1YEHH

Structure of igg2a fab fragment
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
EMQLQQSGAELLRPGTSVKLSCKTSGYIFTSYWIHWVKQRSGQGLEWIARIYPGTGSTYYNEKFKGKATLTADKSSSTAYMQLSTLKSEDSAVYFCTRWGFIPVREDYVMDYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Catalytic antibody
molecule keywords FAB FRAGMENT
publication title X-ray structures of a hydrolytic antibody and of complexes elucidate catalytic pathway from substrate binding and transition state stabilization through water attack and product release.
pubmed doi rcsb
total genus 44
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1997-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yehH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yehH02
3DETC 3IDYB 4ODTH 5CEZE 2PCPA 5E8OA 3OKYA 1A64A 1XCTA 4I48B 2HT2D 2O5ZL 3TT3L 5CD3A 1S5HA 3H9HB 3TGXA 5F93C 1HH9B 4Z7UA 3HI5L 2HT3D 2VNCA 3MCLL 4AJ0A 1MSPA 1YEFH 1AGCA 4ORGB 4JFEA 1YY9C 3PHSA 1T1ZA 5E4EB 1T7XA 2GAZB 1RK1A 1UYWL 1MIEH 5C0RL 2IJ0C 2IPUG 2W0KA 2ARJB 3HC4H 5DJYA 5IESH 1UGNA 4TUKL 5B38G 3GBML 3KYMB 1P6AB 4UT7H 3RUGA 1RZ7L 4GS7C 1TZGL 1IGMH 4JZOA 5K9QI 5DK0B 3BSZL 2HRPL 1ORSA 4R0LB 2E7BA 2BVEA 1M05A 3MBXH 1FZMA 5I73C 4HZLB 1G1CA 1A1NA 1CDCA 1NC2A 1P4BL 1FLRH 3F58H 1TENA 5D6CB 2AJ3A 2GYSA 1JRHH 4R7DA 3RZWA 1XR8B 5C0FA 4LP5A 1U2CA 4WHCA 1UJ3A 5BO1L 1QVOA 4DEPC 3BQUC 2BVOA 2MPAL 2DWDB 2DTMH 2D9CA 3QUML 2A2QT 5IW6B 2X5PA 2X4PA 4JFFA 1X6NA 5FGSA 2O5ZH 3TT3H 3KWWB 5CINL 3VFPA 2YD9A 4G6KH 4EZMA 3FZUC 5ITBL 4MJ4A 3HI5H 3MCLH 1XZ0B 5DJZA 1CE6A 4XCYB 4LCUA 4X6DE 3VFWB 4XPGL 2P5ED 2VAJA 2IH1A 4WJ5A 3EJZC 2G9HA 3SDXA 3O41B 3SE3C 2O93L 1G7QA 1T6VN 5FO8B 3WD5L 4XCNB 1SYSA 2FB4L 3RHWF 1CBVL 3QDGD 4TUKH 1AGDA 2VLJD 2HTKC 3MMEA 3I3EA 3QIWA 15C8L 1TZGH 4R96A 1U3JA 3K2MC 5D6DC 3BSZH 1JYXA 5MEND 3L95B 2HRPH 4QHLA 1L0QA 3UBXA 1YNLL 3HAEB 1MFCL 4FTVB 4DUWA 1DCLA 2C1OA 2FR4A 1P4BH 2FATL 3DMMC 5CBEA 2QHRL 1G9MC 4G6FD 3T77B 4OQTL 1EEYA 1PX4A 4U1JB 3OWEA 3G08A 4MNGB 5IJVA 1V3LA 2BVPA 5DMJB 4XVUD 5DJCB 4U1HB 5CD5D 3IDIA 4JFZL 4JN2B 3DPBA 3QUMH 5I73B 4KVCH 4M62L 2I9TA 3IJSA 4JDVA 2RGSA 3OX8B 2A1WH 2CSPA 1E6JL 4JFED 5FUCC 1MCDA 3IB4A 4K3HA 1K8IA 4U2ZA 5CZXD 4PS4H 1UM6L 3U48A 1RZKH 3U0PB 4LU5L 3HPLB 4DEPB 4NNYB 3BQUB 3GI9L 2A83B 4ZXBC 2AEWA 5IK3B 1ZHKA 1FFNB 4HJGA 5MEQA 2B39A 3BJLA 5IM7B 4QNPE 1GPOL 5ID1B 4KUZH 4P3DB 5GSVA 4S1DD 3WD5H 1OTUC 2FB4H 3HNVH 4WFGD 1MRDH 2OMBA 1A8JH 5DEFA 1T4KB 3IDGB 4RWYL 4BKLB 1IZKA 2HJKB 3N1FC 3S5LG 4XRCB 4LPXA 4LBEA 1MFCH 3QI9A 5I1IL 4K9EL 1JGEB 4JVUA 1MF2L 1I1YB 2FIRT 1NGWB 4LEOB 5AWNH 3VU2A 5I75C 4ZO6A 5ID0B 1FPTH 2X09A 4MA7L 1AO7E 3BP4A 4YHPB 2HJLB 3PWJB 3S4SB 4JFFD 2GSGA 2JCCE 5LGKA 2VLLB 5GGTA 4JFZH 4KK5C 1CICD 3J7HA 1BZ9B 3DMMB 4O58L 2MJWA 1E6JH 1BIIA 3L3DB 3CDGB 1T89C 4XT1C 4OCSL 1KXQE 1J1OL 2IAMA 4N8PA 4LU5H 1S9VA 4G8FA 4Y5VA 2LAAA 4OFYA 1EEQA 2IBBA 3GI9H 4F7PA 3TN0A 3FB8B 4HK0B 4QGYA 1OQOA 3JVGA 1HXMB 2J1KA 4HC1A 4O4YL 2GCYB 5CEZH 4K94L 3CDYA 2OI9C 1D5XB 5CZVL 1UCBH 5DQDL 4NFCA 1DBBH 1I8KB 4ZXBB 2DMKA 4OZFB 4JJ5A 4XX1G 3C60A 4CUCA 4BQBA 3VXRB 4DW2H 1F5WA 3MNZA 4K9EH 3AB0B 1MF2H 3DVNA 5IUSA 2APTA 3FONA 4NBZB 4Z0BL 2ADFL 1IC1A 4WW2F 2C4FU 4U6YB 1KCLA 1R5VA 4HUNB 1D9KC 4BFEA 4LCCB 3G6DL 2AK4D 3MRDB 1R24B 2B5IC 4H5SA 4O58H 4Y2OA 3WE6A 1U95B 5HGHB 1KNOB 3HRZA 1ZLUH 3SDAA 4OCSH 4YXKH 1KN4H 1ZVSA 1J1OH 1EGJL 3I50L 2ZSWB 3ARDC 1I7UB 5J7CC 3PDOA 3MSPA 4NQSA 4OFIA 2QQLL 4LNRA 4JPWL 2C4FT 4GAJH 5DC0A 3I6GB 4QRRA 3IFOA 4K94H 4M5ZH 4LAJH 3QI9D 4N9OB 2C3VA 3QIBC 4OZHB 5TH2A 3VMNA 4X6DF 5CZVH 5DQDH 1QSFB 3KPRB 1G9NL 2F53B 3WNPA 2DAVA 5DUMH 3V6FB 4ZFOL 1CLCA 4LRIC 2AV1A 4NUJA 1H0DA 4S1QL 2W91A 3D87B 2DLIA 1VEPA 5D7LB 4K2UH 4Z0BH 2OI9B 2ADFH 1A7NL 4IRSC 4XBPB 2W59A 1LP9A 1P9MA 4IOFD 4NKOA 1U8OA 3VW3L 2A73B 3G6DH 1S7SB 5CAYB 4K07A 4ISVA 4WFFE 3L3GB 2Z93A 4GW1A 3Q5OA 4OFYD 5GRWA 2PW1A 1S8DA 5GJSL 2JJVA 2FO4B 3TN0D 5C0GB 4JN1L 3M17B 1EGJH 3I50H 1N59A 1F90H 2X1WL 3MUJA 3BD5A 1D9KB 1MVUB 3L5WA 1U3HC 5GXBB 3VXSB 1IGTB 3LN4B 4LPWA 2QQLH 2VXTL 4JFOB 3W9DA 1ZVYA 1B3JA 2E3VA 2G2RB 5CKGA 5ILTL 5C9JA 3CMOL 3O45B 5HVWA 3C60D 3TZVB 3EO0B 1HOCB 3SCMA 4MJIE 3MUY1 1DVFC 1CD8A 3ARDB 1PG7X 3BIKB 2BVYA 1E4KA 1G9NH 3UJIL 4QNPF 3MXWL 5FV1L 3WXWL 4JVWA 4QRPE 4OFVA 3T09A 3A67L 1HH9A 4S1QH 5JLZB 2MQ0A 4LVOC 2YD8A 4KKBC 3LQMA 5FGBC 3LPFA 1A7NH 3MLZH 1WFOA 4C56E 1UJTA 2GAZA 3TBSA 3NTCL 2WZPD 2ICEB 1QR4A 1ZA6B 4Q0XH 2ARJA 4UB0L 4Z18A 5C0NC 1BD2A 3X12B 3FAWA 3KYMA 2VXQL 5L2KD 1S7TB 1U91B 5EZIL 5KANG 3RY6A 5DK0A 2JCCF 4LVEA 1DR9A 4IRSB 5IBTL 4R0LA 4QTIL 1G7HA 2ESVD 2K7PA 3ZYIA 4FQQB 4PYGA 2MNUA 2BNRE 2VLME 3AUVA 4HZLA 2HN7A 3HNTH 3FMGL 3LEVH 1MQKH 1ROWA 1S7XB 5KOMC 5F1IB 3MLUH 4WEMB 3BJ91 5ILTH 1J8HA 3CMOH 1XR8A 3QXTA 2NW2B 5CIPH 1XH3A 4MQTB 2VISB 3BP7B 1JPST 3UTPE 5D1ZB 3UJIH 3WXWH 5IW6A 1U3HB 4Z77B 2Q3ZA 5IBUG 3WO4C 4TVPD 4NQEE 1T7VA 3V5DB 1DUYB 5F7NC 3ZKMD 1WT5A 1XZ0A 4Z9KB 4G9DB 5ESQB 1V7ML 4XCYA 1DVFB 3VFWA 3U4BL 1BLNB 2YRPA 3QG6B 1BHGA 3E8UL 3ZDYE 3O41A 5HHOA 5JDSB 1J9CT 4WUUA 5LBSL 1AR1C 4XCNA 3BD3A 2X9WA 5FV2A 4YFDB 2A0LC 4LVOB 4PP1C 5C09B 1P2CB 1R3LA 2HKHL 1MH5A 3L95A 4M1CC 4S1SL 3VRLE 1TZHB 1MREH 4MD0A 3HAEA 4OKVB 1QSVA 3E3QC 4OT1L 5EIIB 1HINL 1T2JA 3IU3B 4OF0A 1VADB 1YYML 5DRXB 5DYOA 2Z0BA 4D3CL 3FMGH 2C5DC 5F9OL 2WMPA 3SCMD 3T0WA 3UZEA 3T77A 3AAZB 1FVEB 1WFTA 2GTWA 3DRQB 3FN0L 1A3LL 3FQTB 4POUB 5DJCA 2DLTA 4IMKC 4U1HA 5ACMA 4PRIE 1A0QL 5DJXB 5E1AB 4I3GA 3BZDA 3V6OE 2IALA 3BZFB 3NPSC 3FTGA 3CUPA 5EU7E 2BNQB 2RFXB 1OAQH 2YD7A 1JZ8A 4NNPL 1FDLL 5JW4Q 2J4WH 2A74A 4NNYA 2C4XA 5IK3A 1FFNA 4X4YB 3KHQA 5ID1A 3F7RA 4P3DA 1URLA 3E6FA 3WO4B 2MMXA 3UBXG 2WBJD 1E0OB 5F7HA 1T21A 3MV9B 3IDGA 4P3WA 3ZDXE 1JMZA 1A6ZB 4BKLA 3ELAT 3B6SB 1NCWL 4LPTA 4G6AD 4QT5B 3FO1A 4K7PL 4XRCA 5IBLC 4OT1H 4WHTB 1ZKAA 1KCUL 1HINH 3HRPA 2CKBH 3L5IA 3SE3A 5F9OH 3LPGA 3O0RL 1I1YA 1NGWA 4LEOA 2XV6B 5ID0A 3SGDI 4YHPA 2Q7NA 3PWJA 1JIBA 3GSVB 3FN0H 1A3LH 2VLKB 4K8RH 1JI1A 2R1WB 3C8DA 3HZVB 2DQHL 3F7VB 4KK6D 4JR9L 1X7QA 4UT9H 1BZ9A 4MHHI 1WWWX 4HXBH 3DETD 1GHFL 3L3DA 2CIKB 1JNJA 4YBHA 4LCIH 4NNPH 3GB7B 3MFFA 4HD9A 3KDMA 2QV2A 2VUOA 3NCBB 5E2UL 4WFEE 2R4RH 4PJFB 4HK0A 4OSUH 2XXMB 3SDDB 3UO1H 5HPOA 3UZVB 2W9DL 2FGWH 1YY9D 4J3TA 3NPSB 1D5XA 1MFBL 2NTFB 1QACA 4FTVD 2P4AB 3LKPA 4HPYH 4ESKA 3QQNA 1PYWA 2X4UB 4K7PH 4YDKL 5GS0H 4OIIL 5JPNB 2BERA 4P3CL 1KCUH 4R6UA 4HF5L 3BIBX 3VXRA 3KJ6H 3FB5B 5EFIA 4HQQH 1OY3B 3RNQB 1PKOA 2EO9A 2HAZA 4ZUTA 4ZYKA 4U6YA 1HZHL 4PJ5B 4R4BB 4R7NB 1UB5A 5D5MB 5FM8A 4LCCA 4KXZI 4OCXL 1N2RB 4TTDC 1KIRB 3U7AA 1R24A 1PFCA 2H9GB 3BQUD 3S35L 1UWXH 3BHBB 1LQSR 2J8UE 1T7ZA 5HGHA 2PTTB 4PREB 4PBWD 3BEWB 3BKYL 2ZSWA 1I7UA 1ZT1B 3BXNA 2CK2A 4GG8A 1G7PB 5E2UH 3FZUD 2OM5A 3GRWH 3SKNB 1D7FA 2I9LB 3BGAA 4DWHA 5I8CB 2W9DH 4QGTA 1ZT4B 1TNMA 3S34H 1KENH 5F7WC 1T89A 4IDJL 4AIXA 1MFBH 2YA0A 3EJZD 1YPZE 1MWAL 5DJ0A 4PJHB 4EQ3A 3VGHA 1QSFA 3KPRA 1B4JL 4FQ1H 1MCHA 3ZDYF 1GSMA 3A6BL 3QAZB 4U1SB 4GSDL 4HF5H 1CGTA 3UPRB 4D0CB 5A40E 3BE1H 5IB4A 1UQSB 4P4RB 5D7LA 2V7HB 4JO2L 5F6HI 3VRLF 4XBPA 3W0WA 1KJ3L 5GJTL 3DMMD 4LRNL 3K2UL 2Y72A 1TZIB 1NAMB 3B3IA 4Y19E 4OCXH 2A73A 1S7SA 4S0TD 5AYQA 1HWHB 3LMJL 2R4SL 3F5WB 1FVCB 1YY8B 2D7QA 1SBSL 2FSEB 4LLYA 4P2QB 2L7UA 5F7EH 3M17A 1RZGB 3BKYH 5TGBB 1GJIA 3FQXA 4YH6A 1MVUA 2RQ8A 3C8HA 3VXSA 1INEL 1IGTA 1Z5LA 3KYNA 4JRYE 3HG1B 1I1AB 4JHAH 1LE9B 2G2RA 4MVBC 3U6RB 4ZXBD 5FYJE 2YD4A 3TZVA 3EO0A 1BEYL 4JZJC 3VXRD 4NO3B 1MWAH 1U8LA 2KPNA 3BIKA 1B4JH 1OTUD 2EKJA 2VDLL 3WS3A 3ULUC 1KCSL 1C5BL 1ZV5A 2ICES 4MLIA 3I2CH 5D7SL 5KS9A 4GSDH 5EC2A 2FEEI 4LDEB 5LXGL 3ZDXF 1I85C 3MXVH 5CLTA 3BDBA 4U7KA 3KJ4B 3O6KL 4MD5B 2EECA 1GL4B 5AAMA 3FQNA 5LGHL 4JO2H 4PJCE 1TITA 3H42H 4CN1A 4KROC 3K2UH 1LEGB 1NAKL 4HLJA 1ZA6A 5ERWB 4QHKI 1SYVB 3LMJH 1NGXA 3DX6A 3MPCA 1IEHA 3C09C 3X12A 4JCLA 4LLWB 1WIPA 4HCRL 3VWKC 1U91A 4F8QA 1SBSH 1BWMA 4YK4C 5D7KE 1C12B 4KK5D 4IRSA 3OV6A 4FQQA 2BVQB 3QHZH 3PHOB 5HGDA 1INEH 1CFSA 4AEFA 1S7XA 1FN4B 1Q0YL 1WF5A 4MCZA 1QSFD 3KPRD 3EIFA 5F7UA 4PV8B 2F53D 2P24A 1A7QL 3B5GA 3K8KA 4EN3C 3TJHC 1G6RB 3WSQH 1TQBC 5IFJA 2NW2A 1FNEB 1BEYH 3MJ9A 5AD0B 2YPKB 4D94A 1DBML 2C3HA 1CU4H 2NY6C 1MPAL 4LDLB 1OTSC 5D1ZA 3UC0H 4LFHD 4PJXB 4CN6A 3D6GA 5D7LD 1U3HA 4XB7A 2F19H 4L4JA 4Z77A 1MAML 3U0WL 5CJ5A 1HI6B 4I2XE 5T1DH 3FT2B 5D7SH 2Z91B 5L2JB 5LXGH 5K9KB 4F2MB 1QBBA 2VSDA 2XRAL 4JZJB 3UTSE 4G9DA 4ZUVA 5CGTA 4PJAE 1OF2B 3CJJA 1P5VA 2ERJC 5AUMA 1IARB 1MFEL 4JQXC 4ZQKB 5JDSA 2W65B 1WLHA 2IPUK 4QHUB 3H0TA 4CU8A 4JZNB 4RMQA 1D9KD 1VFUA 4HCRH 3VXSD 1P2CA 5FGBA 2H3NA 3DYMA 3TCLB 1NL0L 2E27H 1A4JA 4YIQB 4KROB 1AJ7L 4L3EB 4OKVA 5EIIA 5IEHB 1NGYB 3IU3A 5DRXA 3ZKSD 1F6FB 1KLUB 3V52L 2EDRA 1MJUL 3OGCB 3C09B 3ARDD 3O4LE 4GMSL 3WIIL 4MQXC 3DRQA 4LCYA 4YK4B 43CAB 2R29L 2P7TB 1Z2KA 3KXFB 1FG2A 5DJXA 1MPAH 4PBVC 4PJGB 3WFDH 3S3PA 5E1AA 2DYPB 3NACL 4RGMC 1MAMH 3U0WH 4PD4K 3O3EB 4JKMA 4MA1C 1R3KA 1U3YA 2RFXA 3WDHA 1YPZF 1TQBB 5IMOB 3RWDB 2XRAH 2P8MB 1W72L 3G5VA 2GSIA 4R4FL 2VLRB 3VE0B 4X80L 1OWRM 1P4LB 2NY6B 3HI1A 1QBMH 4DVBB 3PL6C 4X4YA 1MFEH 4JREC 1MHCA 3BUTA 1V8HA 4Z7VF 3LDBC 4IRSD 4LCWE 5I8KL 4KK9D 2C26A 3HAEG 1T22B 4PB0H 2X6MA 4DQOL 1INDL 3VFMB 1RZFL 3B6SA 1TVDA 5CP3H 1NL0H 2DKSA 3U4AA 3H9YA 4RMTA 4KMQA 1AJ7H 2Y1VA 4WHTA 2ERJB 4PGZA 1W0WB 4QEGA 1GGYA 2Q87A 5CEYB 5DTFB 4LLAA 3WMSA 3RGHA 1MCQA 5CGYC 3QUMB 4PJIE 3GNML 5D1ZD 4Y8AA 3P4LA 1WBZA 1U3HD 1AGEB 3GSVA 3DECA 4O51B 3RQ3A 2R29H 4P49A 4N0FA 1QRNB 4M1DL 3CFKB 3CFDB 3F7VA 3HZVA 4HS6A 5IW1A 4JG1H 3DROB 1PZUB 3KYAA 4J3UA 1UH2A 1PD6A 4L4TB 5EUOB 1DVFD 4XAKE 2BY2A 2CIKA 3LVEA 4QXTA 1X6LA 1YMMB 1X5LA 1K8DA 3QFJA 4K9EC 3OMZA 3GB7A 1W72H 1AGBA 2YBRB 2X4RB 4F58H 5FYJH 4C4KT 3IYLW 2ZNWA 2H26B 1HHHB 4KKBD 5C09D 1TJGL 4PJFA 1UEYA 4RGMB 3HMXA 4M00A 3SDDA 3WKML 1H3UA 4OFPA 4MA1B 5HI5C 4DQOH 5BZDB 5HBBA 4K3GA 1RUMH 4PJCF 1RZFH 4XBGB 5EBLB 2X4UA 2X2YA 5HGGS 2BXZA 4G42B 4XC1L 4Q58C 4MQ7B 5C0ND 4AENB 4CDHA 1B9ZA 5C08E 3MZTA 1IC4L 3S4SG 3QJFB 4JREB 3PJSB 1Y6MR 5DEZA 5ECJE 3LDBB 5GGRB 2WINA 3LB6C 3FB5A 4RGNC 1KPRB 5JXAL 3GNMH 2R2EA 3IFNL 4N0UE 5E56A 5FYKL 2CK0L 4N90D 1Q94B 4PJ5A 3GDBA 3L9RB 4R4BA 4R7NA 1NFDE 4K94C 3D3VE 1CWVA 2BNQD 4E42B 1N2RA 1KIRA 3LS5H 2H9GA 3G5XA 4KV5F 4LSVL 5A16B 3MROB 2PTTA 3K8MA 2BHYA 4PREA 3HR6A 5DK2B 2V2TB 3OJ2C 4UU9A 5FCUH 4HV8B 4M5YH 1VFMA 3MV9D 1G7PA 4U2YA 2F58L 4YO0B 4FG6C 2XQYG 1EFXB 1TJGH 5D2LE 3SKNA 1MAJA 5FF6B 4RZCA 5I8CA 2EC8A 2F5AL 4OZFG 2JJUA 3VRJB 5FDWB 5HHXL 3JWNC 4YR6A 5GRYA 1UWGL 1JHKL 4PJAF 3C6LC 1H3PL 3D48R 4PJHA 1E4XI 5CJ8A 1AR1D 2ZCKL 4XC1H 5JIKA 3D39B 1CGVA 5EA0L 2A0LD 4RX4A 1IC4H 4LIQE 4B50A 4PP1D 1RULL 4D0DB 4U1SA 4V1DB 2VLKD 4D0CA 4M1CD 4F15B 1M7XA 3QDMD 4P4RA 4UUJB 3IFNH 5BW7C 1S7UB 4OGAC 5FYKH 2CK0H 2AGJL 4XBEL 1O7SA 1YN6B 3KYKL 4ZSOE 5F1NB 1CFQA 3H3KA 2OMNA 1QD0A 3BN3B 4J3WA 5DC4B 3VA6A 3K81A 4I3SL 1G9NC 3CMGA 4WGWB 4LK4A 4LSVH 4LLUB 2VR4A 1B0RB 4RGNB 1YNKL 5ENWB 1HYSC 5C0AA 3QQ4B 4P2QA 4Y4HC 5A2FA 1QFHA 1RZGA 3MRJB 5TGBA 5ICXB 5DD3L 3ZSSA 3FFCB 4NCC1 2ZCLL 3HUJB 4EDXA 3ULUF 3NA9L 4OUUB 3HG1A 1KV3A 1I1AA 1AIFB 1TFHA 1LE9A 2XFXB 2UZIH 3U6RA 2P5WE 3HC0B 5JHDB 2WP3O 4OZGE 5HHXH 3W81A 1JHKH 1IAMA 1DLHA 2O5XL 4NO3A 1A6TB 3RWEB 1JHLL 1BJMA 2ZCKH 4LFHG 1M1SA 2ZSVB 3NFPB 1NCDH 5T1LB 5E8NA 2EXYC 1RULH 2PW2B 3MRCA 4QXGH 1VFOA 4PJ5D 1RJZB 4OTXL 1KSRA 1NCNA 2ZPKL 1N6UA 2QBWA 2HFEB 4D9RD 5IBLD 4MD5A 3ARFC 3T2NH 1EAPB 3C6LB 2AGJH 4XBEH 5GRZA 3KYKH 3FQWB 3QXDA 4Y16C 1LEGA 3CC5A 2VXVH 2FLRT 4I3SH 4PJIF 4G80A 4ENEC 5IWLC 3HCVA 1XCQB 5D96C 2LU4A 4NCDA 1C12A 1YNKH 3BD4A 3BZEA 5JA8B 3GMNB 2OCFD 3KVQA 2BVQA 2ZCLH 3WL9B 4ELMB 2N4IA 3NA9H 4LGRB 2ICWJ 4CVWA 1Z3GL 5DR5H 3MV8A 4ZFOB 4NKMB 4BQ8A 3GBNL 5BCAA 3T65A 3T3ME 2GQHA 5AD0A 4JM4L 5ANMB 2YPKA 4Y4HB 3CH1B 1X5IA 5INDB 3V7AE 1FFPA 4PJXA 3TT1L 3RWGB 1HI6A 2EXWC 1IQWL 3FT2A 1RFDH 4GRMA 4YAQB 4CU6A 4OTXH 5JIHA 5FYLL 2R2BB 5K9KA 3OAZH 2ZPKH 4F2MA 4JZJA 1OF2A 3KPQB 4AY0A 3KR3L 1I9RH 4WEUD 5ESAA 1T3FB 4ZQKA 4P2QD 1IBGL 5J1AB 4QHUA 2H32H 1CTNA 4JZNA 2A6KB 5EO9A 4G9FA 4E41E 3RWCA 3ARFB 3HG1D 4FQXC 3TCLA 1NFDF 2EYSA 3QUZC 4YIQA 5IEHA 5DSCB 2X4QA 4XPHL 4NC0B 5D2NA 1FAIL 1NGYA 5CIPB 1EFQA 3EOTH 5HHME 4X9IA 3OGCA 4Q6IA 1U2HA 2CDEB 2VKWA 3MRIB 1BQHA 1ONQB 3UJJL 3O3UN 5D96B 3GBNH 43CAA 2V5TA 4JM2F 3KXFA 1D5ZB 2XTJC 3KLDA 5C0IB 5T5NG 2DYPA 5D2LF 2V17L 3O3EA 4HWBH 5DMYA 4ODWA 4OI7A 5H8DA 5DJDB 4FQ2L 2VXUL 4M03A 5FYLH 4ZAKA 2NY5L 2EDDA 5IMOA 3RWDA 1G0XA 5F7FA 2XG4A 4HIIB 1WISA 1JGUL 2VLRA 1OAZL 3KPTA 2BFVL 3VE0A 1GOFA 5D93C 1P4LA 1AI1H 4DVBA 2YSSA 5FUZH 1IBGH 4K23H 1T22A 4CADB 4LIQH 3KS0H 1FO0L 4W4OC 2V9QA 2ZG1A 1VPOL 4GRWE 5I1DA 3QDHA 3SQOL 3BH9B 5FECB 1W0WA 1FAIH 1F11B 1KC5L 1WIOA 1IGYB 5CEYA 4JQXA 5DTFA 1MY7A 3PXHA 4L5FL 4X99B 5HD8C 3QUMA 2JIXB 4CVXB 1CG9B 5SWZE 3UJJH 2HTLC 4O51A 4YDVA 2VB5A 4FQXB 4OM1H 3UPAA 1AR2A 3QUZB 4MVBD 2XKSA 3BX7C 2GUOA 5IB5A 3DROA 5HGBB 3TA3C 4HUMB 4MYWB 4L3CB 2CO7B 3IKCB 4L4TA 5EUOA 1ZLWK 4OZGF 2MFNA 1CFNB 4FQ2H 4XCCL 2VXUH 1LE5B 2WAHA 2G75B 2NZ9D 4R97C 1I3RB 3RX7A 2WUBL 3IDMB 3QWOB 3LN5A 1OAZH 2X4RA 1JUFB 3RPIA 4GXUM 4DGVL 1KCKA 4IRJA 4HFUL 4HK3N 4LSRH 2X41A 2EDLA 5SX4I 2FL5B 4OCYL 5DJ8B 1AC6A 2VH5L 4KROD 2GJ6B 4L3ED 4PJBE 1FFQA 3MC0A 1P7QA 5BZDA 3OTTA 5EBLA 1FO0H 4G42A 3S36X 4MQ7A 1VPOH 4KTDL 2YD3A 3EW3B 3WIFB 5D93B 1L7IL 1NKRA 3MOBH 5J6GB 3QJFA 3PJSA 1U8QB 3KXFD 5GGRA 1ED3B 4XP5H 1KPRA 4UTBL 2VZ3A 1X5HA 1J5OL 1I1CA 2DYPD 4M7JL 2PN5A 1Q94A 1NJ9B 4QRQB 3GFUA 3O6LH 3BPLC 4JQVC 3QO0B 2A77H 3EDKA 1EA9C 5JO5B 5TDOB 4ZO9A 4EN3D 3TJHD 3EGSB 4KKAC 4KVNL 3Q1SL 4F7EB 2VLRD 5A16A 1AY1L 2R2HB 2FWOA 1U8HA 2NY6D 1WUNT 1ZS8B 1OTSD 1FORH 1RUQL 3MROA 4XCCH 2XTLA 4FQJH 3T3MF 1AXSB 1RIHL 2V2TA 1CL7L 3OXSB 3LH2L 1FGNH 2CLRA 4QWWC 2AV7B 4HV8A 4KWUA 4U0RC 5DRNB 1FBIL 3BKCL 4QRPB 3JSSA 4YO0A 1A9EB 1EFXA 4X7TB 4X4XA 1R5IB 5FF6A 4HFUH 3TA3B 4GRLC 4AIZA 3C8KB 3VRJA 5FDWA 2VH5H 1CR9H 4X6CE 4WO4B 1HHGB 1KOAA 5F8RC 2YUWA 4P4KC 4KJPC 3P30L 4R97B 3CSPA 3U4EB 4YHLL 5BVJB 2QR0B 1L7IH 3T0EE 5JOPD 4D0DA 3L3HB 1I8IB 2XWTB 4ZD3H 5T33L 5E1HB 3QNZB 1YJDL 2B0SL 4PRHB 43C9B 4NZJA 1F3DJ 2FIKA 2DQJL 4UTBH 5DRZB 1QRND 2DLFH 4M7JH 1S7UA 2IMNA 1DQDH 3IFPA 1YN6A 2UWEB 3RHWK 2BNRB 4PTUB 5F1NA 4W6YB 3BO8B 1YMMD 4MQXD 3R4DA 3PWVB 3M8OL 1AFVH 5GZOC 3IDJB 2Y07H 4LLUA 4OF3A 1B0RA 5EUKB 1DQQA 3OAUL 1JWUB 5ENWA 2AEPL 3QQ4A 3ECBA 5EU4B 2VMFA 3LH2H 5BMFL 5HHPB 3HUJA 1Y18A 1FBIH 1VFBA 2XT1B 4G6MH 5IMMB 1N0XH 5FHBL 4ZTPL 1WBYB 4EOWH 5I1AB 5JHDA 3R06B 4G8GB 2XXCB 5TF0A 4J3VA 4OLYL 3QEGL 1CT8A 3DX7A 3KNBB 3WXVL 1Y0LB 1YYLL 4KZEL 1QLFB 4YHLH 3VWJC 5TQ2L 4HPOH 4U0RB 2ZSVA 5E08L 3NFPA 2GEEA 5T1LA 3P4NB 4XP9H 1V3JA 2PW2A 2D4FA 2AJZB 2VKXA 4XMLL 3TH3T 4GRLB 1SJHA 4ERSL 2DQJH 2HFEA 4KZDL 4KRPB 2RAMA 4CU7A 1RK0A 1CLYL 4JHWH 1EAPA 4P4KB 2E8ZA 5GGQH 2R8SL 2D31A 3FQWA 5CGYD 5EBWA 4X4ZA 1AE6H 1QA9B 3C9NB 3GKWL 2NY1C 1EGJA 3N50A 1QBLL 2E9BA 3HR5B 3M8OH 5JIIA 1U6AL 4GRWH 4HGMA 3AS3A 4HBCL 2FX8H 5KVFL 1D5IL 1XCQA 1Z0MA 4GW5B 3OAUH 2KDGA 1EFXD 2AEPH 2AJSL 3GMNA 4LF3B 4PRIB 4MAYC 3IFLL 5BMFH 3WL9A 4ELMA 2A9MH 1MWAB 5HHQB 2F8XC 5KOVC 3H9SE 3S6CA 3GMMA 4ZTPH 5FHBH 5EZJB 3D39D 4ZFOA 3PABB 3P11L 2HKFL 4OZIE 4V1DD 3WJLC 3QPXL 1BFTA 4LPCA 4OB5L 1EJOH 3SKOA 5INDA 3WXVH 1YYLH 4KZEH 3NCJL 4UQ3B 4U6HB 5E08H 4JFPA 3EOAB 5HI5D 2W9EH 4OLXL 1XT5A 1MI5B 2VXSL 2JJWA 4XMLH 1TVHB 4PJBF 5C92A 3ABZA 4ERSH 4RIRB 4PUBH 4ZS7L 4DN4L 3QEQB 1L9NA 4UZGA 5C6PB 5SWSB 3VFOB 2W92A 2B1AL 3KPQA 1KELH 4F7TB 3LB6D 2PR4L 2F8VA 5LJYH 3MRFB 3VWJB 3MUGB 4RGND 4PJDB 3GKWH 1T3FA 4OCRH 4ZNEE 1NLDL 5J1AA 3WLBB 1U6AH 3FFCD 1RIVH 4HBCH 2OK0L 4PGDB 4DKEL 3QG7L 2JCCA 4U1KB 1B4RA 4GXVL 4BFBD 1ZSDB 3IFLH 5DSCA 1BQLL 5JHDD 5CIPA 4F37F 3L7EA 1EAJA 4ZFGL 1S7QA 2NY1B 4H8WL 4LOUC 1HE7A 5E6YA 2CDEA 1L6XA 3MRIA 5IWLA 1ONQA 3P11H 5J13B 2HKFH 5IROA 5T1LD 4NRYA 4FG6D 4JFHD 1FSKC 4WI7A 2DF3A 4PRPD 5D7IB 1D5ZA 4MAYB 3QPXH 3V95A 4WI2A 2D9QB 3UTOA 5GRUH 4WWKB 4ZODA 3NCJH 2APFA 3CDCA 1NLBL 3C6LD 3BRDA 3KYOB 1K5NB 4NYLB 2VWEC 5DJDA 2XN9E 4DTGL 4X6CF 1HCVA 3ES6A 4DN4H 3I6LD 1TVBB 1IM9A 1RY7B 3T04D 1JF6A 2OZ4L 1EVTC 1DZBA 4RQQB 2PR4H 4XAWL 2D7TH 4MJ6A 5FA4B 3JTSB 3GMLB 5IVXB 1A14H 4C59B 4FQLL 4GG6E 3P77B 1MCNA 4R3SB 2OK0H 4DKEH 3PGCB 3QG7H 5EB9A 3U2SB 1F58L 2DQDL 1CXKA 4G43B 3O2WL 3NOIA 2VRAA 4NC1C 1N6QH 3BH9A 5I19H 1F11A 2R56L 4H25B 4ZFGH 1HYSD 4F9LA 2OP4H 4Y4HD 2EIEA 1QFPA 2J8UB 4OF8A 2JIXA 4NQCE 4HZAA 5E5MB 4CVXA 1CG9A 3P73B 1VGKA 5BZWB 1KIPB 4BM7A 3OPZH 4FQXA 3K3QA 4M3KB 2BOCB 2H45A 3FHAA 2J5LC 1HSAB 2F54B 5DQJA 4JY5L 1LMKA 4M48H 5HGBA 3HE6C 4HT1L 1ZANH 3ISWA 3IKCA 4HKXA 1NLBH 2WWMC 3BKML 1CFNA 3NH7L 1GGBL 2FGZA 3LV3B 4LLVB 2G75A 1TMCB 1I4FB 3I02A 2EXYD 1I3RA 3IDMA 3QWOA 5E9DE 4FQHB 2OZ4H 4F80A 1JUFA 5T1KB 1CK0L 5I1CL 3P9MB 1YEGL 3STBA 3ARFD 4WFHE 3SDYL 4O9HL 3ROLB 2E6QA 1C8PA 5DJ8A 4FQLH 2GJ6A 4HLZH 5F71A 4DCQB 2L4OA 2CLVB 2CKBA 5DJ2B 1U41A 1F58H 5FKPB 2DQDH 2JJSA 3O2WH 5C0DA 2DN7A 3WIFA 3QXUA 4ENED 3EJYC 3OJDB 2R56H 3RBGA 3GZKA 4ALAL 5J6GA 4NKDA 1V7NH 3MGOB 4AEEA 4AL8H 1E28A 2BMKA 1ED3A 4IJ3C 3W82A 1FLTX 4ZO8A 4ZPVA 5I18L 2ICWB 4HW6A 5DMGC 5C07B 5EU6E 2MHAB 5L9DH 3WHE0 3DV6B 1NJ9A 4QRQA 1DEEA 1S5IL 1JK8B 4UOW0 1NDGB 5JQ6L 5TDOA 3AROA 5JO5A 4Q2ZB 1OAYH 4JY5H 4I1NB 4P2OA 3MRBA 3EGSA 1W72B 3Q3GB 1FE8L 1I9JH 1A7OH 4F7EA 1S78D 5ISZB 2R2HA 3FRUA 1QP1A 3NH7H 1GGBH 4OZIF 4M9OA 1AXSA 5ICZB 4UOJA 3EO9H 1I8LA 1II4E 3OXSA 2EXWD 1OHQA 3QPQC 4NZRL 2AV7A 3ARVA 4NHUB 5GZNC 2VN4A 1JPFB 2J5LB 4QRPA 5C86A 1A9EA 2NQCA 1MLCB 5I1CH 4X7TA 1XF3A 4TSAH 1R5IA 3HE6B 1DLFH 2LABA 3SDYH 1KB9K 3H7BB 3C8KA 5I74B 1UB6B 2IQ9L 5KBNC 1A6AB 4WO4A 1HHGA 4WW1B 3PQYB 1QSEB 5ALCH 4C56A 2DOCA 3U4EA 5BVJA 2JIXD 2QR0A 4Q9QL 1PW3A 1GVIA 4QYOA 5SWQB 3RZCA 1I8IA 2XWTA 3QNZA 4FQXD 4I9WD 4PGJA 4LHUB 3BVNB 4OGXL 3QUZD 5DRZA 5I18H 4KHTL 3F7YB 4XPFL 3DX9B 5FOBB 1UA6L 1VACB 3LEYH 2BJML 4RFEA 1DUZA 1ZHLB 1T6WA 2BNRA 2WIIB 2ZJSL 3LY6A 5JQ6H 1FNGB 3DTXB 2EE3A 1CGUA 4JG0L 1FE8H 1IKFL 4IJ3B 2IANB 1YQVL 1T2QL 3GRWA 2R23B 3AGVA 2C3XA 3I9GL 1CFBA 5FB8B 5E5RB 4U1NB 3FT4B 3MNWA 2HJFB 5H94A 2NZIA 3G04B 4JQVA 1GH7A 5HHPA 2GJ6D 3IDNB 3E1F1 2ENSA 2ED9A 5FO9B 4XI5C 3ARWA 4I8DA 3VXNB 1WBYA 2V9RA 5I1AA 3R06A 2KZ1B 4LPVA 2Z4QB 3PWPB 4WFFD 3QWRA 5HDOA 3AXLB 2Y36H 4MNQB 1J86A 3KNBA 1XGQB 1MCWW 1Y0LA 1QLFA 4TULL 2MCPL 2BP3A 1KTDB 2Z8RA 3SKUD 2DIJA 1P84K 2AJZA 4JHZA 1CS6A 4GG6F 2VSCA 3BT2H 1CD0A 4GRLA 4YC2C 3ZE0E 4CKVX 1GOHA 3L3OB 3MLRL 3WFHB 1UA6H 3GSXB 5KN5B 1XGRB 4KHXL 4NWTL 4NDMA 5I0DA 1FZKB 5HD8D 2ZJSH 3PV6A 1QA9A 4P2RE 1FZJB 4P57A 3B2VH 3HR5A 1QEWB 2HTLD 5MEPB 3O4LB 4UNUA 4JG0H 5C9KA 1IKFH 1MCKA 3L3JB 1D6EB 4GW4A 1J05B 1T2QH 3K0WA 4JHBA 4PRIA 3TA3D 3GMPA 5CUSH 1KGCE 1RUPH 1N4XH 1GRWA 4QF1B 1YMHA 32C2B 4WO4D 1MWAA 3V6OA 1JE6A 5HHQA 1WZ1L 1HXYA 4KI5C 5A2JH 4ZOAA 3ARBC 1IGFL 2WBWB 4JPVL 4DVRL 3PABA 3P4OB 1K4CB 1M7IB 3DV4A 4PRHD 1CGXA 2QSCH 4GT7A 4UQ3A 5EO1B 4U6HA 2MCPH 1XGUA 5D72H 3OZ9L 1MI5A 2QADB 2BNRD 1Q9WB 4RIRA 1N7ML 3QEUB 3MLRH 3QEQA 1VB9A 1BM3L 1TETL 3VFOA 5IOPB 4NWTH 3MRFA 3ZMRA 4KUCF 1SBBA 3MUGA 4PJDA 4ACPA 4X7SL 4UV7L 5JW5B 3WLBA 1PGRB 1FVDB 4CVUA 2IQAB 1C5DB 4KKLC 2OR7A 4YC2B 4FXKB 1XMWA 3CFBA 4U1KA 3VG0L 5HHNB 3M45A 4KKAD 4KPHL 1BQUA 1SEQH 2ATKA 1K9TA 1ZSDA 3W39B 5E03A 4G8GD 1HILA 2CGRH 1CXHA 2CQVA 1EEZB 2LTQC 1J7VR 3TBTA 2Y7QB 2OJEB 4NQXB 3IAPA 1AXTH 4XMKH 4QWWD 2DQUH 1IGFH 4W4NA 3L7FB 3VXPB 2VIRA 4DVRH 2HLFD 3K74B 1VEMA 3QWQB 4WHDA 1DN0B 1L4IA 5D7IA 4MAYA 3U9UA 5B3NA 1JYVA 4GRLD 4WWKA 1B0GB 1BVLA 5GGUB 5I1JH 3RJDA 3ARGC 3LEXA 4BH7B 5MP6L 3KYOA 4P4KD 4KJPD 3OZ9H 4TPRL 4NYLA 3ULVL 3LN9A 4HIHB 1N7MH 4OD2B 3QNXB 4WCYH 1JGDB 2FJHB 3WNNA 5IMKB 3HS0B 1UACL 4YNYA 1NFKA 1TETH 2H32B 2IF7A 4NN7C 4Y5YA 3GHBL 4XMPL 3O81A 4HCRA 1W0VB 2EDWA 5FA4A 3O3AB 3GMLA 3BP5B 5DDHB 3S37L 3VDBA 4XCFL 4A6YH 1NUNB 3O9WC 3P77A 5F7DA 4R3SA 3RPKA 3PGCA 3WCYA 1B6DA 3U2SA 4G43A 2X4SA 3QA3B 4R2GC 4KPHH 5SV4A 3D3VB 5I66B 2IG2L 5GZOD 2ADJA 5ACZA 2NY5C 3LS4L 4H25A 5BV7H 3LD8B 4KRNA 3R8QA 3MV7B 4GMTL 4U6XB 2GK0B 3ARSA 5DMKB 4U0QB 2D4DA 2J8UA 5E5MA 4FABL 4WI3A 3BMWA 1VHPA 4CVZB 1JBJA 3C87A 2ZG3A 1ZGLB 2BOCA 1MI5D 2ZG2A 3OG4B 1HSAA 2F54A 1MCJA 1N8ZA 3QEQD 3G5YA 4H0IA 3NZHH 4DGIL 4JRXE 2LTQB 5SWSD 4LSQL 5SX5H 3HE7C 4TPRH 3DXAD 1I1FB 5DXWA 2DD8H 5GGVY 5IVZB 3VWJD 3CAFA 4X9FA 2A38A 2BNUB 3GJFB 3LV3A 1H5BC 4LLVA 3PF2A 5F89B 2FNBA 2F9BT 2CR3A 3CX5J 2J6EH 1FIEA 4FQHA 1A6PA 3GHBH 4XMPH 2WQ8A 5T1KA 1PJ9A 3JTTA 2CRIA 3VH8A 3HA0A 3P9MA 5MHSE 2PYEB 5CP3A 2GJJA 4JFYB 4XC3L 3ARGB 2IBZX 4KQ4L 3S37H 1KJ2L 3ZE0F 5HJ3B 1IE5A 3RVTC 4P0DA 3C5JA 1R3IH 1RU9L 1F3JB 1KLGA 4LARL 2NY1D 1NMCC 3MGTB 1A22B 1FHGA 3L3IB 4ZOBA 5HDQL 4NN7B 1A21A 1A6VH 2Q8AL 2IG2H 3MLYL 3OJDA 2SEBB 5IJKA 1UZ8B 3HMWL 2YXFA 2QHLA 3CVIL 3MGOA 1J1XH 1Q72L 2EYRB 1HN1A 4MAYD 2IMMA 4Z5RB 3O9WB 4MCYB 4FABH 5KSBB 5C8JB 4LNVA 2MHAA 3DV6A 1KCRL 1KFAL 1EO5A 1MUJA 2A6DB 4R2GB 5FYKU 5C0BB 3QNYB 1NDGA 5A3IC 4Q2ZA 4CJ1A 3GSNA 3QXVA 4JRYA 2EH8L 3CIQA 1W72A 3Q3GA 3JV0A 3QXAA 4JO4L 1VFAA 1EHXA 1PSKL 1DDHB 4LSQH 5ISZA 3RDTA 2KL6A 5BS0B 3IU4H 4LAQL 4AM0B 3G9VA 3B9VA 3S88L 5GSRB 1J8KA 2BSRB 3BYTA 4FFWD 4HG4J 1MLCA 4LSDA 3L6FB 1FO0B 3V5KA 3TO2B 3H7BA 4KQ4H 1KJ2H 2UUDK 4HS8L 4OF5A 1OCWL 1Q38A 2FX9H 4PJ7B 4WW1A 1RU9H 3QHFH 1IEBB 4QRTB 1F02I 1ORQA 4MWFB 5IFHL 3F12B 4M6ML 1QSEA 5LWYH 4LPYA 3TO4A 3NABL 5HDQH 35C8L 2WIMA 4YHML 2BDNL 3PIQB 5SWQA 1KYOJ 4BQCA 3PP4L 4U6VH 1NUDA 4AH2B 4LHUA 2GTZB 3BVNA 5DFTA 2F54D 3DJ9A 5FOBA 3KPSE 4LKXB 4EI6B 1KFAH 1IGCL 4K7PX 4LOUD 1ZHLA 1NMCB 4Z7WB 2XNAA 1RZJL 2WIIA 4K3EL 3DX8B 5T3ZE 3ZL4H 1UH3A 4Y89A 2I24N 3MFGB 2EH8H 4DKFL 4LASH 4TSBH 4JO4H 4TUJB 2EDQA 4PJEB 3L5JA 5CGMA 4LSUL 3VRIB 5T1KD 2R23A 2BCKA 1OB1B 4HJJH 3FB6A 1YJDC 1QO3B 5CP7A 4KAQL 4CAGA 5FB8A 1ZVHA 2VQ1A 4O2CA 4U1NA 3FT4A 2HJFA 3S88H 4XX1E 1GGTA 4FQPA 3IDNA 4I2XA 2YK1L 4Y1AE 4HHAB 1VA9A 5FO9A 4GLRH 3VXNA 4NO5B 2EIZB 1VENA 5DHYA 2EDNA 3BZ4A 4HS8H 4O2EB 5D8JL 5J56B 3EZJB 1OCWH 3UTSA 2EDKA 3PWPA 5IB2B 4PJAA 4BSVB 5TE6H 5IFHH 2NX5B 5EOCJ 1XGQA 4L8DA 5GIRA 3VI3E 35C8H 4XVTL 3V6BR 1G7LB 4YHMH 1KTDA 5C07D 4ODSL 2JB6B 3DUSB 4TOYH 3IVKB 3FCTB 3L3OA 4GKOA 1A6UH 3WFHA 1OAKL 4XWGH 4NM8L 1CD1B 5C70A 4J4PC 3P0VL 3ZKND 5KN5A 4V2BA 1XGRA 4HFWB 1CLOL 1IGCH 5I17B 4BH8B 4PV9B 5ISZD 1RZJH 4ZG1A 3CSGA 3BEVB 5LQBL 1NC4A 5BJTB 1FZJA 1UZ6E 4DKFH 4X5WA 3WFCL 1QEWA 5MEPA 3O4LA 2Q3AA 5F96H 3SE8L 4PRAB 1D6EA 2HG5A 1J05A 4LSUH 4NC2B 4HUUB 1CXIA 3HE6D 3BISA 5JW3H 3VD9A 12E8H 1W8NA 3DARA 2NXZC 4QF1A 5IB3B 2WWMD 32C2A 3N1GC 2YK1H 4NBXB 1Y6NR 4HIXH 3PQYD 4X8XA 3S35X 4YGAB 3FQRA 1F3DH 1QSED 4NO2A 5CZXC 3G5ZA 2DQGH 5T5FL 4F7MB 1VDGA 4V2CB 1TDQA 5D8JH 4MA3B 2E7LC 3GIZL 3MJ9L 2VE6B 3NMEA 3T0AA 3S3SA 1M7IA 4YDLC 2XZZA 3H9ZA 4LHUD 4S1RH 3QYCA 1S9YB 1YNTB 1MCOL 2DB8A 3MCKA 4ODSH 4QCIB 1RZIB 2CDGB 5HYFA 1Q9WA 1UENA 3QEUA 4FFZL 1OAKH 3EJYD 4NM8H 3GM0A 3O6FC 2QSVA 1DE4A 4GRWB 5HHVL 5L8LB 1CLOH 3RWHA 5B39A 4MX7B 2IAND 1X44A 1H8OA 1T5WB 5DMGD 4ONFL 1OGTA 4X5LA 5F9WC 2WUCH 1FVDA 2LV4A 3U9PH 1SMOA 1IQDA 2ZWLT 4L29B 3SE8H 4FXKA 2E9WA 3KPMB 1HQ4B 3B2UD 1HQRA 4IMLA 5HHNA 4D8PB 3UCRA 4ZDHB 4GLRI 4X7FC 1X5AA 4JAMB 3PWPD 4MNHB 5DVMA 3HPJA 4QY8B 4NQXA 2OJEA 4MNQD 5D1XC 4U3XA 3QPQD 1CFVH 3KPNB 5GZND 1XCTB 3L7FA 1OGAB 5FYKD 3SBWA 4NIKB 3QIWC 2FH6A 2P5EE 1B0GA 5E0QA 2NXZB 5GGUA 4TVSa 2JTDA 4EVNA 2QJDA 4M6OH 3D5OF 3MQIA 1MCOH 1PY4A 1T1ZB 3QDGE 2VLJE 5AZEL 1RK1B 4I13B 3SOBL 2D3VA 4D2NA 2DLEA 3EYOB 4HIHA 4H8WC 3QNXA 4FFZH 2FJHA 5FGCB 3HS0A 5DJYB 5MENE 4ZPTB 3WNMA 4GXUN 1A7RH 2H32A 2V6HA 4YDLB 5GS2H 5C08A 1R3HB 5HHVH 4Y4FA 3DVGB 3RUGB 1JNNL 5B8CA 4JZOB 4KJWD 4MGXA 1GGIH 5FUOL 3O3AA 4ONHA 1WZLA 1U0QA 3WUWB 2JELL 3FJTA 1A1NB 2R39A 2VOTA 5C71A 4YHOL 3SO3C 5H2BB 4XNXL 3O6FB 1Z9OA 3QA3A 1T1WA 1HHIA 3D3VA 4R7DB 4Z7UE 3FRPA 1IC5H 3ESVF 5K9OB 1KB5L 1AQDA 1QVOB 2B4CL 1FP5A 4LSPL 2JJTC 4G7YH 3SKMA 3RL2B 3QFDB 4P46C 4JFEE 1WEJH 4KTYA 2GK0A 5DMKA 5IMLB 1JFQH 3WHXA 4HBQA 1KBGL 3PWUB 2X4PB 1NFIA 4OFKA 5DFVC 4HWBA 4CVZA 5HPMB 3IJHA 5DD0H 5DVNA 4XI5D 1ZGLA 5J3HC 5F1SA 4UTAL 1F8TL 1RD6A 5TJWK 3OR7B 5D2LA 5DJZB 1CE6B 3V4UL 5BRZB 4WFGE 2FO1A 1NUFA 4YXHL 5D1XB 4WJ5B 3X3GH 1I1FA 5IVZA 3ILPA 1OW0C 4X8JA 1MJJB 4S2SB 5F89A 5ELIA 4F9PA 4UIKL 3VI3F 2OTWA 2AKRA 3WJJA 3QIWB 2FECL 4R96B 4HKZB 4ODHL 2PYEA 3HMXL 4ZMAT 1SMAA 4JFYA 3TYGH 5JNYA 4GKNB 3ARGA 1LNUB 2JELH 5MI0C 4E0RA 2ADIB 5HJ3A 4JEGB 4YHNB 4MB4A 3IRZA 4NZTL 4O2FA 5DJ6B 1F3JA 4JFFE 5GHWH 2DDQL 3F65A 5H37H 1UVQB 2NY0C 3MGTA 4ZSOA 4RNRB 9CGTA 2IAMC 1EEYB 3NVQA 4KRLB 4LPUA 1H15B 2SEBA 4G3YL 5JZ7C 1UZ8A 1KB5H 1UZ6F 2BVPB 4IS6B 4LSPH 4QHNA 3IDIB 2EYRA 5TDPA 3WNKA 1KBGH 3O9WA 4NFDA 4MCYA 4LGPB 3SDXE 5KSBA 5C8JA 2VDNL 3JVGC 1ZA3A 3SO3B 3AFLA 2A6DA 3QNYA 4KI5D 1F8TH 2KQNA 5AZ2L 1CF8H 1MNUL 2DI9A 4PLJC 3V4UH 2OTPA 1DDHA 4P46B 1S9KC 2Y5TB 3OKKB 3C60C 5MEQB 5J1TC 1C5CH 1QPXA 4OZGA 4YXHH 3DRTA 2AJXL 2R1XB 5BS0A 4YUEL 4AM0A 5FHAH 4X5XA 2J8HA 1EMTL 3DUUA 2YPVL 2BSRA 4OUOA 1K6QH 4B53A 1TTUA 1F4XL 3L6FA 1FO0A 4ODHH 2D0GA 3TP4A 1GAFL 3TO2A 3K1DA 4LBEB 1LGVA 2EH7L 3PNWB 5CCKL 1FFRA 4NZTH 3PUCA 3STZB 3WLWC 1IEBA 4QRTA 1ERNA 3MV7D 4BK5A 2H1PL 3SGKA 2W07A 1VKXB 2AK1L 3SDAC 1HSBA 2AK4E 3PIQA 4KKLD 1NCCL 1OTTC 4G3YH 3P0YL 3NZ8A 1YZZA 2HLAB 4CW1B 4W70A 5FYLD 3ALXA 1JCKA 1NSNL 1PBYA 3BGFC 1N3NB 2XICA 2XZQL 3WEXB 2VDNH 5TPWL 3ZT5A 3ZTNH 1G6VK 4O5LL 3O6ML 4HEME 3DSFH 2NY0B 4Z7WA 1TCRB 3BP6B 3DX8A 2ID5A 2IAMB 3QQ3B 4NJ9L 3IAGC 1S9VB 4G8FB 3H9SB 1T03L 4PJEA 2EICA 1A1OB 3ARPA 3NAAL 4HUKB 2AJXH 5F9JB 4TN9A 4DN3L 2PYED 1QO3A 3QCUL 1TNNA 4JKWA 3ARGD 4R8WL 1AC0A 5T3XL 1QTYT 2YPVH 1JPTL 2BVTA 4RFNB 1P9MC 4HHAA 4XXCA 1F4XH 5JW4M 1GAFH 2D03L 1PG7H 2EIZA 3IJYA 4PGCA 2EH7H 4MZ2A 4O2EA 5CCKH 2IGFL 3EJJX 4PJ9C 5IB2A 3MNZB 4ZFFB 5E7BA 2NX5A 3DVNB 3VXOA 3OKMB 4Y5XA 3WNOA 4LHUG 4PGBA 1Y6KR 3FONB 1G7LA 3O9WD 4OLWL 3N9GL 3U0TA 5FM5M 2JB6A 3VXTA 4F7CA 1LO0L 4RFOH 5CJBA 4TNWK 1T80A 3DUSA 4R2GD 5C0BD 3FCTA 1NPUA 4X7EC 4E41A 1NSNH 2XZQH 3AU1B 3TIDA 4H5SB 5TPWH 4O5LH 3O6MH 4HFWA 4Z7UF 3EFDH 3WE6B 5I17A 4KK8C 4RDQG 2FRGP 5F70A 3SDAB 5BS0D 5BJTA 4P48A 3IDYC 1E4KC 3PDOB 3D18A 1LK3H 4NO0A 4NP4L 1HNGA 1OAUL 1HKLL 5C2BL 2QQQA 1TTGA 2IH3A 3BGFB 4U1IB 4MDJB 3FOLA 1F6LL 1QYGL 3REWA 4QRRB 3CZJA 4R8WH 5T3XH 3IFOB 1A1MB 1JPTH 3T2QA 5BOPA 4I77L 2CKNA 4GH7B 3ZHKA 1P7KB 4C54A 1CL7I 4MDIA 2D03H 4F7MA 1RIUH 2CD0A 5CHNA 2E9IA 4LLDA 1H0DB 2IGFH 4OM0H 4CJ0A 3X3FL 1P5UA 1KXVC 3RY6C 1MLBB 3TBVA 5IHUL 3FN3A 4BJLA 3RVTD 1S9YA 1YNTA 5E2JA 4QCIA 1RZIA 5L2KE 1MIEL 4AT6B 3AY4C 5JIPA 3RU8L 5IESL 4PJ9B 1W8OA 2ESVE 1S8DB 2PW1B 2Q6WB 2O61B 1NQBA 4MX7A 4G8IA 2VZOA 4JJHA 3W5MA 1MHHA 2B8OT 1CDHA 5A1AA 1T5WA 3G6AA 1A7BA 1MJ7L 3HTLX 1PQZB 4YFLF 3L5WB 3IDXL 1EV2E 4L29A 5SWZA 3SDXF 3VXUE 2XZCL 3F58L 5A3ID 1FRGH 3H2WA 5C2BH 3W9DB 1HQ4A 4D8PA 3TWCL 1JRHL 3DURA 1ZLWH 4YHYC 2N56A 4ZDHA 3FO9A 4XNUH 5CMAB 1WT5C 4X98B 1SQ2N 5ABDE 1XEDA 1HEZA 4JAMA 4I77H 4MNHA 3C5ZB 4TVPE 1LP9E 2DTML 2FYYB 4QY8A 1JYNA 2NX5D 3KPNA 1FNFA 1OGAA 1TJHL 5KANI 5I30L 3V0WH 4NPYB 4G6KL 3D25A 1UKTA 3X3FH 2CLZA 5JQHC 2G5BB 2J88L 2YZ1A 5IHUH 3GJEB 3LHPL 3SGJA 5EIVA 3QBTB 3TBSB 3EYOA 4XWOC 3MJ6A 1XF5A 2E7LA 3RU8H 4ZPTA 1BD2B 1WICA 1T5XB 1KTLB 2WK2A 4KDTA 1R3HA 4I4WB 3DVGA 1U42A 3HZKB 3TFKC 1HKFA 3OL2A 3QIUA 3WUWA 1G7HB 4BSWB 1MJ7H 3FHQA 3IDXH 2HN7B 5EU6B 4O00A 2XZCH 1BJ1H 5H2BA 3MRMB 3O6FA 5GGVL 3TWCH 1J8HB 3ULVC 1LO2H 5K9OA 5HYJE 1XH3B 2CIIA 1BAFH 3RL2A 3QFDA 2AERT 5IMLA 4WEBH 1A02N 4KVCL 3PWUA 4DFIA 5DD1L 2NY4C 1TJHH 2A1WL 5HPMA 5I30H 1WBXA 4HDIB 1IVLA 1EHNA 5EU3A 4YHYB 4PS4L 5GGSY 1X4XA 1RZKL 3BH8A 3U30B 3I6KA 2GT9B 3OR7A 2J88H 5BRZA 3LHPH 4UIMA 5D1XA 1T7YA 4NQDB 5CKAA 4H1LH 4PLNC 5MERB 5C2UB 4KUZL 5HHOB 1MJJA 4S2SA 4WUUB 3VD4A 3HNVL 1TJIH 1MRDL 4A6YB 1QHOA 3B9KA 5EDXA 5GPRA 3QUYC 3DI2B 4K7FB 1JHTA 1R3LB 3LRGA 4HKZA 1MH5B 1UC6A 1D5MA 1WTLA 5E4IA 4GKNA 4J4PD 4QKXB 1LNUA 2RCSH 4OI8A 2V7NB 5JW4R 2YUXA 4MD0B 2ADIA 4NQUA 4YFLI 4YHNA 1CDYA 5DYOB 1IZJA 5DJ6A 5BV7B 1R5WA 3R0MA 2HVKB 2YMXL 2Z31A 1UVQA 5AWNL 2YR3A 5GGVH 1FPTL 3UXFA 2IFGA 3GMQB 4WI4A 4AQ1B 5JXEC 4RNRA 2GTWB 2AQ3A 4YXLH 5MEOA 1H15A 4TSCL 1OGAD 4KKCC 4YDJB 4IS6A 1WSST 3UBXI 3NBNA 5CZKA 3RIFF 3CU1A 2LU7A 5DD1H 2NXZD 3QSKB 2IALB 5TFSH 1OL0A 5TF1L 5K59E 3FTGB 3CUPB 2AAVA 4JLRB 5IHZB 4M1GH 5E2TL 2F74B 2A74B 5F44A 1UXSB 3CCHA 2JJTA 2OZ4A 4P46A 5DD6B 2EEDA 1MHPH 2Y5TA 3OKKA 4FTVE 2R1XA 3BWAA 2NY4B 1F4YL 3OAYK 3AB0C 3E6FB 5CEZL 3WYRA 4QHMA 1T21B 5CSBA 3B8YA 3TC9A 1NC2D 1UCBL 3PGFH 4UI2A 3UROR 4MNGE 1DBBL 2K7QA 1IKNA 3O6FD 3FO1B 4LCCC 4NFBA 1UM4L 3PNWA 4UBDC 4DW2L 2ZUSA 1NGZB 1A2YB 1OW0A 3SJVB 3UZQA 3STZA 2YMXH 3HKFA 4X7CC 1O7VA 3AVEA 3S3JA 1VKXA 4YHIB 4OCWH 1NDMB 3QUYB 4TSCH 5CSZA 2FDBP 2HLAA 4CW1A 2VZ1A 5EU5B 2MQ3A 1X7QB 1N3NA 3WEXA 1G0DA 4PRNA 5BRZD 3ROOB 4EQ2A 2VZUA 5TF1H 1TCRA 3BP6A 5D1XD 4YX2H 4YXKL 1KN4L 5E2TH 5I8EB 3QQ3A 4JGUA 4UDTA 1LP9F 4JDZB 3FQUA 3H9SA 3MFFB 3KDMB 3MLXL 2FX7H 1KIUA 4OLEA 1A1OA 5KZCB 3QIWD 4KJQC 4WENB 5FM5O 3T8XB 4H26A 4TYUA 1QG3A 5F9JA 2EYTA 3FFDA 4QRUA 1F4YH 4GAJL 1FGVH 4F37K 4G8EB 4X9BA 1S7WB 1KJ2B 3OKDB 2OXGA 4M5ZL 4L9DA 3LKPB 3VI4F 1PYWB 5IR1A 3RWJA 2BZDA 2UVEA 4S0SD 3H3BC 5DUML 3TBYB 1DQMH 1LO5A 1UM4H 1CDBA 2KKQA 4P9HH 1J87A 1QFWM 1BGXH 4ZFFA 5LVEA 1A9BB 3TM6A 3VXMB 5EFIB 2AJYL 5CS7A 2Z9TA 5HYQA 3OKMA 4K2UL 1LO3L 4ZUTB 4ZNEA 2L0DA 2UYLB 4ZYKB 2G60H 1UB5B 2NXYB 1QPPA 1N0LA 1KPUB 3C2AH 4XHQA 1EUTA 3S98A 5I1LB 3AU1A 4P46D 1EXUA 5FUCE 1EJ6A 1CLZL 3TZVC 5DFVD 3QH3A 3GKZA 4OIAA 4NCC2 5KG9B 4L8CA 5E6ZA 1F90L 3BXNB 5F97E 4KTEL 1C1EL 3MLXH 4LLMB 4GG8B 1KEGH 5J3HD 5DHVH 3MLTB 4U1IA 3VXRE 4MDJA 2X70B 1P4IL 2EDEA 4NKQB 4KY1H 3RKPA 1A1MA 1OT2A 1ETZB 3K1KC 5HDLA 5DJ0B 1P7KA 4FOMA 2VTFA 2XN9A 1W0YT 1GC1L 2VO5A 2VC2L 5F21B 2BRQA 1CXLA 1KPVB 4OCNC 4UAOC 3AREA 5IB4B 2AJYH 1NMBH 1MLBA 1EPFA 2OYPA 1LO3H 3MLZL 3NIDE 4MXWL 3W0WB 4WTZG 1OSZA 3Q48A 4KK9C 3RWIA 2CRZA 2AW2A 2NY0D 1UM5H 3B3IB 3REVB 2A6IB 3RTQA 4Q0XL 4L9LA 4X6FB 4AT6A 3TV3L 2IAMD 4Y2DB 5JZ7D 2OR8A 1HHJA 7FABL 4PJ9A 3H9SD 3V4PL 3A6OA 3BOVA 2Q6WA 1N5YL 2O61A 1CLZH 2APWA 4LLYB 3S97C 4OZHE 4HWZA 3JUZA 3FQXB 5D1ZC 1PQZA 1QSFE 3KPRE 4XB8A 4KTEH 2F53E 1C1EH 4NQCA 3HNTL 1Z5LB 3LEVL 4NJAL 3KYNB 5F72S 1MQKL 4HWEL 4JO1L 2JE8A 5K59F 3MLUL 1P4IH 4PLJD 3FT3B 2DQCH 4BZ2H 5CMAA 4X98A 5D7LE 1A5FH 3THMH 3C5ZA 3MYJB 2CO6B 3QUXA 2FYYA 1U8LB 2BSTA 3WS3B 1WV7T 1GC1H 2VC2H 5KS9B 5EC2B 4MA8L 4NPYA 4WVRA 3VFRA 5E9DA 4HH8A 4RBPK 3T4YA 2G5BA 3GJEA 3FQNB 4MXWH 3WLWD 4RCAA 1FYTE 4FA8A 3KLHC 5DURB 3IETB 3EFFB 3LPWA 3SDAD 3VXSE 1BMGA 1C16A 3TV3H 1NGXB 3DX6B 1OTTD 4GAYB 7FABH 8FABB 2Q76A 1T5XA 1EVUA 1KTLA 3V4PH 4UAOB 5T1MB 4JFQA 4I4WA 4M9PA 4XP1L 1N5YH 3HZKA 3ARZA 1GCFA 2Q20A 4R9HA 4J2XA 4OF7A 1MREL 4BSWA 5IVOA 1DL7L 2PYFB 2VDKH 4QRRD 4X4ME 2ENYA 2NW3A 4LHJB 5HGDB 1CFSB 5EU6A 5F8QC 1FL5B 1JPSH 4NJAH 3AY4A 4NZDA 3MRMA 4JO1H 4HWEH 4MCZB 2P24B 3HHRB 3U36B 5IFJB 4XNZC 1FNSL 1IEAB 4TTGA 4ELKB 3A0OA 3SGDH 2H2PC 5I76B 3TF7C 4OGZA 1NCTA 5K9JL 1Q9KA 4HDIA 1EHAA 4MA8H 4X7DC 1OAQL 3U7WH 2GT9A 5TDNA 2J4WL 3QDJB 4ZUVB 4XCEB 4PJ9D 3SPVB 2EE9A 5DQ9B 1KTRL 4UNTA 4NQDA 1PDKA 5AUMB 5MERA 2B4CC 3O4OC 4QRSA 3WUWG 1DJSA 4A6YA 3SN6N 3H0TB 4YBQC 5I15L 1CYGA 4XP1H 2EDOA 3T2PA 1MCRA 4IRZL 2H8PA 4K7FA 2H3NB 2FEDD 1R6VA 1A4JB 2WANA 2V7NA 1G9MH 1DL7H 2MKLC 4YHZL 4KK8D 2PNDA 5IQ7L 2CKBL 4WUKL 1UH4A 2D0FA 3OSKA 2VJXA 2HVKA 3CSYB 2N7AA 3IXTB 1I3VA 4GQ9L 3GMQA 4WNQA 3CPLB 4JQIH 2DTSA 3U46A 4LCYB 1FNSH 4YDJA 4K8RL 5HXMA 1FG2B 4N1EA 4GKSA 2DQEL 4UT9L 3KPOA 2E6JA 3WFEL 3SDDC 5K9JH 3UDWC 5EZOL 1H3TA 4HXBL 5IKCB 4JLRA 4KXZH 1R3KB 4OZFH 5IHZA 2F74A 4LCIL 5C09E 4XNZB 5FA3B 3G5VB 1UXSA 2GSIB 4N8CL 2J6EA 4W81A 2FBOJ 1BD2D 1L0YA 1JZ7A 5DD6A 5E94B 4JFDE 2DKUA 3B8SA 2R4RL 3HI1B 5E6IB 3EDFA 1ZEAL 1MHCB 4OSUL 3UO1L 2FGWL 2LAGB 3W5NA 2A9NL 4B7LA 5I15H 1OD9A 4HPYL 3NIDF 5DI8B 5EU6D 4IRZH 1IAIM 5F3HB 5DLML 4XPTH 4OKDA 5B21A 5GS0L 1J8HD 3ZDZE 3ZHLA 1JZ2A 4LMQE 2R69L 4YHZH 5D70L 1KB5B 1TQCC 4NQTA 5FM4A 1NGZA 1A2YA 3KJ6L 3O4OB 4WUKH 4XP6L 2DIBA 3SJVA 4N90E 5IQ7H 3TH4T 4HQQL 4GQ9H 4YHIA 2BNQE 1WBZB 1NDMA 3QUYA 4OZHF 2FEEL 4N0FB 4KMTL 1A3RL 3UYOD 1NBVH 4HS6B 5EU5A 2DQEH 5IW1B 2J3SA 3WFEH 4NSKB 2I26N 5KJRH 3ROOA 5EZOH 4LGSB 3LKRB 4EBQL 1RUKL 4QXTB 3MV9E 4NQDD 3HN3A 5JXEA 4TNVF 1K8DB 3QFJB 3QXWA 3GGWB 5I8EA 5HHOD 4WUUD 4JDZA 1AGBB 4N8CH 1WAAE 2JB5L 4P2CG 4XTRC 2CR6A 1X4YA 3CDFA 3T8XA 3QAZC 3GRWL 4Q6YA 1ZEAH 4DGYH 4P5TC 4G8EA 2GJZB 1S7WA 1KJ2A 3OKDA 3S34L 2VDOL 2XWJA 1KENL 2MKWA 2A9NH 3KGRA 3SEPA 3QRGL 3WIHL 4XWOD 1MCPL 2VLKE 5DLMH 1PZ5B 4FQ1L 1F4WL 1QFWI 2CDFB 3PDGA 3QDME 3TBYA 2R69H 3E3QE 3OGOE 5D70H 5ALBH 1ZLSL 3CLFH 3W11C 3OBAA 4XP6H 3TFKD 2DQTH 2CRYA 1RZ8A 2WINB 3BE1L 1A9BA 3VXMA 3Q0HA 3MRGB 2R2EB 1BPVA 2D7MA 3GK8L 5C0CB 3OG6B 2UYLA 1OT1A 2XZAH 5DC9B 1KPUA 1A3RH 1L0XA 4KMTH 3ULVD 1I1AC 1TQCB 5I1LA 3X17A 3G5XB 5EOQH 4RMRA 1RUKH 4EBQH 3MV01 2ITDA 5F7EL 1U58B 4X6BB 3V4VL 2NY4D 2CJUL 4UU9B 5KG9A 1UCTA 2JB5H 5AG8A 4LLMA 2AI0L 2GK2A 5FOJA 2Y23A 5L88H 4JHAL 3MLTA 2R2CA 2X70A 4RZCB 5IGXL 5E8EB 1S7RB 4NNXA 4IHOA 3KJ4C 2VDOH 4YR6B 3QO1A 4EI5B 1ETZA 3QRGH 2PTUA 3SJVD 3VFSA 3WIHH 1ADQH 3G6JB 3INUH 1MCPH 1F4WH 1N6VA 5D5ME 5SX5K 1N64L 3JXAA 2XG5A 1J0ZA 4D9RE 3MLPA 3I2CL 2AXFA 1CGYA 3N1MC 3QUYD 1ZLSH 4P5TB 1KPVA 4Z7VE 3EYVA 3MXVL 3UYPA 2VDPL 4OLUL 5A2IH 3GK8H 2M2DA 2C1PA 3H42L 2BY3A 4LDOB 5GRXG 1R0AH 1CFQB 4JKLA 3S8WA 3MRRB 3REVA 2A6IA 5JXED 4X0KB 4X6FA 1IILE 4Q9BA 5DWUH 4Y2DA 4KKCD 5J4MA 5CFHA 4MLSA 1XF4B 2ARJQ 5T5NF 5KZCD 3SKJH 5C0AB 3V4VH 2FLBT 2CJUH 3H3PL 4PJHE 1PY9A 3HZMB 1J12A 3QHZL 1X9QA 2AI0H 4EDXB 3RBSA 4MAUH 3T1FB 3ZO0A 2OX5A 4I3RH 1NMAL 3P40A 1QR1B 1L6ZA 5IGXH 1DBAL 1U8JB 3FT3A 3WSQL 1K4DB 5I1GL 2B7DT 1DLHB 1NBZB 3MYJA 5JOFB 1CU4L 4D9QD 3UC0L 3VXMD 1JWMA 2NZ9C 2F19L 2PO6B 4PG2A 1N64H 1EBPA 5T1DL 5E8NB 5DJAB 3MRCB 1K2DB 4Y7MA 3DHMA 1RSFA 1NCBH 1RHHB 2VDPH 4OLUH 4UBDD 4P2QE 1GYAA 1RMFL 3SE4C 1CZ8L 5C0EA 3KAAA 3ZDZF 3QXDB 3IETA 3EFFA 4WI6A 5D2NC 2UV3A 3CC5B 2Q8BL 3FL7A 1JNLL 3DSNA 4AQOA 3HG1E 2YPLB 4Z78A 1JWSA 3OHXB 4GAYA 4Q6IC 5KAQG 8FABA 4ZFZB 5DVLA 4G80B 5T1MA 3T0XA 1B90A 3HCVB 3BZEB 5MEOB 2OJZH 4RA0C 3CFJB 2E27L 1IAIH 3BDYL 3H3PH 1IJ9A 2PYFA 1IL1A 1FL5A 1FL3B 5M7QA 1NMAH 4FFYH 3CXHJ 4U1MA 1ZWIA 4KV5E 3MV8B 1DBAH 4ZAKC 3PWLA 2Y06H 4ODXA 3U36A 3CK0L 3T65B 4KJQD 1WAAF 5I1GH 1IEAA 4OZ4B 4ELKA 1F45A 4CMHC 3WFDL 1FFPB 5I76A 4L4VB 2IBZY 3W0WD 1U93B 4GRMB 4GBXA 4RGOH 2UUDH 3QUKB 1BVZA 1JGLH 1H3GA 5JTWA 3QDJA 4I0CC 4Y2DD 4XCEA 1RMFH 3LKNA 1CZ8H 3SPVA 5DQ9A 4X9HA 1NGPH 1QBML 3Q5YA 2R9HD 3RI5F 5ESAB 5E99L 2Q8BH 1JNLH 1VSCA 2J7LA 5L0QC 5FDYA 3RGVA 2EKSA 4HWUA 4PB0L 2I60L 2VITB 5EO9B 4B0MM 4G9FB 3RWCB 2QTEA 3FO2B 2EYSB 3BDYH 2JF1A 1RZKC 4GJTB 5IHBA 2X4QB 5D2NB 4PP2B 4PJXE 3TZVD 3M1BB 4PJFF 3EOBB 4PRDA 2VDRH 3KPSA 3HZYA 1VESA 3CSYA 1YC7A 3LKSB 4JPKL 4Q6IB 3IXTA 1ZGLP 1X5XA 4WU7B 3CPLA 1PEZA 1BQHB 2ADGB 3CK0H 5KSUB 1G84A 4XNMA 3CX2A 3VCLB 5FKAB 4Z0XA 3R1GH 4PR5B 3D1MC 4JG1L 1YN7A 4IRJC 3MTRA 3BESR 3ULUE 2AQ1A 4H0GA 2DQIH 5IKCA 1NEUA 4ODWB 2IC2A 4QOKE 1NANI 4H1LB 1LD9B 3SY0A 5DURD 5ICYB 4CRPA 4ZAKB 2NYYC 3GSNL 1F2XK 4Y1AA 5FA3A 1H3WM 4QLRA 1FC2D 5C6TH 1YEHL 5D5MF 4F58L 4UMGA 5FYJL 5E94A 5GS1C 5C1MB 4CMHB 1JZ4A 4POZC 2YSSB 4L3EE 4LMQI 5E6IA 2DWEA 2ITCB 5E99H 1FQ9C 3T4AB 3W2DL 5IVNA 1IAII 2I60H 3C2SA 4MXVE 5JW4N 1IAOB 1T0PB 1RUML 5DI8A 5F3HA 3MLWL 3KPPB 4HULB 3KXFE 5EULV 5AEAA 5I1DB 1V5JA 4K3DH 4PJGE 5GRVK 1KB5A 4DK3A 5ADPH 3P4MA 3W9EB 1GGCL 1SHMA 1E4XH 3J8F7 4JPKH 5L0QB 1KXTB 1EZVX 2KBGA 4IEFB 3MCG1 3PDDA 1CCZA 3GSUB 2V9TA 4YDVB 4PJHF 4U1GC 2VLRE 2XYCA 5HYIA 3TYFB 3MA7B 2GUOB 2APXA 3LS5L 5IB5B 3QDJD 4IDLA 3ZYJA 2O26U 4NSKA 2R1YB 3LRHA 5GS2D 3UYRH 3LKRA 2EIDA 3KPLB 4IOSD 3GGWA 3GSNH 3I85A 5FCUL 3GJFK 4G7VH 3UTTB 3O8XC 1YEHH 3LN5B 4M5YL 3RPIB 1P1ZB 1S7VA 4JO3L 3PWNB 4IRJB 2DMCA 3UDWA 3W2DH 5K93A 4F15C 2GJZA 1ZHBB 3QCTL 1UT9A 3KLHD 3LAFA 2EO1A 1P7QB 1NAMH 3N06B 4WW2C 5JOPE 4JKKA 1PZ5A 1G9EA 3MLWH 2CDFA 5GS1B 1QRNE 1LEIB 1WJ3A 4XNQB 4FZEL 1GGCH 1LEKA 3VFGH 1EH9A 1Z9SA 5AG9A 4Y8DC 5EUOE 1U8KB 1ZE3C 3MRGA 5HVHC 1MELA 3MR9B 1QFOA 1YMME 5C0CA 1M7DB 4RMUA 1BFVL 2QKIA 3VXUB 1RPQA 2HRLA 3KHOA 4M7KH 2FWOB 1U8HB 5E6ID 1J11A 1U58A 4X6BA 1B88A 2H2PD 3NCEB 3ORJA 2VUYA 2CLRB 4ODBD 4U1GB 1PKQE 4JO3H 2AJUL 2QSQA 4X4XB 3LSOA 2HYMA 2UZIL 5E8EA 1S7RA 4AIZB 4FXLA 5M94B 2P5EA 3QCTH 1SEBB 2ED7A 3NN8B 3AC0A 4P23B 3ULUL 1AKJB 4EI5A 2OBGA 3G6JA 3QDGA 5HTSA 1Q1JH 3O8XB 3GSQA 2GIYA 1NCDL 4YBQD 2KH2B 4M43L 1T2XA 3MGAA 4KRMB 3X14A 2NPLX 4FZEH 4QXGL 4P5TA 1UEMA 5KSAB 2FIKB 1DANU 2XQBL 5DUBA 3RX5A 3DYOA 3T2NL 2VDMH 4WW2B 5ITFA 3IFPB 3OKEA 2BC4A 1BFVH 4L8SB 3MRRA 4PJXF 2VXVL 5CJXC 1RI8A 1G6RH 4X0KA 1VCAA 3QFJD 2IFFH 5EPMB 1U8NB 4Q7DA 1XF4A 1GC1C 5KSVB 4PBXA 5KVMC 1M6OB 5HGAB 5HVHB 1DQQB 5DHVB 5HYJB 3ECBB 5CILL 1BBJA 3SDDD 4M7ZC 1AP2B 3HZMA 3D39E 3MRLB 1Y18B 1BFOB 1DANT 1VFBB 5TQ0L 1U3ZA 3T1FA 2AJUH 2X40A 1UKSA 4NN5C 4V1DE 5DR5L 1QR1A 1UFUA 4R26L 1U8JA 1K4DA 2DI7A 3ULUH 5KVEL 3T0VA 4M6NH 4X6DB 1NBZA 4YBLC 1CT8B 2M1KA 2WBJB 3DX7B 5JOFA 5HSFA 4FXGB 3NFSH 2X1OA 2PO6A 4JB9H 4DOHE 4M43H 1WCQA 5C0CD 1JTPA 5DJAA 1K2DA 1RFDL 4MXVF 1RHHA 1SJHB 4I0KA 2XQBH 4RGNE 1CTOA 2B20A 1RK0B 3KLAA 2W0PA 2D31B 1I9RL 3FFCE 4PJGF 5I1EL 1FH5L 5EBWB 4HX1B 3HUJE 2E9JA 4JPIB 4JKPL 1NH6A 2Q86B 4CN4A 2YPLA 3OHXA 3WV0A 2W60A 4ZFZA 5I2IB 3ZT6A 2WNGA 5JHDE 5IROC 1CICA 1UXWA 1JTTA 3CFJA 5CILH 3TLRA 5IB1B 1MCIA 1UYWH 1ZXQA 5TQ0H 5C0RH 2ZUTA 1FL3A 3EOTL 4EI5D 4JFHE 4PRPE 3GMMB 2NY2C 1U8PB 3GBMH 1AHWC 3CFCL 4R26H 5J89A 4XTRD 1RZ7H 2XACC 4RX4D 5KVEH 4OZ4A 1S78C 4P5TD 3VMOA 3SKOB 4M7ZB 2BRRL 4JFPB 4L4VA 1CVRA 3I6LE 4HWBL 4HMDA 1U93A 4NGHL 1BZ7A 4NN5B 1LVEA 3QUKA 1CGWA 4GS7B 4ZS6C 1JF1A 2H6PB 5BO1H 4RWHA 1WC7B 3W11D 2MPAH 4YBLB 2J8OA 1AI1L 2VN7A 5I1EH 1FH5H 3O2VL 3TBWA 4JKPH 5C0AD 2X89A 3VGFA 4ELME 4F9LC 5FUZL 2VDQL 3EYFA 5EUOF 4K23L 5CINH 1AO7B 5T3XD 1QFUL 3DYPA 2VITA 2AK4A 5ITBH 4LIQL 5IFAL 2JCCB 4ONGL 2AP2A 1I1AD 5ANME 4H0HB 5SX4H 3O2DL 3SE4A 3FO2A 3NCCB 4XPGH 4RA3A 4PP2A 3VD5A 3L7EB 3M1BA 3EOBA 1S7QB 2H2SC 2Z8WC 1KT2A 1CBVH 3LKSA 4ZUSA 3MRHB 1X5FA 4WU7A 3CFCH 4N9GB 2DQFB 4PB9L 15C8H 2PO6D 2ADGA 3GIVB 5KSUA 4NRYB 5HDBE 3VCLA 4OM1L 5J06A 5FKAA 1MQ8A 4PR5A 1JRHI 4R90L 3VD7A 3FAXA 1YNLH 1YDPA 2E6PA 4F3FA 2GW5A 2BRRH 5CJOL 2FATH 2HVJB 4NGHH 2QHRH 5E7FA 3NIGE 2NY2B 1LD9A 4H1LA 4OQTH 5ICYA 1AHWB 3ES6B 4NWUL 4XGZB 4U33A 1SM3L 2JJSC 4TNWF 1IM9B 2YPLD 2ZUQC 2HFFA 3MJGX 3AMLA 2ITCA 4M62H 3O2VH 4MJ6B 1BBDL 2WLYA 4K8RC 3T4AA 4LSRL 2VDQH 5GS3A 3VFTA 3RVUC 1CI5A 1OSPL 4R4NC 3AM8A 1QFUH 4HIJA 4LKCA 1IAOA 1UM6H 5IFAH 3LCYA 4ONGH 2DJ4A 3S9DB 3KPPA 1M71B 3O2DH 4LSSL 4AYFA 5E5UB 3MV8D 3MOBL 4P2OC 3VGGA 1FYHB 1GPOH 3W9EA 1XF1A 4XP5L 3VDAA 2C7UA 4OAWB 2ZUVA 4HSQA 1JP5A 4RWYH 3OB0K 4PB9H 1VGKB 3GSUA 1T1YA 4L4VD 1I8LC 2CXGA 5EN2A 1CQYA 3O6LL 2A77L 3TYFA 4R90H 3MA7A 5DQJB 2OL3L 5I1IH 3FOMA 3NCYP 1U8MA 4HKXB 5CJOH 2R1YA 5GS0C 3EDDA 3KPLA 4N0RA 4LEXL 1FORL 4MA7H 1JNHA 4FQJL 4WO4C 4NWUH 5IP4A 2X89D 2P43B 4KGJA 1SM3H 1FGNL 3I02B 3UTTA 3BW9B 1P1ZA 3OKOB 2QL1A 4G9FD 2V2WB 1ND0A 3PWNA 3RZCC 1BBDH 5H37G 1F42A 1ZHBA 1K3IA 5I75B 1OSPH 1CR9L 3MLSL 2CKBB 1KEML 3QZWB 4Z76B 1OOAA 3GMOB 5C0DB 4I9WE 5L2KA 1QLRB 3HUJF 2ZUQB 4LSSH 3RAJL 5GS1A 1I75A 1LEIA 4XNQA 4ZD3L 1T0MB 4NKDB 1FNLA 2P45B 1E28B 2BMKB 2ESVA 4O4YH 1U8KA 4ZPVB 3MR9A 2DLFL 3RIAF 2BXYA 1DQDL 1M7DA 4MMZC 1FJ1B 1DEEB 3ZSTA 2XTJE 1D5BA 3VXUA 4OBSA 4Z95L 4ZAKD 3VXQA 5JPMA 4P2OB 3U83A 3MRBB 2IEPA 2OL3H 1AFVL 2HP4A 3PE9A 3CVHL 4URTB 2Y07L 3FRUB 4N0CC 1JTOA 4LEXH 5E2WL 2GJ6E 4FHBD 4MJIB 3UP1A 5EG6C 4J3OC 1PX3A 2HLFC 1WITA 1G0YR 2QQKL 4G6ML 1XF3B 1N0XL 4BZYA 3MO1B 1FNAA 4EOWL 3F7QA 1SEBA 4HUXB 4KRPC 3NN8A 4EXKA 3MLSH 2ZNXA 4P23A 2YOCA 1AKJA 1KEMH 1QHPA 1FYTB 4AG4L 4C56B 3STLB 3O8XA 4HPOL 3RAJH 4QYOB 4ELMF 4XP9L 4JPWH 4BYHA 5IT2L 1I7ZB 3RZCB 2B5IB 4OLVL 5IF0B 5KSAA 5KTEL 1F4AA 1CDJA 2J2ZA 3PV7A 4M8QB 4XH2A 4OV5B 4JHWL 4WW2A 5JR1L 4RFEB 5C0JA 5GGQL 1DUZB 4L4TD 4L8SA 2WLZA 1AE6L 5KW9L 4I48A 5F7KC 1CFTB 3TIEB 3I3DA 4Z95H 3V6OC 1WGOA 5EPMA 3H9HA 3GBLA 4MJ2A 3D85B 1T83A 5EU7C 4AEIL 3UTTD 3CVHH 2FX8L 1U8NA 1B6UA 2ZOKB 5KSVA 1M6OA 5HGAA 5E2WH 5DHVA 5HDBF 5HYJA 3QIBB 4IRJD 4ORGA 4Y0GA 5H94B 3MNWB 3B5TA 1SVZA 2BHZA 1AP2A 3D9AL 3MRLA 3VW3H 1FG9C 1BFOA 3ZTJG 1P7QD 2FBJL 2A9ML 2QQKH 3F6IA 4PG9B 4NQEB 2NYYD 2Y25A 3NIGF 1IGIL 2EE2A 4PRHE 1CQKA 5GJSH 1JZ6A 4POZD 4KMLB 3RIFK 1SVCP 4JN1H 4X6DA 4N1CA 2WBJA 1EJOL 1WWCA 4AG4H 4FXGA 2UWEE 4KJYB 5E95B 2DS4A 2W9EL 4A2LA 3O3BB 5IT2H 2VXTH 1JZ5A 1I3UA 4OLVH 5D6CA 1B0WA 3IS1X 1J0JA 5KTEH 3BGMB 4PUBL 2BK8A 3VXUD 1OWWA 2FHFA 5F88B 1FCGA 5JR1H 2DWDA 3KS0J 1AQKL 1KELL 4NDMB 4UQ2B 5K9QG 4HX1A 3PV6B 3MXWH 3EUUA 4JPIA 4OCRL 4U3HA 5KW9H 4HH9B 1FV1B 2Q86A 4B5EA 3KWWA 4P57B 5J8OA 4M8VA 3A67H 4OD3L 5CEZD 2P44B 4AEIH 5I2IA 1RIVL 3UTQB 4GW4B 5J13C 2XA8L 4G8GE 3GMPB 4WWKC 2L7JA 5IB1A 3D9AH 3WHE1 1YMHB 1QLEL 3NTCH 4B41A 5CJXA 2FBJH 4P23D 2LQRA 2NCMA 1AKJD 5FO8A 3DO7B 4UB0H 1BWWA 3CX5K 1HXYB 3V7MA 4UOW1 4Z7NE 4FMKA 1IGIH 1X5JA 1U8PA 2AJVL 2VXQH 3O8XD 1CXFA 5B3JE 1IC7L 5EZIH 2VR9A 3OAYH 2XPGB 1RJLB 5IBTH 4Y5YC 2VERN 3DV4B 3GSWB 3D0VB 4B7IA 4QTIH 4JFDB 1ZLVK 5KSAD