1YEIH

Catalytic antibody d2.3 complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
222
Chain Sequence
EMQLQQSGAELLRPGTSVKLSCKTSGYIFTSYWIHWVKQRSGQGLEWIARIYPGTGSTYYNEKFKGKATLTADKSSSTAYMQLSTLKSEDSAVYFCTRWGFIPVREDYVMDYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IG ANTIBODY D2.3 (LIGHT CHAIN))
publication title Crossreactivity, efficiency and catalytic specificity of an esterase-like antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 43
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1998-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yeiH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yeiH02
3U1SL 3MNZA 5ALCL 5FCSH 3BVNA 4KJWD 5DJ8A 1S9VA 5LQBH 1F3DH 1G9MC 3SGDH 4ODTL 5FO9B 1HH6A 1U8LA 3SCMC 3SJVD 2EC8A 5D96C 3WKML 1N5AB 5KVDH 3LMJH 1G7PB 3MJ8A 4HWBL 3SGJA 5HI3C 4EI6B 2I26N 4GXVH 4TNVF 1QR4A 2V17L 4JO3L 1AP2A 1HIML 4PJBA 4LAQL 3IFOA 2XFXA 3G08A 5HYQA 3B3IB 4HXBL 2IAMB 3QI9D 2ADIB 1CFTB 3QUMA 4PJDE 1GZPB 4P2RA 4BZ1H 4P59H 4X6FA 3SE8L 1NCTA 1E6OL 4LEXL 1S9XA 4MSWA 2CSPA 1A7PL 5DYOA 1ZANH 5I9QB 1MCJA 1FL3B 2FGWH 4KPHH 1FJ1B 1YEIH 3UYRL 3U9UA 1JZ4A 3QB7C 3HRPA 1U8NB 4P3CH 3JWOL 4HQQL 5GGSY 5EN2A 4PB0L 1G7HB 1I9JH 1P7KB 2V2WA 2EDWA 3QUYA 5IROC 3PJSA 4N5EC 2R2HA 2IBZY 4RA3A 2K9UA 3QA3B 5I30L 1W8OA 1G7JA 4MNGA 1C8PA 4MXWH 5CGMA 1SEQL 5MEPB 2YD8A 4W4OA 4KROC 5EUOB 4U3CA 5DGRA 2OCFD 3ARBB 5DF0A 1PD6A 1IEAA 4F9LC 4FFVD 4HWUA 2HKHL 4R96B 1OQXA 4MZ3A 5E5MA 1YPZA 3AY4A 4JFEB 4MWFB 4CMMA 4X6CA 5GXBB 3UTPD 1IKFL 1RZJH 2ICWB 1KOAA 1R3HB 2DQDL 4XCCH 1MIML 1A7BA 4GMSH 3HLAB 1ZLSH 3PHSA 5L2JA 5A2LH 4L8CB 1EX0A 5I17B 3LPGA 5GHWL 4M9OA 4S0SD 5HDQH 5DUPH 5T1KB 1LO2H 1JN6B 2FX7H 4KI5C 2W9DL 1PYWB 2YC1B 3MROA 3TBSB 3MXWL 4FZEL 4I1NB 4DKAA 1T22B 4BFEA 1OW0A 1WEJL 3DUUA 3DYPA 4L9LC 1KENH 3B6SB 5CCKL 4PJCF 4U6HB 3AMLA 4JM2A 3VXUE 5GS1A 5EU6D 4HWEL 1HHKB 4KHTL 3CZFB 4GBXC 3HE7A 4LPWA 4LVOC 3VI4E 1Y0LB 2ZUXA 2P7TB 3QG7L 3UYOD 4QRPB 1OTUC 2WNGA 3MLSH 2I9LA 3PWPA 3AFLA 1P4LA 1LEGA 4CW1B 2Q8BH 4ZOAA 1NMBH 1BVLA 5CMAA 4XP4L 4F7EA 5SWZA 5ID0A 3T0VA 5HPOA 1AO7A 3LEVL 3QXTA 4AL8H 4NT6A 3QPXH 4IM8A 2DQCH 3VRJB 4QOKD 1O0VA 4LSPH 4L1DA 3F65A 1TTGA 4M43H 5D5MF 5D7LD 3RZCB 4IMKC 3GMMB 2XIDA 2UWEE 4CUCA 12E8L 3V5HB 4F33A 1EO5A 3S3PA 1RAMA 3HI5H 3WS3B 1PJ9A 1PZ5B 4LVNB 4OZIB 1ZS8B 5FYJH 4DGVL 3ARED 1N3NA 4ZNEA 4MA7H 3GSQB 4MVBD 4BKLB 4NRYB 1MFCH 3RFZC 5DO2C 2YPLE 3MV7E 2XTJC 5ESQB 2P24A 1K6QL 5E6YA 1JVKA 1UZ8A 2NY5H 4QXUL 1UXSA 4G7YL 4OCXH 2EDKA 4O9HH 3DXAD 5DJAB 2IGFL 1S3KH 3O3EA 5I8EB 4Y4FA 5I8CA 4HKXB 4NC1E 1BLNA 1Z9SA 5I1HH 3D18B 2D0HA 3KPMA 2IFFH 3LKRB 1HYSD 3GRWL 4D8PA 4LHUA 3H42L 3E1F1 3LEXA 3I9GL 2X4SA 4PV9B 1UCTA 4PP2A 1XF1A 3B9AA 4S2SA 4WFHD 4UQ2B 1FYTE 3VFVB 4M1DH 3GRWA 3IXAA 4Z95L 4P2QA 5F88A 2OJZH 3H3PH 5BOZG 5DVMA 2HT4C 2ZKHL 1CFQB 5B4MC 4LP5A 3B9KC 3KLAA 4D9QE 3VG0H 3BPLB 2FO1A 2EE3A 2Q3AA 5DHYA 5FKPA 1JNNL 5ITFB 1HINH 3PWVB 5AWNH 3CVIH 3SBWA 2ZUQC 3REWB 4POYA 3CLFH 4OD3L 43CAA 5C0IA 1AFVL 1UT9A 4OKDA 5EUKB 1BD2D 3D85D 4JPWH 3WXVL 2CGRH 4NP4L 3MRRB 4GG8B 3KXFA 2DOCA 1U0QA 1I3GL 5EORH 4J6RH 5IB3B 4HCRL 3D3VB 2X4RA 3VFGL 1PG7H 3BH8B 2O5XL 5EBWB 2FRGP 3FQWA 2O5YL 3QDMD 4ZFFA 2ATKB 3SEPA 2BK8A 3VXRB 3IDMA 4RGOH 2DJSA 1NEZA 3HNVL 1CVRA 5C7XL 1KJ3H 4FA8A 5DD0H 2J5LB 3IDGB 3AGVA 5CJQL 1T83C 4KJWC 3TM6A 2SEBA 3PL6B 4QHNA 5MP6H 3G5ZB 3ARDB 3X3GL 4P4RA 1BQHB 3ZHLA 2X10A 2I25N 1P6FA 2JELL 3Q0HA 3TT3L 2B39A 4KGLA 2NXYD 3BKML 2VWEC 4XNYH 2FJFB 2R9HD 4ORGB 3QI9C 4X9HA 1A1OB 1YZZA 5F9JA 3U36A 2VLRD 4PRIB 2GSIA 3T3ME 3OKEB 1Z3GL 3P2TA 5IBLD 2QKIA 4NUGL 4EBQL 1T0NB 4IRSD 4NDMA 3WMSA 1F6AB 2LQRA 4I0PC 1OGAA 4FABL 5JIPA 1MI5E 3FN3A 3HKFA 1QTYT 3CFDA 3ESUF 4CVXB 4YX2L 1MCFA 1I7ZA 4MNQB 3VFRB 5FUZH 5IMKB 3QUXA 4HIIB 2CK2A 4F57L 2IANA 5D7IE 5MI0B 2JK5B 1DQDH 4MJ4A 4NRXA 2NY0D 5CGYD 5I1GH 4YHNB 2V7NB 3UC0L 3D39D 5IB2A 3DYOA 5B38A 1NC2B 1WFNA 4NYLB 1AY1L 5JQ6H 4TVPE 3LQAC 4LLWA 1WICA 5DXWA 4OZFB 4UTBH 4FFVC 5E9DE 3ARSA 1S7SB 1XF5A 1XF3B 4HW6A 1KN2L 2FX9H 4O58L 3SKMB 3RZCC 3VXQB 1CT8A 2R0KL 1IQWL 5C0CD 4PRNA 2R1XA 4XPTH 4HUKB 3D69A 4RAVA 5I1JH 3O0RH 2F53E 4HH8A 1KCLA 5FM5O 1MRFH 5DFTA 4PJFE 2P8PB 4C83A 4TSAH 4XVTH 2WK2A 4FQIL 5H8DA 1B0GA 3RPKA 3ALXA 4M3KB 3ORJA 1QBAA 1A1NA 1SQ2N 1YECH 4UBDD 3U0TB 4NBXB 3GGWA 2UYLB 1ZT1A 1HE7A 1NGYB 3LS4L 4C4KO 3MLXL 5C0RH 1I8KA 3PHOB 1DQQB 5CD3A 3RWHB 2UV3A 3CGTA 3ARFD 4YK4C 4P5TA 1TDQA 4PRPA 4NOBA 4C56E 4K8RL 4WI8A 1A4JB 5C09A 1BOYA 1P84J 3CDGB 3KPRA 4X4XB 1HH9B 5DC9B 1E28B 1QSFB 2ICEA 4M93B 3TNNB 4TSCL 5DT1L 3TZVA 1QA9B 2DB8A 5LKNA 1U8MA 5HHMD 3NZ8A 3NCFB 1N4XH 1JGEB 3PG2A 2NTFA 2Y06L 4LIQE 4NNYB 4WI3A 3RIAK 1EXUA 4NZTL 4V2BA 2PETA 1LHZA 4LFHD 3SKUD 4YHOH 1RZGA 2Q7NA 4OD2B 4Y5XC 4P0DA 3TVMA 4YDJA 5F7DA 1XH3A 1IC5H 5AZEH 3HNSH 4KJQD 2VITB 5IQ9B 3MLYL 3RL2B 3GMNB 3TBTA 1F13A 4HKJB 3MCG1 2QSCL 1UH4A 4FQQB 4U1KB 1X5KA 4RSVA 2A6JA 3C8KB 3H9SD 4LKCA 4RMVA 1AR1D 4OZHB 1LO5A 4LLVB 5T5FL 4X7FC 3KHOA 4UDTA 3FL7A 4G8GA 4MVBC 1FFOA 1BQUA 2B2XH 5TE4L 3RI5K 1MQKL 4KTEH 3WIIH 1EHXA 2V5RA 3HG1A 3FT4B 4G43A 4GOSA 3AS2A 3KYMA 4PJIE 3WLBB 2B20A 1C16B 5C0EA 2IQ9L 5I1EL 1WITA 5DRNA 2EC9U 4NO0D 4G42A 4K94L 2HJKB 4FQCL 2QQNH 3P4OB 1Z5LA 4JE4B 5IFHH 2GTWB 5HGAB 1X6LA 2NY4D 1FP5A 2O5ZL 3EO0B 3E6FA 1HYSC 4NJ9L 2VDKL 2R0WH 1AKJD 1E0OB 2CLRA 2W0FA 1C1EH 3QIBB 4NN7C 4U6XB 1J8HB 4ETQB 3H7LA 1WZMA 3BKCL 4XP5H 1P84K 4U33A 4LLQA 3X11A 4UB0L 1D5IL 3MRMB 4HF5L 3BYYA 2C1PA 4N9GB 5JLZA 5JQHC 4XMPH 2UZIL 4NQEE 1CU4L 4KK9D 4HZAA 4OI7A 3SGEI 3GB7A 3ARRA 3FQRB 1FVDA 4QY8B 5ITBH 3MREB 3MV9E 4XCNB 2ERJC 3QFJD 4XMLH 5GGRA 2E7CA 4PJ7A 4MX7B 4WTWA 5C08E 1Q9OB 3C5JA 1YEFH 5I19H 1I85C 5B21A 1TNNA 4XWOD 9CGTA 1BEYH 3WN5B 2J8UF 1VPOL 2R15A 2VDOL 1AJ7L 3L9RB 4ZUUA 5EC1A 2EYSA 2YD7A 3NFNB 4L8DA 4XNUH 5BV7C 4HS6A 2RCSL 2WV3A 4NN6C 4LGPB 1AH1A 4FP8L 3UPRA 1UWEL 3ETBF 5DS8B 4M6ML 1FG2B 4GRLD 2XKSA 3VXUB 3HPLB 1AIFA 4XNZB 1A9BB 3QO1B 1P9MA 4JO1L 2XQYK 5IKCB 4GG6B 3TIEA 1H0DB 4L8SB 3QXDB 5L2KA 4NZRH 2Q76B 3LH2H 4AEIH 1U9KA 3NPSB 2FJHA 5HHNB 3GKZA 3O8XB 3W2DH 3ES6B 2NXYC 3DX8B 2GSGB 5DJ6A 3HZYB 4RMTA 3HR6A 1NLBH 2WM0A 2IPTL 2FCBA 5IW1A 2VABB 3CFEA 5HVHC 4OKVA 1T3FB 2P5EB 2NNAB 4LHUG 5IBLC 4HUXA 1NANH 4D9QD 4L4VE 3SHSA 1BFOB 4IRSC 3R0MA 5C07E 4XCYB 2X1QA 3VGAB 4QWWD 2L0DA 4LCWA 1TTUA 2HFTA 1EJOH 3GHEL 5FO7A 4FS0A 1AGDB 1AGFB 1PQZA 3P77B 2VB5A 2ADJA 4XVJL 4J3OC 3KPLB 3WFHA 3TJHD 4PJHA 3HZKA 4OLWH 2NY0C 1A1MA 1SYVA 2ITDB 3IJSA 5CGYC 3E8UH 3ZYOA 1KXQE 3C60A 1T7YA 2IH1A 1X5FA 2VQTA 2YPLB 3MV7B 4RAUA 5CP7A 5BZDA 1T5WA 4JG1L 1B4JL 1AGCB 1EAPA 2BSRA 1MFAH 5EU3A 3UTSD 1WC7B 4HDIA 5J57B 4LNVA 3RUGF 1KGCE 1YYLL 4YH6A 4Y4KD 4I5BA 5EPMB 4S1DD 5D7SL 3BP6B 2G2RA 1M71B 5I8OL 4NQXB 2BC4B 5LXGH 4DOHE 2A73A 2A0LD 1MCSA 4KTDL 4NWUH 3MA9H 2FBOJ 1NFDE 2V2TB 3GJEA 2K7QA 1CF8L 1KCSH 4XXDA 2FX8L 1D9KD 3VWKA 4MQXD 1QBBA 1U3YA 4NHUB 1R24A 5H37G 2ZCLL 1Q9KB 2VR4A 2GJJA 1RZKH 3BP4A 3DMMB 1FYTB 4LK4A 3UTQA 5CSZB 2HWZL 3TFKD 2Y7QA 2XZQL 5IFJA 3GSVA 2A83A 1AXIB 4JGUA 4ZDHB 1WWWX 3ARFC 1MI5D 3D2UD 3UTZA 3VG9B 2A77L 4PRHE 5EBLB 4FQPA 1AD9A 1G9NH 4N5UA 2QSVA 4ETYA 3MBEB 2PO6D 3AMKA 4XP1L 4AEHL 4HMDA 3T2QA 1PX4A 4J3WA 4K3DH 4WHYH 2WBJD 4QGTA 3K3QA 1NGQL 4A6YL 3T2OA 3BIKB 3CD4A 1WLHA 3FN0H 3NGBB 5AYQA 4M3JA 1S78D 2APXA 5C1MB 1JTTA 1KN4H 3IJHB 5FOBB 5D2LE 1TQCC 2GTZB 1SJHA 1MCEA 2AXFB 4RFNC 4G8FB 1I1CA 2HN7A 4UQ3A 2BNRD 4MQ7A 3MV8A 4KJQC 2CRIA 5IB4A 3G6JF 1TJGH 3U9PH 2NX5A 2CKNA 4XNXL 4YE4H 5EZJA 3V5DA 4RQQA 3RY5A 3LY6A 4DGYL 4P4KB 3VXME 3S9DB 2GK0A 2VSCA 3W81A 2H26B 4IS6A 4AQOA 1LK2A 3U2SB 1EO7A 1AR1C 4PJAA 3RWEA 1FNLA 4GKZA 1JNHB 3IKCA 4A2LA 1NLDL 1ZK9A 3MRFA 4E0RB 3L7FB 3ULUE 4OB5H 1I1AA 4O4YH 4B0MM 3UJTL 1Y6MR 3P0VH 1CXKA 4NZUH 3ZO0A 1EEQA 1RJLB 2K1MA 5BS0D 4U1HA 3EYQC 4Q6IC 1SBBA 4K7FA 1N64L 3DVIA 1M7IA 5IGXH 5JUEH 3W82A 1CICB 3PGFL 2X41A 3FO2A 1N59A 4MA8L 4PBXA 1Z9LA 1KB5L 5JOFA 3VD5A 2OZ4L 2H2PD 1TJHH 1OP3H 1MNUL 4EN3B 3I02A 5GS0H 2NY4C 2YWYA 2D7PA 5TQ0H 4UDUB 4M61B 1KB5A 3RGHA 2PXYB 4I2XA 4ZXBC 2OZ4A 3O4LD 1AHWA 1D5BB 2CMRH 1IZKA 3GIVA 3O2WL 1CD9B 2VISB 5IT2H 5KS9E 1DBBL 2JB6A 4ZPVA 3WIHL 3BAEH 4Y2DB 5E9DB 1A6UH 4NQVA 5TPWL 4X8JB 5HPMB 5H35A 2DLTA 2CRMA 4X6DB 3JWDC 1DBKH 5J3HD 3SKNA 1MCBA 2ARJB 2JIXD 2R0ZH 3WJLC 3WIHA 4P48A 3STLA 2VLKE 4OF8A 2DQUL 4GMTL 4RFOH 5GZNC 2A6KB 4QXGL 2F53B 4LLUB 4UNUA 4PLKD 5H2BB 2JCCF 3QNYA 3NCBB 2F54A 2EE9A 4JPIA 4XWOC 1F4AA 3OF6D 3HR5B 2X89A 3M17A 4R7NA 4JJHA 5GRJH 3DO7B 1DLHA 4BZYA 5B39A 2X1WL 1DQTA 4L4TA 4JPKH 2JKXA 1A7QL 1YJDH 2XG5A 3BSZL 2AJVL 4V1DA 3W9EA 2VAAA 4YFEA 3TO4A 3P11H 5HGGS 4GRLC 4GAGL 3UZVB 4G3YL 4C56B 5T1DH 5LGHL 1H5BC 3GNML 5J06A 1K4DB 3TA3C 4JG0H 3MMEB 2GKIA 2BY2A 4WWID 5CUSL 1FLRL 2HRPH 1FC1A 1M7XA 4OM1L 3KYOB 3ARZA 2E27L 3DLQR 3P4MA 3INUL 1F6LL 4JFYA 4JM4H 5JHLH 4OF7A 1HSAB 5EC2B 5KJRH 2PYEA 4IIQC 4JFZH 4LBEB 5IK3B 3P4LA 3DHJA 3VH8A 3HUJE 4LQ1A 3RTQD 1P7HL 4JY6A 4PJ8A 1DSFH 2Q87A 4Z7UA 1KEGH 4NQED 1ZMYA 1UJ3A 1NAKL 4QWWC 1A2YA 1JNLH 2HFGL 5F9OL 4EJ1C 3ALPA 4P23D 1VFOA 1QSEA 1CXEA 4K7PY 5E4EB 3OXSA 5D2NA 1XZ0B 5FYJE 2J8OA 3VXOB 2B4CL 3OHXA 1EVTC 1BJ1H 5TGBB 4DQOH 4DZBA 3FQXA 1XGUA 4XPHH 3QNZB 1AC0A 2C3GA 4RMQA 2FBJL 4LVHC 3QHZH 1A6ZB 1ZTXL 5SWQB 4LPCA 5J8OA 2AJXH 3I3EA 4PJBF 1CL7L 5GGQH 5SWSA 5ICYB 3GJFK 4LLAA 4CN1A 3DTXB 1IC1A 2BVUA 1QEWB 2AI0H 3RWIA 5ADPL 3IF1B 1VB9A 2H41A 1D6VL 3X14B 4PJIB 3NOIA 1T4KA 5M95B 3LSOA 3TCLA 1OAKH 3O4OC 1K8IB 4Y4KC 4G6FB 4LQFL 3FO1B 1QLRB 5GGSB 1JPFA 1QNZL 5I2IA 5CJOL 3BEWA 1NGZA 1A5FH 4UZGA 3CSYB 1NUFA 2A0LC 5FKAA 3V95A 3MR9B 3GK8L 1Q9LA 3FFCD 4HV8B 3ZE2F 3QEQD 1K5NB 3GBMH 4L3CA 3B9VA 1D9KC 3VFWB 4MQXC 4ONFL 3V6FB 1ZLWH 2BHYA 4FFYH 1FYHB 1LD9A 2LAGB 3GMLB 1K4CA 3F58H 4NQSB 4XPFL 3VFMB 3ZE1F 4NKMA 1UQSB 4YHPA 1F4YL 5C07D 4U1GC 5KSAA 2ADFL 3ULVD 1V5JA 1MHEB 3MV11 1NGWB 2FLBT 3LCYA 5DQ9A 2PO6C 1D5MB 3RWGA 5JZ7D 4Z8FH 1DBMH 3KR3L 1YPZF 3HE6B 2IG2H 5HYEA 2WBJC 5FEBA 2YRPA 4NNXA 4PJEB 1JZ8A 1SY6L 3MV9B 5E94A 3MRNA 1FVCA 2QTEA 4ZYKB 3LRHA 3FOMA 3H3BC 5EBGA 4NM4L 5C08B 1S78C 4YDLC 6FABH 2RQ8A 3OJDB 1FNEA 3PWNA 1SY6A 2C3WA 2QHRH 1KIUA 3AAZB 2X70A 3NPZB 3I6KA 4LMQE 1MVFA 2DQFB 1KGCD 3BQUD 3PXJA 1M1SA 1PFCA 2VL5A 3C6LD 5DWUH 2IALB 4Z7VA 1FAKT 1RULH 5DMYA 4JKMA 5I1KL 4JM2F 4D0BA 4M62L 4WIQA 4OGAD 1U91B 4OIIL 2FZ3A 1RPQA 4POUB 5E6ID 3CJJA 5KTEL 4PJCE 4MD0A 3CH1A 3OJ2C 3LKOA 4R8WL 1F11A 1HXMA 1A3LH 2N7BA 3MBXH 3PGDB 4WWKB 5EO1B 4HIEB 2WWMD 2J88L 2NY7H 2YMXL 2N1KA 4P9HL 2Z31A 2IJ0C 5HHOA 1T5XA 3K74B 5GIRB 1BPVA 2APVA 4L4VB 3BT2L 1BBDL 1F00I 4PRHD 2E9IA 1IL1B 1P2CB 3QEUA 2LTQB 3DI2B 2QL1A 4S1RL 1YEHH 2WLYA 3RDTB 1PEWA 2H2PC 5A16A 4HS3B 4JKKA 1IGTA 4TTDD 2IADB 1S7WB 4JZJC 1RIHH 1B6UA 5D5ME 1UACL 5ESVB 4G8EB 4LRNH 1A7RL 4N0RA 2KH2B 1CGVA 1KF9B 3FRUA 2H32B 5K9OA 2EKSB 1HZHH 2YPKA 1Q1JH 3EJZD 1NAMH 1IARB 5ICXA 1OWRM 1A4KB 2YBRA 4U0RC 5ISZA 3EDKA 1DANT 1HWGB 4MJ5B 4WHYG 1JBJA 5J3HC 1DBAL 5IBTH 5A1AA 4BM7A 1MVUA 3U1SH 2P45B 3U7WH 3OJVC 5TE7H 4WW2C 1DFBL 4WRLA 1UA6L 5C0BE 4DOHB 1WFOA 3WE6B 4XBEL 4HGMA 1YNTA 5FECB 5T1MA 1QBLL 1ZGLB 3QCVL 3KJ4B 3RHWF 2DL9A 4R4ND 4X7CC 3BJ91 2AGJH 4TRPL 1NL0H 3HAEB 2C1OB 2IC2A 3GI8H 2BP3A 2X1XR 3SGDI 4TUKL 1MWAB 5JOPE 4HUMB 3UTTA 4PIRF 1CD1A 5HYJB 4GRWH 5IJKA 2OQJA 3SE8H 4LU5H 2MPAL 3KYNA 2G75A 4HK3N 1KV3A 3VFNA 1EFXA 2ZG3A 4X6BA 3C08H 1IM9D 2Z93A 2VUYA 2HKFH 3X17A 1S9WB 4HJJL 1T0MA 3DECA 4BQCA 1EJ6A 1P53A 3UYRH 1CFNB 4ZG1A 5FYLL 3ECBA 5GGUA 3H9ZA 4XMKL 3NA4A 2ESVA 1HKFA 2X9YA 4KKNA 4Y1AA 3RWJA 2XWTB 5BRZD 5KSBA 1I4FB 3LKSA 1CS6A 3M1BA 4I18C 3SGKC 1K2DA 2ZUTA 4N1CA 4OT1L 4XVUC 3QNXA 5JO5A 3RTQC 3ARGC 4DKFL 5C71A 5D1QB 4HZLA 1CLZL 3T0DA 2NQCA 2I5YH 1EHLH 3CVHH 1NQBA 4Y5YA 1ED3B 4JB9L 4NQDA 3NH7H 4P23C 1S5HB 1YY8A 3ZE0F 3VXMB 3UMTA 4PJGF 4TUOB 4MA1B 4RFEB 4FRWA 4D0DB 3CVHA 5GGVH 1LE9B 3WXWL 1SM3H 1UEYA 3O3BA 4HLZG 4GW4A 1DQML 3NIFF 1CDJA 4HXAH 4JRYE 2XN9D 5C0AE 3WFCL 4EDXB 3DGCR 3NABL 1JP5A 1LNUA 3U0PB 1WBZA 1E6JL 3VRIA 3E2HC 2VH5L 5DK2A 4Z0XB 5TE6L 5E2UH 5F93C 5KVFL 3IDNB 3T04D 3U4AA 3RX5A 4J1UB 1MLCA 4HUUB 4PGDA 5B39G 3HS0A 2VKXA 5SWZD 2FSEA 3BRFA 3T4AA 1LWRA 4PR5B 5GJSL 4LRIA 1GGBL 4YQXL 1XCTB 5ABDE 4TOYL 4WWKC 4YGVA 3K46A 1JNJA 3VXSE 3T65B 3HMXL 3A6BH 5ID1A 5I1LA 4J7RA 2NLJA 1TETL 3FMGL 5A3ID 5K9KA 2E5EA 1PW3A 2PW2B 2VDML 1T1WA 5BCAA 4X4YA 1ZA6B 4F7CA 3HMXA 1WZLA 4YIQB 3Q1SL 3MLUL 5AD0A 5IW3A 3LIZH 3ULVC 1MCDA 1ND0A 2VLMD 3V7AE 2DI7A 3IB4A 2DBJA 3VH8G 4KDTA 5JZ7C 2NY3D 5FYJD 2VLKB 1QPPA 12E8H 3QISA 5E8NA 4YDKL 2FEEL 3SDXB 4EXPX 3FB6A 2FECI 3VWJA 2B0SL 4F80A 4X5XA 1XIWB 2OS7A 3MLRH 2MCG1 1RHHA 1UM6H 2RAMA 4HK0A 2AJUH 4HX1A 5C70A 3GKWH 5A2KH 4MLIA 2CH8A 4S11A 3V5KB 4FNLL 3P4NB 3IDUA 5ACZA 3BQUC 1G7LB 5F1NA 3PHQA 5JOEA 4PPTA 3DV4A 3U46B 3BIBX 2A74B 5CBAB 4OGAC 3VE0A 1L7IL 4P2QD 3B5HA 4E42B 1WCQA 2C3HA 1I8IB 4PREB 4HAGA 3T0EB 5E6IC 4L3ED 4WEBL 1T1XB 3IS1X 4P2OD 3O45A 4S1QL 5DEFB 4MD5A 4J8RA 2BNQA 3TBYA 3UYPA 4O2EA 4YDIL 2VXQL 5FHBH 2DWDA 1OPGH 2P4AB 4WV1C 4EOWH 3U0WL 4GJTB 5C9JB 5F7KC 3TC9A 5IESL 1CDUA 2BVPB 5IMLA 3K0WA 2FATH 2CDFA 1XGPA 4PRBB 1GGIL 4OZGF 4GRMB 4NFCA 4H88L 4U1NB 4O5LL 1MHHB 3O9WB 4GXUM 3LKNA 1X7QB 4KRPD 3ULSB 4IRZH 1B4RA 5C0GA 3WUWA 3U30C 3MLVH 4FFZH 4FQJH 4TTDC 3O11B 4KMLB 1FZJB 1T89C 4U3HA 5E2TH 2XKNB 3F12A 4JANA 1HEZA 4Z18A 3SDAD 1KLUB 4HMCA 3MRDA 2D31A 3AREB 3QWRA 4TYUA 3DROB 4AIZB 4YHYB 3AC0A 4MA3B 1HNGA 3EJZC 5EOTA 3HC3L 4XTRD 5J11C 5JW4M 4HCRH 1FV1B 2IFGA 1YNLH 3VFGH 4RBPH 1MCKA 2CIIB 2BSSA 4X83A 4HULB 2G60L 1BOGB 4R3SA 3LKPA 4HGWB 4HPOH 1OF2A 5D1XD 1BMGA 3K8MA 5TDOA 3TJEL 2EDBA 1OP9A 3O6KH 4E5XA 5CJQH 4NQUA 2DBLH 5FF6B 3QXWA 4ZSOE 4LLDA 1PLGL 4Y16A 4JLRA 1N6QH 5CEZE 3MA7B 5EZOL 4R4NC 5F89B 4P2YA 5HGBA 2GT9B 3TT3H 4X98A 4UT9H 1FZMB 2DQIL 5F72S 3K4AA 1BFVH 3QUXD 4CN6A 3P0YL 4M7KL 1PKQB 1DLFH 2VDQL 3D9AL 1FQ9C 4MCZA 4ENED 4JQXC 4MJID 2HA1A 1EEYB 1UFUA 2KQNA 3QUZA 4K3JL 1Z3GH 3MOQA 2GQHA 1MEXL 4GSDL 4PJ9D 4K3HA 5DD5H 4GUPB 3AVEA 5D1ZA 2FD6L 2P5WA 4Y5VA 3W11D 5F9AC 5ESAA 3MC0A 3WL9A 3BRGC 1G9ML 2ZPKL 4P5MA 5DLML 3SE4A 3PQYE 4YX2H 4QTHB 2B8OT 4U1SA 3C5ZA 1MFBH 1CE1L 3WFDH 4JDVB 1S7TA 2WZPD 2O61A 1GPOL 2CKBH 4KK5D 1IRAY 5IB1B 3SCMA 3LQMA 3CFCH 5KANI 1U8IA 3L5XH 3EYSH 1J0YA 3BWUC 1JGVH 2QADD 1AY1H 2CKBA 3DX6B 4H0GA 4BFIB 1RZJC 2CR3A 2J8UE 5D9SA 4DZ8B 2FLRT 1I3UA 1IGYA 3P9WB 2R4RL 4JFXB 3QWOB 4MAYB 4ONHA 3JTTA 3P3YA 5C0BD 1BECA 4Z7OF 1XIWC 5IQ7H 2GY5A 3DX9B 3FO9A 2J2ZA 4UV4H 5BMFH 5FYKL 5FO8A 5I73C 5HGDB 1G0XA 5JA8B 3L95B 1R5IB 5IROA 1YEKL 1LEIA 4RZCA 1JGDA 5F7NC 3UEZA 3T1WA 3MCKB 1MLBA 5IOPA 2V5SA 2GK2A 1T1ZB 5DK0A 4JVWA 4JFOB 1U6AH 4H1LB 3P9MB 4KZEL 4F9LA 3ARPA 3BOVA 3OZ9H 1ZXQA 2IBZX 1YUHB 1EH9A 1INQA 1NMAL 4NPYB 4TSBL 2XWBB 4AG4H 1LK3L 3OGCA 5T33H 3PABA 1YN6B 1Q0YL 2DIJA 3F7VB 1CR9H 1HI6B 4ZTOL 1RJZB 3KWWB 5IHUL 1GIGH 4R4FL 3KPSA 1RZFL 5HYSG 3MRKB 2A6IA 4HBCL 4WJ5A 3H0TB 2Y5EA 1G0DA 3BKJL 4BZ2H 3BP5B 3QCTL 1FNGA 4Z77B 5C8JB 4TNVK 1ZEAH 5IUSA 1DE4A 2AVGA 4HKZB 1IT9L 1EK3A 3FRPG 2NY3C 3CDCA 5DUMH 3BZDA 4XP6L 5HVFB 3NACL 1BVKB 2A1WL 4G7VL 4L9LA 4QRRE 3VD7A 1MH5A 3RUGE 5KG9A 3LN4A 5J6HB 5INDA 2H6PA 3GFUA 2CUMA 1GCFA 1MJ8H 4GBXA 4OUOA 1JE6A 4PGCB 4YHYC 2NY5C 1EIBA 2AK4B 4FQXD 3C9NA 4JRYD 2OSLA 4BUGA 1T6VN 4NHCH 5DK3A 5CZVH 5TE4H 1NFIA 4AMKL 4XAKD 5IB5B 3QO0A 4MD4A 5EWIL 5JDSA 1KFAL 4DKDC 4NWTH 3REVA 3IGAB 4M6OH 1OAZL 2FIKB 2R2BA 4ODWB 4F3FA 3BKYL 1HHIA 1FGNH 1I7RA 1U58B 3FT2A 3VDBA 1HDMA 1MAKA 3MGOA 1XGQA 1P69B 4P2OC 1F3JA 4IMKA 3L3HA 5GGTL 3O41A 4G6JL 1YMME 5I66A 3C09C 2WANA 4JZNA 1HQRB 3V6BR 5HHMB 1KNOA 4HS8L 2FR4B 3RA7L 3VCLB 3BN3B 4LF3A 5F3HA 3CMOL 3QBTB 4UAOC 1B88A 3WIFA 3KYKL 1A6TA 5GGTA 1FRGH 4XT1C 4HJGB 4E41A 4M8QB 2HJLA 4PJ5A 2VL4A 4NM8H 3M8OH 1JHKL 1R3IL 1JPTH 5BW7C 3PWLB 2XY1A 4KRPC 4HT1L 4JFFE 2LE9A 4G8IA 5BQ7A 2MWCA 1S7QA 2AQ1A 4KHXH 2I9TB 3RU8L 3V0WH 5J12C 5IR1B 1NMCC 1J5OH 1ACYH 1JWMB 1AE6L 3R06A 3G6JE 5DRZA 5FO9A 3SDAC 2OTWA 4XHJD 1CE6B 4PJAF 1P7QB 3RY4A 5GRXG 4QRQA 5C0AB 4NQCE 4Z0BH 43C9B 4MDJA 1G9EA 3TNMB 2PR4H 4LEOA 5L9DL 3L3GB 3UTOA 4FTVA 4XTRC 5D7JD 5ILTH 2M2DA 1HQ4B 1QSVA 5EBMA 4IMLA 2VXTL 1YQ2A 1C5BH 3AU1B 5D1XC 2BVOB 3BGAA 4MAYC 3SQOH 1T03H 5MENA 1DL7L 3V4VH 1F3RB 3PDOA 2OTUB 2HJFB 4CJ1A 3B9KA 5E00A 5GISL 2VE6A 2FYYB 5DJXB 3VXSB 1A64A 4D9RE 3JTSB 1IAOB 2JJSC 4ZTPH 1AKJB 1WWCA 3O6LL 5AYUL 5HGHB 1PVHA 4HWZB 25C8H 2BY1A 4AENB 3QA3A 4R9HA 4ONOA 3QP3A 5E2VH 3IDYB 4ENEC 1ZV5A 2R69H 4D0CA 1FLTX 4R7DA 2VZ1A 5EUOA 3C60D 4DAGH 1T1YA 2YN3A 1U8JB 4PJ9C 3DUSB 4XAWH 2YD5A 4XBPA 5FUCE 3F5WB 2ITCB 5JXAL 4UTAL 3W11C 4L8BB 1WF5A 2X9WA 5ENWB 1SEBB 2DQTH 4XCFL 4MWFA 1LMKA 1TCRA 4X99A 1MCNA 1T2QL 2GJZA 1NANI 2Q8AL 3E6HB 3NIGE 1NPUA 4PB9H 1T83A 4KK5C 4PFEA 3MRJA 3HLAA 3WUWG 4F7PB 4WI4A 2B1AH 2VDRH 4R4BA 2JCCE 2NXZD 2VDNL 4CNIA 3O6MH 2CDEA 1A3QA 2QADC 1RVFH 3G9AB 2UUDH 4Y8AA 1VGEH 1G6RL 1GC1H 2MJWA 2BVEA 2DQGH 3TBSA 5E8OA 2JB5H 3QI9A 3BH9A 3KPNB 3B6SA 4NJAH 3QDGD 3TYFB 1G6RA 1DBJH 3D25B 1EO8L 4I0PA 2JTDA 4KMTL 3BPCB 2F19L 3LKQA 1Z9OA 3OPZH 1Y0LA 1CFSB 1PKOA 4JKPH 5HHXH 3TN0D 3BJLA 1MHPH 3CX2A 5D6CB 4QRPA 5ALBH 2EYTA 1D5XB 1QBML 3LQAL 4LSTH 2DDQL 4QEGA 1TENA 3UJIH 1NSNL 4S10A 2HWZH 2A6DA 4PYGA 1GZQA 2M26A 1U8QA 2FL5B 5JW5B 3GMRB 4U49A 1CN4A 3RPIA 4K07A 4KI1A 4JFPB 2ZUYA 1UXWA 4G6MH 4I0KA 4JPVH 3RZCA 2DYPB 3A6CH 3GMMA 3MV8D 3V5HA 2BFVH 3T2NL 1VGKA 5LGJA 1UKQA 4RGMB 1ETZA 4PTUA 2DMKA 1A14L 3C8HA 3WO4C 2DLHA 3I6GA 4ODVL 3GSQA 3W5MA 5JORA 2XRAL 3ROLA 1JK8B 5TF0A 2YD2A 2R1YB 3JV4A 4LDOB 1Y18B 2XPGB 3UTSB 1E4XH 4OLZL 4URTB 2OK0L 5EU7E 3BEVA 1V3LA 1U8HB 3LD8B 4I4WA 4FQHB 5I8EA 4Y19E 5EU6A 3V8OA 1IGMH 3G6DL 4CDHA 1DN2A 4M03A 4WTZG 4FQXC 5DMKA 3L1OH 1RIUH 1OCWL 3BDYL 3BDBA 3O6FD 3SY0A 5IHLB 3ZE2E 1F90L 2APTA 3G5XB 1IC7L 2Q6WB 1G1YA 3WJJC 2HMID 5EIVA 5I71C 2X5PA 1M6OB 1AD0A 2VLJD 2ENYA 5GS0D 5KAQG 1LO0L 3PGFH 5DURD 1CFQA 1I7UA 3X12B 4Y5XA 4CVZA 3PQYB 4QOKA 3F6IA 3ZE1E 3O2VH 3S36L 3V0VB 4UUJA 4J3SA 3B83A 4IHOA 3LV3B 1YPZE 3RAJL 1ZHKA 3V79C 2UVFA 4W4NA 2IMMA 4U1LA 5I1IL 1AXTL 3H9HB 2KQMA 4XC3L 2WINB 3EYVA 3MRHA 4OFIA 4YDVA 3STBA 3CUPB 2X89D 4K3EH 5GGRY 2J8UB 4TNWF 3D3VA 5HHVL 3MLPA 1JF1B 4KWUA 4QRRD 5EULV 3RWFA 1IC4H 4V1DD 2GCYA 5DD6A 1IGIH 3DXAA 4F15B 2VQUA 3CPLA 5DQJA 2V9RA 2AEPL 3S36X 4QYOB 2CIKA 3EJYD 3ROOA 4XHJC 1WCBB 1FVEA 3OG6B 2P8MA 1DQJA 5C9KA 2H1PH 4WI7A 2W65B 4RCAA 3BE1H 5D7JC 3CFBA 3BZFA 3VW3L 5FK9A 3LOWA 1VFBB 1CLOH 3BSZH 4ORGA 2E7LC 2AW2A 3FOLB 1A1OA 5DI8A 4OV5A 2V2XA 1X5JA 2PYED 1PSKH 2BRRH 2EH8L 3P9LB 1X5IA 3PIQB 4LNRB 4G3YH 1QFUL 4TQEH 3FFDB 3MRIB 2C7UB 1VFAA 3L3IB 4OD1L 1TLKA 2EXYD 1MFNA 4WDIB 2BSED 3HNTL 1EZVY 1WSST 3T4YB 4DUXA 1AO7E 2FIRT 2ZUWA 2KPNA 1HHGA 1XGRA 3D0LA 1N0XH 1MRCL 2DQHL 1A6VH 2YPVL 3O4LB 2AKRA 4N8CH 4OZFH 1NKRA 1BD2A 3MSPA 4XPGH 5BV7L 4P46D 1I85A 3TBWA 1KEMH 1FO0B 1UWXH 1XCQA 4KRLB 3C60C 2P8LB 4FXKA 3OKYA 2MHAB 3AB0C 4OZFA 5E08L 1S7SA 1FIGH 5SWSD 3QDMA 2R0LH 1ORQA 3VXQA 4M5ZL 3RUGB 3DVGB 1L4IA 1TTFA 1ADQL 1KC5H 3TCXA 4XCEB 1E27A 2PYFB 4GG6F 1JZ6A 4X8XA 2YZ1A 2XV6B 4G80A 5E1AA 5IVZB 1QFWM 4WUKH 2NXZC 1YEJH 4ZAKB 1ADQA 4OV6F 2HP4A 5I6XB 3T08A 2BCKA 5MHSD 3F6LA 1QKZH 4EI5D 3BFOA 4NC2B 3GSUA 1RK1A 3RBGA 4FQ1L 4OSUH 4RIRA 3U0TA 5C0FB 2ARJQ 3VFUA 3CAFA 1NGYA 1C12A 3QJFA 3RWHA 2EDJA 1DEDA 1LO4H 3A0OA 4NZDA 4IRSA 5LVEA 1WTGT 3IETA 2RFXA 4NCC1 4F2MB 4D9RD 1RZKC 1BIIA 5K59E 2BVQA 4W6WB 2I07B 1G1CA 3OKMA 2AERT 5KSBF 3TN0C 3IS0X 4YXHL 4DN4L 4U6VH 1NBYA 1JGEA 1G9NC 4ORZC 3RY6C 1VKXA 5F7FA 5JW3H 1ES0A 1Q72L 1S7RA 3GHBH 4PLOB 3D39A 3HPJA 2OI9C 3RNQA 2EDFA 3Q6GL 1SJEB 4X80L 4ZS7H 5MEOA 4LKXA 4JHAL 1OAYL 1KT2B 2Y6SD 4JFFB 1JCKA 4N68A 5L0QC 1INDL 4Z76B 1QHPA 3TYGH 3N1PC 5IQ9A 3BPOC 3EOBB 4JQIL 5TFSL 2DWEB 4UIMA 4ZD3L 5C0CA 5F21B 4OLUL 3LQZA 3SO3C 1H8OA 3ZE0E 3LS5L 5I76A 4NQCB 4PJGE 4ERSL 1KJ2L 5IFAL 2DQJH 2R23B 5FV1L 1I7TB 3GBNL 1DVFB 4JO2H 3VA6A 4UIKH 2OL3L 3NIFE 1NDGA 4NFBA 5JNYA 1F2XK 3FT4A 3GI9H 4PJDA 1OP3K 5DHVA 1KJ2A 4P57A 4MDIA 4M62H 1W72L 1OM3H 4XP9H 4F15C 1K8DA 3ARFA 2DTML 1JF5A 4QRTA 3WO3B 1CLYL 4M7LH 1KULA 2OL3A 4XC1H 2NR6D 1RMFL 2HJKA 1KJVA 3IJYB 4OLYH 5HGAA 1CZ8H 4H5SB 1W72A 3QEQB 5EU5A 1BJ1J 4WENB 3WEXB 3O6FC 1HNFA 3ZDXF 1IAIM 2AABH 4ETQA 1S9YA 1QUNA 4ELMB 2HMIC 4K9EH 4ELKA 1QO3A 1MRDH 1LP9F 5J1TC 1F5WA 4UNTA 1MJJB 4RDQF 5GS0C 3JV5A 3AS0A 2YKLH 3KJ6L 1BQLH 4JZOB 4ODUB 5DDHA 4HIXH 4OGYH 4N9GA 1WBYB 2VERN 3KVQA 4X6EB 1JFQH 5ISZD 3LVEA 2VZSA 5B8CC 4KC3B 2FEDD 1MCPH 1R3LB 2IQAA 4OLEA 4JFHD 1I1FA 1RUML 4QY8A 1AI1H 1EERB 1CGXA 3W39B 1U3HC 3QEHA 1A7OH 4BH8A 3OAUL 3EO9H 1H3GA 3KYAA 3TP4A 1NBZA 2JCCB 4KVNL 5F8RC 4YXLL 3NZHL 4AEEA 4YHLL 5IVXA 3ELAT 4R97B 2X4OB 3OB0H 4MB5A 3IAPA 3IFPA 1OAQH 2J7LA 2YD4A 4I48B 4GAJH 1TQBB 1B0RB 1SBSH 2XNAA 4JRXE 4NUJB 1UCBL 1CFVH 3C6LB 1A8JH 4QXWA 1KLGB 4LVEA 1JHTA 1AXSA 3TH2T 4BSVA 4ODSL 3DBXA 1RY7B 3VXUA 4Q6IA 1RFDH 3QCUL 1KACB 3HMWL 3MYJB 3CSBA 4JFQA 4MJ2A 1KELH 3DYMA 3BD5A 2HFFB 4NO0A 3EJYC 1CYGA 3VXTB 1TPXB 1C5CL 1T6WA 3LHPL 3G5VA 4OM0L 1YJDC 2EYRA 5JHDE 5FCUL 2ESVD 3ZYJA 2D7MA 1N7MH 1NGXA 2ZCKH 3B5TA 4GAYB 1N2RB 4ZXBA 4HPYL 2GJ6E 3JWDL 3NIDE 1U95A 4GKSA 4L3AA 3Q3GB 2H2SD 4G9DA 1RIVL 3G6AA 4KQ3L 1V7NL 1JZ2A 4X6DF 2AEIT 4XCYA 4OZGE 1HSBA 3PV6B 2UWEA 1FFNA 5HI5D 3K2UL 1Z2KA 3WJLA 1KB9K 4ALAL 3EYFA 3S96B 5IF0B 4OAWA 2YA1A 4NQDD 1QYGL 4Q9RH 1HILA 4Z5RA 3FAWA 2WP3T 3MUJA 4ODXB 3BVNB 3QFJA 4GW1A 5DJ8B 1S9VB 4GXUN 3L3OA 3U4BL 5CEYA 3V4PL 1HH6B 4U6YA 5EDXA 2HLFD 4P46C 1R0AH 4KGJA 2YPLA 1EEUA 1J1XL 3MJ8B 4RGND 3WFBH 1J87A 5H94A 1U8KA 1U3ZA 3T1FA 4QRSB 1AP2B 1QLEL 3FO0H 3EGSA 4G8GE 4PJBB 4BFGA 1WC7A 3IFOB 2B5IC 5HYQB 2H3NA 3G08B 4PRAA 1IEHA 3ZKXB 1QFWL 2XZCH 1ZA3B 3CFKA 1FDLL 1NBQA 4GRLA 3I6LE 3QUMB 3HG1E 5FM8A 4HIHA 4P2RB 3IU3A 1H5BA 1ZT7A 3TA3A 1ZLWK 1S9XB 5DYOB 2DQEL 3MCLH 4M5YH 3QAZC 2XQBH 4IRJD 1HHHA 3NCYS 4PJXA 3U9UB 2BJML 1DN0A 3MOAL 1J1OL 2V2WB 3QUYB 4EI5C 4F8QA 3PJSB 4JN1L 4JAMA 4K7PL 5EU4A 2X1OA 1I9IL 2R2HB 5EOCH 4IIQA 1FYTA 4R0LC 4MNGB 2HT3D 1A3RH 3UXFA 5I1AA 4YHKL 4ZNCD 1A02N 1FNSH 1MJUL 2MSPA 5A2JH 5EBLA 3WHE1 5CSGA 3RVWD 3U83A 1H15A 3WLWD 1IEAB 1J0HA 3WNLA 5F7WC 4TOYH 4R90H 2VO5A 1F42A 5E5MB 1YPZB 4CMMB 2X7LA 3SDDD 4OGZA 3VWJD 4H26A 2AJSH 4Y4HB 5L2JB 1MREL 3QH3A 4U1JA 3IJHA 3WHE0 1JPSL 1CXHA 4NOFA 1RZ8A 2AXFA 2Y6SC 2CDGA 1DDHB 1F02I 3MROB 35C8L 3X13A 1P5UA 4MCYA 1RZ7H 3OB8A 2R8SH 2QQKH 4XNMB 4ZUVB 4LASL 4Y4KA 3DUUB 4UT7H 1YNKL 4H25A 4U4BA 4OZFG 2B0SH 4JM2B 4P4KA 4YFLI 2H26A 5GS1B 2A9MH 2F5AL 1VFUA 1JNHA 2A9NH 3HE7B 1D9KA 4R26L 2CK0L 3GJFA 3Q6FA 5EG6C 3DVNA 4HFUL 2I9LB 3PWPB 3C6SB 1P4LB 1CDBA 1LEGB 2EXWD 2X4UA 4LLYA 3SKOA 1BVLB 4CKVX 3VXPB 1MI5A 3D2UA 1S7UA 5ID0B 3H8NA 3ZTNH 1AO7B 4NT6B 1QLFA 3WD5L 2PO6A 2NR6C 5F1IA 5IIEA 5FIEA 1NGPH 4PJEF 1JL8A 5D7IA 3N85L 5DZLA 4LCWE 2VXQH 1OSPH 4F33B 4TVPH 5CIPA 1NDMA 2PXYA 4FQ2H 3ZKQD 3HZMA 3MLTB 4MXQD 4X5LA 3LN5A 4NKIH 4KRMB 1FSKC 2VIRB 1ZVSA 5HBBA 1R6VA 4D3CH 1N3NB 3VJ6A 4OCWL 4XVSH 3RGVD 5KSVA 3QYCA 4O5LH 5E9DA 4KI5F 5C3TA 2NY1B 5TJWK 3BISA 2P24B 1V7MH 2BNRA 1OSZA 1UZ8B 4L9DA 4YXKL 2BDNH 15C8L 1UXSB 5LWYL 2FEDC 2F5BH 2NY2D 3WSQL 5C6TH 4PJFA 3O3EB 5KVEH 4Y4FB 2Y36H 1MPAH 3JVGC 3QDJD 4IOIB 3R8BB 4Y16D 1BLNB 4XPAL 1RI8A 4X4MA 3B8YA 4D8PB 4AK1A 1NUGA 4LHUB 3LEXB 1CGSH 5TH2A 2J1KA 2X4SB 2BXZA 3ZHKA 2I60H 4PP2B 3QUZD 4S2SB 1EGJH 2D03L 3IXAB 2VDPH 4WHCA 4P2QB 5F88B 1KXTB 1K4DA 4WUUD 1A6AA 3MMEA 4LIQL 3SE9H 1FZOA 2VC2L 3KLAB 5DHYB 3KYOA 1YYML 1ZKAA 2AJYL 4Q58C 1UYWH 4JZJA 3IAGC 1GGTA 3C5ZD 3UBXB 4G9FE 1BM3H 43CAB 3SDCD 1A6PA 5EC2A 1PBYA 2APWA 1OOAA 3RVVD 5IK3A 1WT5C 4S1SL 4MS8D 2R56L 1VACA 3BYTA 1BZ9B 2CLVA 4DCQA 4YPGA 2H2SC 4OZIE 5TF1L 3SDYH 3KXFB 1CG9B 3MACH 3QG6A 2VZ3A 5F6HI 1FBIL 4LFHG 2BZDA 1F8TH 3BUTA 1J9CT 1JGLH 3FQWB 5HI5C 2IPUK 2JIXA 4ZFFB 1XZ0A 4PV8A 3VXOA 4WW2A 1NEZB 2BHUA 1F4WH 3FB7A 2HTLD 1KCUH 3NFSH 4Y4HC 2SEBB 4PJGB 2BOBA 4QHNB 3WFEH 4OQTL 4Z6AT 1AGBA 1MJ7H 1BQSA 4JFDD 2HLFC 5JMRA 3GUTA 4KQ4L 4P4RB 1NC4A 3OF6A 3WNOA 2Y07H 4RGNC 4M6NL 3ZTJH 4BH7A 1XR9B 4UV7H 1D5ZB 4OTXL 4NNPL 4CL7A 5F9JB 2J4WH 5HI4D 2GSIB 4I3RH 5ICZA 4KROD 1JRHH 3GSNA 2QKIB 1QLRA 5GGVY 4EDWH 3ET9F 5GRZA 4NDMB 1OGAB 3FZUD 3CFDB 4IRJC 4BA8A 1K5NA 2DN7A 1I7ZB 1T7VA 2FWOB 1KPRA 4JKLA 3V6FA 3QUXB 2GJ6D 2IANB 3X3FH 2XI9A 5E99H 4I18A 4NRXB 3SGKA 2FB4L 1A6WL 4I2XE 2HT3C 1C5DA 1FFRA 3S35L 3KPSD 2WUCH 4NQSA 3RTQA 3ARGA 5IB2B 5B38B 2EICA 4LPUA 4NQEA 4KDWA 2NYYC 2AXJA 3WLWC 4LLWB 5JXED 4M1GH 1MCIA 4WY7L 3EOAA 3N9GH 1FE8H 2W59A 1XF5B 4M4PA 4TSBH 4P23A 4OGXL 3K2MC 1L6ZA 1CT8B 4ZYKA 3SDDC 2V7HA 4PRNB 2R1XB 3VXRE 3D69B 3ILPA 4RAVB 3VWJC 2YSSB 2V5TA 4U3XA 4OFVA 3HRZA 4GBXD 1X4YA 4C83B 2F54E 1MIEH 1LE5A 1A0QH 5E24E 1B0GB 3LN9A 3BPNB 1I1RA 4OCRL 2E6QA 3FQUB 2CLZB 1DJSA 5F6HJ 3S35X 3R8QA 2YD3A 3ZSTA 4R2GB 3GGWB 4BUHA 5T5NF 4CU8A 1ZT1B 3OX8A 1SHMA 4L4TE 1I8KB 4D9LL 4FZ8L 1TZHA 2DLFH 5EO0A 3FCTA 4ZOEA 1XGYH 4KK6D 1W0VA 5D7KE 4P5TB 4PRIE 1Y6KR 1JMXA 4PRPB 1CXIA 2LVEA 1RU9H 1CIUA 1KCRL 4OLVH 5C09B 5DD3H 4O02H 5D93B 3KPRB 5DQDH 1AQDA 4WWKA 2G9HA 4JO4H 3DI3B 3T8XA 3LZFH 2ICEB 4UINL 4XWGH 1PG7W 3TZVB 3EAKA 4ZUWB 4JY5L 3QSKB 2EDXA 4ONGH 1U8MB 2RJMA 4MNQE 5I74B 5KW9L 3NZ8B 4YUEH 3ULVL 3PE9A 1RUAL 4YWGH 4RISH 2NTFB 3I2CH 4N0FA 5T3XH 2EXWC 3QIUD 2FO4A 4FN0A 3QRGL 1IL1A 5C07A 3W0WE 5IBUB 1RZGB 1U93A 3D87B 1JPGA 3MOBH 3TVMB 4YDJB 1BVZA 1JUFA 1XH3B 4M7ZC 1MCCA 2H32H 4K2UH 5GRUH 1S7WA 3QIWD 5LAXA 3SDXF 1TVBA 3TBTB 5FGRA 1QSEE 3MLZH 3CMOH 3NAAL 1ZHBA 5D2NE 4N1EA 5I18H 1XF4A 2Z9TA 4EVNA 4MXQC 2A6JB 5C6PB 4RBPK 3QDHA 4JDTL 5KN5A 4LKCB 3EOTL 3RKDD 3W9DB 1AC6A 1GGCL 4QXTB 1LO5B 5SX5H 3QUKA 1BZ7A 3FONA 3OMZA 3RGVC 4UDTB 4G8GB 1K3IA 3P30L 1FFOB 2X44D 1RUKH 5KZCB 4IBLT 4LGRB 3BQUA 2QQLL 2IAMD 3LEYH 3HG1B 1F58L 4G43B 4GS7C 1QFHA 4KVCH 3KYMB 4LSVH 1J1PH 2NY2C 4WTXA 3HAEH 1QRNE 1MFEH 3S4SA 5C0EB 4WCYL 4DTGH 1K9TA 3AXLB 1MWAH 1ZGLA 5B4MD 2VXUL 1NFDA 4RMRA 4G42B 3EFDH 3BGFC 4Y16C 1Z5LB 2V5MA 1IZJA 2X42A 3E6FB 1YEEH 1MWAA 3CK0H 1QSFE 4FQLL 4WV1A 4PS4H 4JDZB 3PV7A 2CLRB 4JREC 2W0FB 3CXHJ 3QJHA 3ZT6A 4P2CG 1SYSA 2APFA 3WNPA 2VLLA 4G6KH 4PRHA 5JR1L 4OI8A 1W2KT 4CADA 4LLQB 3ARBD 3X11B 2Y5TA 2D7QA 1UWGH 5JLZB 2C1PB 4MJ6A 5TDNA 3U6RA 1BGXH 1NCCL 2OR9H 1J12A 2HH0H 3NN8B 3SPVA 1IAMA 2XWTA 1RQ5A 1T89A 4JFED 5DFWH 1GJIA 2J6EH 5D70L 4LSUL 1ZSDA 2ZNXA 4Q74A 1FVDB 3SDCC 5JTWA 5GGRB 3RIAF 5LQBL 4PJ7B 3RVVC 1VHPA 4PD4J 1ACZA 4MS8C 3EYOA 3C5JB 3ZT7A 5D2LA 2N4IA 4K23H 5KVDL 3LMJL 2ZG1A 4OZHE 5E7BA 1F97A 5JXAH 3D6GA 2IH3A 3QUML 4GXVL 4ZUUB 1G7IA 2EYSB 3P73A 5EC1B 4WNQA 4L8DB 2WW8A 3H9YA 1ED3A 4HS6B 3TT1H 2NY6B 3UPRB 2EDQA 1FL5A 5FXCH 3ULUH 3WDIA 2ICWI 5E56A 4TULH 1FL6B 4WGVB 2HTLC 4BZ1L 4P59L 1AIFB 4J23A 4F7TB 5EH1A 4I0PD 1ZANL 3ZKMD 3PDDA 2HFEA 4YEEA 3TIEB 5F6IB 4EQ3A 2FGWL 5L2KB 4KPHL 1YEIL 4OFPA 4I77H 2FJHB 2Z8WC 5I8KL 5F3BA 3THMH 1I9JL 4QRPD 5DJ6B 4BQ8A 1KTLA 4JQXA 1KTDA 4Z0XA 2OXGA 3N1FC 2Z92A 5IW1B 3IDNA 4MXWL 2ZSWA 1J8HE 3CFEB 3CSPA 1YN7A 5HHOE 4OKVB 5HI4C 2YS4A 1IBGH 4HUXB 3QQ4A 4JY4A 1IM9A 3NFPA 3FZUC 5IEKA 1INEH 4LCWB 3CXHK 3IU4H 5FO7B 3RZCD 1BBJB 1REIA 1GOHA 4Z7QF 5BRZA 1PQZB 1T7WA 2DLIA 1RZJL 3EFFA 5E03A 2ADJB 3MV01 5GJTH 3WFHB 3OAZH 4PJHB 4XCCL 4GMSL 5KS9A 3HZKB 3B2VH 1A1MB 1SYVB 1ZA6A 3IJSB 4XZUA 1FCCA 2H8PA 1FPTH 3N1MC 5GS3A 5DJYA 5ACLA 4WGWB 3RBSA 4NFDA 4UT6H 2LU7A 3ME0A 4FXGB 5HDQL 5DUPL 5CP7B 5BZDB 1LO2L 1T5WB 4KMQA 2FX7L 1EAPB 2BSRB 3G5YA 3GO1H 5EU3B 5JXEC 1PEZA 3VGGA 4HDIB 4RNRB 3LDBB 3U82B 3VD4A 4LARH 4PD4K 4I5BB 2AV7A 2DMBA 1KENL 1J05A 3DRQB 4BJLA 1XIWA 2G2RB 1FORH 2A73B 4ZQKA 1NBVH 3NCJH 3OQ3B 4N8PA 5BO1H 1QFPA 4GG6E 3GJEB 3DVFA 4XXDB 2XN9A 3WNNA 5AG9A 3VWKB 1RUQH 3L3KA 3RVXD 3P4NA 5F7HA 1R24B 3NMEA 1KXVC 3MLSL 3BMVA 3UTTE 2R4SH 3HFMH 4I9WE 1N6VA 1ZOXA 4NIKB 2ICWJ 2Y7QB 4KTYA 3GSVB 3UCRA 5IFJB 2A83B 2Q8BL 4KK6C 1NMBL 5LBSH 5T1LB 3UTZB 2CJUH 3V4UH 2P5EE 5CBEA 1AD9B 2FECL 1E4XI 2WUBH 4AL8L 3QPXL 5K33A 1T1XA 2DQCL 1CK0H 1JHLH 3FAXA 4DEPB 1JV5A 2KDGA 4G9FB 2ED9A 4NC0B 4N0YH 2A38A 2ORBH 4LSPL 4F37F 1J8KA 4M43L 4NN5C 3ZTJG 1OCWH 5EZLA 1R3JA 5CWSA 5AUMA 3HI5L 4N1HB 3IKKA 5JPMB 4HHAA 5KSBE 4GO6B 1GVIA 1U8OA 3HUJA 3QQ3A 5IV2A 4CMHB 1TVDA 5C0ND 5FYJL 5FYLE 5BZWA 5BJTA 4PRBA 4MA7L 3QIUC 4A6YB 5T3ZH 1IGCL 3EZ8A 1KTKE 3CXDH 1MFCL 3MRLA 1SJHB 5SV4A 4XPBH 3D3VD 3S36H 2ZCHH 4UQ3B 2Q1EA 1I8LC 2NY5L 2GY7B 3O11A 1FZJA 5IB4B 5GSRA 1NCUA 3VXRD 3QIWC 4PTTA 2NX5B 3PP4H 5EZJB 4O9HL 2K7PA 1KLUA 1S3KL 4WI6A 4GKNA 2GK0B 3PL6D 3DV6A 4IS6B 3STZA 1LEKB 1LK2B 2XICA 3I50H 3RKDC 4DUWA 1BF8A 4PJAB 3ARDD 4GKZB 4WI5A 5E95B 5DEGB 3IKCB 5F70A 3MRFB 5HHPA 1V05A 5I1HL 4OLXH 4CJ0A 3TLRA 2IFFL 1I1AB 1VFMA 2AK1L 4PJDF 5INCA 3HC0A 2E9BA 4NO2A 2PCPA 2NW3A 2D4FA 2IAMC 1QD0A 5D7KD 2CR6A 4KY1H 4U1HB 3AM8C 3RZWA 4LLMA 4M1DL 1BFTA 1IFHH 4K7FB 1M7IB 5CJXC 5FHAH 3GEWB 2OJZL 32C2B 3H3PL 1LO3H 3FO2B 3MGTA 1N59B 2EE2A 4CBPA 5E70A 5JOFB 3MLWH 4L3EA 3VG0L 5I9QC 4P2OA 4H8WH 1EHNA 1HINL 4MHHI 4MNQD 4Q9QL 1E4WH 2MKLC 3CVIL 1RURH 2XZAH 3CLFL 1KB5B 3FB5A 3WS6C 5SX4H 2D4DA 2JJTC 3PXHA 2AAVA 4I2XB 3VFPA 3ZMRA 3JUYA 5DMJB 1WTLA 2YHGA 3K4ZA 2VMFA 1AHWB 2YK1H 3ZDXE 1QFOA 3GIVB 2CGRL 2JB6B 4ZPVB 1CD8A 3ABZA 1BAFH 1LP9E 1NC2D 3ARBC 4J3VA 4NQVB 5BW7A 4GW5B 3AUVA 4RMWA 5EORL 4J6RL 1SJVA 5H35B 1I1YA 1PG7L 4UI2A 3SKNB 3WHXA 2WQ8A 3STLB 4RGOL 5DRWB 4UMGA 4BK4A 1KJ3L 2UUDK 3SDAA 3EHBD 4JEGB 3TH4T 4TPRH 3UZQA 3QNYB 2F58H 4NKOA 4HFWA 1YMHA 5IVXF 4ZODA 2QHLA 5MP6L 2F54B 5CHNA 4JPIB 3QQ9C 1S5IH 5EOQH 4ZFGH 3VDAA 4R7NB 5GRVK 4DN3H 1MQ8A 2HAZA 3PWJA 3HC4H 4NQTA 5B39B 4U1IA 2DAVA 4XNYL 4L4TB 3GSOA 5D1XA 1H9VA 3FB8A 4MAYA 4XRCA 1LDPH 3W9EB 2VAAB 1TNMA 2V5YA 3TO4B 4WO4B 1MCOH 4PJCA 1PG7X 4LCCB 1GC1C 3ZKMC 4PGEA 3L95A 3S4SG 4J3XA 3P4MB 3RL1A 1QSFD 2JJSA 2EECA 4H1LH 1MCHA 5FUZL 1RJYA 1MF2L 4JFYB 3ZL4H 4Z78A 3UO1H 1DQDL 4MJIA 2PYEB 5DHXB 5F7YC 2H9GA 3VH8B 2W9EH 1QR1A 5I1GL 4H1LA 2R39A 4PJ9A 3W0WB 4JY6B 4PJ8B 4Z7UB 3EIFA 5CINH 1ORSA 1TZIA 3RQ3A 1MCRA 5JQ6L 2IBGA 4UTBL 1UJ3B 4QTIL 4NPYA 2Z35A 2XWBA 1A2YB 1I9RH 2Z91A 2FX9L 4X6DE 1QSEB 5D5MA 5F9WB 5F7EH 3OXSB 5D2NB 3F7VA 3PNWA 3OHXB 2B1HL 4XPTL 4JCMA 4DZBB 3FQXB 2HLAA 1HKLH 1UB6A 2OM5A 3O0RL 3OSKA 4G5ZH 4HH9A 3RWCA 5I1JL 4LVNC 3H0TA 1MRFL 3OG4B 2W0KA 4TSAL 1JZ5A 4XVTL 3OKDA 5SWSB 1YECL 3SOBH 2Z8VC 5GS2H 3RWIB 1MAJA 1IGFH 5C0RL 1T4KB 3BHBA 1QRNB 5C0BA 5LCVH 5J6HA 4QHMB 5I2IB 3R0NA 3MUGA 3BEWB 1NGZB 2BY0A 2MMXA 4PJXF 4KAQH 4UOW1 4DVBA 5FKAB 4HSQA 1Q9LB 5C2BH 3ZLQC 3S37H 4L3CB 2P47B 3RVXC 5EIIA 2ILLA 3QIBD 1LD9B 2VXVL 3K7UA 1N4XL 2RIKA 1AR2A 2YEZA 3BZ4A 3WNKA 4N0UE 3MXVH 1OAXH 2PUQT 1UM4H 4Y2OA 1QPXA 4YHOL 5KSAB 4YHPB 3SKJL 1U58A 3QEGH 1RMFH 1G7MA 3A67H 1FNHA 1ONQA 4AT6A 5C86A 1V3MA 1VENA 3BPLC 3RWGB 1NFKA 1IC5L 1WGOA 5AZEL 5CZXD 3MODH 4UOW0 3HNSL 1HQRA 4NNXB 5J13B 1T2JA 2FR4A 4X7SH 1UENA 3FTGA 5J0BA 5E94B 3MRNB 1FVCB 3FOMB 3H6JA 3PGCA 1KIPA 4P9MH 4MMXC 2Y72A 2VDLH 4LP4A 4KU1A 1UKTA 5C0NC 1T20A 1WIOA 3VGEA 1FNEB 3PWNB 1NCAL 2BX5A 3F62A 2X70B 3I6KB 3DARA 1KIRA 2B2XL 2EZ0D 4ZUSA 4KTEL 4FFWD 1Q94A 2VL5B 3G04B 3WIIL 1A7NH 3EYQD 5K93A 3VXUD 4D0BB 2J5LC 5D6DC 1ODAA 3GSXB 2FZ3B 1UH2A 2E3VA 3GMOA 4RA0C 3PL6C 3KDMA 4MD0B 3CH1B 1RSFA 4FQXA 4JRYA 1F11B 2QQNL 3ARDC 4F9PA 1WJ3A 3B5GA 5B3JF 5IFHL 1HXMB 1ZGLP 3UDWC 4X5WB 4PG9A 3O8XD 1P4IL 2R0WL 1FGVH 4WVRA 3CZJA 3WJJA 2Z31B 4ZXBD 2AEQH 1C1EL 3OR7A 1J11A 5HHOB 1T5XB 2W38A 4H20H 5GZOD 4XP5L 4F58H 2P5ED 4APQB 3QEUB 5D71H 2VQ1A 1JYXA 1C5CH 2FYYA 1T66D 2KUTA 3MFFA 4XMPL 1OB1A 3VXSA 5A16B 3S8WA 1UWXK 1IGTB 2DMCA 3V6OE 4IOFD 3QT2A 5GZND 1OGTA 2MNUA 1TZGH 1WWBX 4M48H 4PJEE 5ITBL 5MI0C 4XMLL 1OL0A 1YEGH 2R1WA 3FRUB 5K9OB 1YEFL 2VN7A 2YPKB 4WI9A 4YHMH 5I15H 5I19L 4LPVA 1OLLA 1CBVH 4HC1H 1BEYL 2YPLD 2D7TH 3F5WA 3MV7D 5ICXB 4Z7NF 2YBRB 3O3DB 4QRUA 5ISZB 4KI5E 4XNUL 4OF6A 1VADA 2WMPA 5IMMA 1QYGH 4HC1A 1GOFA 4O00A 5D72H 4Q2ZA 2QR0A 1LILA 2DKMA 3K1DA 1KBGH 2W60A 4F7PA 4HIJA 3EHBC 2F9BT 3TA3D 5IEHA 2EH7H 1YNTB 2YXMA 3MRQA 4WHTA 3SO5A 2WIIA 1ZWIA 2XA3A 4AH2A 4NZRL 4AEIL 1B2WH 2JJWA 5D7JA 5E4IA 3HB3D 3W2DL 1FH5L 2Y1VA 1ZHLA 2R2EA 5TQ2H 1O7SA 3UTTB 1QFWH 4M02A 2E7LA 2P1YA 5SV3A 2XY2A 1NLBL 3DMMD 4I3SL 4ODHH 1FYTD 3FQNA 2ADGA 3EYUH 2ZJSH 2OQJB 1MFDH 2G75B 3KYNB 3VFNB 1EFXB 3L3DA 3ZT5A 4X6BB 5J4MA 2Z93B 1AQKH 5BVPH 3MBED 2I24N 4X0KA 5I0ZA 4QHUA 5GGUB 1ZVYA 5HDBF 1EJOL 4Y1AB 3U4EA 3RWJB 3JBG7 3BWAA 4M93C 5T3XE 5KSBB 4WFEE 4DKEH 4HUNB 4PUBH 3VI3F 1EZVX 2DD8H 3LKSB 2HVKA 3M1BB 4OLWL 1K2DB 2FGZA 3MNWA 3E8UL 4A2MA 4YZFE 3QNXB 1MJUH 4YC2B 5JO5B 3QDAA 4UILH 3I75A 4HZLB 1HOCA 1X44A 4PY7B 4NO3A 1MFAL 1WZ1H 4Y5YB 3TWCH 4FXLA 4HKBA 4NQDB 4WW2F 1YY8B 5F96H 3GIZH 1GAFH 4P4KD 3DSFL 4YHZH 3TO2A 1BWWA 4JGJA 4OUUA 5DVOA 5LXGL 2MCPH 4NWUL 3O3BB 3MA9L 4GW4B 1KCSL 2R1YA 2AXGB 3MNVB 4LL9A 2D3VA 5EFIA 2VXSH 1LNUB 2FHCA 2VR5A 1WBXA 1WBZB 4ZPTB 5CEZH 4KFZC 5EIQA 5L6YH 1RZKL 5DK2B 1N8ZA 3MUY1 3QDGA 1MLCB 4DW2L 1J7VR 3HS0B 4ZSOA 5HYJE 2OYPA 1CICD 1QHOA 5MENE 1RHFA 2NW2A 1G9NL 2FSEB 4HGKC 3T4AB 4LCIH 3ILQD 2W1NA 4EN3D 1NEUA 4YGVB 3TN0A 3SN6N 1ZHNA 3UJJH 5ID1B 3OKLA 5IM7B 1JZ7A 5I1LB 2NLJB 1W0WA 5FA3A 2PXYD 3RY6A 3QIBC 3FN0L 5K9KB 2DICA 1M6OA 1T1WB 4X4YB 1LP9B 2D2OA 4APQC 4F7CB 4LDEB 4GQPH 1D6EA 1ZT4A 3CLEH 1IAIH 4TVPD 5AD0B 5BVJA 1KN4L 5E9DD 1YEDA 1ND0B 2C4FT 2YD9A 5D8JH 5KANG 1II4E 4O2FA 3OJMB 1F4XH 3V0VA 4H1LG 4K9EC 2V9QA 3VFOB 5CZXC 3C87A 3EOYG 3CIQA 3MRBB 3QHFH 2VOTA 3GMQA 5E8NB 3OB0K 1TJGL 3U9PL 4J4PD 4YE4L 3S5LA 3FB6B 2F53D 1VERA 5DR5H 1XAUA 3FT3A 4X5XB 1ZLVH 4EKXA 2X4PA 1RHHB 4OCWH 2WINA 4HK0B 4HX1B 3SJVE 3H7BB 3OKOA 4XX1E 5DRXB 3WN5C 1DUYA 1YY9D 4IDJH 4DFHA 3MRCB 3C5SA 5EOCJ 5E8EB 4OB5L 4O4YL 4YBLB 4NBYB 1EMTH 5E2JA 2EZ0C 3P0VL 5ACZB 4H0HB 15C8H 4FFWC 5F1NB 5F44A 2X1PA 3PHQB 4NZUL 5F1OB 4HMEA 2OXHA 3L6FA 1OARH 2VAJA 4XBGA 5I1DA 3BX7C 3VE0B 4C56D 5IGXL 5JUEL 1KPVA 4XNZC 2EDYA 1WV7T 3TPUA 1UM5H 1TJHL 2LABA 3O45B 4L8SC 5CILH 5FUOH 2VJXA 3ARXA 5GS0L 4MD5B 3NPSC 4J8RB 4AIOA 2BNQB 2B7DT 3TBYB 5E5RB 5TQ0L 3O8XC 4O2EB 3O6FA 4LCUA 2DWDB 1PDKA 2GUOA 1C7SA 4ELMF 2QLVB 2QEJA 4LNRA 2CMRL 3VGBA 2VLJA 5DC4B 3BW9A 5GZOC 4EUPB 5IJVA 2CDFB 5IT2L 1ZLUH 3ZYZA 3ULVF 1XGPB 3L5JA 3BAEL 1FAIH 3L3IA 1GGUA 2XWJA 4NSKB 3HI1A 1UVQA 1A6UL 4GKOA 4OCYH 4IJ3B 5B8CA 1NH6A 1T66C 3IFLH 1DBKL 3VGAC 5C0GB 3WUWB 4Q97A 5DD1H 1FO0H 2R0ZL 3TBVA 3OKKA 1U3HA 4RFOL 3EBAA 1IEBA 4IOFC 3F12B 1Q0XH 4JANB 1HEZB 3SDXE 3MRDB 1FZKA 2AJZA 2D31B 4HG4J 5FDWA 4L5FL 2L7JA 5TF1H 3RVUD 5EOTB 1NC4D 5GRJL 4OF0A 5DTFA 3K4DA 2BSSB 4R3SB 1CD0A 3LKPB 1OF2B 1YC7A 4QRRA 4JPKL 2YD1A 3S88H 2QV2A 1YJDL 2R29L 5TDOB 5ERWA 1EDQA 4K71B 3P11L 4E5XB 4QHLA 1HCFX 5T1DL 2QSQA 1NFDF 4WI2A 1HK6A 1WFUA 3GSWA 4JG0L 4LLDB 4NC1C 4JLRB 2HRPL 2X4QA 3T0EE 5HGBB 4L29A 5I75B 2IEPA 4O2CA 4X98B 5LG1A 4EZMA 4X7DC 1CGWA 5C0FA 3HB3C 4JM4L 1S7VA 1TJIH 3DRTA 3QFDB 5JHLL 5EA0H 3CX5J 4MCZB 4LCYA 4N0UB 5KJRL 3JWNC 3QUZB 4JFZL 3DMMC 1S8DA 4XI5D 2LFGA 4CN4A 4XVUD 3R4DA 5CP3H 3ARGD 4LSRH 1DSFL 4HAFA 4MZ2A 4DUVA 1UG9A 5D1ZB 1KEGL 3VG9C 2NPLX 2P5WB 4Y5VB 2Q20A 5ESAB 4I13B 3WL9B 2YA2A 1CDHA 4P5MB 3MBEC 1YMMA 2XXCB 3LPWA 3MJ9H 1JNLL 3HE6D 1MCLA 4QOKE 4U1SB 1IGJA 1WZKA 2ZZUT 3C5ZB 1JRHI 4U1MA 1S7TB 5D7LE 3MV9D 4POZD 2O61B 1P4BH 5T3ZE 4DQOL 5C08D 2F8XC 1A6WH 4XPHL 3NGBC 3MJ9A 1FFPB 4ZO7A 4P46A 3SCMB 2ID5A 4I3GA 5D96B 4DGIH 4LSQH 3QHZL 2YA0A 1L7TH 2CKBB 3B2UC 2AJXL 4XNQA 2OP4H 4RRPA 5F1KC 5GGQL 2XA8H 7FABH 1NCWH 3QPQD 3M07A 3RNKA 5I16A 4ODBD 1I8MA 1DUZA 5D9SB 3GM8A 3V7AG 2AI0L 1IGYB 3MJGX 3SE3C 2DWEA 4HG4K 3G6JA 5J1AA 2EEAA 4ONHB 1OAKL 3JTTB 4NZJA 1MSPA 5A2IH 3DURA 3DXAE 1U8PA 3NTCL 4P4KC 3MJ7A 4NQCA 3OWEA 3FO9B 1A5FL 3R1GH 5JPNA 3WYRA 5FO8B 4WWKD 3F7QA 2WWKT 3GBML 4EI5A 1X9QA 1CGYA 1LEIB 3I3BA 4RZCB 1JGDB 5HTSA 4FFYL 4R0LA 1MLBB 5IOPB 4M8VA 1PKQE 4KROB 4HLJA 5DK0B 4L4VD 3MRGA 3OKNA 4WFHE 2DTSA 5C92A 2EC9T 1CICC 4CAGA 3TESA 8CGTA 3IJYA 3RDTD 4JHWH 4H5SA 1INQB 4TTGA 4Z8FL 1DBML 1P1ZA 3VFTA 3CX5K 5T3XD 3ILQC 4EN3C 3OGCB 2X2YA 2IG2L 4X6CF 3PABB 5E8DH 1YQVL 4CRPA 2OMNA 4XGZA 3TV3H 1MOEA 1U36A 2PXYC 1NCBH 3DSNA 3KPSB 5E2WH 4O51B 1BD2E 2A6IB 4WJ5B 5CEXA 2GFBA 3HN3A 2XYCA 1JZ3A 4ODUA 4Y2DC 1FNGB 5IMOA 3DUHA 5FYKU 3ARTA 1DE4B 2J12B 2PTVA 3QQNA 1EAJA 4M7JH 5DWUL 3ESVF 4L9LB 3QDME 1RULL 4J4PC 2YZ8A 1MH5B 4ZO9A 3LN4B 5INDB 2H6PB 4QT5A 5AZ2H 4M7LT 2ZUSA 1JWUA 2VTFA 5J6GA 4KZDH 3C9NB 2X4OA 1H3PH 2OSLB 4LVOB 3RIFK 4RAHA 1A3LL 1SMAA 3MBXL 4BQ6A 1B0RA 1MCWW 4RWYH 1M05A 1YY9C 3FQTA 1GXEA 3IFNH 2NY7L 3QO0B 3OXRA 5JDSB 5HYJD 4DK3A 5K9JH 1XMWA 4CVUA 2VLRE 2R2BB 4F3FB 5FGCE 1X5ZA 1IKNC 1I7RB 3FT2B 1HDMB 1TXKA 2HVJA 1YEHL 4UU9A 1F3JB 3L3HB 3O41B 4Q0XL 4JZNB 2UY6A 1RIHL 1KNOB 8FABA 3S34H 1MAMH 4LF3B 1DQLH 3O2DH 4GQ9H 4LRNL 3DGGA 3WIFB 1A6TB 5ETUA 1GHFH 1HZHL 2BNUB 5DUBA 1EBAA 4E41B 1Q1JL 4P3DB 2HJLB 4PJ5B 3D39E 5DMIH 4BYHA 1NAML 5D1QD 2XTJB 3O2DA 2FH6A 1OVZA 3KPOA 1NCCH 4G8IB 5CS7A 1S7QB 5IBTL 1KCVL 1S7XB 5E4EC 1NAMA 5ALCH 1UH3A 4ODXA 4PLJD 3U7WL 4JGMA 5TE7L 3VXMD 1HN1A 2X4NA 2DJ4A 2ZOKA 3R06B 5DRZB 5C0CE 4ODTH 1C08B 2DI8A 2OTWB 3B9EA 1U2HA 3JVGA 5CFHA 3CFJB 3JXAA 2ICCA 3WKMH 2DLGA 4QRQB 4M00A 3S5LG 4HWBH 3QZWA 3RVUC 3ARYA 3QUMH 4MDJB 3ULUD 5F8QC 2AGJL 2AK4E 4LEOB 3L5WA 1L0YA 1NL0L 4YO0A 2V17H 4FHBD 4FTVB 3GI8L 4JO3H 4QRSA 1HIMH 5EBMB 4LAQH 4IMLB 3HZVA 2ED7A 4HXBH 1ZA3A 1OHQA 4YHIA 4HWBA 3KAAA 1IQDB 5MENB 4Y19A 2Z4QA 1D3CA 2ZNWA 3IXTA 4LU5L 1UZ6F 3S3JA 3PDOB 1E6OH 4LEXH 1A7PH 3C08L 3ZDZF 3DJ9A 1GRWA 3B9KB 2HKFL 5FA4A 5E00B 3GM0A 4JN2A 2VE6B 4I0CC 5MEQA 4ZFZA 3JWOH 1W0YT 4HQQH 4KV5F 5I8KH 3LPFA 2ZUQB 5HYSA 4PB0H 3VMOA 4LSSL 4KJYA 4F7MA 5HHME 5I30H 3BRDA 1MUJA 4XH2A 1WT5A 2CO7B 3HCVB 4D0CB 3KPQB 1SEQH 4XI5C 4R7DB 2G5BA 1MCWM 1UB5A 3FRPA 1T1YB 1RV6X 4K3GA 5KSUB 4KUCD 1FC2D 4XBPB 1IE5A 2EE6A 5J56B 2HKHH 2DIAA 2I5YL 4Y0GA 4Z9KB 1EHLL 2VLKD 3CVHL 3HE6C 5CSBA 3V6OC 1TCRB 3NH7L 4X99B 2GJZB 3MJ6A 4WU7B 1IKFH 4POZC 2DQDH 5BXFB 4PRDA 3NBNA 1MIMH 1XIWD 3MRJB 4N90E 1EEZB 4Y4HA 3V52L 2X6MA 5GGVL 3SJVB 3H9SE 3CCHA 4OBRA 4R4BB 1JIBA 5GHWH 1SM3L 4CNIB 5DA4A 2CDEB 5IVXE 4HXAL 4OF5A 5DJDA 1DDHA 4OFDA 2W9DH 2YRLA 4WW1A 3T3PF 3QPQC 1BREA 1Z6JT 5E8OB 3MXWH 4FZEH 3KNBA 4XNMA 4TUJB 3QI9B 4ZUVA 5CGTA 1KIQB 1WEJH 3BH9B 4NRZA 5E2UL 1P5VA 5CCKH 1NCNA 3TF7C 2GAZB 1QVOA 1G6RB 1LVEA 2OX5A 4I0PB 4J3UA 5CD5D 4HWEH 4J2XA 4KHTH 3T0ED 5IWLA 3KPPA 3LKQB 4IRJA 3CH8A 5CJ5A 5DSCA 5IG7A 2VZUA 3QG7H 3BZEA 5KOVC 1CDGA 3A6BL 2EYTB 1YDPA 3KG5A 3C6SA 1U92B 5HVGB 2A6DB 5FB8A 1GZQB 1U8QB 3VD3A 3CNKA 3VXPA 2O93L 4XP4H 3PWUA 3RPIB 1QQDA 3LIZL 3LEVH 3O9WD 4B7IA 2NZIA 2LTQC 4PBWD 5F9DC 1JI2A 1XR8A 1UXWB 3RDTC 2PW1B 5SX5K 2AV1A 2X4TA 4X9BA 5T3ZD 3SDDA 1VGKB 1I3RA 5LGJB 4EXKA 3LRSA 3MLTA 1ETZB 4QNPF 1MY5A 3JV6A 4PTUB 2VIRA 1HHJA 3IDJA 3QFJE 4MNHA 4DGVH 3MLRL 3ISWA 1UM6L 5MERA 3I6GB 1IGCH 2AJUL 5JORB 3ROLB 3GKWL 1GYAA 1WUNT 3VXNA 3JV4B 3MGAA 3L3JB 2GI7A 1K6QH 2AS5M 4QXUH 4DVRL 1KLFA 4UOJA 4G7YH 2P46B 4RRPG 3BEVB 2IGFH 4YK4B 4I4WB 4L1HA 5DZNA 5L8LB 3KLDA 5DEZA 1VEPA 4Z7WA 1JMZA 1XEDA 5DJ2A 5EU6B 4YR6A 4IOIA 3KJ4C 5AAMA 2DF3A 3MZTA 5AAWA 2D9QB 3V6ZA 5DMKB 1G7QA 3GRWH 4PJXE 2AK1H 3H42H 1KG0A 3SY0B 5FHBL 3I9GH 3O81A 1OPGL 2HG5B 2FJGA 4X7TB 3GMPA 4EOWL 3VFSA 3HHRB 5DVLA 4X9IA 1AD0B 1R5WA 2FATL 4J12A 4Z95H 5F97E 5C0DA 4D94A 2ZKHH 1M7DA 1KJMA 2PNDA 1I7UB 4QF1A 4Y5XB 4CVZB 2C4FU 5L8KB 4QOKB 1ULVA 5JDJA 1XGTA 1JNNH 1ZAGA 4IRZL 3MRPA 4Q9QH 4UUJB 1RK0B 5D7LB 3UBXA 3MLVL 4FFZL 4FQJL 4IHOB 4OD3H 1AFVH 5E2TL 1ZHKB 5CAYB 3CC5A 1CGUA 1R3KA 3WXVH 4U1LB 1BZ9A 4NP4H 3VGDA 5FOJA 3RGVA 3EYVB 3MRHB 4YDVB 1CG9A 1QSZA 5D1QC 1I3GH 1R5VA 5SX4I 4YEFA 3IVKB 4MB3A 1YNLL 2O5XH 3GSRA 1QACA 2O5YH 3MO1A 4HPOL 5H37H 3UTSE 3TIDA 3HI6L 1E4KC 4QCIA 3RWFB 1RUPL 5HY9A 4MAYD 2GCYB 1GL4B 3HNVH 5DD6B 4DWHA 3C2SA 5C7XH 3DXAB 4PLJC 5DGQA 3O6KL 4HCRA 3CPLB 1EV2E 5DQJB 2DBLL 3CSGA 1SMOA 2CIKB 4PJGA 3ROOB 4MA1C 1FVEB 3QDJA 3X3GH 3GZKA 2P8MB 1N6QL 1DQJB 1J0JA 3BUYA 4LMQI 1DZBA 2JELH 3WBDA 4UT9L 3ULUC 2G5RA 3CFBB 3BKMH 3BZFB 5B3JE 4G6AD 1P6AB 1BFVL 4NN7B 5FK9B 3NCYP 1XR9A 3VGFA 1DLFL 1D5ZA 5GRYA 4OV5B 5DI8B 2V2XB 4ZFOL 3HA0A 4NUGH 4EBQH 2F15A 4EIGB 1VFAB 4WUUA 5DD5L 1GGYA 4FABH 3RWDA 1UJTA 5L88L 3OAZK 1OP5H 5DJCB 5IHBA 1HHGB 4ZFOA 1XGRB 3D0LB 1TITA 2FWOA 3BXNB 1MFBL 1IAKA 3WFDL 1MF2H 1HCVA 4S0TD 2BSTA 4F57H 3SDCA 2ERJB 2CKBL 2E6PA 2AKRB 4PJ7F 1BD2B 3D85B 1TVHB 5B3NA 2BVYA 1GSMA 2GITA 5DJ0A 3TBWB 4WU5B 3CFCL 3MQIA 3UC0H 3L5XL 5CJ8A 1XCQB 3EYSL 3EJJX 3DIFA 4FXKB 2OR8A 1JGVL 4JJ5A 5J9PA 4QTIH 3UX9B 5BV7B 4Z7NE 1KN2H 4NN6B 4O58H 3QDMB 1ORQB 1RZIA 2BNRE 2R0KH 1IQWH 2B1HH 4WTZA 4HUWB 4PGZA 4BSWB 2YSSA 1E27B 5GS2D 1IILE 5IQ7L 4YAQA 3W5NA 4JFDA 2AK4D 3NCCB 4G80B 4YNYA 4UV4L 5E1AB 1HXYA 5BMFL 4FQIH 4JRXA 2BCKB 5F7UA 2NXYB 5E8PB 5JOPD 2CLZA 1L0XA 3FQUA 3GSUB 1RK1B 4RIRB 3VFUB 4X4ME 3LS4H 1C12B 3MLXH 3QZWG 3HTLX 3QJFB 5HVHB 2VLRB 5FGCB 4BSJA 1U6AL 5BS0E 1OTSD 4IRSB 3BGMA 4K8RH 5JHDA 3BP7B 5CD5C 1KPUA 3IETB 2RFXB 3T0EC 3OZ9L 2E8YA 1BIIB 3T77A 3CU7A 2BVQB 4AG4L 5T33L 3OKMB 4TSCH 5DT1H 4ZUWA 1EVUA 2D9CA 4N8VA 2GJ6A 4CDGC 1CR9L 5HDBE 2VXVH 4PJHF 1NBYB 1VKXB 2EIZA 2Y06H 4I8DA 1GIGL 2NY0B 4Q9BA 3O4LE 1ES0B 1S7RB 4NZTH 3VI3E 3D39B 3HPJB 1LDSA 1AGEA 3RNQB 2WQRA 2MTPA 5MEOB 4LKXB 3SKJH 4BZ2L 1B3JA 4OZGA 2MQCA 1NJ9A 3O9WC 5JXEA