXB 2J6EL 1JPST 1IM9B 3DVNB 4LLMA 3W9EA 5HYJA 1FZKA 3V6FB 1NBZA 4NRZB 1CK0H 1OLLA 4PBVC 1B9ZA 1EJOL 1GPOH 4MHHI 3CIQA 1EV2E 5B8CB 3MRPA 4KI1A 2R56H 2VSCA 4QRQA 4IRZL 5DVNA 5JW3L 1CGYA 4N5ED 4TQEH 2F58H 1OCWL 1SEQH 3BN9C 3MA9H 3OB0K 3WFHB 2IBBA 5AEAA 4ODXA 3OKDB 3RWCB 5KVDL 1MJ8H 5E08H 1WWWX 5KVFH 3T09A 1KEGL 4GS7C 5JHDD 1CZ8H 2XZZA 2EXYD 3DROB 1T1ZA 1RK1A 3BQUC 2VXVL 1XF3B 3FQRB 1I1CA 3LKSA 4AMKL 1MCPH 4OSUL 1RJYA 3JTSB 1S9VA 1UFUA 1YMHB 2FJHB 1BFVH 5H94A 4PGDB 5BCAA 4K7PX 3BIBX 1AO7D 4ZUSB 1QKZH 3HA0A 5HGAB 3LV3A 5E00B 2Y6SD 3C87A 4M6AA 1D5XA 1RZ8B 2E6PA 2P5EE 4HF5H 3X17A 2PUQT 4BQCA 3DSFH 2P8PA 4DGIL 1NJ9B 4ZO7A 4LCCB 4WFGD 2OK0H 2A6DB 1HXMA 1MJJA 5ITFA 4GW1A 3KHQA 3DMMA 4M6OL 3RTQC 5GRVK 1E0OB 1KCVH 4JQIH 2PXYB 1OTUC 4LCYA 1B4JH 4U3XA 1VA9A 5E2VL 1OW0C 2NY4D 3BW9A 1G9NL 2GJ6A 3U4EB 1NCWL 1FAIH 2ZUQB 3FL7A 3VGEA 3QT2A 4S1QL 5LGJA 2WWKT 5BVJB 3ARDB 4OZHF 1FO0B 3QQ4A 3TBSB 2G5BA 1VKXB 5DA4A 4JKPL 1NLDL 1VB9A 5E5UB 2XWTA 4UT6L 1PYWA 3MFGB 3MLRH 4M7LH 1RIHH 3D9AL 1ES0A 2YMXH 2JJUA 3QIBB 1PZ5B 4GAJH 2LU4A 5AAWA 4LEXL 4CJ0A 2UWEE 4TSCL 1U6AL 1G7QB 2MQCA 5JHDE 5LXGL 1AHWB 4J8RA 4HH8A 4LL9A 4XNMA 4RSVA 5DS8B 2DQFA 3HE6C 4JLRA 5E9DA 4M7ZC 4U1LB 4JG0H 1CDHA 5KSAD 5BS0D 4JN1H 2YZ1A 4NM4L 4S1SH 3TWCL 1AO7E 2VDPL 3TVMD 3QG7L 1JZ4A 3ZYZA 1CFVH 4MLIA 4FQPA 1DN2A 2YSSB 4XNYL 1SVCP 1UQSB 4YHZL 1TPXC 2GFBA 2HTKC 3HS0B 3R1GL 5D7LA 5INCA 2Z31D 1EDQA 1WVZA 4WFGE 4Z7QE 4IOSD 4Q9BA 2HFFB 3U4AA 3ZL4L 2WMPA 4GW4A 4UQ2A 4L3ED 3F7YA 1BX2A 4E41A 5DQ9A 2BCKB 4N1CA 4APQC 5IJVB 2Q6WA 4NZUH 5J3HD 5KSBE 3JWDL 4ZXBC 4J4PA 1OPGL 1YQVH 5B4MD 5I1LA 2Z8SA 1JPGB 3RX5A 3DHMA 4JJHA 4M9OA 3HPLA 1LE5A 4GW5A 4HIEA 5HD8D 3FTGB 5GISH 4KZDH 3SKJL 1CLOH 1E6JH 3JVGA 5DI8B 1HHGA 5FCUL 3S9DB 1YDPA 4LNRA 1RZ7L 4XC3H 1AR1D 3G5ZB 1TQCC 3VI3F 4NKOB 1PBYA 3MOAL 3B9KC 1FH5H 4YHYB 4HQQL 2MTPA 1FAKT 4ZQKB 3QCUH 5J9PA 1OAXL 1A7QL 3S37H 1RJLB 3NPSC 2K3TA 3HAEA 5ISZA 3DXAA 2A6KA 3LHPH 1ZT1A 5CP3A 5FFLA 1CXKA 2XPGB 7FABL 4HS6B 5IB1B 1JZ3A 1KPUA 3QXUA 5DEFA 5I1CL 4G7VL 3D25B 1VDGA 2VTFA 3L9RA 2A6IA 1MCWW 1JIBA 4JDZB 4OFDA 1S9KC 4EEEA 4LVOB 5FYKL 5J1TC 1RJZA 1OM3L 1VESA 4HDIB 1YEKH 5BS0E 4DCQB 3G08A 3PWNA 1T0MB 1X7QB 3I3EA 3G9VA 1MIEH 1R5VA 4HS3B 2BY2A 4QF1A 5IW6B 2QSCL 4U1GB 4GKOA 1SBBA 1R3KB 2ARJA 2X9YA 4PRID 1G9EA 3PHOB 1ZLUK 3MREB 2OYPA 3MBEA 2X05A 1PEZA 5EUOE 1XGUB 4L3EE 3IDMB 3REVA 3SOBL 4B7LA 2ED9A 3VGDA 3I02B 4RGNB 1ZANL 1NGZA 2I60L 4YFDB 3OKLB 3BZFB 3OHXA 5B39B 2HKHL 3P30L 1QBAA 2BFVL 5IBTL 5D1XC 4X7FC 4YQXH 5I18H 2AJXL 2JE8A 3DVIA 4XPAL 1U8LA 4PP2B 1Q94B 2JTDA 3CMGA 5ESQB 2V5YA 4CKVX 3EO0B 1IGCH 3BPCB 2ENYA 3LKNA 4ACPA 2VOTA 1QRNB 1AD0A 4LAQL 2B4CC 1JNLH 4R4BB 2OLDA 4P99A 1A6TA 1PW3A 3C5JB 4N0YH 3JV4A 2NYYC 3P77A 4QRPA 3EYOB 3CFDA 4O51B 3U79A 1KJ3H 1Q9KA 4UNUA 4BFBD 1K8IA 3MJ8B 2AKRA 1XIWA 1QO3B 1DN0B 2BHUA 3MCKA 3FCTB 3TJHD 2J2ZA 1PX3A 3CSBA 3O3AB 3MRIB 3QH3B 4DW2H 3MODL 5IQ7L 5HDQL 3G5VA 4I18C 3E0GA 2M8XA 1RVFH 4ERSL 1FRGL 1NBVH 1ZVSB 4U6YB 1AGFA 3MRGB 4HT1H 2WUCH 3QAZB 3EYFA 3IDJA 1EXUA 5D2NC 4F9LA 4LF3A 4XP5L 5HBBA 3PGCA 4LPTA 4QNPE 4OZFG 4PRIE 4IRSC 4NQTA 2UV3A 3VWKC 2YK1L 4KFZC 43C9B 3V6OA 4NQVB 1ZTXL 4DQOL 1HH9A 1S9XB 4AEIL 4YWGL 1OHQA 1D6VH 2XWJB 5IKCA 5TDOB 3MLSL 1U8PA 3LRSB 2FHBA 4KI5D 5EOTB 4GKSA 4IDLA 5IT2H 3EOAB 4KC3B 3RGHA 1H3WM 5HHQB 5D7JD 3RZCA 4MZ2A 1S9WB 5KVEL 4OFIA 5JPNB 1A7NH 3V0VA 3KGRA 4P23B 4PGBB 5D1ZD 4FXGB 4Y16B 1QQDA 3VD3A 1GC1H 2XIDA 5BO1L 4GUPA 3NZ8B 2R69L 4M1CD 3MRRA 2Q76A 1MFEL 3AS3A 1CFBA 2H3NA 1LP9A 5FO9B 4LEOB 2ZNXA 4XCNA 5IB5B 3DV6A 3TBTA 3K2UL 4D9QD 3U0PB 4CADB 4Q97A 3RL2B 4DGYL 5SWSA 1PG7L 1JGDA 3BPOC 1RUPH 1LEGA 3QJHA 4NO5B 5K33A 4W6WB 1F4XL 2PYFB 1YEFH 1BOGA 2APVA 2VXUL 3SDXA 4H5SB 3U46B 3ZTJH 3NCFB 4UZGA 4L5FL 4PRDA 1GYAA 1M71B 3TO4B 2CSPA 5I1AA 4JPVH 1UZ6F 3O6LL 3BVNA 2BERA 4XI5C 5EORL 1MFNA 1HYSC 1AY1L 1TNMA 5EU7E 2B1AL 4PLJD 2Q87A 4B0MM 2N7BA 4O9HH 3TESA 5HHVL 1MFAH 2COQA 4UMGA 1QVOB 3DETC 4HUWB 4I4WB 5EU5B 5GS3A 2ERJC 1E28B 1KNOB 1S7TA 3KPNA 1CR9L 3VFOB 3H7LA 2V2WA 5D93C 3MRJA 4K9EC 2GEEA 1IE5A 2W65A 4QO1A 4KI5E 5DJ8A 1UB5B 4H20H 4R8WH 5F1IA 3WIHH 4MA3A 4HWBL 4Y5VB 3H3BC 3FT4B 1K6QH 3CSYB 2ITDB 4Y1AB 4ZOEA 2OTUA 2GTZB 5I75B 4KKBC 3P0YL 4K7PL 1CDGA 3EJZC 1A0QH 2R2EA 3MUGA 3IETA 5FYJL 3MROA 1UJ3B 4P2RA 4GSDL 1KTKE 3Q1SH 1WWBX 3QHFH 4R26L 4HPYH 2Y07H 1VADA 2O61A 5FECA 1A7BA 2D3VA 3X3FL 1IAOA 5T1KD 3EFFB 5F3HA 4D9QE 4QRRB 3SDCB 2Q8AL 5MP6L 5MEPB 2IFFH 1JI1A 1LO4L 4Y2DB 1JJUA 1KV3A 5HI4C 3OL2A 5EC1B 3HI1A 3G6JA 1HH6A 4JFHD 2X70B 2B0SH 1G6RH 4YJZL 3BP7B 4GRLD 5E0QA 5IESL 4AG4L 3QDJB 3O6FD 3WHE1 3QRGL 1GGBL 3FO2A 5C3TA 1J86A 1VFAA 2L7JA 2GY5A 2Q1EA 5DQJB 1CFSB 3DMMC 4DN4H 1CTNA 3PWPA 3V0AC 4QTHA 4L8DA 4JFZH 5EU4B 3KXFD 4P2YA 1T7VA 4IBLT 3QFJA 3KWWB 2AK4A 4CNIB 4E42B 1RHHA 3PE9A 5T3ZL 5DD3L 2ICES 4KPHH 1T3FA 3MNWA 4G9DB 3O4OC 2E7LA 3CH8A 4CJ1A 2PNDA 2FDBP 3BPNC 4J6RH 4FTVB 2F54A 3I2CH 2XQYK 2PTTB 4GS7B 4GG6F 1U93B 3CZFB 4WDIA 4KUCF 3HNTL 1MAJA 3BQUB 2JCCB 3GSWB 1JWSA 3GIZL 4HFWA 4BZYA 5I1JH 1KPVB 4Z0XB 1MLCA 4U1SA 2FIRT 5DHXB 1GAFL 3IDNB 5FO7B 4OV6F 2AEPH 4QXTA 1K4DB 3UBXA 5IVXF 1ZHBB 4U1NA 4KAQH 3Q6GL 1GOHA 1MLBA 3RA7L 3VFNA 2YWYA 3QO1B 1J8HA 3OKKA 1JZ5A 3BEVB 3QQ9D 2ZSWB 5HHOB 1YJDH 1WBZB 5C0GB 4ZTPH 4MAUL 3UC0H 4MA7H 1NSNL 3ZE2F 3ULVF 2X4RA 1P1ZB 4JFHE 5DD1H 2ICWB 4Y5YB 3VE0A 1KGCD 3RTQB 2YA0A 4PJCA 4JQVA 4S11A 1FLRL 1YNKH 4B7IA 1F3DJ 3CLFH 1EO7A 1BJMA 2VIRA 4R96A 4DKAA 5ID0B 3KXFE 4WEUD 1OSPH 3GMQA 2XOTA 2CUIA 3FAWA 3IT8D 4GQ9H 1Y6KR 3QDHA 1F2QA 2V5RA 4WCYH 4ZUVA 3ROLA 2QV2A 4Z95H 2I27N 2NY0D 2VDML 2VLJB 3VWJD 1UM5L 2ZOLB 4YDKL 4OZ4B 4N5UA 4MWFB 1T04A 3UJJH 4KK5D 3O45A 3OGCA 1F4HA 3WFBL 2W07A 5TJWK 3SO3C 1IGYB 4M6ML 1KB9J 3NGBB 1FFNB 4HK3J 4JKMA 1CICD 1G7IA 1F97A 3LOWA 2H2SC 1FE8H 1IQDA 5CJ5A 3MUHL 3GSXA 3L3KA 5IEHB 4R9HA 4HXBH 12E8L 4MNQB 1FCCA 3KPSD 1FVEA 3LKOB 1A22B 5C0EB 1XF1A 5EPMB 3LZFH 1I1YB 3QFDB 3DX6A 3SKOB 1EEYA 3FRUA 3TV3H 1TPXB 1FGVH 4OLWL 1LO0L 1OGAA 1FNLA 3OG4B 1ZEAL 3GIVA 5EN2B 4DTGH 1LO3L 1HKFA 5CHNB 5CMAB 5DT1L 3RUGA 1YEHL 1U41A 2F74A 4XPHL 2OZ4H 4G43A 5J1AA 3C9NA 1KGCE 3EOTL 3R0MA 4QGYA 4UDTB 2CKBH 1U58B 4WW1A 4O2EA 4Z7NF 3O6MH 3INUL 3QXDB 3MBEC 3T2OA 2NX5D 5CD5D 5F89B 5CD3B 2IPKB 2EE9A 3S7GA 3VI4E 4JFFA 2AXHA 4AEFA 3UJIL 4PJGA 4GAGL 4I3SL 2EECA 1L0XA 3KNBA 1UJTA 3FONB 2ESVA 1KJVB 5EU3B 3KPRA 3FJTA 5BZDB 5F7HA 4FS0A 3DTXB 1TQCB 4R90L 5DJ2B 5EOCH 3B3IA 2KQNA 3B9KB 3IDGA 3KYKH 5FUZH 5JNYB 4AYFA 3SEPA 3HG1A 1WC7B 2Z4QB 4P5TB 5SX5K 2VLLA 4NQCA 2H26A 3Q5YA 3NPSB 4QXGL 4PJ5D 1ZHLA 1T2QH 5C2UB 3G5XA 3GM0A 5KW9H 2LVCA 3M45A 4KGLA 4JKLA 4ONOA 4PD4J 3LKQB 2X10A 1GOGA 3FT3B 4V1DD 4TUOA 2MCPL 3QB7C 5CP7A 3VRJB 1Z5LA 2EDRA 3GSNB 3VW3H 4D94A 3VXTB 2MHAA 2ZUSA 2D4DA 1XIWC 4YHOH 3WDJA 4J7RA 4DN3H 4D3CL 3KPSE 2R15A 1GJIA 5DFWH 5BXFA 5KVMC 2QLVB 3ROOB 4HHAB 1MHPL 5JR1H 1ZS8B 2GHWB 5IK3B 1II4E 3UZEA 5EO0A 3OZ9L 3OJ2C 2ZG3A 4PRNA 3VXME 4F9LC 4PY8J 1NGWB 4TTDC 3PGDB 3QUXD 4X8XA 4PJDA 3FMGH 3O3EA 1NMBL 4HWNA 4EUPH 1IGFL 1G7PB 2NX5E 5EA0H 5D7IE 5I8CA 3CFCL 3A67L 1J1OL 3WIIL 3CLEH 1MCIA 1UM6H 4M48L 1A1MA 4PB9L 1KIPB 3RZCC 5KG9B 5E4EB 1WISA 1MOEA 3FB8B 1KENH 1F3JA 2ZUTA 2BMKA 1U8NA 1FZMA 5LQBH 3IFOA 1S9YB 3O3UN 1F2XK 4MJ2A 2DJUA 3TT1H 3OKMB 2PYEB 4NQSA 5D2LB 2GYSA 2X1QA 5MEOB 1DUYB 2F53D 3RVXD 2VDRH 3HI5L 1D3CA 4PJ5E 4U1IA 4PJ9C 4P3CH 4PJFF 1IGIL 4Q9QH 4PJBF 4HJJL 2ITCB 4GKNB 2EXWC 1QLEL 3S4SG 4V1DE 4J23A 1DLFH 1LD9A 5EIIA 4I18B 5ALCL 4R4NC 4GG8B 5IW3A 2DDQH 4WY7L 2CR6A 5FYLL 1JPTH 3MV8A 4ZDHB 4LSTL 2BVYA 2FGZA 3QWOA 2J7LA 4X80L 2PKDA 3C6SB 3JV6A 2BNRB 3U2SA 2GY7B 2V9QA 1I8MB 3GMNA 1PLGH 2QQLH 1PSKH 1DZBA 4IRSB 2NY2B 4IMKA 4Z7WA 3VWKB 1MPAH 1WEJH 4XBEL 2D0HA 3BX7C 4FQCH 1K5NB 1NFDB 5HI5D 1FORH 5DYOA 1RIVH 4K23L 2OXGA 3S37X 3L3DA 4CU7A 2X89A 4P4KD 2J8UB 1X5IA 1IT9L 3N9GL 2DRUA 2OP4L 2VLRB 4NUGH 3W5NA 1GHFH 4MNGB 2VDOL 1A6AB 4PBWD 2Y1VA 3MACH 2BSTA 1MCCA 3KLHC 4UOW1 4DKEL 5CCKH 3G6DH 1HHKA 1ZWIB 4P46A 4ELMA 3RU8H 4I3GA 4RIRB 2AJZB 3SDDD 1BD2D 4TSAL 4NKIL 4JPKH 5CZXC 5DHVA 1MCQA 3ZE0E 5KANG 3RIAF 2F53E 3JUYA 3EHBD 4QXUH 4L29B 4OV5A 1KN2H 5TDPA 5CKGA 5EFIB 4FZEH 1XAUA 5HHXH 3MRLA 1I9RH 4MCZA 3U6RB 3CK0H 4J3XA 2VITA 2ZPKL 4AH2A 1DQJA 1N26A 1Q9OB 2RAMA 2V17L 4IJ3B 2H32H 4RFNC 2O5XH 3HTLX 2R1WB 4WUUB 1ZMYA 3V2AR 4OCRH 1JGVH 2QSTA 4I5BA 1Q9WA 2OTPA 1LDSA 4LSPL 3D3VD 1B0GB 1Z9MA 5HJ3A 1VGEH 3HKFA 4X7CC 4L9LA 1FNHA 5HYFA 1DVFD 1VFBA 3T1FA 4HX1A 4NDMA 1JNHA 1VSCA 1WZKA 3LPGA 4HMDA 3LY6A 4JO1H 4K94H 5HYSA 2ERJB 5AZ2H 5BV7L 3ZYJA 4XWGH 1NBZB 2H1PH 2OTWA 4HCRA 1NMCB 2K7QA 5D93B 1KG0A 1WITA 5HVWA 4LSSH 1S8DB 2HLAB 4NBZB 5T5NG 3WO3B 1UXSB 3VG0H 2WBWB 1Z3GL 3E6HA 4O2FB 1CFTB 5JZ7C 4LU5H 5CJ8A 4HK3N 5EOQL 1BGXL 1R3HA 3VXUD 4CBPA 5ESAB 2W60A 1G9ML 4O5LL 5KZCB 3GSVB 4Z7UB 4XMKL 1BD2E 5I17A 1U8IA 3EGSB 3BUYA 4JM4H 5IB3A 1RJYB 5C0CB 4WI3A 4LFHG 2VISA 3FT2B 4PJXE 3EDDA 3DVGB 1RPQA 5JXEA 5IEKA 5H94B 2DQIH 2ARJQ 3V6ZB 3R0NA 5TPWH 3LV3B 3CMOL 3RHWF 1CFQB 1X5JA 4PRPA 1KCUL 4LLUA 1OAUH 2WM0A 3RIFK 3OX8B 3GSNL 4MAYA 3FN3A 3OF6D 1HXMB 5ITFB 1QBLL 5D70H 3K81A 2C1PA 2JJSA 3D3VE 4NIKB 4JQVC 2J88L 3W11C 1HK6A 4NHCL 2IMNA 3GJEA 1MQ8A 4L8SA 2HG5B 2IMMA 1SQ2N 2XN9D 4JO3H 2GJ6B 3MA7A 4N8CH 3HC4H 3VXSA 4I77H 4I2XE 2J5LC 1TJGH 3QIWA 1RUAL 2DJ4A 4DKFL 4LLQB 5FEBA 2G5BB 3BPNB 5F7DA 1I1AD 1QSED 4JFDD 3TYGH 2UY7A 1Y6MR 4JRYD 4BZ2H 1RMFH 2XWTB 3PXHA 4OKVB 2O5ZH 4PJHF 3OXSA 1BFTA 1ES0B 1I8KB 2DICA 3ULUD 3QNXB 1NEZA 5DLML 5H2BB 3VXUE 5FUOH 2R4SH 4J8RB 4ODUA 5T5FH 5IFHH 2P5EB 4CVZA 5E2JA 1ADQH 1JK8A 4U3CA 5HI3C 3FB5B 2DQFB 4CMMA 1CK0L 1WAAF 4U4BA 2GW5A 4WO4B 5E9DB 1UVQB 3QEHA 4N0UE 5KSUB 5GGUB 3LMJL 1GPOL 4D0BA 1CYGA 5B21A 4QRSA 1IBGH 2R56L 3B6SA 5IWLA 1A6WH 1U8OA 5FB8A 1NCTA 4TQEL 2F58L 1SEQL 3MA9L 4MB3A 1MJ8L 2GFBB 5KVFL 1CZ8L 4HUXA 1EBPA 5D7LB 1MF2H 4RFEA 1GGTA 1PKOA 1Q0YH 4I0KA 1IILE 1D9KA 1MCPL 1BX2B 4ORGA 4P5KB 3RI5F 3VH8A 2CRIA 5GSVA 2VZUA 1CG9A 3QP3A 1BFVL 2QADC 1LE5B 2HAZA 4NNXB 3F6LA 1QKZL 2XN9E 1FYTD 2CR3A 3NIDE 1A6ZB 4G6AC 3M1BA 4HF5L 2XYCA 3DSFL 5MERB 2ZJSH 5EBGA 1EAPB 4I1NB 5C86A 4R0LB 2OK0L 3AREC 4NP4H 3O3DA 1QSEE 4JFDE 3SDAA 5KSVA 4WRLA 1VERA 4JRYE 3CVHB 3NA9H 3V52H 1KCVL 4EI5A 1R3IH 1CE1H 4JQIL 4NRXA 4K8RD 1B4JL 2BRRL 3BSZH 1BVZA 3LS5H 2YOCA 3ULUE 2A6KB 2DAVA 3KLDA 1JZ7A 4HIXH 1FAIL 3RWEB 3RBGA 5DGQA 2VXSH 4PRHD 5C8JA 4YBHA 4PGCA 3QWRD 1P6AB 3L3HB 4QRTB 3TZVD 4OB5H 5DEFB 5C9KA 1CGTA 5KS9A 3T8XB 5EIVA 2A6IB 4J3SA 2WBJC 3X12B 1RJZB 2HJLB 3V0WH 4BFEA 5JIKA 4PJEE 3MLRL 5GRJH 1CL7I 4M7LL 1RIHL 3SKMA 5C0IA 5I16B 2YMXL 4BQ9A 5KSBB 1UH2A 3IXTA 4GAJL 3ULSA 1JV5B 2NY4B 2ARJB 4LPCA 1MHCA 3I6KB 2EYSA 4RFOH 3OGOE 2YPLD 4ODSH 5I1HH 4U6HA 1IEAB 2A6JA 4JG0L 3CVIL 2WSKA 3AVEA 2IBZX 4LOUD 5T3XD 2BSRB 2IF7A 3FQXA 4JN1L 4OFVA 3HZVB 5ETUA 5C0DA 3U9PH 2XV6B 1E4WH 5F97E 3VFVA 5JQ6H 3H8NA 4S1SL 2IPTH 4LP4A 3I9GH 2G75A 1CFVL 1FYTE 5F8RC 4IOFD 1HDMB 2DD8H 1U8LB 3HRZA 4UU9B 3DBXA 3P9LA 2FCBA 4GXUM 5GJSH 2JIXD 1HZHH 2NZIA 4X98A 1JVKA 1P4LA 5ADOH 1S7VB 1AD0B 3S4SB 1MCSA 3DNKA 5JMRA 1S5HB 3NTCH 1A6TB 2AV7B 4NZUL 4HKXA 1YQVL 3MFFB 4F57H 5BS0B 3EJYD 5GISL 1RI8A 1YY9C 4KZDL 1Q9KB 3SGEH 4WHTA 4OQTA 2ADIB 2AKRB 4ZUWB 2BVUA 1CLOL 1E6JL 3KLAB 1MVUA 4FNLH 4PRHE 4XC3L 5JW5A 5BRZA 4TVPD 2BOCB 5GGRB 3P0VH 3A6OA 2Z31B 3BXNB 2EDJA 2W9LA 2ZKHL 4G8IA 4M8QB 1FH5L 3BKMH 2X6MA 5EUOB 3OB8A 1JPFA 2V2TB 2R1YB 1D5ZA 4CVWA 3QCUL 2GCYB 3S37L 1EXUB 1ETZA 4ZNEE 5FGBA 5KANI 2Z8VC 4Q6IA 2NY3C 1G6RB 3LHPL 3MBXH 4N0RA 3RWGA 3PGCB 3P73B 1N64H 3HI6L 3UTZA 4IMKC 4ONHA 1FNGA 1U3HD 2HYMA 2V2XA 4MB5A 1DQMH 2YPLE 2VABA 1HH9B 4I48A 3TN0A 1ZGLP 2XRAH 1E27A 2H6PA 5IKCB 5T3XE 1HHIB 3ZKQD 2XKSA 1YEKL 2FL5A 1QD0A 4RA3A 3O4LD 5A16B 4G6JH 1NUDA 3QDGA 1A1NB 3RZCB 3CFBA 3MRDB 3QCVH 2FH8A 1FNEA 5ACZB 1MIEL 5F3BB 3MUJA 3IDYC 2R8SH 4G8GD 2UWEA 3V0VB 1OB1B 1OAYH 1ZE3C 5JHDA 1QQDB 2JK5B 1G7LB 5KOMC 4BSVA 3QPXH 4RWHA 4PJ9B 5I6XB 4X9IA 3EYSH 3SJVA 1KXQE 4FMFA 3DV6B 2D31A 1W0VA 3RNQA 3H2WA 3SQOH 4PB0H 5D7SH 1R5WA 3O11A 5GRVL 5CBAB 4Y4FA 1LEGB 3QJHB 5CSZA 5DJDB 4YQXL 2MJWA 2I9LB 5I18L 3B2VH 2X7LA 4DJMA 5EBWA 4OZHE 1U8QB 5D96C 3ILPA 2BOBA 2BVPA 3QUKB 1IGCL 4TVPE 4ODHH 4QTIH 1A7PH 1KJ2A 4NO0A 2C4FU 1JNLL 4WTWA 4WNQA 1TZHB 1NAMH 3ZKSD 4CL7A 4MJ5B 4N0YL 4AM0B 5LWYH 5BZWB 2OL3A 2ICWJ 4NZTH 1MCLA 2E8YA 4ZYKB 5HY9A 1KJ3L 1ACYH 1SMAA 2W91A 4JFPB 3CFIC 4L9LC 5HDOA 2YD6A 1OTTD 4DW2L 5JORB 1DDHA 3IU3A 1RVFL 1IRAY 3V5HB 3ULUH 1NBVL 5H37H 5DC4B 3CDGA 1I3RB 3PDDA 3MX0A 4HZLB 2V2WB 4JFXA 1D6EA 3PIQB 4JRXD 1NC2D 2EDNA 4HT1L 2WUCL 4NKDA 3QUMA 4BA8A 3UAJD 3O4LE 2CDEA 1MSPA 4PLKD 2DKSA 4G8GE 3HFML 3O6KH 2AJUH 4OAWA 5DO2D 3JBG7 5D8JL 4AQOA 2ATKA 3S6CA 1I7ZB 4H0IA 2YPKA 1H9VA 4IS6A 4U6VH 1T80A 3DUSA 3MROB 5I2IA 1UWEH 1NL0H 1KPRA 4CUCA 5KSAA 2O61B 1D6VL 2DM3A 2M2DA 3ZDZF 1CU4H 3TBWA 4M00A 4BQBA 2FH6A 3OR7A 5C1MB 5JXEC 5DMJB 4F15B 4ZSOA 1A7NL 1AJ7L 5CEXA 2XY1A 4NWTH 1CWVA 4E0RB 4HLZG 4U31A 3G6JB 3NCYS 1HH6B 3LQZB 2Q86B 1GC1L 1NFIA 1NFDF 5DMKB 1HHHA 1AGCA 1HSAA 4OT1H 3VI3E 4L3EA 4ZO9A 2PW1A 3FFDA 4XZUA 1VHPA 1S3KH 3FZUD 1J1PH 3ZKMD 1MJUH 4MAYC 2J8UF 4ISVA 4U1HA 4YHIB 4YDJA 4OI7A 3QEUB 3RL1A 4JANB 2JJSC 4CAGA 4ZOCA 3G6AA 2NMSA 4L8DB 5CGYC 3UTSD 3O2DL 3ARPA 2DQDH 5D7JB 4L8SC 1RUPL 2P44B 4LBEA 4YHKH 1RHHB 1MIMH 4K8RH 1YEFL 3LN4A 3QIWC 3PQYA 1B4RA 1T7YA 4JRXE 2X4QB 1C12A 4LP5A 1XF5A 3T0EA 5CGMA 4NT6B 4YFLI 2VQ1B 4JPVL 2P7TA 2B20A 5FUCC 5DK2A 4HFWB 2VH5H 4O9HL 1JRHI 1MFAL 5AAMA 1CL7L 4G42A 2LE9A 1MLCB 3IDXH 2X44D 3DRTA 1Y0LA 4E5XA 4N9OB 4QXTB 5IFJB 5C6TH 4XGZA 2VXTH 5D9SB 5F21B 2YR3A 3VFNB 4R8WL 3WIHL 4X6CF 4PS4H 1OD9A 1K6QL 2EZ0D 4F7TA 5CZVH 5IWLC 1HEZB 4IRJA 5T3XH 4M3JA 5EBMA 2X4RB 1JE6A 3PWLA 4KJYB 5ABDE 1BP3B 3NZHH 5GHWH 1YYMH 1A0QL 3C2AH 3VE0B 3L1OH 2V9TA 2IADB 3QHFL 1T22B 4PJ7A 4HPYL 2Y07L 1DLHA 3KPOA 3C5SB 4HIHA 4NWUH 5SWZA 43CAB 3MXWH 1FZOA 1D9KC 1F00I 5E8OB 4WV1A 1WIOA 5J6GB 2J5LB 3TNNB 4V2CB 2IFFL 5J8OA 1F11B 4J12A 1MRFH 5E2UH 1XR8B 4UILH 2C4XA 3CFEB 3BD5A 1DJSA 4EUPB 2B0SL 2XTJC 2P8MA 1G6RL 3QEQD 5H35A 4XHJC 1XZ0A 2AJSH 3PXJA 1YY8A 3ROLB 5HYQA 5AD0B 4L1DA 4XBPB 4NNYB 2LAAA 3ARZA 3H42H 4S1DD 4DN4L 3SDAC 4MJIA 4ZFZA 4X6EA 2RFXA 4TVPH 3ZSTA 4EI5C 2H8PA 4JFZL 3F58H 4L4VD 2NW2A 1KIRA 5F1SA 3SBWA 4RAVA 5DEGA 5I1DB 5DK0A 2HLFD 3GSXB 4AENB 2R2HB 4KPHL 1C7SA 1NEZG 3TO2B 5JLZA 2MKWA 3PJSB 1ZAGA 4JHBA 1B0RB 2BK8A 1SJEA 2BNQA 2W0PA 1TVHA 1F90H 4D0CA 5L8JB 3IJHA 4YX2H 2NXZD 4J6RL 3O6FB 2BDNH 5ILTH 1FFOB 2CDFA 2WQRA 3GBLA 3FRUB 4UBDC 1L6XA 3I2CL 5EU6D 1OGAB 2C7UB 5E8EB 3D18B 1D7FA 4XWOD 4JO4H 1RZKH 1ACZA 2YXFA 5I1JL 5L8KB 1HIMH 4G43B 3C9NB 3HR5B 2B7DT 4QHLB 2AEPL 3W5MA 5TE6H 1H3TA 4KAQL 3D6GA 5LJYH 1LE9B 4YH6A 3VXPB 2MOVA 3TM6A 3D39A 3RWDB 3KNBB 4IOIA 1YJDL 5DGRA 1UEYA 3EYQC 4ZTPL 3DGGA 6CGTA 1OAZH 3QWQB 2IPUK 2P1YA 4MA7L 3AREB 5ICZA 1RV6X 3IDGB 3QEQE 2ARWA 4HZAA 3WYRA 3WNPA 4BSWB 5IHZB 4JB9H 5CGTA 1YC8A 5IMMA 2VDKH 1YEDB 1YNKL 1MWAH 5JPMB 2YD3A 5DHYB 3VJ6A 4HC1H 2I26N 3CLFL 4UUJB 1INQA 3GI9H 4UAOC 4LLWB 4NO3A 4DVBA 4Y5XB 4Q74A 3KDMB 4L4VE 1OSPL 2VAJA 4RAUB 3T0WA 4OF6A 3S34H 4MD4A 3X11B 2X4PA 1IAMA 5M94B 2WBJB 4WCYL 3U7YH 1ZT4B 4Z95L 5IVZA 1FP5A 5BXFB 3KAAA 1F6LL 2R0KH 3O2WH 4R2GD 1YN7B 3DO7B 1ONQB 5EU6E 4AL8H 5EO0B 2H32B 2VZOA 3PWVA 4YIQA 1BPVA 3ARGD 4FXLA 3RPIB 3DUUB 2EO9A 1HQRA 5FGBC 4Q6IC 1YEGH 1U91A 4C55A 1FE8L 1UYWH 3I6GA 2DTMH 3D85D 3IKKA 3UZQA 4HXBL 4LLDA 4PBXA 3QR2A 3T0VA 1ZT7A 5E4IA 2HJKA 4JREB 5IMKA 3ARBD 3VGBA 4MQTB 9CGTA 3WJJA 4FFVD 3LZFL 1KB9K 4KKCD 3VWJB 3D2UD 5DJAA 2JJVA 3TN0C 3MMEA 2DYPA 3TV3L 4DZ8B 1FGVL 3GSUB 5LAXB 5DJYA 5T33L 3VFWA 5IV2A 3ULVD 3AFLA 4JM2A 4DTGL 1P84J 3T0AA 3IFOB 1P7QD 2XACC 2WIIA 2OZ4L 4QYOA 2R39A 2WLZA 2CKBL 5FO8A 2A77H 1LK2A 2FEEI 4FZ8H 3O6ML 1XF2A 5T1KA 5H37G 4Y19D 3KPSB 1TTUA 1XGQA 4RA0C 3WS3B 1S7SA 3WBDA 3LN5A 3FB7B 5JA8B 5EIIB 5DRWB 3HB3D 2JJWA 1GZQA 3IVKB 1HXYB 3W39A 1DBMH 4P57B 5EOCL 5DJ0B 4Y4FC 1L6ZA 3VXMB 2HT2D 3KYKL 1PX4A 5FUZL 2A0LC 3UEZA 1RULH 4XMPH 2FECI 4RMUA 4Y4HA 5FOBA 3W0WA 1T2QL 2NY3B 4NQXB 4QCIA 5D7IB 3KXFA 4GG6E 1TNNA 4MMZC 1H0DA 4NC2B 2HN7B 5E7FA 1AGDB 3IJSB 2IANA 3VW3L 4L1HA 2KPNA 1EH9A 1D5BB 4A6YH 5DFVC 3RVUC 4R3SA 1AH1A 4DN3L 1F02I 1W72A 4PD4K 5IVXE 3IF1A 1WIPA 2GSGA 4QEGA 5C0BB 4LSDA 5JR1L 2PXYD 3KJ6H 15C8L 2XY2A 4H8WH 1I1FB 2BSTB 3MNVB 1CGSL 1PQZA 3RQ3A 5HTSA 1I4FA 2M1KA 3PNWA 3ZE2E 4ELMB 1MNUH 3ULVE 4PGZA 4RWYH 5EC2B 3ARDD 2DJSA 4QRUB 3FMGL 1I9IH 5C70A 3DX8A 5FM8A 3UTTD 4MXVF 4PTUA 4Z7OF 3CDYA 4HV8A 3OV6A 4Y19E 3LSOB 3IFLL 4OV5B 3BYYA 5EA0L 3NVQA 3BH9A 2DKMA 4PY7B 1J05A 1I3VA 2Y9RT 3CLEL 4HWUA 1UM6L 3QIBD 4MDIA 3MO1B 2VITB 4OGYH 5FV2A 1P7HL 3TIDA 1G9NH 1KENL 4LLYA 3V7AE 3TT1L 3WKMH 3PF2A 3PL6A 3GRWL 3OKEA 5EH1A 1BHGA 5FDWB 5L2KA 2VDRL 4Y8DC 3V5KA 3G04A 1N3NB 1OAQH 5E1AA 2D7NA 4P3CL 4Q9QL 4L9LB 3NCJH 4OD2B 2NY6C 8FABA 4LCWA 1J1XH 1AGEA 3T1FB 4XVUD 1AKJA 4ZAKA 1AD9A 3F8UB 1DLFL 2GSIB 1TENA 4X6FB 1H8SA 1FFPB 4LSQH 3ZKNC 2LU3A 3QI9A 3OJVC 1IZJA 2DDQL 4FFZH 4LEXH 5DD6A 3V5DB 1JPTL 2OTWB 4NUJB 4DZBA 2IC2A 5FYKU 4KRMB 4M7JH 1KSRA 4TTGA 3UPCA 3MGAA 2ZP0T 4FQHA 4WW2A 1PKQA 4H1LH 1LP9F 2F53B 1R24A 1PLGL 1RK0A 3SKNA 2QQLL 1PSKL 3MV9B 4FXKA 1CXFA 5F9JA 2APTA 3JWOC 3T0EC 1CICA 4NM4H 1KJMB 1MPAL 1WEJL 1F6FB 2Q8BH 4HAFA 1FORL 1RIVL 1YUHB 4M03A 3SN6N 4Z76A 5AG8A 3BUYB 1RZFH 4Z7NE 5JO5B 3UTTE 3C5ZD 1QA9B 1S7XA 3ZLQC 2Z92B 2FGWH 3B5TA 3SDXF 4NUGL 3ZL4H 1OSZA 1GHFL 2QQNH 4QOKE 5IEKB 1JHTA 3ALXA 4N9GB 2P8LA 5AG9A 3TJEH 5CCKL 2DLEA 3G6DL 1WFOA 4PREB 2UUDK 3RU8L 1M1SA 1QFWM 2GKIA 4IRJC 4G5ZH 4JPKL 1A9EB 3BE1L 3TIEA 4X9BA 2FJFB 4EVNB 4Q6YA 4QXUL 4Y4KD 4P4KB 3C60C 4MX7B 5D1QC 3KJ4B 3GJEB 1WF5A 4HQQH 1B90A 4FZEL 3WIFA 3BGAA 1IAKA 4JFEA 1OAXH 4KXZI 4WV1C 3CK0L 4UT9L 4L8BA 3WN5A 2DN7A 2O5XL 4X4YB 1WTGT 4IM8A 4OCRL 1JGVL 3DHJA 5F7DB 3MRBA 4NN7B 4PJ5A 4G7VH 1AIFB 4MQ7B 3PDOB 1VGEL 4PJXB 1OM3H 3SGDH 4YBLC 1NEZB 5I1EH 5GGSA 3F7VA 4JJ5B 3QULA 3RVWC 2DIBA 1DUZA 4O00A 5FIEA 3EFDH 3QDMD 4JO1L 4K94L 1SY6H 1Y18A 2O93L 1NH6A 2EDEA 1OTSD 3D48R 4C56D 1FL5B 4BFGA 3G6JF 4XWGL 2H1PL 2HT4C 3SBWC 2AERT 4CMMB 1T6VN 1QRND 3QEHB 4K7FB 4GKZA 3BGMB 1T6WA 1OF2A 3NN8B 5C07A 2VL5A 4XRCB 1IEBA 4TRPL 1A6PA 2AVGA 3VG0L 3T4AA 3D0LA 4FQLH 3ELAT 2WV3A 4LU5L 3T77A 1WBXB 4QWWC 3N85H 1MJ7L 3UMTA 5SWQA 2HVKB 1A1OA 4TN9A 3OAUH 1MFBL 4F7CB 2YUVA 4MCYA 4JM4L 1D9KB 4JFQA 4XB8A 4JHWH 3VD7A 5I15H 1KFAH 2I24N 1DEEA 3EBAA 4MXQC 1I7TA 3X3GH 3ULVH 2XXMB 4FQQA 5KAQG 4PJFE 1CG9B 4PJBE 3S5LG 5FDYA 2DQIL 2G2RA 3MRQA 4KKAD 4R4FH 5TPWL 3LB6D 3T08A 1WBYA 1K4CA 5I30H 2QSQA 1P4BH 3ZYOA 2XTJB 3RZWA 1VPOH 3AU1A 3L7FB 4M1GH 1OAUL 3NH7H 4YGAB 3MJ6A 3O9WA 4WI9A 1WCBB 4TVSa 1QFUH 3WUWG 4RZCA 2FHFA 3MODH 3WE6A 5D70L 3SDAB 2RBLA 2IQ9H 2IAMB 3QXAA 2W9DH 4NRXB 5KVGH 2PTVA 2VWEC 4JO3L 5CINH 3HC4L 1KELL 4I77L 2NY5L 5EB9A 1P4IH 3QDME 1TJGL 5C8JB 2OI9C 4C56E 5IIEA 4KK6C 4QHMB 3HCVA 4PJCF 4XPTH 4XXCA 2D7TH 3TYGL 3AUVA 4OZIA 4OUOA 5CIPH 4BZ2L 1RMFL 1ZTXH 2O5ZL 2WWMD 2V7HB 5C0IB 4URTB 5EIQA 3ETBF 2IG2H 4JAMB 4Y89A 2X4UA 3ALWA 2EIEA 3LIZH 5GSRA 2XN9B 5JQHC 3NIFF 5GS2D 5FUOL 3KPMA 1U8KA 3RDTA 2R4SL 3KHOA 2SEBB 5T5FL 1X3DA 2KQMA 3MCG1 5IFHL 5J06A 1ADQL 4NQEA 4OGAD 4LPYA 1JN6A 2YC1B 5MEQA 2E7MA 5DJ6A 4LHUG 2YUWA 3S96B 2FX9H 2FRGP 3HMWH 4X4ME 1FIEA 2A6JB 1BQLH 3Q3GB 5C0DB 3FQXB 1MHEB 1I1AB 1M05A 1IBGL 1XGRA 2GITA 3VFVB 1FO0H 4JRYB 3GGWB 3WJJC 5C71A 3QA3A 3ZHKA 1IM3A 5IM7A 3J7HA 3DBXB 4WGWB 1A6VL 3ARSA 2O5YH 1MF2L 3U0WH 1QFPA 3MJ9H 1Q0YL 4JM2C 4X98B 3EO1A 4R7NB 2H9GA 3SPVB 2IALA 4JG1H 5E95B 4NOBA 3UYRH 2DWEA 2NNAA 5J11C 5IOPB 4PJEB 1WWAX 3E3QE 5HDLA 4Y1AD 3TT3H 5EO9A 4G80A 3VRLF 1CT8B 4YR6A 3L3GA 3RUGF 3HR6A 2ZJSL 3CXDL 3X13A 1N7MH 1QLRB 3IGAA 3D1MC 3D3VA 1FVCB 3IU4H 4M4RA 1JPFB 3LEVH 1D5ZB 2DLHA 3NA9L 1QPXA 3V52L 1A4KA 2DMCA 3TPUA 1CE1L 4I0PD 4QRRD 3K0WA 3SDCD 1X5HA 4Y4HC 3U82B 3BSZL 4PJGF 3LS5L 4U1MA 2FSEB 5GS1A 1AP2A 4Y2DD 2BC4A 1FYTB 3MQIA 2DL2A 4HUVA 2VXSL 1BF2A 1FNGB 1NKOA 2V2XB 4OB5L 3P0YH 3WNMA 3OR6A 4K3DH 4KU1A 1RAMA 3OJMB 4F7EB 4IHOB 5EBLA 5IMLA 1MCRA 4LSUH 3KYMA 1T7XA 3QDGB 5GRJL 2EIBA 4M5YH 3WHE0 1MFCL 2R0LH 2FIKB 1ITBB 3MXVH 1ZA3A 4G9FB 1U8HB 4P4RB 4RFOL 2P45B 3NFPA 3WXVH 4CN4A 4Z78A 1SJHA 4PRHB 5HHMB 2GQHA 4N0UA 1I7UA 4ODSL 5EOCJ 5I1HL 3HE7C 1C5DA 1ND0B 3BN9D 2DQHH 1W0VB 1M7IB 5E6YA 3EOBB 3D69B 2A73B 4ODWB 3QRGH 4FTVD 1GGBH 3FFCB 5MEND 1E4WL 5CS7A 5JQ6L 5GRYA 3VCLB 2P5WA 2IPTL 3RWIA 5CEYA 1R5WB 1FL6A 1CGWA 3OXRB 3DX9B 3I9GL 3OKNA 4U7MA 4Y1AE 4Y4FB 5CSZB 2Y72A 1TJHH 2NTFA 3MR9B 3BQUD 5GRUL 1NCUA 2X7LB 5EBWB 5TDNB 2R2BB 1BFSA 3BO8A 4M02A 5D6CB 1HZHL 5DJCA 5C0FA 4Z18A 2VC2H 4BKLB 2I5YH 5ADOL 1KJ2B 4NO0B 4U7SA 5E70A 3F12B 3PL6C 1DL7H 3NTCL 4JDVA 4PJHE 1HHJA 2AQ3A 1WQVT 4OUUB 3JV0A 4QRRE 4F57L 3AXLA 1VFOA 2EICA 4XXDA 1BIIA 4FNLL 1T5WB 4ZAKC 3VG9C 5CEZD 5ACLA 1ZV5A 4F3FB 4JFOB 4WGVB 1MCDA 1WAAE 3QI9C 3RTQD 1IQWH 2JIXB 3P0VL 2EIZB 1OTUD 1RURH 3TFKC 4XNZC 1MCJA 1RJCA 3QUMB 1BVKB 3H9SB 5L0QB 1IGML 1MCHA 1YMMD 3TYFA 4WW2C 4LRIA 4DEPC 5DD5H 4F7MB 1CXLA 3RA7H 2YN5A 4Z7VA 1T1YA 2VQUA 4YXLH 4OCNC 1N64L 4MAUH 4QHUA 3RWHB 2D7OA 3V95A 5F7LB 4P5MB 4JN2A 4OZHB 5DZLA 1LNUA 1MH5A 3RJQB 5JIHA 3VRIB 2XRAL 1EEQA 3BZEB 1AGBA 4LQFH 2C5DC 3TBWB 3HC0B 3DVFA 4FTVE 5MENE 3H9HA 4G6JL 4JPIB 4ODVH 3QCVL 4K3HA 4XBGB 5E8PA 1NCCH 2R8SL 2IEPA 3HUJA 3LQAH 4U1KA 1OAYL 2I25N 4Z7WF 2FR4A 1FN4A 2I07A 3HE6D 1NFIB 1MY7A 3QQNA 3BEWA 3QPXL 5KBNC 1EEZB 2BRQA 2PW1B 1RZJH 4XZUB 5GGTA 3TP4A 2EO1A 3EYSL 5F9OH 2NY6B 4OLZH 1NQBA 1FBIL 3MRNA 1DQLH 1REIA 3RL1B 2RIKA 1HQ4A 3SQOL 2HTKD 5D7SL 3GSRA 3ZKXB 3GNMH 3CCHB 4G7YH 4HH9B 4P9HC 4ELMF 4G8GB 3B2VL 5DEZA 4OF7A 1FVDA 4NOFA 5CEZE 4PGEB 3EOYG 3V6BR 3WXWL 4APQD 2OR8A 3WN5C 2YZ8A 4ODHL 1KLGA 3PQYB 4QTIL 3MRMB 2UYLB 3GHBH 1A7PL 1UXWA 1EFXA 4YNYB 4F2MA 2A83A 3T0EB 4C59B 1NAML 1YMME 4GO6B 5HGDB 3GSQB 4M93C 4NZTL 2BZDA 4C58B 5IHLB 1AR2A 4NHUB 5DK2B 5C09A 3QZWG 4N0FB 4LGSB 5KJRH 3TZVA 5MHSD 1ZEAH 3B9VA 5GJTL 4G42B 3MYJA 1HSBA 3B9KD 3DRTB 1NGXB 4E5XB 5HGBA 3FQNA 2ADFH 3ULUL 1FNAA 4P5TD 2HP4A 2PCPB 3CX5J 4XP4H 5ANMA 5GS2H 4P59H 1LEKA 4RGMC 3I75A 3O8XA 2XNAB 4OFPA 2DLGA 3TNMA 1S7WB 4H26B 4AT6A 3O6KL 1AXTH 2AJUL 3Q6FB 1A2YA 1KIQB 5IW1B 4XC1L 1TCMA 1BQUA 2P48B 3S5LB 2BJMH 3LVEA 2IH1A 1UWEL 1NL0L 1PD6A 3SHSA 2CLVB 1SVZA 5A40E 3C60B 5D1QB 3BT2H 1XCQA 4HIHB 1XH3A 3TBYB 4JFYA 1FZOB 2VJXA 4J1UA 1CU4L 5CUSH 1Q38A 4X5XA 4QXGH 5I76A 1NC2B 2MFNA 3GMOB 1X5YA 3WUWB 4JQXA 5IB4B 4NWTL 4OCMC 2WIMA 3B2UC 1FSKC 4PJ8A 2P8MB 2ZZUT 4TUJB 4OT1L 3OJDA 2BSED 1LMKA 4AJ0A 1S3KL 2Z8WC 1J1PL 3O9WC 1GZPA 1MJUL 5E6IA 5EZOH 3TBVA 1RZIA 5D1XD 4BUHA 2D2OA 4MJIB 4X6EB 2H8PB 1KB5A 3FOLB 4YPGB 3VXRD 2HFGH 4X0KB 5FA4B 4MDJB 5TGBA 5DK0B 3FQUB 4YHKL 5MHSE 3KYOA 1MIML 4K8RL 2PYED 4MMXC 1NFKA 2Q3AA 1E4XI 2FJGB 4IEFB 4Z9KB 3GMMB 2NYYD 4DK6A 1JWUA 1NMBH 1CLCA 4ENEC 4XXCC 2FX7L 1G7HA 1HWHB 2C1OA 3A67H 1TVBB 4LHUB 1U8JA 1U3HA 1X4XA 2VH5L 3QIUA 4OM0L 2ATPA 3REWA 4LDEB 4P3DB 3IDXL 3RDTC 1AQDA 1A9BA 1QEWB 5C6TL 2BNRD 3WO4B 1G7JA 1O0VA 3IAQA 4PRAA 3SY0B 5A3IC 3D39B 4OBRA 1NC4A 2HKFH 4PS4L 1ZSDA 3STZA 1FCGA 2UVEA 2AXFA 4HJJH 2NY2D 3DGGB 4IRSD 5CZVL 3VFPA 3VWKD 1KEMH 2EC8A 2GAZB 5T3XL 1E4KA 1EGJA 1RUKH 2HRLA 5CSGA 2A1WH 3NZHL 1YYML 1QYGH 2YRPA 3C2AL 3L1OL 2R4RL 3UX9B 4WY7H 2D0FA 4LSTH 4NWUL 5BQ7B 2C3VB 5J13B 3HZMB 2XZCH 1ULVA 3FB6A 1N2RA 5JDJA 3MUZ1 4DVBB 4JY4A 4M61A 1IKFH 3VXRE 5ID1B 4HKJA 1MRFL 3OSKA 4HC1A 2V7NA 5E2UL 4BQ8A 1F5WA 4UILL 4U1JB 35C8H 4UOW0 2EC9T 4JO2L 3GMRB 4KQ4H 2AJSL 4O02H 3OKOA 2PYEE 1I3GH 1FV1A 3MLTB 4K23H 1VENA 4WIQA 3B4NA 1IVLA 1MHHA 4XHQA 2W92A 3H42L 5CEZH 1HE7A 3IJYB 4XH2A 2CD0A 3N9GH 4X5WB 4OCSH 1LQSR 3JZ7A 2VDOH 3R8QA 4TVPL 4KGJA 1X5AA 3F58L 1S7QA 2LVEA 5ESVA 3LDBB 3NAAH 3WNKA 4F7PA 5GS1C 1U91B 4XCEB 1XMWA 3FO1A 4KJQC 3I6GB 1N59A 3PV6B 4JRXA 2BNRE 1F90L 4POUB 1P2CA 5GRZA 5F1KC 3ZDZE 4H0GA 1FJ1B 4N68A 4YX2L 5D2NE 5DJAB 5C3LD 5ILTL 2BDNL 4XI5D 2DYPB 2N56A 3GBNH 4FG6C 1HYSD 1P7KA 4UTBH 4EOWH 3AAZA 4LCUA 3CFKA 3BP4A 3DETD 5GPRA 4JO4L 3BWAB 1SYSA 4NZRH 1NFDE 3AM8A 4HS8H 3QRFM 1HIML 2V17H 5K9OB 5KS9F 3AB0C 5FO8B 1LK2B 4GBXB 1CXIA 1Z9LA 3HZKA 2J8UE 1MAKA 4NZJA 5TE6L 5J11B 5J4MA 4MNGE 3MCLH 4GOSA 3VMOA 2A9MH 5DZNA 1TZIA 3IFPB 1T1WB 3LN5B 4KKBD 1IGTA 4XB7A 3EJZD 1I9EA 1OAZL 5CILH 4RQQA 5KZCD 1I8LA 4MD5B 2P24A 3WFZA 1XR9B 4PLOB 4JB9L 4PJAA 3JV5A 2ICEA 2VDKL 2J6EA 1MWAL 1Z0MA 3STLB 4HWZA 2GTWA 1EPFA 4HC1L 4WHCA 3GI9L 4L8CB 3UTSA 1QBMH 4LKCB 4OGXH 3U0TA 1DQTA 4AEHH 1H0DB 4RISL 5C08A 2WAHA 4TOYH 5SX4I 4NGHH 5DTFA 4GMSL 1BGXH 4P3WA 3S34L 1KCSH 1WZMA 1MCKA 1G9MH 4UNVA 3SGDI 3U7YL 1W72B 2RCSH 3DMMD 3RJDA 4L4TA 5J1SC 2F5BH 3O2VH 2AV1A 4A6YA 2R0KL 2OXHA 4P49A 4I3RH 2Z91A 2GJZA 4WENB 4X6CE 3O2WL 3W2DL 4ZUUB 4AL8L 2BNUB 4IMLA 3NFNA 2R1XA 2GJ6D 4QY8A 1NGYB 4LRIC 1QSFB 3V7MA 5KOVC 5CWSB 1GIGH 2QEJA 3HE7B 1UYWL 2GT9B 2DTML 1BVLA 3H0TB 4JZOA 5F7YC 2XWBA 4X7TA 5I71C 3BWUC 3DX8B 1YNLH 2W0FA 3QG6A 4PTUB 3LH2H 5B38A 1VFMA 5C2BL 1ZVYA 2N4IA 1QBLH 3BH9B 5EO1A 1XGPA 1T1XA 4OFYD 1RY7B 4AIZB 4PP1C 4PJIA 4NHCH 3AMLA 1KXVC 2X1XR 4R2GB 5J0BA 4G8FA 2Z93A 1PAMA 5FGSA 5GZOC 5F7WC 1DFBH 4Z8FH 4OZFH 2MKLC 2V5TA 1H3GA 1KLFA 4S2SB 4MNHA 4HEPG 5E2TH 2E9IA 4OZGB 4DKFH 2A77L 4WO4D 4FZ8L 5E9DD 4PV8B 4LLAA 5IVXB 1ZA6B 1KACB 3H7BA 5C7XH 1OGTB 3ARBB 1BZ9A 1P84K 1AGEB 4PUBH 3UZVB 3E6FA 4G3YH 3VG9B 5CAYB 3DX7B 4OLYH 2W38A 3QEGH 4UDUA 3KPTA 2F15A 1DBML 5DLMH 4F80A 3UYPA 2PW2B 5D7LD 2OX5A 3ALPA 3QNZB 4Z6AT 1P7QB 5GGVY 5C0NC 4GLRI 1JHKH 1RULL 4XMPL 4E41D 4WW2B 3N1QC 1OT1A 1WZLA 1DE4B 2MNUA 4LNVA 3QZWB 1K3ZA 2BVOA 2YHGA 3ORJA 3SKNB 4Y19B 3LMJH 1MCNA 4FXKB 4WWKA 4X6DA 1AXSB 1E4XL 3CUPA 2GJ6E 2NXYC 2DWDA 4ELKA 1TQBC 1AQKH 3FAXA 2FWOA 5FCSH 4MYWB 4A6YL 4NM8H 1WIUA 1J11A 3JUZA 5TH2A 2CRMA 5I1GH 3TZVC 3BHBB 3SDYH 1S7XB 3D5OF 3P11H 5EULV 3J8F7 1K8DB 3FQTA 4JR9H 3MGOB 4M8VA 1UWXH 5EU6A 3KJ6L 4WHYG 4H8WL 2EDYA 1N8ZA 4Q2ZA 3ES6A 5DWUH 5DK3A 3WEXA 2H2SD 2FZ3A 3DXAD 5ISZD 3O8XC 3QQ3A 1MNUL 5JOFA 4RWYL 1T5XB 2PO6A 3WHXB 4EN3A 2VLKB 4HIIA 4BH7A 5CIPB 1I9IL 3K1DA 4YC2C 1CLZH 1A8JH 3JSSA 2W9EL 4LIQE 5E9DE 4S0SD 3QHZH 4CN1A 1R5IB 4GT7A 5C92A 4LOUC 2L4OA 1BLNA 3R06A 3MUY1 4FQJH 1BM3H 2OM5A 2YBRB 2QKIA 5L2JA 3UROR 3DV4A 5HHNA 3KS0H 3QUZC 2BRRH 5L9DH 4OGYL 4F37F 4FQ1H 3E8UH 1W0WA 4JQXC 5D7LE 5T1LA 4JZNB 3MBED 4AQ1B 3WKML 4PJ8C 3MRFB 3L95B 4E41E 3H6JA 3UTTB 5C0JA 1T83A 4CVXA 4G6FB 1OAQL 1I8IA 5TF1H 5IHBA 2MSPA 4ZUTB 3NCJL 3M17B 4GAFB 4QOKB 5E6IC 1C08A 4WU5A 3THMH 1J1XL 2IQAA 4LSQL 3TA3B 2C3XA 3MV11 1Y18B 3HMXH 5EUKB 4XNQB 2DM4A 4G8EA 2EDHA 2ICCA 3I3DA 3GDBA 4FFZL 1KTDB 1FFRA 5DSCA 5ICYA 2OSLA 4X7EC 4M7JL 1ITCA 4DGVH 1PFCA 2ED8A 2HVJA 4RGMB 4UIMA 5C07B 1IFHH 4KROC 1IEBB 1RQ5A 1R3JB 1T7ZA 4GG6A 3CVIH 2J1KA 3D0LB 5IHUL 5E5MB 3ARGA 1SEBA 5ISZE 3DXAE 3MJGX 1BBJB 1XIWD 3MRCB 2X9WA 5F7UA 4M1DH 5I66B 2Q8BL 1A1OB 2Y23A 4W68A 4CU6A 1F6AB 3C6LB 1N5AB 4N1EA 5D7KD 3E2HB 1R3LB 1QLFA 1RZFL 5E6ZA 1U3HC 3QIUC 3L7EB 5FK9B 4O2CA 1DEEB 1TTFA 2P49B 5HVHC 2FGWL 1T21B 3D2UA 4F33A 2QQNL 5HHPB 4HKBB 1RZKC 5GRWA 1IC7H 1XF4A 5DJXA 4K9EH 2Y06H 3KPLB 3TJEL 1IM9A 5GZND 4TTDD 1WWCA 2B2XH 4LSRH 1F3RB 4NRZA 4U49A 1H3XA 1E4KC 1K85A 4G5ZL 2BSSA 3VFUB 3ESUF 4X9FA 4R7DB 3RP1A 1LEIB 3DURA 1WZ1L 1Z9OA 2C3GA 3C5ZB 4YK4C 1EX0A 5BMFH 2YUXA 2ZKHH 3QXAB 3L3OB 1MCWM 4OD3H 3WFHA 1YEIL 1T4KB 3RZCD 4UQ3B 3RWCA 3KPPB 4K3EH 2BHZA 4Y88A 2BY0A 4UINH 1IAIM 5KAQF 3FQRA 3HI6H 5E5RB 5F6HJ 3JTSA 1MI5B 1NDMB 4PJ9D 3RGVB 4PJ7F 4W81A 1F13A 4YBQC 2FJHA 5FHAH 4PGDA 2EXWD 1C16B 4YHNA 3VFSB 3ET9F 5DMIH 3BGFB 5E8DH 4PJFB 1ZHKA 4HJ0C 1INDH 3QO0B 4Y4KB 5E00A 5HGAA 4PJBB 4R4ND 5SWSD 4ZOBA 5I1EL 2CLZB 1RZ8A 2X4UB 3B5GA 1J5OH 3HC3H 4XPFH 4CW1B 3EFDL 1SY6L 3IXAB 4LCCA 1J0IA 5LKNA 4I0CC 4P2QB 4NQEB 2A6DA 5D7KE 4MXVE 5MEQB 4Z7OE 4GMTH 1DBBH 3RWJA 4OIBA 5GS0C 2GITB 3KR3H 4NPYB 4ZFOB 5J6HB 1V7NH 1CCZA 4FQLL 1DSFH 3U4EA 3N85L 2LTQB 1IM3B 5I73B 5F1NB 1YPZB 3U9UA 5BVJA 2XZQH 1V05A 1JNNH 4NJAH 3OAUL 3QDMB 3TBSA 1VKXA 3MRHB 2NLJB 3VFMA 4C56B 3AM8C 4JHWL 5I15L 1KFAL 3FOMA 2H9GB 3X3GL 3ULVL 3KLHD 4HIJB 4KY1L 4YDVB 4PFEA 4NO2A 4HWEH 4R4FL 1EZVY 2HH0H 3UDWC 1PZ5A 4KDTA 5JTWA 5I30L 1P4BL 4LIQH 1ZLWH 2XG5A 1G7QA 1HILB 1VPOL 4LFHD 1AHWA 1PEWA 1B2WH 5CZXD 4M1GL 4LHQB 3L6FB 3NH7L 5DS8A 3MV7B 4JY5H 4YAQB 1QFUL 3C8KB 1I8LC 1EFQA 2R0WH 4U1LA 2VAAB 1RHFA 2CDGB 3GMPB 4LLVB 1EK3A 1X44A 1Q0XH 1LP9E 4P9MH 2IQ9L 2XA8H 1A4KB 3GSOB 4NFDA 3LD8B 1JBJA 2W9DL 5KVGL 3VXQB 1UCBH 4QT5B 5I8KH 1ORSB 5GS1B 2YSSA 5SWSE 2DI7A 1CGVA 5CINL 1UQSA 1GCFA 3WKNA 3HS0A 1P4IL 3HFMH 4KK9D 4HBQA 4OIAA 4PR5B 5D8JH 3RAJH 2NTSP 1JI2A 4HWBA 5F7MC 2BCKA 5IJVA 3SDXE 4XPTL 2D7TL 5ENWB 1J0YA 4PG2A 4LVNB 2OJZH 4S1RH 1TLKA 2FX8H 4NZDA 4P2OC 3SKUD 5DI8A 2IG2L 1AC6A 3LIZL 5HGGS 3CVHH 4KRPC 5DA0B 1AJ7H 3RKDC 2EDQA 2Q3ZA 3G5ZA 1ODAA 3HAEH 4NKOA 2V6HA 4NRYA 1C5DB 2FX9L 1L9NA 3HMWL 1NCAL 5CP3H 1BQLL 3IDUA 4ZQKA 5JZ7D 1CDYA 5EZJB 3IDIA 1RJLA 2Y7QB 2P5WB 1FO0L 3RWIB 1CDCA 5FKPB 2EZ0C 1DP0A 2ZUUA 4ZS6C 2XPGA 3L3JB 4MQSB 3I85A 3O2DH 1QTYT 4Y2OA 4HS6A 3VU2A 4NSKB 2F9BT 1IGJB 2O5YL 2WK2A 3D25A 1QFWI 5DJCB 3MJ9L 3U0WL 4ZD3H 2IBGA 3BZDA 3JWNC 2HWZH 1JF1B 4XP6H 4HDIA 4HJGA 4DCQA 3TH4T 1T0MA 2AS5M 4JG1L 1X7QA 1G9NC 1J8HD 3CAFA 3EYVA 4HS3A 5IW6A 3UYRL 4U0RB 4XXDB 2E5EA 3TT3L 1R3KA 1BIIB 1MFDH 5IBLC 3G6JE 3MREA 1AXIB 4JM2F 5IMOB 3SGJA 4NQDA 3SQBA 4JDTH 1XCTA 3H9ZA 1XGUA 1N7ML 1CL7H 3W11D 3IDMA 2DQTL 3IU4L 1M6OB 3I02A 5K59F 3BMWA 3PHSA 3OKLA 5B39A 3LEVL 3G5YB 4Z77A 2QBWA 3TYFB 2JKXA 4FA8A 3C09C 3R8BB 3PWPE 4S1DC 4EIGB 1E6OL 2IFGA 4Z7VB 4WWKC 4PP2A 1Q94A 2ZUYA 5I71B 1UACH 2AK4E 1UKQA 5ESQA 5A2FA 2ZG2A 4D9LH 1JGLH 3OTTA 1QRNA 2AQ1A 1MH5B 4K3DL 5I1KH 5L88H 5HPMB 2HFEA 5E99L 1FL3B 3BIKA 3C5JA 4MA1C 4LSUL 5D71H 3RVVC 3GJFA 3EYOA 1NKRA 3GI8H 4M5YL 4O51A 4PJHB 2R0LL 4YGVB 5E8PB 3MJ8A 5D5MA 4K7PY 1QO3A 4I0PB 1DN0A 3MXVL 3MLVH 3FCTA 3VFTB 3O3AA 3QH3A 4QKXB 1DCLA 1JF6A 3TCXA 3WLBB 3WXVL 1NAKH 5K9QG 2JLLA 1DQDH 3BEWB 5GIRB 1IMHC 2PO6C 4JKKA 3JWDC 3MRGA 4EN3C 1NBQA 3SE3A 2DQHL 4MSWB 4XT1C 4WTZA 1UEMA 4KMTL 1HQ4B 1J8HE 3P4OB 1OGAD 1TJHL 5L8LB 2MQ3A 43C9A 2ADJB 3TCLB 2QHRH 2VC2L 2I5YL 4PJCE 4YXKH 2QQQA 2QADD 5TDOA 1T66D 3LRSA 5E7BA 5EOTA 1EFXB 1DL7L 3EOAA 4JGJA 1JWMB 3DRQA 2NXYB 2YEZA 4G6AD 1S9WA 2H41A 4JFFD 5HHQA 3BRGC 2VUOA 1T83C 5LCVH 3BUTA 5JPNA 5MENB 3FQWA 4P23A 4GFTB 3NIFE 4ZFOL 2AXJA 4Y16A 4HUNB 3ARED 5LGKA 1MAML 4YXHH 3U1SH 1HSBB 2FEDC 2ZSVB 5CFHA 3BMVA 3SGKA 1QHOA 1YA5A 1IQWL 3CPLB 1AC0A 4NN5C 2NY1C 5FO9A 4LEOA 4OZGF 3WSQL 5ANMB 5C9JB 3BH8B 5IB5A 1RURL 3U0PA 1BZ7B 4CADA 3RL2A 2ADGA 1SMOA 2AXGB 4FQXA 5DD5L 4AT6B 1CFNA 2JJTA 3WFEH 4NO5A 3D0VB 4RX4A 3P4NB 3ARGC 4YXLL 1MCBA 3T3MF 1T89A 1AFVH 2PYFA 2WBJD 4B53A 4N8PA 2VSDA 4H5SA 1XCQB 4WUKH 3ZHLA 4ZPVB 4E9LA 1M71A 1UZ8B 4WW2F 3TO4A 4LQFL 4HUKB 3KLSA 4PLNC 5I76B 3QUZB 4OGZA 4ODVL 2X1PA 1T20A 2YKLH 1OGAE 1NCCL 1YMMB 3F7RA 3LQAL 3VRLE 4J4PC 3PP3H 3Q5OA 3RUGE 4HUWA 4I4WA 5EU5A 3KPQA 1E28A 1KNOA 2WINB 5D72H 3VFOA 3ARYA 1RZJL 3JVGC 4L3CB 5F9OL 3HZYB 1KT2B 4OLZL 1UB5A 4LVHC 1K2DB 4LK4A 5HPOA 3TBVB 1T03H 1DQLL 4JFFE 1Z2KA 4KV5E 3FT4A 4Y5VA 2G9HB 2ITDA 4PJGE 1KB5B 4Y1AA 1PGRB 5SV3A 2H2PC 3GNML 4G7YL 5TGBB 1YECL 4CDHA 4MD0B 3BKYH 4XCYB 3UTQB 3KYOB 3HB3C 4DKDC 1UJ3A 4OCWH 3HE6B 3QNYB 4KROB 2UVFA 4M7ZB 4MQXC 4O58H 3GHBL 4U2YA 1VFUA 3EFFA 2VYRE 1YY9D 3QHTC 4QRRA 4HK0B 4U33A 2AGJH 4Y2DA 3HPJB 1UH4A 2ZCLH 3I50H 3WS6A 3L5WB 3PWUA 1U8JB 5KJRL 5T33H 3BP7A 3MV8D 1A4JA 3NPZB 5HVHB 3VXMD 3VD9A 1S7UB 2CLRB 2EH8H 1X6NA 3JTTB 3MYZA 2ADFL 3QDJA 4LCCC 4MS8C 3RY6A 2X4NA 3GM8A 3QXTA 3CFJB 4APQB 4XP4L 4PRAB 4ZXBB 2RGSA 3DJ9A 5ICXA 1CFSA 2NY3D 4P59L 4EQ3A 2NR6C 5EU4A 1NUNB 1T0PB 4M7LT 2DMKA 1NCBH 3KWWA 2VZSA 5HVFB 1AXTL 3K1KC 1A7RH 4CNIA 3CX5K 2YD4A 2DKUA 3FO9B 3PWJB 3IYLW 2ZUQC 2XXCB 2BJML 4Y8AA 4YK4B 1KBGH 2JB6A 5TE7H 1VGKB 2GUOB 4X7SH 2X89D 3BT2L 1YEJL 4D0DA 4MA8H 5C0BD 1XGYH 3RX8A 4ZO8A 5CUSL 1QFWL 3X14A 1U93A 3CZFA 1A3RH 2MQ0A 2R23B 1QHPA 4X4XB 3BQUA 5DRNA 5DRZB 2JCCA 3GSWA 3P4MA 3LKPB 1JCKA 1EUUA 4KDTC 3CH1B 1WLHA 1DEDA 1OWRM 4NJ9L 4C57C 3EW3B 1AHWC 5FO7A 4OF8A 3T0DA 5JMOC 4HG4J 1FV1B 3HAEG 4NC1C 2Q7YB 2A9NH 1MHHB 5EZOL 4RRPA 3QO1A 3KYNB 4OLEA 3BEVA 2CMRH 2ZSWA 5HHOA 1IARB 4WI8A 4OZFB 1JRHH 15C8H 3LEXB 1N4XH 5ESVB 2HFGL 1CGSH 1H5BA 4F7PB 1P1ZA 1QBBA 2DLFH 2ICWA 4Y5YA 3MV8E 4ZPTB 1AE6H 2KBGA 2L0DA 3ZDYF 4KJPD 5JW4R 4WI5A 1CQYA 3PDGA 1P2CB 2CK0H 3ARFA 3HNVH 4UTAH 3PP4H 3V6OC 3W82A 3IFLH 4LHJB 5F88B 5ID0A 1U8MA 3MRKA 5D1XB 4PG2C 2AJ3A 2F5AH 4Z7WE 4KDVA 1I85A 1SYSB 3VXRB 1NDGA 5ERWA 1MCFA 3N1MC 3VXOB 5B3JF 1TCRB 1SYVB 1MREH 5DQDH 5HDBE 4J3WA 3MC0A 2VLJA 3HZKB 3ARVA 2ZOLA 4OZ4A 4YHMH 5FV1L 3GRWH 4MWFA 1M7DB 2VQTA 2JF1A 5C0BE 4OZIF 1YN6B 4WFHD 3MV9D 2HKFL 3O41B 2FD6H 1FFNA 4GXUN 1MUJB 1KEML 4ELME 1RUKL 5IEHA 3V8CA 3NOIA 2A1WL 4MNQA 4P48A 2P24B 2P4AB 1QYGL 5MI0C 1QR4A 3LKOA 5JOPD 5JW4M 3MNZA 4PJAB 2ICEB 5C0EA 2YPVH 1OARH 2HJFB 5FM5O 1I1YA 3HLAA 3QFDA 4HKZA 3IB4A 2XZCL 4LVOC 3SKOA 5JXED 2F8OA 1XT5A 4PV9B 3VA6A 3B9EA 4C4KT 5DRXB 5D2NB 2NW3B 4J3UA 3U0TB 5IR1B 2BVQB 1IKFL 4ESKA 3EKCA 1IEHA 4F58H 1S5IH 5CHNA 3RIFF 3WL9A 5CMAA 5IG7B 1A7OH 2KDGA 35C8L 1YPZF 3MJ7B 4MJ4A 5IUSA 1NCDH 3BZ4B 4UDTA 4KQ4L 4ONGH 2E9JA 1U58A 4O02L 1P5UA 1I3GL 4CVUA 3SGJC 1IL1B 5F89A 5CD3A 2IPKA 4ALAH 4L4TB 3A0OA 1J7VR 2B5IC 5AUMA 4P2OB 1H15B 5CGYD 5K9QI 4TNVK 5CEZL 1TDQA 4OCSL 4RGNC 1KJVA 5IB2A 5EU3A 4IMLB 3NFNB 2WQ8A 5BZDA 1C7TA 3DTXA 2N7AA 4KKNA 3VXSD 3NAAL 4JY6B 5C0RH 1UENA 3QIWD 1EHNA 4RBPK 1I7RB 3B8YA 5JNYA 1BVLB 1OTSC 1WC7A 2APBA 4X7TB 4OD1H 2W0FB 2Z4QA 4P5TA 5BJTB 3QG6B 5CLWA 3GUTB 1UB6A 1N6UA 4ZOAA 3GB7B 2XICA 2YD9A 3BE1H 2Y5TB 4UI2A 3GBNL 3LKQA 1KLUB 4WFHE 3FT3A 3MV9E 4PJIB 1KYOJ 4UTBL 4EOWL 5F1OB 3VRJA 3BPOB 3L5XH 3GSNA 2AW2A 1BF8A 5FKAA 3F7QA 4NZRL 4HS8L 4UT9H 4W70A 2VE6B 3MGTB 1HKLH 4ETQB 5JOPE 3LRGA 1HOCA 3P9WB 1ZS8A 2OJEB 3MCLL 1CLYH 5FF6B 5IK3A 3SE3C 2A9ML 1P9MA 2XTLA 3E6FB 4X6CB 4PRPE 2R9HC 3ZMRA 1HINH 4UDUB 1NGWA 5CILL 3PGDA 4KVNH 1O7VA 4LLMB 3W9EB 2DTSA 5HYJB 3GMLA 1FZKB 1D9KD 5CLTA 1G7PA 3ZDXF 3C09B 3S3JA 2A74A 2E9WA 5E1HB 1V8HA 4YZFF 4X6DB 1U2HA 3MRPB 5I74C 4TRPH 1QBML 4QRQB 1G7MA 4OGXL 4XTRC 3CUPB 4TUKH 5KG9A 2E7LC 4AEHL 3VXSE 2XTJD 3GK8H 4TOYL 3FB8A 4NGHL 4XHJD 4ODXB 1EA9C 1BBDH 1MJ7H 3SCMA 4P23C 3VGFA 5HXMA 1KCSL 2PYEA 5D2LA 2L7UA 3ARQA 4Y16C 4FQIH 1RUQH 3NCCB 5MEOA 1DUYA 4MA1B 1B3JA 4XVSL 1T1ZB 1MFBH 1RK1B 1A47A 2RCSL 3SDAD 3SGKC 3LKSB 4PG9A 3S8WA 2F5BL 2YXMA 2IAMD 3O2VL 4EI5D 4I3RL 2ITCA 1EHAA 4GKNA 5FUCE 1S9VB 3STBA 5T1DL 3AGVA 1CD1A 1JNJA 4I18A 5TFSH 1JL8A 4GG8A 3QQ3B 4FQXC 5JOFB 4HPOH 3DYMA 1GIGL 4ZDHA 1OQXA 2PO6B 1F4WH 2JJTC 4UIKH 1D5XB 2RJMA 2A2QT 4BH7B 4OJFH 2P8PB 2VZTA 3C6SA 1YNLL 4JGUA 2BNRA 2GJJA 1T89C 4OGAC 3QUYA 3LH2L 4KJWC 2DQJH 4UBDD 1I8MA 3EZJB 1MJJB 4G6MH 3BAEH 4GW1B 5C0AA 3DMMB 1L7TH 3TO4C 5L2JB 2X09A 4LCYB 5HHNB 1A14H 4Z7VF 1K5NA 1NFDA 1QFOA 1RIUH 3BW9B 4WTZG 1UM4H 4Z8FL 1DFBL 1CN4A 2OS7A 5K9JH 1KELH 1W0WB 5T1LB 2NY5H 5F7KC 5LGJB 3UO1L 2Y36L 5CSBA 5E2TL 1CDBA 2VLRA 3O4OB 4ZS7H 1N6VA 3QQ4B 1A6AA 5C7XL 3FKUS 1C08B 4WU5B 1PYWB 2X2YA 5DHVH 1ZWIA 4PUBL 1C1EH 4G3YL 4Y5VC 1OVZA 2CO6B 2XTJE 2IQAB 2AJZA 4OLYL 3HUJF 3I3BA 4U6TA 3QEGL 2MWCA 4HLZH 4NN5B 2NY1B 4NN6C 3DYPA 4PY8I 5DMGC 3RNKA 4XNMB 3KG5A 1G6VK 1JHKL 1UJ3C 4RBPH 4L29A 4JLRB 1I1RA 5EFIA 3PGFL 4KDWA 4J2XA 2B4CL 3T0BA 4BJLA 3U6RA 4MXWH 2QL1A 4KKLC 1HNFA 1Q9OA 3MLWH 3GHEH 4EQ2A 4Y2DC 3UBXG 1Q1JH 1AQKL 2R1WA 4WUUA 4NM8L 1FLTX 4YDIH 5BRZD 5KS9E 1A6VH 5LVEA 5I1GL 5INCB 3SDYL 1WSST 3MLZH 3P11L 1B0GA 2DQGH 3BDYH 4HMCA 4JR9L 3RY6C 4GW4B 4UQ2B 3F7YB 1H3PH 4E41B 5DQ9B 2Q6WB 4HCRH 4FFWC 5DWUL 5I1LB 3HPLB 4GW5B