1YEIH

Catalytic antibody d2.3 complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
222
Chain Sequence
EMQLQQSGAELLRPGTSVKLSCKTSGYIFTSYWIHWVKQRSGQGLEWIARIYPGTGSTYYNEKFKGKATLTADKSSSTAYMQLSTLKSEDSAVYFCTRWGFIPVREDYVMDYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IG ANTIBODY D2.3 (LIGHT CHAIN))
publication title Crossreactivity, efficiency and catalytic specificity of an esterase-like antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 43
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1998-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yeiH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yeiH02
3QXVA 3SGJC 4Z7VB 4EQ2A 1PAMA 4JM4H 2ADFL 4IMKA 4PREA 5HPOA 2V7NA 4WHDA 4NQEE 3TBWA 3U2SA 4Y2DD 4X4YB 5EH1A 3TCLB 3QXWA 4JHAL 3H9ZA 4YBQD 3ZE0F 3ARDA 1OSZB 3T8XB 4LPWA 4NKMB 3BO8A 5HGGS 5JDJA 3EDJA 4KHTH 1S9XB 3VFOA 3B83A 3O6LL 3U7WH 4N0FB 4FQXD 4YXHL 2E7CA 1FL6A 3PWUA 4YDVA 3NVQA 5FUOH 2FNBA 4KDTA 2B4CC 3FQNB 2CKBA 1J18A 5LGHH 4WJ5B 2NY2B 3WLWD 2VUOA 4I18B 4R2GC 4ONHA 4CW1B 3QHFL 4YX2L 1U8OB 3VXUE 1U3HA 1QSFA 5HHPB 1UKTA 4QF1B 1HXYA 5IBTH 4XNXH 4R96B 4D9QD 4XP1L 1NGWA 3A67L 1QYGH 3T0EB 3Q0HA 5IWLA 1U6AH 1K8DB 4XBEH 5I1CH 5JW4M 3V6OC 1S7RB 3LS5H 1XGTB 1U93A 3DYMA 4HKJB 3PQYD 1YQVH 4RAVA 1C8PA 1A4JB 3LKOB 3MV7A 4L4VA 3I84A 5HGBB 4WHTB 3W82A 4PGCA 4KAQL 1TZIA 1OVZA 2HJFB 3VFPA 4HXAL 5DTFB 2YD6A 5FHAL 1QLEH 1LP9A 5CJOL 5J4MA 3LV3A 4PRBA 5EWIL 1XF1A 2CUMA 5CD5C 3LEVH 2GTWB 1UXSA 3RL2A 2IWGA 3MLVH 5IVXF 1OY3B 4JFHE 5I75B 3GJFK 4XPHL 5D72L 4KTEH 5TQ0L 4JFZH 4NQDE 5H94B 3RIFK 1DSFL 3AUVA 3SCMD 1RQ5A 3TH3T 1TJGH 3KYMB 1CTOA 4HMEA 1YEJL 1P5UA 2HFEB 4JO2H 4HK0A 4OB5H 2LU4A 4PY8I 3IF1A 4JZOB 4K7PX 4S10A 4OZGB 1KT2B 4UIMB 2NX5B 3CFKA 4U1IA 4FOMA 1FZKA 1S5HA 2A6KB 1E28A 1J0IA 2HTLD 4GQ9H 3SKJH 4KWUA 3TH4T 3ZLQC 4LDLB 1FGNL 4U1SA 2BVEA 4DZ8B 4A2LA 4G6AD 2I9LB 3SDDB 2B1HH 4ZMAT 4LHUD 4H20H 1CICA 3HMXH 3MLSL 5ABDE 3UO1L 2AXFB 4MXWL 2BHZA 3B4NA 3CLEH 5CEXA 3QDMB 4UOW1 2P46B 3MREB 5CHNB 5IB3B 4O2FA 3BSZL 3EYOB 3W11D 1OSPL 4XP6L 3WEXB 4PJHE 2YSSB 3TT1H 2P5EE 2VR4A 2NY4B 5D7IB 3KS0J 3ZTNH 4Q6IB 4ZD3L 1I85A 3MRNA 3GMPA 4H1LG 4DN4L 1VADA 5ICXB 4OLXH 3DTXB 3MJ9A 5B8CC 1FYTB 4YHYC 2FO4B 3HI6H 4TNVK 4XNZB 2H8PA 3PL6D 5T1KA 3PWJB 1PEZA 1S9VA 3UJTH 4OI7A 2DJ4A 3QEQB 4U1HB 4K3GA 3B9KB 1JGDB 4EBQL 3QO1B 5F72S 3RGVA 3MUGA 5L88H 4IBLT 5E03A 2Z93A 1T83A 4G6KH 1WCBB 1QOKA 4NM8H 1P7QA 2XZCH 4M9PA 2WLZA 5I9QB 4ZFFA 5FIEA 1DBKL 3QEGL 3WL9A 1T21B 4JRYE 1IILE 3VMPA 5GISH 2RJMA 4M6NH 4LSPH 1UQSA 4E41A 5DUMH 4NWUH 2CDEB 1XAUA 4LSVH 1NBZB 1S78D 3OG4B 1HH9B 5D5MB 1D6EA 5IFHL 4I3SL 3OKKB 1JF1B 2ADIB 1FO0H 1IEAA 3HI5L 5IVXA 2WUBH 4RA3A 2HT2C 5E8DL 5AD0B 3BZFA 5GGVL 4K9EH 1QBLL 4G42B 4IRSC 4MCZB 3T0VA 2A38A 4PBXA 3GSVA 4N5EC 3SJVD 1T5XA 5HD8D 1Z5LB 4HIJA 5IR1B 5CMAA 3LY6A 3T0EC 3IDGB 4PRPA 3ARBD 3HC4H 3F62A 4HJJH 4KDWA 3NFPB 2EYSA 2P7TB 3QAZC 4C83B 5JNYA 4LPTA 1LO3L 1OGAE 3H42L 1RZKL 4UT9H 1ADQL 3D0VA 3MRJA 3NIFF 3C8KB 3MLYL 4HD9A 2XQYK 4ZDHA 4HF5H 4K7FB 4MJ6B 5HYJA 5I1AB 5J9PB 2I5YH 5LAXA 2JB6A 5MEQA 4W4OA 1D5XA 1MNUL 2IPUK 5SWQA 1F11A 2Z35B 2FYYB 4GW5B 3HMWL 2PXYD 1D6VL 3MGTA 2J5LB 3UTTA 3BW9A 2Y07H 3PHSA 5JUEL 3PHOB 3S36H 3DOSA 2BOBB 1FSKC 4K7PY 3RNQB 3UBXG 5JXAH 4EN3B 4LMQE 4KY1L 2GIYA 3S98A 1ZHNA 1RMFL 2D31A 4XH2A 1RJZA 1MFDH 5D1QD 4HZAA 2BVQB 2Q76B 4L4JA 1F02I 3MGAA 4IOSD 1LE5A 4MAYD 1BBJA 3CH1A 2V7NB 1P4LA 1WV7T 4U1KA 2NXYD 3HPJA 5IJVB 4OCMC 3CDGA 3K1DA 4R7DA 3B2VL 3U9PH 3PIQA 4P5KB 1YQ2A 1YNTB 1BFSA 4RRPG 1IC7H 4WO4D 3BO8B 4PS4L 1BREA 1AE6L 3IDYC 4MA3B 5EZLB 5B3NA 4LKXA 4M7LH 3G6AA 3V7MA 2XXCB 1CXLA 1FL6B 2YWZA 3PWUB 3RVWC 3EZ8A 4D9QE 2DL2A 4S1QL 4NZJA 2ZSWA 4ZO7A 4NQCA 3OJDA 3W9DA 2V2WB 2JJUA 4OCNC 1I8LA 4BK4A 2EE2A 4Q6IC 6CGTA 2XXMB 2W9DL 4NC1C 4M1DH 2ENSA 3DWTA 2IH3B 1QSFB 5HI3D 1VPOH 3PQYE 4EIZC 3W2DH 4GUPA 1HXYB 1GIGL 2R15A 5J6HA 5IQ7H 4QRQA 1YECH 3H3PH 1UH3A 1MFCH 3QQNA 1GHFH 1IFHL 3U7YH 2EC8A 1A3RL 5GS0L 3UZQA 3UYRL 3BD3A 1CIDA 1RUQH 4TVSa 5JA9A 4H8WC 4PJ8A 1NGZB 4LSTH 1J0KA 1U93B 4L8BB 2DQGL 5CKAA 2H1PL 3ARGC 4RAVB 3MV7B 5C7XL 3U4AA 4L4VB 3BHBA 3FFCA 4MSWA 1WIOA 1KJMA 4UINL 5FM8A 3NFSH 4WUKH 5E2TH 1TZIB 4P5TB 4HW6A 4K3EH 4XPTL 3VFPB 3U0PA 3DURA 3JWDH 4KKAD 1N8ZA 3WO4C 4PRBB 2R69H 3QIWA 3MO1A 2ZG2A 1MIEH 4LLVA 3RL2B 4OBSA 3IJSA 4PJFE 3OMZA 3MRIB 2FBJH 1NBQA 4KVNL 4WTZG 4JR9H 4S1SH 1I1RA 1DQLH 5DEZA 4S2SA 1BECA 5ETUA 2ZNWA 4P2OC 3RBSA 2LVCA 4HK0B 2ADJA 1AKJD 1NFKA 2IMNA 4JG0L 4GXUM 4F9PA 2HKFL 4JGMA 4TULL 3TWCH 4JPIA 3CFKB 3A6CH 3S5LG 1WISA 1NMBH 2A6IA 2R2EA 1UYWH 5KTEL 1FFOA 2BNRB 3F7YA 3N0PB 1MLBA 1IQWH 4ALAH 2Q7NA 4MQTB 1LDPL 2OSLB 3FHAA 1CICB 2YXFA 2F8VA 3HUJF 4GT7A 3S34L 3S36X 4H0IA 5KVEH 2FIRT 5E6IC 3MXWH 4O2FB 4PJGB 4NFBA 3V6FA 3PV6A 4ERSH 4PP1C 5LCVH 3WS3A 3SPVA 1TETH 4IRZH 4I8DA 4NHCH 3MRNB 4HXBH 3D87B 1VADB 3JWNC 1UT9A 5LG1A 3PNWA 4X8XA 1KUMA 1W8OA 2CDGA 4ETQB 3KPPA 4IMKC 4GKSA 3BP7A 5ICYA 1VHPA 2RIKA 4LCWB 1OAYL 5DD0L 3EZJB 2I9TA 3SKNB 1S9VB 5FYLH 4N1HB 3ABZA 3WYRA 1C08B 4ONFH 4U6XB 15C8H 1X5ZA 3RL1B 3ARDC 3VXSE 3MUGB 4NN5B 5C8JA 3GI9L 2J4WH 4P5MA 5DDHB 1S7SA 4NC0B 4DW2L 5J1SC 1QFHA 4QRUB 2XV6B 3KNBA 4L1HA 3QBTB 1P7QB 5DYOA 1F4WL 2BY3A 2XFXB 3WL9B 2R4RH 2BHUA 2IFFH 2YWYA 1PYWA 3ARFA 4O9HH 3D39A 1UQSB 5E2WL 3MACH 3SJVE 4E41B 1A14H 4POUB 5F3BA 5DD3H 5TFSL 5D8JL 2XN9A 4G8IA 4P46D 3ZDZF 2A0LC 1C7TA 2HG5A 4ZUSB 3CGTA 3NACH 3G04A 2BVUA 1VENA 1D6EB 3DGGA 4Q9QH 2OK0L 5TQ2H 2VE6A 3ZYIA 3O6FD 4M43L 1UM4H 3JXAA 1IEAB 4X6DB 3TLRA 3REWA 1UZ6E 5IB2A 3CXHJ 4LCCA 1U3HC 1JPSH 1IRAY 3BZFB 1T0MA 3WNMA 1QR4A 3GSVB 3RWCB 1T7YA 5IMOB 3LPGA 3IJYB 4NHUA 1SY6L 4HIJB 4LLUA 5CMAB 4JO4H 5DUPH 9CGTA 1G7QA 4PRPB 1DBBH 3WV0A 1SJHB 5I1IL 5IWLC 3D0VB 3MRJB 3RRQA 1OL0A 1TVBA 4YJZL 1DQTA 1P5VA 4NO0D 3NIDF 3GNMH 3EGSB 2ZUVA 3WFEL 1AI1H 3HMXA 5HYJB 4OD3H 1VCAA 5LAXB 2AP2A 3FQTA 5MEQB 4U05A 2QBWA 4LVOC 1D5XB 5HHVL 1I8KA 5SWQB 4I2XE 3HUJA 5T3ZD 3NOIA 1BIIA 4AT6A 3MGTB 3UTTB 1EFXB 4LQFH 3BW9B 5DQDL 5DK0A 4TUKL 2R0LH 5MERA 5CWSA 3HNSH 4WI5A 4KROB 1IGYA 5L2JA 4GJTB 3DVIA 5F9WB 3NA4A 2NY5C 2Z91A 1ZHNB 4XH2B 1SJVA 5M7QA 1MCRA 3PGFH 5T1DL 2G2RB 3BOVA 3ULVC 3V52H 3HG1D 5TPWH 4U1KB 3E3QE 3RA7L 3L5XH 2O61A 3OZ9H 2PO6D 1MREL 4Y4HA 4KRPD 4Z6AT 2YR3A 3PIQB 1HHGA 2O26U 3HB3C 5ELIA 3FT4A 1VEOA 5TF0A 5BS0D 5T5FL 4RMWA 2K7PA 4UOW0 4G9FA 1CDCA 1ZGLA 1GOHA 5GHWH 2ADFH 1G7JA 1IAOA 4LFHG 1EHNA 2BY2A 4KK5D 2ZCHL 4LKXB 4WUUD 4HQQL 3G6AB 3EDDA 3MX0A 3QB7C 4PJBE 3N1MC 4JHAH 1MCJA 4TVPL 3ZO0A 1B0WA 2IADA 4RMRA 5CEZL 4R2GD 1FV1A 3P73A 4NQCB 3OJDB 3KXFB 1FO0A 1UJ3A 4U0RC 4UT7H 1W0WA 1S7WA 3KYKL 1I85C 2VKXA 4XTRC 4C56B 3O6LH 4YXHH 3CSBA 1JYVA 1ROWA 3MV11 4GUPB 4OCWL 4PV8B 5CJBA 5C9JB 4I13B 5CBEB 1MCWM 3BRGC 3LEXA 1JHKL 2J8OA 1Y6KR 4YIQA 2BNQA 3C5SA 3QHFH 8FABB 3RGVC 5D2NA 4NN5C 4U6VL 5J11B 4H26B 4CL7A 1T83C 2ZPKL 4G3YL 4APQA 1FJ1A 1HHIA 5KS9E 1N5AA 4XP1H 2YD3A 3V7AG 3FFCB 4AK1A 1FFNA 5E1AA 3A67H 1DVFA 2UY7A 1OPGL 3VI3E 1IQDA 4V1DB 2MQ3A 3GMLB 2H6PA 2NR6D 1N8ZB 5C0BD 4WEBL 1N2RA 3MO1B 2JTDA 4LLVB 1I9IL 1MIMH 2NY3B 5TE7L 3RTQA 1MUJA 2QSQA 3BXNA 4R0LC 1XR9A 4PJ9B 1YYLL 3RHWK 1NBYB 4UZGA 2GAZA 4KAQH 3WD5L 1PKQA 4K3HA 4N0UE 4UNVA 1G0DA 4O51A 2EDHA 5DJCB 1K4DA 5FHAH 4YC2C 3VD5A 1FDLL 2ADJB 1CD9B 3G6JE 4E42B 2EXYC 3OJ2C 1XT5A 2F53B 4JPIB 5D72H 1CBVL 5TQ0H 4OQTL 2V2TA 2A6IB 2XY2A 2F19H 4LSQL 1DSFH 2R1XA 1FFOB 1ULVA 5FUZL 3V95A 3HZMA 2Y72A 4IIQA 3PWPD 2LU7A 2NTSP 3GBML 4JB9L 1MLBB 2V7HA 1AH1A 4DJMA 1ZKAA 3KYNB 1KTLA 3QP3A 4PTUA 3HZYA 2ATKA 4ZUUA 3V6FB 3DX9B 5C0CD 4KROC 5JHDB 4HK3J 1TPXB 1DFBL 1FGNH 2JJTA 2FZ3A 1FVDB 2H9GA 2PW2A 3MLSH 3H9YA 3UO1H 3PNWB 2NY0B 3IU3A 5TDOA 3KPPB 4GKSB 1OSPH 4XP6H 3WJJA 3IDIB 3VG9B 2YBRB 2I9TB 1WWBX 4MB5A 1BM3L 3WLBA 4ZD3H 3EDKA 5DJXB 5GGQL 1KENL 3U36B 1G7LA 4DN4H 1YJDL 2ESVA 3CDFA 5C8JB 1NCTA 4P5MB 1FORL 1TIUA 3LOWA 3FFDA 2LU3A 3GI8L 5DYOB 5ICZA 4OFKA 1MHPL 1SJXA 2NW3A 1NUDA 4JKPL 1KCUL 3AY4A 1R24A 4NUGH 1PD6A 5DMGC 2BNUA 1AGBA 1NCDL 3D39B 1T03L 4Y4FB 3WNOA 2D7NA 5F3BB 5A2FA 1AHWA 2NY2D 4QY8A 5JIHA 3B9DA 2XN9B 1LEKB 4G8IB 2HG5B 2HT2D 3G04B 4PR5A 5FKAA 5F6IB 3FZUC 1I8LC 1N6VA 4CVWA 4N5ED 1DBKH 3QEGH 4JRXB 4WHCA 2VLKA 4WGWB 4LCCB 2Y5EA 2Y06H 3DX8B 3EJJX 1W8NA 3I6LD 1CZ8H 3T0ED 3O2WL 2VL5A 1FVEA 4X4ME 4ODVH 4NHUB 4OCSH 2E7HA 4LLUB 4JFQA 4JFYA 1U58B 4HS8L 5IIEA 1RJCA 5IFHH 4I3SH 5EU3B 5T3ZE 4JAMB 3HI5H 4PJ8C 5DS8A 4XC3L 4U1LA 3MC0A 3X14B 1QBLH 3P9WB 1KCRL 5C08A 3GSQA 3ARSA 2I24N 3FQTB 5LQBH 1KCLA 3REVA 1TMCB 4HH9A 3B43A 1I8KB 4L29A 2BVOB 3V79C 1LO3H 1BIIB 3H42H 4AT6B 1RZKH 1F3JA 1TQBC 1Z6JT 3QIWC 3MLYH 3F7PC 3H7BB 2VAAA 1XF5A 1IGYB 3W9EB 4U49A 1T4KA 2N1KA 4FP8L 5I8EA 1QSEA 5F3HA 2Z91B 3DBXA 5BS0E 1MNUH 2YUVA 4H88L 1X5AA 3ULUL 4GRLA 3HMWH 1D6VH 3LKNB 2NX5D 3EUUA 5JUEH 1MFAL 4WUUE 1ES0B 2O61B 4F9PC 4Y4HB 1T1XB 2GY7B 4NNYA 5HHXL 3OAZK 4AQOA 2RBLA 1HHGB 2FLRT 4KY1H 3SDDD 1BD2B 3FT4B 4L5FH 4B5EA 1NCWH 5J12C 4I4WA 1MHEB 3GB7A 4FQCL 2QSVA 4G9FB 4B0MM 3L7EB 3QDMD 1ZGLB 1RUPL 1G7JB 2VDKH 43CAA 2YK1L 3EBAA 5I1GL 3VXPB 3IETA 1X44A 3RUGF 2W38A 4NBXB 4CVUA 2EDXA 3S37H 4CGTA 2IADB 3ZSSA 4PJIB 3V6OE 2G60H 3N1QC 1BFOA 1UJ3B 1W0WB 1S7WB 1FYTD 1AE6H 1GC1C 3OKDB 4X6FB 2RCSL 1A7RL 1NFIA 1T22A 2FATL 4ZFZA 3NCEB 1F6AA 1QBML 2E6JA 4S1QH 3VCLA 4WW1B 3B9KD 3CFEA 1OAXL 3CFIC 1U8LA 1MH5B 5GZNC 3LEXB 1JRHL 4YIQB 2DQUH 3C5SB 4WGVB 4AYFA 2W9DH 4U6TA 4QXWA 1BZ9B 2DQTL 4K55A 4XCCL 4BFIA 5FO9B 5C0BE 5D2NB 4CN6A 5FOBA 4M1GH 3KPRB 1W0VB 3MRHA 3C9NA 1R3IL 4APQB 1FJ1B 1HHIB 3MOAL 4HLZG 1N5AB 1WAAF 4M3KB 3VWJA 2OTWB 4JZJB 1FFNB 1IFHH 3MNZA 4NNPL 4CN4A 2H2SC 1A3RH 2YA2A 5CCKL 1NL0L 3ARFC 4PV9A 3UYRH 1A6WL 5KVMC 3RDTA 5B38A 2EKSB 4U0QB 4GMSH 3KDMA 1OCWL 4I0CC 1S7QA 2DQGH 3NABH 2H1PH 4Y16B 5C7XH 1QG3A 1QLRA 2YN3A 3BT2L 4P49A 3BXNB 4P2OD 3MRDA 1XR9B 3BIBX 4HJ0C 4UINH 1KJ2H 4LCCC 3QQ3B 4X9FA 5E2VH 3MRFA 1DQDH 3AM8A 4XPTH 2DKMA 2AXGA 1K4DB 3QXTA 1SVCP 3PWPE 3ZKQD 4EI6A 5EIVA 3NCCB 4GLRH 5E0QA 3VFGL 4OFYA 2XKNA 1X4XA 3L9RA 3MRBB 4JQXC 4KV5E 5F7MC 4IJ3C 3QHZL 1OARL 5L9DL 3VXOA 2NLJA 4OKDA 3K80A 4KVNH 2X10A 2JJWA 2V2TB 4GLRI 1NCNA 5C0CE 5B3JF 2GKIA 2R1XB 5GRXG 1T1ZB 3CFDA 2PNDA 2NNAA 4Z7VE 1EJOL 4JG0H 3WN5A 1EPFA 5EPMA 1BEYL 1TJIL 3KPOA 1ZV5A 2HKFH 4TULH 1KTLB 2J12B 4OTXL 2FJHA 3HZYB 3RUGA 3GIZL 2ATKB 5T5NG 2YRPA 1WIPA 3S3PA 4S1DD 5KTEH 2GFBA 2G75B 4IMLA 4TN9A 4BYHA 5DRZA 3FL7A 5F7DA 2CK2A 3MMEA 2A83A 2AVGA 1LDPH 3NAAL 2H9GB 2PW2B 1HCFX 3IU3B 5IHZB 3S34H 4MNHA 2NY7L 3GGWA 3ARDD 4X4ZA 1AQDA 4PRHA 3WLBB 1KNOA 1E4XL 3QULA 1G7LB 2ESVB 4FXLA 5EZOL 3I02B 3GSRB 2Q87A 2FJGB 2Y7QA 3FB8A 2YA0A 1KPUA 4G80B 5IB5A 2ID5A 5ICZB 3F8UB 3P3YA 1EIBA 2NW3B 1R24B 3CC5B 1WAAA 1OAYH 5DD0H 3I6LE 3TESA 5EO9B 3ZKMD 3T0EE 1IM9A 4G8GA 3R8QA 4CUCA 5ID1A 5MP6L 1UWEL 4QY8B 3LKRB 4MQSB 1QFUH 5IVOA 1A6UH 1J8HA 3GI9H 3O41B 1A6VH 2VZ3A 4PR5B 1U3HD 1QSFD 5FKAB 3MCKA 4XNYL 1QO3A 1D5MA 4K9EC 2VLKB 3CX2A 5JIKA 3UTSB 4M9OA 1RJLB 5E2WH 5CBAA 4LPCA 3CCHB 5CAYB 1FVEB 3V2AR 4JFQB 3VWKB 2JELL 4JFYB 1QR1B 5HPMA 3UDWA 3R0MA 5HHMD 4BSJA 2OK0H 3AB0B 4M43H 3MV7D 4L4VD 1CE6A 2B5IC 3TIEA 4LL9A 4YO0A 5DS8B 4HWEL 1P84K 1K4CA 4U1LB 1J0JA 3TF7C 5DVLA 5C08B 1SY6H 4AENA 2KKQA 3K3QA 4M5ZL 1DVFC 4GS7C 1I1AA 3LRHA 2VERN 5HI4D 4LLWB 4OZGE 4V2BA 3V6BR 5I1IH 2NX5E 5I74B 1F3JB 1OTTC 3BEWB 4W4NA 3T4AA 2F15A 3HE6A 4XP4L 4MS8C 4OI8A 3WFEH 3VDBA 3RTQC 1U8IB 1T4KB 1IZKA 1U36A 3PGDA 4PGBA 3MA9L 5HHVH 3FHQA 5ANMA 3I75A 3QDME 4GRLB 2EH7L 3ZHKA 5IBLC 3DVNB 1K3IA 5DQDH 4JRWA 1TZGL 1ZANL 3BP5B 3OB0H 5D7IE 2Q3AA 4N1EA 4HAFA 1N26A 2VH5L 1ZWIA 4NC1E 5HGAA 2R2BA 1XGUA 1CICD 4I4WB 1FYTE 4IIQC 3KPMB 4OBRA 4M7ZC 1X5JA 3RA7H 5A2IH 3NCYS 1AIFB 1N59A 1MREH 2OJEA 4A2MA 3TZVB 4KKBD 1L4IA 3ILQD 4XTRD 4KUZH 3LD8B 3ELAT 1R3LA 3WDHA 4OZFH 5T5FH 3C09C 5DUBB 5E94B 1JZ7A 1GOGA 3QXUA 3V4VL 3Q48A 4AIOA 2ZCHH 2Z4QB 2ZZUT 1NFIB 1QRNB 1T22B 5T1KD 6FABL 4LCWD 3KAAA 1B0GA 1A1NB 4TVPH 1F6AB 3LHPH 4OV6F 4X5LA 5CEZH 4D9LL 5E6ZA 1JGUL 5BW7A 3CFEB 3WJJC 1GGYA 1U8LB 1A6TB 5FO7A 3DARA 5LGJA 3KYKH 3LKPB 1P7QD 2FWOA 5I1JL 3D85B 1JV5B 5E4EC 3GZKA 3MA7A 4M4PA 4ORZC 3LN5A 3MRHB 4WY7L 2DOCA 3C9NB 3MGOB 4E41D 4OCWH 2R0ZL 1FNGA 3Q1SL 4OLUL 3VWJB 5HDOA 3AY4C 2UY6A 3MNZB 3NN8A 4FNLL 1KG0A 5DJ0A 5ENWA 2AKRB 2CO7B 2MCPL 3GHBL 1JHKH 4PV9B 2GUOA 3MBEA 1AHWC 4KKNA 5B38B 2E27L 3H9SB 2YZ1A 4U6VH 5EUKA 3KDMB 4U3XA 2ZPKH 2OX5A 1JGEB 3R8BB 4G3YH 3JV6B 4J3SA 3SY0B 4GO6B 3T08A 3BGFB 1QLRB 4P59L 1KLFA 2DL9A 3MRDB 5KSBF 5JW3H 4OZFG 1KCVL 4PRPD 1UGNA 1G6RA 2AXGB 4ZNEE 1WBZB 3QWQB 3QIUC 4UV7L 4RGOL 2Z92A 4OD1H 2HMIC 1CFSA 4ACPA 3L9RB 1U3JA 4U1JB 3EHBD 1EERB 5E5MB 1I9IH 4QXTA 1BQLL 1F4AA 1U8PB 2VJXA 1A4KA 3VXOB 3IVKA 2NLJB 2UV3A 2HN7A 3GO1L 1C16B 5HYJD 5ILTL 2I60H 4XXDB 3WD5H 4Q2ZA 4XHJD 4HFWA 3DHMA 4XRCA 4R9HA 4WENB 1MRFH 3G08B 1FDLH 2UUDK 2YN5A 4QRRA 4AIZB 3X3GL 3QHTC 3UTTD 1J5OL 3ZE2E 3WN5B 5EPMB 4I1NB 3AVEA 2PYEA 5DJZA 3BDXA 4KROD 2NY6C 2FJHB 1MCEA 3ME0A 1CBVH 1MFNA 3GMOB 1OT1A 3P4NA 4OQTH 4XNUL 5FUZH 2VXTL 2HT4D 3KYAA 5D1XC 4IMLB 2NY1C 1BZQK 4DGVL 5F7DB 1CDGA 1CLZL 1LNUA 4JB9H 3U82B 2A83B 5FYKL 3KJ6L 3U4BL 2QV2A 3AAZA 2FX8L 3OKLA 2B7DT 2KL6A 3MTRA 5I8OL 4GRLC 4MNHB 3G9AB 3O3BB 4KKLC 2Z0BA 3HAEH 4N0RA 5ERWA 4UNTA 3GGWB 3C5ZA 3KPQA 3MRKA 5CINL 1AQDB 4PUBL 4LDOB 4PRHB 1DFBH 4J4PA 1IGFH 3M1BA 3GJEA 1CR9L 2YHGA 1QSFE 4JE4B 3FB8B 5EO0B 3NIGF 5FKPA 5IB5B 1UG9A 4YNYB 5TF1L 4HZLB 4S1RL 3MJ7B 5F1SA 3O4OB 4NQCD 1BM3H 4JZNB 1ZXQA 1IM9B 4G8GB 5ID1B 3FZUD 5GGQH 1KENH 1A1MA 2V2XA 1V3JA 3KPLA 1YJDH 3DUHA 3QI9B 3KPSA 5HHNA 3F7RA 2PN5A 1FORH 1F3RB 4PLKD 2J3SA 3CVIL 2FR4A 5HDLA 1KJ2A 5CIPB 3MCKB 5DC4B 3MV7E 1MHPH 4L4VE 4JKPH 3TH2T 1KCUH 1D5MB 3VFSA 3ZDXE 5DHXB 5BJTA 1NCDH 5KSBA 4KZDL 5FDWA 5DA4A 1T03H 3N85L 1JNLL 1LP9E 5F7UA 3B2UD 4PJ8D 5EA0L 5HPMB 4ELKA 1SMOA 3R4DA 2P45B 1WZKA 2MJWA 3S7GA 3SKMB 1ED3A 4OZIB 1PKOA 3EO1B 1YMMA 3HAEG 5INCA 4I3RH 5JPNB 4YO0B 3FFCD 3BX7C 1FIGL 1KEML 1FZMB 5DFVC 3QCTH 3Q6GL 4NCC1 4HJGA 2Y25A 3FOLA 2ZCLL 4AENB 2CUIA 4QRPA 1XR8A 4HS8H 3KGRA 1Z9LA 3L1OL 1I1AB 1MJUL 5ITBL 2NY3D 3RDTC 2Q8BL 3QYCA 4ODHL 3G5XA 3ZE1F 4LPUA 4MDIA 1NC4B 1KCRH 5SWSA 1UWXH 1ODAA 2BNRE 5FGRA 2EEDA 4JFFA 2WWKO 4ZXBB 1A7PL 2ITDB 4PGBB 2IPTL 3OKEB 3PGDB 5SX4H 3AM8C 3IDMB 4UBDC 4MD5B 3RWEB 3H3KA 5ANMB 2PF6A 2HJKA 4G6JL 5F89B 3QFDB 4M7JL 4K3JH 2A6DA 2HFGL 3SE4C 3O6ML 3QWRD 5SX4I 2Q7YB 1LWRA 3MLWL 4U6YA 1E6OH 3SEPA 3ROLB 4FP8H 3LQAL 4UTAH 3F6LA 1CGVA 5I8CB 3VJ6A 5F7LB 4JVWA 5JLZA 2BSSA 5BZWA 5EZJB 2QL1A 4H88H 3ULUH 5JW4Q 2BJML 1AGEB 1IVLA 1G7MA 3WN5C 5GIRA 4LCWE 1N59B 1NEZB 5HHXH 4P2CG 1I7RA 1ZT4A 3WXWH 2V5RA 4PJAF 1B4RA 1HINL 2ZOLB 4FQCH 4C58B 4P4KB 4ZFGL 1NKOA 3HE7A 1RUPH 2YK1H 5I1GH 2AW2A 1KJVA 1S5IH 3QZWA 3D5OF 4I0PA 5GZND 4YDLC 2WNGA 1B0GB 4E41E 3OKNA 4FZEL 4Z8FH 2FBOJ 4LRNL 5A16A 2P5WA 2VLRA 2MNUA 1NAML 3EYFA 4PRIA 5LGJB 1X5LA 1QFWL 4X80L 3ZTJG 3K0WA 3BPLC 1SEBA 4X6DE 1A7RH 4M7LT 3J7HA 2FATH 1MAJA 2H2SD 1T1YA 3MA7B 3LN5B 5DGRA 3D39D 3UMTA 3P0GB 1FNGB 1QA9B 2ZP0T 2XN9D 4HLJA 4UB0L 1K3ZA 3NN8B 5ENWB 4EXPX 4PRPE 1TJHL 3L3IA 1JRHH 3MBEB 1AO7B 4XZUA 3FT3A 1ETZA 2DQTH 3FO9A 4GBXB 1F4YL 3RPIB 1MCPL 2HVKB 5DD6B 2X41A 1R3IH 1TLKA 3MOAH 4NSKA 5DC0A 2ZCKL 7FABL 1F8TL 1JRHI 5L2KA 5HYJE 2WW8A 4HS3A 2BZDA 4H25B 4MXQC 5AYQA 1NL0H 3O8XB 1JUFB 1A6WH 1G6RB 3RQ3A 5GS1A 2WINA 1YN6A 4ZYKA 5GXBB 3C5JA 4OZ4A 3UTTE 1CFSB 3SO3C 3UDWC 3QXDA 3MZGB 4QXTB 5EC2A 3BT2H 1A4KB 4O2EA 3B3IA 2HN7B 1A64A 3LDBC 1AFVL 2VO5A 4HFWB 4Y5VC 3HZKA 4Z7WF 2ICCA 4RAUA 4QHMA 3JV4A 2B39A 5EFIA 3S97C 3PWNA 4LLAA 1I1AC 1PW3A 5DJZB 3QHZH 4N8CL 4WDIA 4WI2A 3O11A 1OARH 5L9DH 4NNXB 4ZQKA 2OI9C 4OZFA 5TE4H 3P4NB 1I9JL 4PJAA 3GFUA 3HE6C 3EJYC 1GSMA 2YOCA 4WTXA 1EJOH 1GZPA 3VI4F 1FL5B 1OAQL 2J6EL 4FXGB 5J13B 4L9DA 1BEYH 1F13A 1TJIH 3AAZB 3CX5K 1FCCA 4QNPF 3OKLB 4GFTB 4ZFOB 4OTXH 4Y4HD 5DF0A 3GIZH 4MQ7A 4WEMB 1KN4H 1NMAL 1N64H 2APFA 3MJ8A 2O5YL 2FGZA 5ERWB 5HY9B 1GXEA 1DEEB 1P7KA 3C5ZB 3KPQB 1MCFA 4NQCE 2ZSVA 3KXFE 3T4YA 2AQ1A 1FHGA 3HLAB 4G9FD 4LP4A 3NAAH 4KJYA 4C56E 1BAFL 2DQEL 1CF8L 3ESUF 4NCDA 2CXKA 3QR2A 2CLZA 2NY7H 5CILL 3PJSA 4LOUD 3RAJL 25C8L 2MHAA 1E4XH 4UIKL 4XBPA 1A1MB 2V2XB 5EZOH 3KPSB 4NN7B 5HHNB 1EO8L 1XH3A 2FR4B 2AV1A 2KH2B 4CVXA 1KJ2B 3NIFE 1LE9A 1E4XI 4NCC2 3FFCE 3VFSB 5BJTB 1YDPA 4XAWL 1NGXB 1Z9MA 4V1DE 5MP6H 3TJEL 1UWEH 2D7MA 4OCLC 1J11A 2BNQD 4EI5C 4MA1C 1D9KA 1OTUC 2DLFL 5IVZA 2VXVL 2UYLB 1ZT7A 2AK1L 1Q9KA 4ELKB 1YY8A 3KPRD 1B2WL 1SMAA 3QUKA 3OR6B 2XZQL 1ED3B 4RFEA 1F90L 5DMKA 5E00A 4QWWC 4APQD 1YMMB 4XNYH 1CFNA 3KJ4C 4ELMB 3W5NA 2FD6L 4QO1A 2FH6A 1DVFD 4IRJB 1MCWW 4LNVA 1UKQA 2XWTA 1KB5L 1RD6A 3SDAC 1RJYB 3HC3L 4Z7WA 2JELH 2GEEA 3DECA 3BI9X 4QRPB 1GGIH 1XR8B 4OQTA 1RZKC 1FNFA 3G5XB 3RTQD 2FHBA 3VA2C 1W0YT 1JPST 2VB5A 3BPOB 1LO0L 1LD9A 5SWSB 4QTIH 1UB6A 1V3KA 2FEDC 4G7YL 4JFFB 5HGDA 2W92A 2VXSH 4KQ3L 4M5ZH 2YPVH 2VABA 3RVXC 1A7QL 3HAEA 1FL3B 5FCUH 5CJXA 2N7AA 2DD8H 1IAIM 1JK8A 4NT6B 4YPJA 4LNRA 4U6YB 4FQLL 1U95B 4KQ4L 1KOAA 2EYTA 5AZEL 3ULUF 1DLHB 1XGYL 4JJ5A 5KSVA 4YBLB 4TTDC 4IS6A 5JLZB 2BSSB 4ZTOH 5BZWB 4Q74A 1FQ9C 4PY7A 4HWZA 5HHOA 5I73B 4KJWC 2EH7H 1KTRL 3P4OA 3NH7L 1JF6A 2VITA 2NXZB 1G7MB 3SGDH 1CI5A 1TZGH 2VZOA 4CVZB 3LN9A 5GIRB 2G9HB 1ZANH 4Z0XB 4CNIA 3LQZB 4DVBA 1ZT4B 1KIQB 1PZ5A 1RIHL 3MPCA 3JV0A 2EIDA 3O4LB 3UC0H 4PBVC 2VISA 1KIUA 3SGDI 3IGAA 5E8EA 5E8OA 4YXKL 1WZ1L 1X3DA 3HE7B 3GKZA 4JM2F 3FRUB 4PRNB 4GQPH 3RVTD 1O7SA 5KZCB 3QZWB 3ET9F 4I0PB 4YK4B 3D39E 4ZUVB 1I1YA 3OKNB 3VGEA 4XMLH 1N6UA 2CK0H 2XN9E 3KLHC 1CXHA 1FH5L 2UZXB 1ZGLM 4OUUB 2ESVD 2P5WB 4HUMB 1A0QL 2C7UA 4ZO6A 3RPKA 1BF8A 4J4PC 4PRIB 5F8QC 5GJTL 2O5XL 4OLYL 3V4VH 3ESVF 1YEIL 1HDMA 3G5ZA 6FABH 1DN0B 3WXVL 1T1YB 2X4QA 3IS0X 2OP4L 2DWDB 2D2OA 5GS0C 4D9LH 1JGUH 3MLZL 5DJ2A 4J23A 4LVHB 4X7SL 3WKNA 2HH0L 3CFBA 3L3IB 2Z8WC 3T2OA 4XT1C 3FT3B 5I1JH 3FO9B 1MFBL 3HRZB 1VGEH 1YEFL 2VLKD 1QHPA 1J0HA 1M7IB 1CCZA 5J56B 5JHLH 5J57B 4WY7H 4J3WA 4JANA 2AEPL 1YY9C 2R0ZH 3Q1SH 4OLUH 3MCLL 3SE8L 4HS3B 4LSRL 2IH1A 4FNLH 1DUYA 1FFQA 5BRZA 2MCPH 2CD0A 4YDIL 3GHBH 5T3XD 1CFTB 3MBXL 3HUJE 2E27H 2WBJA 2WINB 4ZYKB 1Z0NA 4OZ4B 3C2SA 4P3CH 1CWVA 3FO2A 3R1GH 3QXDB 4P59H 3B3IB 5ESAA 5C08D 1KCVH 2XRAL 4PJEA 1T1WA 4UAOC 3QNZB 4TSBL 5C6WH 4RGOH 5ACMA 4RAUB 4QHMB 1Y18A 4RGMC 5JR1L 5MEOA 2DLEA 5D7JA 1BQLH 1L6XA 4WDIB 1ZVSA 3Q6FA 4KK9D 4C57C 2NY1D 1JWMA 1R3KB 3GO1H 3PV7A 5ILTH 2Q1EA 1S7XB 1FN4B 5ACZA 1BD2E 5EB9A 3AXLA 2DDQL 3MRMA 3H7LA 1GH7A 2OTPA 4G9FE 5GRUL 4PG2A 3DRTA 4GRLD 5D9SA 3X3GH 3CJJA 4KKLD 4JM2A 3B5TA 5FYLD 3AS2A 1L0XA 3RJDA 4TNWF 5H35A 2NCMA 5J1TC 3MV9A 3HNVL 4XNUH 3S8WA 3MJ8B 4PJIE 4OGAD 2B4CH 3X3FL 2AK4A 4OLEA 3ZDZE 4Z95L 3T4YB 4DGVH 4ENEC 1CLZH 2V17L 3BRDA 4X4XB 2DM2A 3GJFH 5FYKH 5JDSB 3U4BH 3O3EA 4KJYB 1P6AB 2J8HA 2DM3A 4M3JA 4R7NA 1ZVHA 4HKZA 5I8OH 5I73C 4OIBA 1G7IA 4MVBC 4N8PA 2CLZB 1UCBL 2EIBA 1QVOB 4LCYB 5CINH 3WFBL 2MHAB 5HYIA 3QDJA 1LEIA 1II4E 2EE3A 2DIBA 1CR9H 2YD8A 4XBPB 1FNEB 3L3OA 2D7TL 3BIKA 5D2NE 4QRTA 3KPRE 1EO5A 4DZBA 3UTOA 2FJFB 1LE9B 3NBNA 4L8CA 4S1RH 3ARWA 3FO1B 2IALA 4X8JA 2NZIA 4DEPC 1I3UA 3UP1A 4G8EA 1D7FA 2OCFD 4LFHD 1I3GL 1D9KB 4X6EB 4YHLL 5CLTA 5IVZB 1NH6A 1Q9KB 3CVIH 3LPWA 1EEYA 2OL3L 3OXRA 1GPOL 4RFEB 5E00B 3G9VA 5KANI 1CFNB 4U1GB 3VWJD 4KZDH 3FT2A 2XWTB 4ODUB 2QQNH 2XG5A 5C71A 3N85H 1DQJA 4N8VG 1JNLH 4D8PA 4U2ZA 4M03A 3RDTD 4Z7WB 1TVHA 4G6ML 5EA0H 4GG6B 1CD8A 4YGAB 2V9QA 3T1FB 3VH8B 4U7SA 1P4BL 1I3RA 3GMNB 4XMKL 1UM6L 5T1LA 4P23A 1FIGH 4Y2DB 1C7SA 1DBML 1LD9B 3Q6GH 3QUXA 1UB6B 1UXWA 2YPLA 5D6DA 4WFGE 2ZCLH 2R1YA 4OFYD 2VNCA 1UJTA 4XC1L 4JPKL 3MLTA 2MKWA 8CGTA 1MJUH 3D2UA 2VABB 4EVNA 5GS1C 4ODHH 2Q8BH 1LK2B 5CS7A 1JK8B 2H26B 4LNRB 1LK3L 2EYTB 1AJ7L 1X6LA 2ZNXA 4JJ5B 4KUCF 4ZPVB 4R3SB 2IPTH 5KSVB 4GRWH 3RY6A 2WBKA 2E6PA 3GSNB 4KRNA 5L0QB 4YFDB 2YS4A 1QPXA 4PY7B 4AJ0A 4G8FA 4RAHA 5HHOB 1VA9A 4ZS7L 4M7JH 4E5XB 5KJRL 2HFGH 1WC7A 2VITB 5KVGL 1CXFA 5ESVB 3O6MH 1G9NL 2DYPA 4ODBD 3MLWH 1U91A 4CNIB 4QHKI 3LQAH 1PZ5B 3IXTB 3LCYA 4ZAKC 4JFXA 2ESVE 3K4DA 2VISB 5B39A 4KKCC 2CIIB 2IAMC 3IGAB 4QOKA 3QG6A 2BJMH 1KSRA 4RDQG 1IC5L 1BZ7B 3VGAB 2OXHA 5KSAC 1PDKA 3NFNB 4PRHD 2IBBA 2IG2H 4WI7A 4XX1G 2FECL 3TO4C 1HINH 1CG9A 3OB0K 2C7UB 1M05A 3L6FA 1NGQL 3WNLA 4D9RE 4ZFGH 4XI5C 4WU7A 2VLKE 1HDMB 4BFEA 1WUNT 3UTSE 3LRSA 2X4QB 4PB0L 4L3AA 1IM9D 2FSEA 3OR7B 4FZEH 4G8GD 4LEOA 5DJAB 4C54A 1L9NA 2YEZA 4M61B 5I76B 3OF6D 5BCAA 1UZ8A 2R1WA 5DJ2B 1F00I 3WIFB 1J8HD 1NAMH 3CFBB 5T3XE 1QFWH 4X80H 3V6ZA 1ZLSL 4JY4A 2QSCL 1B6DA 3P40A 1U8HB 1NLDL 5FGBC 4PJFB 3GUTA 1ITBB 3QUYC 5JPMA 2EDRA 2DM7A 3P11H 5H37G 4JANB 5L6YL 4JFDA 5C08E 4YHML 1QFWI 4UB0H 4F15B 4F3FB 2K1MA 1TJHH 2C1PB 5I1HL 3V4PL 1H0DA 3U46A 2WBJB 1D9KC 1F4YH 2A74B 3C6SA 4HKBA 4Q58C 4NZRL 4PY8J 1MCPH 1J05A 3FO2B 4NP4L 1RUML 2ZCKH 5ADPL 1F8TH 1QFOA 3E8UL 4NGHH 3TBYA 4F33B 5BVJB 1WFNA 2EH8L 5F7EL 4BSVA 2AQ2A 4PJEB 1I1AD 2YC1A 1T1WB 4Z5RB 1SYVA 4MJIA 4J3VA 1C5DA 4PLJD 5F7YC 5I1DA 2WP3O 3VD7A 1I8MB 5MEOB 5FYLE 4KVCL 3ROOA 3HE6D 1ZVSB 3Q6FB 4JFEA 1RHHA 3EJYD 3PL6B 5JZ7C 5GGRY 1AFVH 1DR9A 5ACZB 1MAML 4LEXH 5JA8B 1DDHB 1K6QL 1CD0A 4O58L 4NRZB 3OHXA 4X83A 5D9SB 1BX2A 1KIRA 4KFZC 2FGWL 2OBGA 1HXMA 2XA8L 3AS1A 3INUL 2X89A 3O2VL 3TM6A 4XB7A 3MV9B 2I07B 5CJXC 1I9JH 1CL7H 3EYUL 1T20A 1YPZF 5TE6L 5IB1A 1KELL 5HYSA 4MHHG 3LMJL 3MNVA 5A3IC 3RIFF 1IM3A 2VN4A 4FFVD 5DSCA 1TQCB 4WU5A 3D9AH 1REIA 4Z0BH 3O3EB 2YRZA 4ZSOA 2PTTA 3QO0A 1CL7I 2A73A 3FB7A 4MXVF 5HI5D 3PWLA 1FP5A 4HKZB 1G7IB 4X9GA 2GI7A 3VW3L 2O5YH 4UT6L 1YNKL 1FRGL 2XG4A 2MQ0A 2PKDA 1DQQB 1YJDC 3V5DB 1LEIB 3C2AH 1H8SA 4NQSA 4HBQA 1A7NL 1P84J 4FQ1L 3L3OB 4H8WH 2GCYB 2P1YA 1BAFH 1VSCA 3HPLA 1JMZA 4ONOA 5D70L 1CF8H 4KK8C 2XICA 2AJUH 1AGFA 2XOTA 2CQVA 3RAJH 5ECJE 4YHZL 25C8H 1FLTX 5F97E 2R0WH 4ZPTA 1S8DB 3BQUA 4UIKH 1NGYA 1ACYL 4QWWD 3H9SE 4LIQL 1EO8H 5HJ3B 3JTTA 1EEYB 1HOCB 5IFAL 1I75A 1BQUA 2EZ0C 4TNVF 4PJXF 5LJYH 3JWOL 3THML 2DF3A 3FT2B 3NGBC 2I25N 4X6CF 4XAWH 4YZFE 3TJEH 1DQJB 3GBNH 4D8PB 3MBED 2DLFH 3DROA 1TVHB 2R29H 5DO2C 2GHWB 2AK1H 1WQVT 5EIIA 1B2WH 2XZQH 2FEDD 1I3RB 3P9LA 4BSWB 2F74B 2NXYB 1V7ML 2FD6H 5T1LB 3VFMA 4XCYB 2HAZA 1TVDA 4Q0XL 5MI0C 3F5WB 1KB5H 3BPNB 3WS6C 2OZ4L 3S9DB 1BMGA 1UXWB 3RVXD 1HILB 3VMOA 2YPLB 2ZOKA 5JO5A 5GS3A 5D1ZA 3HC3H 1V3MA 2R1YB 3DXAB 3OPZH 2R2CA 4WO4B 3MLTB 3VFNA 4WHYH 3WFZA 4MD4B 3D2UB 3T3PF 1J87A 4EVNB 3VU2A 4BQ8A 4O2CA 3RUGE 3QJFB 3RZCA 5D7SL 4DN3L 1BBDH 4N8VA 3QFJA 4RFNB 4GRWF 1YPZA 3HRPA 4TTDD 1PVHA 3GJFA 1N5YL 4JLRA 1MHHA 4NQVA 5K9JL 4PTTA 1IAKB 4QRRD 4KQ3H 3ARRA 1CGYA 1P2CB 4UU9A 4PB9L 1A7QH 2PYED 4FFWD 2COQA 4YHIA 1WC7B 2CRIA 2X4OB 1IGML 5T3ZL 1HSBA 4PJBB 1WFUA 5FYJL 1AXIB 1UACL 1U91B 5D7JC 3ES6A 4KQ4H 4PRHE 3TC9A 3FN0L 5AZEH 5BOZG 4M8QB 2ZUQB 1FC2D 4UQ3A 1IGJA 4ZOBA 4JFXB 1UWXK 3ECBA 4RISL 5B39B 2JK5A 1H3VA 4YHOL 5TH2A 5FGSA 1UVQA 1KLGA 3ZYJA 3QG6B 5C9KA 3RIAK 1KULA 1JN6B 2FEEL 4JM2C 5C0DB 2XA3A 1WAAE 3C5ZD 4N0CC 1D5ZA 3FQUB 3UPRA 4G8GE 4J4PD 3FMGL 1X5KA 3MUY1 4MCYB 2VDNL 4DAGL 1CG9B 2D7QA 4MAUL 3WIIL 4JGJA 4UUJB 1WZ1H 2ERJB 5GZOD 4NJ9L 3L95A 3QSKB 2FHCA 5AAWA 4L8DB 4D3CL 1KACB 3SGKC 4MZ3A 4P2YA 4X5XA 3LRSB 3RWDA 1M71B 1F4XL 4PJXA 2PCPA 4OF6A 3DI2B 4X6CA 2FSEB 4LEOB 3GSXB 2YEZB 5IKCA 1FH5H 3BYYA 4DFHA 1UZ8B 2R1WB 5I0DA 1A0QH 3KPSD 5GJTH 2O5XH 4Z7UF 4PIRF 5ALCH 1F97A 2C3VB 4M6AA 5C0GA 4OZIE 4K71C 1YEIH 1YY9D 2XY1A 4NDMA 2Z8RA 5HBBA 4XPFL 5F1KC 2W60B 3WXVH 4LMQI 5JPMB 1X7QB 43C9A 3QQ4B 4JFDB 2BSRA 5B3JE 1EH9A 1JPTL 3MLZH 5AAMA 2VC2L 5DD5L 4X7SH 2HH0H 1BQHA 3ZT7A 5FEBA 3G6JB 3LQMA 4JKLA 3U46B 1A9BB 4WI3A 1YMMD 3C6SB 1A9EB 1BOGA 1BJ8A 1WFTA 1VFUA 4FG6C 4RIRA 2AEPH 4GW4A 5C6TL 3VFTA 3SE8H 1HZHL 2NW2B 1BOYA 3K2MC 3TBYB 4QRPD 3IFPA 5B8CA 2YC1B 3L3HB 3ZKSD 1BLNA 4HIHA 5ANME 5C0RL 4F7MB 3CVHB 1C5DB 3ULVH 2EEBA 2OMBA 4U1NB 5I1DB 3ORJA 4GMTL 5EOCL 3OKYA 3ROOB 3RZWA 5SWSD 3LAFA 4UMGA 3GIVA 1RHHB 4JFFD 4JQIH 1OM3L 4WCYL 4HIXL 1R3JA 4X0KA 4P23C 3SDCA 3U4EA 2XRAH 2OJZL 3QUXC 1HE7A 1KC5L 3BPNC 4NZDA 1CQKA 4TSBH 1EJ6A 2XQBL 1JI1A 3QH3A 2GK0B 5CGYC 5D6DC 1CE1H 1EBAA 3OHXB 1TDQA 2X4TA 3FN3A 5ITFB 1BX2B 4JCLA 5JR1H 3ARXA 3O3DA 1A22B 1G0YR 4M7KL 3BN9D 5HYSB 1VACA 5D93B 5DQ9A 2RQ8A 3MNVB 1CFQA 2YPKA 5GRUH 1J1PL 4UQ2A 2YXMA 1PLGL 3BD5A 3F7VA 5DSCB 4J3OC 4WU5B 1ND0B 3RWJA 4Y5YB 4PRDA 1W72L 2GTZA 3QO0B 4IRSA 3OAUH 3U30B 2WLYA 5J6GA 4EJ1C 2IBGA 5CP3H 1X4YA 1BVLB 3HNVH 1NAMA 4KI5F 3VRIA 1RZ7L 2GSGB 4Z95H 2V17H 3HE7D 5JW4N 4Z7UA 2APTA 3T09A 4HIEA 3HPLB 3RVUC 3TPKA 4LAJH 3B8SA 2LTQC 4DTGL 4NWTL 5KOVC 4I0PD 4Y5XC 1HH6B 4FA8A 1HHHA 3A6BL 3MYJA 1UCBH 5FOJA 3S96A 4XCFL 3UEZA 5LWYL 3WFBH 2P5WD 1JF5A 2ICWI 2VLRD 3BUYA 4H0HB 3G5VB 4Y8DC 4PRID 3L3KA 1NGYB 4DVRH 4B7IA 1FZJA 2X44D 5GGRB 2D7TH 5F88A 2XTJC 3JTTB 5C0NC 1NGPL 1OWRM 5F9DC 3C8DA 2ERJC 1CT8A 2P8MA 4WV1C 2P24A 3DV6A 5IBUB 4JO1L 5IOPA 3TBVB 3GSOB 1IKFH 1NCBH 4LPYA 3HFMH 3S35L 2QHLA 1ZOXA 3AU1A 4YHLH 4EUPH 1I4FA 3DROB 5DR5L 2P47B 4GH7B 4KHXL 4JQVA 1AQKH 3LKSA 2OL3H 3UYPA 1M6OA 3HCVA 3HG1B 1FAIL 1V7NH 3P9LB 2VUYA 3OKOB 5BZDB 5H2BA 3VFMB 2GY5A 3H0TA 4OIIH 4CDHA 5JO5B 1XF4A 1T0PB 2WANA 4JDVA 1JGLL 2DBJA 4TUJA 4G6MH 1Y0LA 2MCG1 2D0FA 2R56L 5DRWA 2VWEC 1E4KA 4U3CA 3VFNB 4LHUG 5GGUA 3VG0L 1HWGB 4XMKH 3OXSA 2B0SL 1UM6H 5HVGB 5ADOH 4O2CB 4WUUB 2OQJA 4R97C 4JKWA 3BEVA 1DBMH 4JLRB 4MA7L 4NQVB 4R2GB 4XB8A 4PTTB 1J88A 1T7VA 4XC1H 3BJ91 2IC2A 4K94L 5D96C 3R06B 3MXVH 1I1FA 3CK0L 4NQDA 5E4IA 5IV2B 1S7VA 4YBHA 4XX1E 5F9OL 1OP9A 4BQ6A 1LK3H 3ES6B 4F7EB 4KKCD 3WUWG 5HDBF 1NC2A 1YNLH 1AJ7H 1ZE3C 1KTDA 4TOYH 2FIKA 3EJZC 1M7DA 3ECBB 4TVPD 3ARGA 2QQQA 2HWZL 3MLUH 1UVQB 1KLGB 5IW6A 5CEZD 4CJ1A 5KJRH 1TCRB 4I48A 3O2DL 5KVGH 1AC0A 3CUPA 1G9NH 5D4QA 3WKMH 4WIQA 3WFHA 2ZUTA 2YKLH 3B9AA 4FFYL 3ULSA 4X6BA 4XI5D 3BZEA 5EOQH 3KPNA 2ARJB 2X2YA 3KPSE 5I19L 4LLDA 5KSUA 3GBLA 4G5ZH 5INDB 3L95B 5F7FA 2ENYA 5E8PB 4X5XB 1MWAH 3VA6A 3T3MF 2VR5A 3DV4A 3S88L 1J12A 3DMMC 3QIBC 2DKUA 1AR1C 4IOFC 2EXWC 4CMMB 5IMMA 4HFUL 3KHOA 1NGQH 2WUCL 2X4NB 4YPGA 3D25A 3OAZH 2CR6A 4UNUA 1I8IA 3LH2L 1YMME 1KB5A 2FECI 4X99A 3PXHA 2J88H 2PTUA 2UZYB 4BH7A 2D4FA 2HVJB 1RZGA 3IFNL 3LN4B 4HDIB 1XZ0A 2CJUL 1D9KD 3MR9A 3W0WA 4QRPE 2ZKHL 4K07A 3O0RL 3FQWA 3NPSC 4LCUA 3BQUC 2QSCH 4NOBA 4DUXA 3QRFM 1NLDH 4M02A 1T5WA 3UAJC 5SWSE 4HBCL 3JSSA 4RIRB 2MTPA 4GW4B 4QGTA 3WHXA 4JFFE 4GRWB 4YHMH 4OCRL 3IDNA 4GSDL 3U9UA 3VFTB 1SM3H 3CX5J 5F93C 5B8CB 5C0JB 4YHYB 3FN9A 5I1HH 4N0YL 3V4PH 1Z2KA 1V5JA 3GSWA 4G7VL 3D3VA 1H8OA 1GGCL 2QADB 5JZ7D 4TPRL 4NZRH 1ZHBA 5BO1L 1OTSC 5IROA 4NP4H 1YUHB 3MRPA 1I7TA 5ADPH 3PDDA 1JTPA 3E8UH 1QUNA 4J8RA 2EH8H 3U4EB 4HX1A 5F7EH 3WFCL 4Z77B 2HLFD 3QH3B 1Q0YL 1QQDB 5D1ZC 1OGAA 2X4TB 4BQBA 3PGCA 2XPGA 4A6YH 5K9OA 4KVCH 1VFOA 1OAKL 3O3DB 4QXGL 2HLAB 5A3ID 4JO3L 5IM7A 1DJSA 3RZCC 4OAWB 1MAMH 3RHWF 1WFOA 3O4LE 3QUZC 1NMCC 1CFQB 2FO1A 1K6QH 4O58H 4E0RA 4ISVA 5ALBL 1G7HA 5HHOD 2HA1A 1GC1H 2OYPA 2FGWH 2IANA 2XA8H 3CSPA 4JREC 4IRSB 3INUH 3ARVA 3O2VH 5J3HC 5J6GB 4J3TA 4ZS6C 3EYUH 5TE6H 1KELH 1X4ZA 4U1MA 4PGDA 1CXEA 3FJTA 4H5SA 3LMJH 5E5UB 2P5WE 2VLRE 3BJLA 3RNKA 1D5BA 3CDYA 3MJGX 5TDNA 3QAZB 1ERNA 4PRIE 5E08L 5A1AA 3VFRA 5JXEC 1U2CA 1YEGH 5I66B 2BRRL 4HIIA 3TIDA 4UDUA 1KXQE 1IAMA 5AUMA 1T04B 5TJWK 3MYJB 2DQCL 2A6JA 4O4YL 1YNKH 1FRGH 1RZ8A 3HI1A 3TO2A 3BUYB 2D9QB 3F58L 1UB5A 3L3KB 4LARL 4H1LH 1A7NH 4FQ1H 3I9GL 1FZJB 3L3GA 1FSKB 3ZE1E 5I30H 5D70H 2EIEA 5L8LB 1DBAH 4W6YB 1XF3A 1CT8B 5EU7E 2P8MB 4YHZH 1SYSA 2P24B 3DV6B 5DO2D 3FQRA 4CKVX 3V5KA 3EFDL 1ACYH 3ZT6A 1I1CA 3AU1B 2WQRA 1I4FB 4LIQH 2B2XL 3OJVC 5CUSL 2X4RA 3LKSB 3D18A 3QQ9D 5IFAH 3HCVB 5IHUL 1MPAL 2E9BA 5GGSY 2G5BB 2QEJA 1X6NA 5H2BB 5CP7B 1DLFL 3THMH 4BZ1L 5B4MC 5BRZD 2R0KL 1KEGH 4J6RL 3H0TB 4WI8A 4MWFB 3IDYB 1T2JA 1XF4B 4NO5A 4LLYA 2WWMC 4TUJB 1H15B 2WBJD 5DRWB 1NFDF 4X7TA 3MUHL 3K8MA 5GGUB 5ESQA 5K93A 3QCUL 4QHUB 3OXSB 2KQNA 1A6PA 2DLTA 2RFXB 1Y6MR 5GSVA 2OQJB 4PJAE 4Q0XH 4F7TA 3ULUD 5IQ9B 1EA9C 3O9WA 4U33A 1RURL 3MROA 5C70A 1ZS8A 3TA3C 3PP4L 3CU1A 4PRAA 4TVPE 5CP3A 2PTVA 1UZ6F 5D7JD 5CEZE 3FONA 1I1FB 2QADC 5D7SH 4F7PA 1S9WB 2R9HD 4OV5B 3VFVA 3LQAC 3QXAA 4GW1A 1RIVL 3L3JA 4P0DA 5CEYB 5K9JH 4KC3B 1EHXA 2ICWA 3QCVL 4ZTPL 4NKOB 4HC1H 3SDCC 1R6VA 3U0TA 5DQJB 4JM2D 3V0WL 4PB9H 3ARGB 1BJMA 3TBSA 2NYYD 1BF2A 4GAFB 5KG9A 3MV9D 1IGMH 5EN2B 4XBGB 4AMKL 1BGXL 3GK8L 5FYJH 4QCIA 1UACH 3W5MA 1U42A 4Z9KB 3ULSB 5EZIL 3WO4B 5GGSA 1UM5L 3KPNB 4YQXL 5DHYB 4HULB 3MOBH 4YHOH 5K9KA 5KSUB 4R0LA 5MEPA 1EAPB 5IGXL 3UBXI 3ZDYE 3Q3GA 4JHWL 4LK4A 4F2MA 3LSOA 3QRGL 2V6HA 5A2LH 3C60A 3I6GA 4P2OB 4EUPA 2BSED 3GMMA 4MX7B 4K3DL 5D7LA 5KN5A 2OL3A 2IBZX 2FEEI 2LE9A 4DAGH 4MAUH 3ZKXC 3WIIH 1U8JA 4YPGB 2VDQH 4NFCA 2XNAB 2IQAA 4G43A 4NJ9H 1S7TA 1U8QB 4D3CH 1KB5B 3FTGA 3BH8B 1MCDA 1NSNL 1F4XH 4P99A 4YXLL 3WE6B 1JE6A 2X9WA 1RZGB 3VXSA 1XZ0B 4Z7WE 3MR9B 3W0WB 4GG6E 3FQWB 5EOTA 4CADA 2W0PA 4LCUB 4CRPA 4HGWA 1NFDA 1C1EL 5E6IB 2E3VA 1CFVL 2A1WL 4LLMA 4XPFH 1DBJL 4D0DA 3E6HA 3S4SA 1T5WB 4MQXC 1QEWB 1GGBL 2XYCA 5GSRA 5JQ6L 1JPTH 3IDNB 2RR3A 3QISA 4FTVA 3TYFA 3U9UB 2AGJH 5DD5H 5LBSL 4DKDC 1AGFB 1NCAL 1DZBA 1RU9H 2GT9A 3VI4E 3G6DL 3DUUA 4HKXA 1LO2L 4XWGL 4QNPE 5D6CA 4PREB 3GSWB 3D3VB 1OWWA 2DQDL 3QUMH 3TBWB 5T1LD 4P23D 2L4OA 4JQVC 3U2SB 3EO9H 1D3CA 2DQIH 3MRPB 3QUXD 4JFOA 5C6TH 3P2TA 2X70A 5EBGA 3ARDB 1HZHH 2YPLD 4B41A 4J8RB 4HX1B 3DXAD 5HVFB 4NZUH 4OZHF 4TSCL 3D2UD 5C0RH 1CDIA 5DFTA 5HHOE 5DJYA 1MQKL 3VFOB 2XPGB 5K9OB 4FQ2L 1E4KC 4GMTH 1QRKA 3GHEL 1WZMA 4YDVB 2XIDA 1R3HA 1OM3H 4WCYH 4XGZA 1QBAA 4KJQC 4Q97A 2CKBB 4NPYA 1K2DA 1KC5H 5ID0A 2XQBH 4EOWH 5EG6C 3UTQA 4ISVB 4ONHB 4MAYA 1MWAA 4LVEA 2IANB 1U3HB 5KVFL 3P0VL 2DYPD 4Z7OE 1ZHKA 4AZ8A 3MSPA 1NGWB 5EBWA 1NCCL 4M7KH 4U1MB 3EOTL 4KI5C 3RNKB 1D5BB 5TDNB 1J1PH 4QOKD 1PGRB 1MI5A 1P9MC 35C8L 3SHSA 3RY5A 5KW9L 3VFRB 3ARYA 3C6LC 5HHMB 1W72H 2CDFA 4JFPA 2FX7H 1FLRL 1MVFA 4HIIB 3KVQA 4YAQA 3TIDB 3EYQC 2UUDH 2VDRL 4UDUB 5C0FA 4PGCB 5AUMB 1DUZA 4LVOB 1RZ7H 2A6JB 3QNYA 2XTJD 1RZ8B 3HI1B 4QHLA 4XPAL 1RK1A 2GJZA 1LP9B 1MCNA 1UB5B 5C0ND 2HRLA 3B8YA 1JHTA 3LV3B 3MRGA 4BUHA 2FHFA 1UXSB 2IBZY 1N7ML 3L3GB 4DTGH 2VQ1A 2FCBA 4NWTH 4L3CA 1RUAL 2BK8A 2FX9L 2NTFA 4XCFH 5E95B 3BUTA 1CIUA 5BRZE 3GKWL 2ATPA 3OX8A 4NRYA 3IF1B 2CSPA 1HKFA 1NGPH 1MEXL 3D18B 1AD9A 4U1IB 4RMUA 1FZKB 1S5HB 1KFAL 3E2HC 1E28B 1Q9LA 1FBIL 4JFDD 1HYSD 2CGRL 4JO1H 3ULUE 1ZA3A 4PJEE 4U1SB 4A6YA 4YWGH 1CQYA 4OZHA 3T2NH 5F96L 3S35H 2X4PA 1T2QH 4LLYB 1WEJL 4D94A 4KHXH 1T89A 1LGVA 4EIGB 2AAVA 4PD4K 3STLA 4X7TB 3WJLA 4XPGH 1RZJL 5CEXB 5ESQB 1FAIH 2GITA 2IGFL 1RSFA 2JJSA 5DZLA 2KPNA 1A2YA 1EEQA 1IGTA 4M6ML 1R0AL 5CZVH 4F7TB 4U0RB 4KUCD 4M93B 1U8MA 4R8WL 5I8KL 1JGLH 3GMPB 2PUQT 1WTGT 4MJID 1T2XA 1KB9J 2D9CA 5I18H 3CSYA 1H9VA 3IFLL 4M4RA 3VG0H 4Y19A 3VRLF 2B0SH 1TCMA 3FONB 2H8PB 3MV9E 5T1KB 4MB3A 3CD4A 1A6AA 1LDSA 1HIML 4N0UA 3CXHK 5IROC 4I5BA 3L3JB 4MA7H 4F37K 4KTYA 4W6WB 2XQYG 3RGVB 3ARPA 1X5HA 2Z93B 1N0LA 3FRPG 3MLRL 3LPFA 2X89D 4ZFFB 5KG9B 1INDL 3CK0H 1F5WA 1PQZA 1OOAA 5FV2A 2DWEA 4RMTA 5F9OH 1S7UA 4H1LA 4QCIB 3D0LA 4PJCF 4NBZB 3LB6D 2IFGA 3SQOL 2BMKA 2HKHL 2FL5A 1VFAA 1KXTB 1MELA 1HKLL 4NO2A 2F8OA 3VFWA 1U0QA 3H3BC 4R4FL 1R5WA 1LHZA 5K9KB 4WW2F 2HWZH 1YEDA 4R0LB 3QPQC 4M5YL 5MEPB 5IVXB 1XGRA 3O2DH 5CZXC 2BCKA 4JEGB 2YRLA 4CN1A 4F2MB 4EDWL 1AR1D 2EXWD 4NKQB 1NDMA 1I9RH 2GJ6A 3C60B 3EFFA 1T5XB 1A1OA 3I2CL 3GMMB 4YC2B 4YBQC 4EUPB 3UJJL 2AV7A 4F57L 5ISZA 2Y6SC 1MLCA 4TQEL 5D7LB 3S3JA 3IFOA 2OL3B 4JQXA 3EDEA 4PG9A 4AEFA 2EYSB 5JNYB 3F65A 2W65A 2IQAB 4G43B 4NBYB 4XNXL 3FTGB 4FQXC 4J3UA 5MENA 4FQJH 1PG7L 1W2KT 5F1NA 4ZDHB 2I26N 3S88H 3BQUD 2JB6B 4L9LC 1CDJA 4O00A 4YUEL 2XWBA 4HFUH 2WUCH 1CN4A 1CLOL 1F11B 1F42A 3IYLW 1NFDB 2CIKA 5AG8A 3LH2H 3ZL4L 4IOIA 2AEQL 3E6HB 2DI9A 5DWUH 1DQML 3S4SB 2YPLE 3IFNH 4FTVB 4UV4L 3TYFB 2D31B 3DXAE 1RJZB 2ZKHH 3O0RH 4XVUC 5DJ8A 2GT9B 1OTSD 3DUUB 4HKXB 3MLVL 1LE5B 3BGMA 4X98A 5FUCE 5LVEA 1BBJB 3CH1B 2P42B 1P4LB 3MODL 3HPJB 3V4UL 1U8NA 1UFUA 3CDGB 4JFZL 4R7DB 4HBCH 1CS6A 4HC1A 4JFOB 1TJGL 4OCRH 4GSDH 3SBWC 4XNQA 3Q5TA 3S35X 5D1ZD 5AWNL 2WV3A 1K8IA 2DM4A 4HGKC 4N0YH 3WHE1 4ODTL 1J0ZA 1GGCH 5M95B 3EOYG 4TPRH 4P3DA 3UBXA 2CUHA 3SKJL 2CPCA 1ORSA 1VB9A 3QFJD 1G6VK 3V5HA 1H5BA 1AXSA 5FYKD 1TTUA 3NCJL 4NUJA 1JHLL 4PJCA 2W91A 4AH2A 2ZSWB 1RK0A 3W9DB 3V0AC 3P4LA 3WFCH 1XIWA 3K81A 3HMXL 1IAIL 1K2DB 3O9WC 4M93C 4HV8A 4LU5L 4B50A 4QOKE 1Q0YH 3UTQB 2E7MA 4WW2A 1MWAB 2CRYA 1EZVX 4OKVA 1EHLL 1OAKH 4QXGH 2PO6A 1A3LL 3BMVA 2W07A 4HUKB 4MLSA 4RRPA 5J6HB 4JO3H 4QRQB 4Z76A 2UWEF 5EBWB 2E9JA 3P9MA 4NN6C 5T33L 2M1KA 4YGVA 4NO3A 3UZEA 2V5TA 4PJ8B 4YX2H 1MI5B 2XACC 4Y4KA 3HI6L 5MHSD 3BIAX 4C4KO 2CDFB 4JGUA 4HMDA 3BHBB 4MSWB 2NPLX 1KJMB 5EU5A 1WITA 1DUZB 5CD5D 3QNYB 4PGEA 3U0PB 2QQLL 1RK1B 3DURB 2GJZB 3C87A 1GZQA 5E08H 4NM8L 2FLBT 1JTOA 3NA9L 1M7XA 1TQBB 1L0YA 3QIWB 4M48L 5DJDA 3VXTA 1FFPA 4LF3A 2BRRH 2F5AL 3PUCA 3IJSB 4L3CB 1ZSDA 5DUML 1MCKA 4JFDE 1ZTXL 1H3GA 2DQCH 3ZZ1A 4LSVL 4HXAH 4S2SB 4O4YH 5ETUB 2VWEE 3F58H 3C60C 4P2QA 5CJOH 1OGTA 5I0ZA 5I17A 3QUMA 2OTUA 3EYSL 5EWIH 2C4FT 1IE5A 3OX8B 3I9GH 4NRYB 3L7FA 1C5BL 2EDFA 3U0WL 3IAPA 1INEL 5B4MD 3BP6A 2XZZA 1AD9B 4XPHH 2CMRL 3PDOA 4YHKL 1NLBL 2R2EB 5EC1A 5J12B 1ZA3B 1O0VA 1D5IL 3F7YB 1YEJH 1A21A 2W0FA 3HC4L 4A6YB 4KU1A 3M8OL 4OZHB 4MJIE 1S78C 2X4PB 2WM0A 5DRNA 2B2XH 3H9HA 5CUSH 1EVUA 4KK6C 3TVMA 4UT9L 3STLB 4WTZA 1BVZA 3VXRA 1CVRA 5IHUH 5C3LD 4TUOA 1MPAH 4HF5L 5DEFA 4XPBL 1M1SA 1AD0A 1DLFH 1IGTB 3PV6B 5F8RC 4BZ1H 2R0KH 3WS3B 5FB8A 4J6RH 3SPVB 3MNWA 1U8MB 3GEWB 4MMZC 4N9GA 3RWGA 5C0AA 2DS4A 4RMVA 2QADD 4MXWH 5I15L 1YEKL 1GVIA 3CSYB 4ODSL 3S5LA 3ARBC 1YN7A 2X4UA 3QCUH 2CDGB 1T7XA 2F5BL 1GOFA 4Y19B 3BSZH 1TFHA 5JORA 3BP7B 4Z78A 5ICYB 3OAYK 2C4XA 4Y1AA 1A6AB 2UWEA 3SDCD 3V0VA 3IDXL 1RURH 2WIMA 3PWPA 1W72A 1Z9SA 3PP4H 1S7SB 4ZSOE 3KNBB 3BAEL 4P4RA 1QLFA 2WBWB 1FAKT 1G9NC 4OQ1A 4P9HL 3PXJA 4ZNCD 1I7UA 5DK3A 1PYWB 3ARFB 2DWEB 3MRRA 5C0CA 1S7UB 1EZVY 2CLVA 3D0LB 3QCVH 4EBQH 2FL5B 3BWUC 4OD2A 3VFWB 4OZGF 5IMKA 2X42A 5D1QC 5F21B 3ILPA 3V0WH 2DTML 4QTHA 1HK6A 3DGGB 4IRSD 4M7LL 2X9YA 2DQFA 2VE6B 1OP3K 3SDXF 1YEDB 3DO3A 4MAYC 3REWB 5EUOF 5IB2B 1XGRB 4M8VA 5F7HA 2BCKB 1BGXH 3T8XA 4XP9L 3GK8H 1FVCA 1T0MB 2GJ6B 3EFFB 2A9NL 1A1OB 3QIUA 5EZIH 1I3VA 5ISZB 1RPQA 3IFOB 2EDYA 4BZ2L 4NKIL 4YQXH 1S9XA 5SX5K 1G7QB 4ZUWA 2HTKC 4N0FA 4IJ3B 1E4JA 3MV8A 5IGXH 3O45A 2W65B 5HSFA 4JHWH 5E8DH 2X4SA 5IQ7L 5GGVH 5MENB 1TVBB 3QRGH 4PYHA 3E3QC 2N56A 3FQNA 1LO5A 5F1NB 4K3DH 4WJ5A 4H0GA 2VZ1A 1RUQL 4P2RA 5E56A 3NCMA 2ICEA 2XWBB 3WDJA 3HUJB 3HG1E 5E24E 1V3LA 1JGVL 3BE1L 1ADQH 3D1MC 2C3XA 5DK0B 3DO7A 3DJ9A 5MERB 4PLOB 5CWSB 1SVZA 2LAAA 5D1XA 2R8SL 5L2JB 4YXLH 3JWDL 4X7EC 1S7RA 4WWKA 4K8RL 5J7CC 1MIEL 1C1EH 3BGMB 4X98B 2A1WH 5HGBA 2JE8A 4WHTA 3OJMB 2OS7A 1DBJH 4S1SL 1KBGL 2HJFA 3QFJE 4DCQA 1YPZE 1K5NA 1WVZA 1GGBH 4HLZH 5FYKE 3W39A 3GRWL 3FAWA 1RMFH 5LBSH 5D5MF 3L5IA 1NCAH 1K8IB 2GTWA 1LO2H 3QA3A 4XWGH 3RVWD 4JVPA 1IAOB 2EICA 4HUXA 2DQDH 5T3XL 1T89C 4L3EA 5H94A 3SE3A 4KJQD 1UYWL 3WJLC 1ORSB 3B2VH 4FQIL 3KYMA 3CZJA 1FG2A 2HFEA 3MOQA 2JJSC 5FA3A 1FV1B 4AH2B 3NMEA 1IQWL 3P73B 1RK0B 4OLVL 5AG9A 1WCQA 5GS2H 4ALAL 4HUVA 1ZK9A 1FO0B 1K85A 4TSCH 1WICA 1UCTA 4PS4H 1KT2A 3O2DA 4HV8B 1CGSL 4UIMA 1U3YA 2NX5A 3SDXA 1MQKH 5EUOA 4FQ2H 4NQDD 3GHEH 2BP3A 4ERSL 1A5FL 4KI5D 4PJ5A 4CMHC 2I9LA 4WWID 2P8PA 5BVPL 4YGVB 4NO3B 2BNQB 3ARGD 5L8KB 2B5IB 5IB3A 3EYQD 1IT9L 5KVFH 3ZMRA 3WEXA 3J8F7 2YSSA 1GIGH 3X13A 4CAGA 4PJXE 4I9WD 4X6CE 1LEGA 15C8L 1NCCH 5E1AB 5EU5B 4RBPK 1DVFB 4GS7B 3SKUD 5ICXA 5GS0H 4IM8A 3EOTH 2VAJA 1IQDB 4PGEB 3DTXA 1WTLA 1GZQB 2H6PB 3C08L 3ZE2F 5FFLA 2CR3A 5KW9H 1N2RB 5DJDB 1MCOL 2R4RL 3GM0A 1FLRH 4R90L 1EEUA 4O9HL 3PWJA 3RTQB 1MUJB 5CJQL 1ZSDB 3MACL 2VDRH 3QEQA 2MOVA 4U1HA 2GAZB 5DD3L 3NTCL 3U79A 4ESKA 1PKQB 4XPAH 4O51B 3NACL 4P2QB 3QUMB 5TQ2L 3T3PE 1UM4L 1T21A 3SE4A 3L7FB 1N7MH 4OM1L 3P4MA 4BFBD 1RUAH 5KVDL 3PP3K 5A2KH 2FX9H 3JWOC 4GRWE 3PDOB 1TXKA 3P0YL 4YH6A 5IJKC 2Q6WA 3MRQA 5I6XC 1ZHLA 3W0WD 3HZMB 1HH9A 5D5MA 3GKWH 4ODWA 4IIQB 2W0FB 2DI7A 1KN2L 4LCIL 3OKKA 1JF1A 4P46C 4M7ZB 5E6ID 2Q8AL 5DRNB 2V7HB 4HWBL 2J1KA 3H9HB 3TVMB 2GK2A 4L4TA 4MB4A 5I71C 1MEXH 4G42A 4LAQL 3DHJA 4PP1D 4PTUB 3VXRB 2E5EA 3O6FC 3GNML 1KFAH 5F44A 1FBIH 1OW0A 4ZUUB 5DEFB 2CGRH 2HP4A 5FCSH 1KYOJ 4FFZL 5DC9B 3C09B 3IDGA 5C07A 3MNWB 2QQKL 1QACA 2FZ3B 4N9GB 4WRLA 5F96H 2P7TA 4C83A 1R5IA 5DGQA 3D3VD 5C0AB 5FF6A 3SDYL 1Q1JL 5FM4A 4O02L 1RZJH 1YN7B 2X4UB 3BYTA 5TDOB 2ITCA 2IGFH 4K7FA 5J9PA 5JORB 2BY1A 4M6MH 1R0AH 3CXDL 4U3HA 4Y1AB 2JIXA 1NKRA 3WHE0 4R8WH 1CU4L 5I8KH 3PGFL 2FYYA 1F3DH 5E4EB 2F8XC 4ONGL 3IFLH 3PHOA 2APBA 3FFDB 4P9ML 3OZ9L 3RNQA 5C6PB 4DKFL 2RB8A 4EN3A 5BOPA 4OF7A 2BNUB 2A0LD 1I7UB 1AGBB 3DX6A 4OLWL 1HIMH 3MRRB 1FNAA 5DT1L 2BVQA 1AHWB 1H5BC 4OIAA 1H3XA 4ZOAA 1X5XA 3QPQD 3HNTL 4LRIA 4OD2B 3CPLA 5GHWL 3JV5A 4GOSA 4Z7UE 5CZXD 4DW2H 3VMNA 2IAND 5IMKB 1XIWC 5IJVA 3ILPB 4QTHB 2EDJA 2DQFB 1F4WH 2ARWA 3MLRH 1NDGA 4F7CA 3RU8L 1INDH 4WW2C 4P5KA 2Y6SD 1YNTA 1FVCB 1L7IL 2MPAL 2VL5B 2PO6C 3SQOH 4KRPC 5TFSH 2HKHH 5D8JH 2VYRE 4UT7L 3QIUB 3MLPA 1HKLH 4MA3A 1GGUA 5EZLA 5IIEB 4R4FH 4ZUWB 3MV8B 4M5YH 3O45B 3G5YA 4PJGF 4OF8A 2DLGA 4Y4KC 4YE4L 2EECA 2DMBA 2X4SB 4KK5C 3TV3L 2C5DC 3DETC 4EDWH 4Y5VA 1LO5B 2V2WA 5HGHA 3I2CH 3OKMA 3UROR 3GSQB 3UJJH 4F57H 4TQEH 4P2RB 2K9UA 2IH3A 2ICEB 5EU6A 3REVB 4HH9B 2NY6B 4L29B 4RZCA 4R4BA 4M62L 2AJYL 4M00A 1FC1A 4LBEA 5I2IA 32C2A 3WDIA 3DO7B 5CLWA 1PG7H 5D1XB 2VAAB 1XF5B 2NY1B 4XVUD 4NZTL 2F54A 5I1EL 5GGVY 3ULVD 1SBSL 5I8EB 1QSEB 4AIXA 1NGZA 5F3HB 1FGVL 3DBXB 4YUEH 4WWKB 5F6HI 1CLOH 3GMRA 4L8BA 4LP5A 5IFJA 1CFBA 1MIML 1HQRA 4KI1A 4QLRA 3ZL4H 4TUKH 2AEQH 5E99L 3HB3D 5DZOA 1DQMH 4P5TA 4MZ2A 2VDPL 4DCQB 4AG4L 4NNYB 1K5NB 4JY5L 1MRDL 3W39B 4UV4H 2JCCF 3GB7B 5T1DH 3QA3B 4X6DF 3MRIA 2NR6C 43CAB 5FGCB 4HUXB 3MODH 3V4UH 4RX4A 1SJEA 4L3EB 2F19L 3TVMC 3IETB 4KI5E 3O9WD 1JI2A 3WBDA 4URTB 1FG2B 1JNNL 2QTEA 5FA3B 5AWNH 3LEYL 3LIZL 4HUVB 2DTSA 1WBYA 1BFOB 5CKGA 3FKUS 3MRLA 4ODTH 1QTYT 1OQXA 3SDXB 3IB4A 4HQQH 2EDTA 1NPUA 2NQCA 5EUOB 4FABL 4ZFZB 2BNRA 1WWCA 4I9WE 3NCJH 3VCLB 1JHLH 3CMOL 4PJ5B 4EI5A 2KDGA 4LGRB 4OGZA 1X5IA 3RGVD 2P8PB 2OSLA 4FQHA 3PF2A 3RWHA 1IAIH 3BDBA 2V5YA 2JKXA 4LU5H 4JDZA 2Q86A 4BFIB 4JKKA 5L8JB 5FOBB 3UCRA 5T5NF 4PJGA 1EHLH 2E7BA 1KPRA 1A3LH 1IAII 3SDAA 3X13B 5FXCH 1LEGB 5T33H 1EV2E 3AGVA 1ADQA 5E1HB 3RDTB 3KLAA 5CJ8A 4ETQA 1SBBA 4NUGL 1S7QB 4LCWA 4W6XB 1M4KA 4HWUA 3SKNA 3C60D 1C08A 1B6UA 4U6XA 5D7LD 3RL1A 4LKCA 3MRFB 1OPGH 2EXYD 3W0WE 3HA0A 5DDHA 2QQLH 5DURB 1H3TA 4QRUA 2XTLA 4EI6B 1VFBA 3NA9H 3H2WA 2XKNB 2XFXA 4WEBH 4M48H 2WAHA 4N90D 1MVUA 2XKSA 2F5AH 3BPCA 5TE7H 2Y06L 3P4MB 1CZ8L 4RGNB 1YYLH 2IQ9L 5DA0B 3WFDL 4WNQA 4ODVL 1ZTXH 4KRLB 4OCSL 2Q6WB 3MRQB 3VXSD 4ZUSA 1ZHLB 3ALPA 4KK6D 4NQXA 2M2DA 3CFDB 2E8ZA 3CFCL 2JCCA 2NNAB 4ODWB 2NY2C 4Y7MA 3EYSH 1A6ZA 5EDXA 4I18C 4X6DA 3D3VE 1C5BH 3KPOB 3U0WH 1INEH 4L4TB 1PG7X 2LAGB 2Y4SA 3RWCA 4HGMA 3N06B 3RUGB 5IMOA 2CMRH 3IJYA 4LSQH 1Q38A 4XVSL 4YHKH 1NLBH 4U31A 4FTVD 5HDBE 2GFBB 1GJIA 5DRZB 1D5IH 4YEFA 5LQBL 2VIRA 3PABA 5C07B 3WSQL 3GBMH 3M8OH 4WI9A 3MMEB 1SJHA 2W0LA 1R5IB 2DBLL 2Z9TA 5FF6B 2E7LC 1F2QA 4WWKC 4YDLB 5JW5A 3EGSA 4YHPA 4HMCA 2ITCB 4OF3A 4XPBH 1IJ9A 2JIXB 4XNMA 1KNOB 3ZSTA 3QULB 3VXNA 3BPLB 3KWWA 5IEHA 5C09A 4QHKJ 1EFXA 5DMGD 4EDXA 1G6RL 5I15H 2IANE 1FNLA 1YEKH 4K94C 4ODSH 1MY7A 3UXFA 2Y7QB 4LHJB 4BKLA 1PBYA 1KPUB 2OLDA 2F5BH 1WSST 3CFJA 1J9CT 5I75C 3T3ME 1LVEA 3DX6B 3SE3C 4L5FL 3IDXH 1NCWL 2P4AB 5C0IA 2OR7A 2G2RA 3CPLB 1J8HB 4NOFA 4XHQA 2VDKL 3CZFA 2W9LA 1L9MA 3LS4L 5HHME 3GI8H 3BAEH 2DLHA 2IMMA 1ORQA 1NDGB 4F7CB 5J8OA 1QO3B 1CDUA 1OB1A 2IPKA 4P9HH 3S37L 1TNNA 5FECA 4OFVA 2HTKD 1B9ZA 2G60L 5CBAB 1B3JA 1BJ1H 1PJ9A 3SDDC 1MI5D 1YA5A 1E4WL 3SO3B 4Y89A 2BXZA 2DTMH 3TCXA 3G5YB 1CE6B 3TIEB 3LDBB 3KLSA 1CD1A 4ZFOL 1K4CB 3S6CA 4XP9H 3O2WH 2ADGA 4Y5VB 1NJ9A 3KXFA 5L7XL 5HGHB 2A9NH 5AYUL 3OKMB 2NY4C 3ULVE 3DLQR 4YLQT 2DQUL 4BZ2H 4NKIH 2WWKT 5E2JA 4C56A 5TDPA 3QIWD 5EU6B 2AQ3A 4M1GL 4RZCB 3T04D 2OI9B 2RGSA 4R4BB 1MJJA 4XC3H 4PV8A 4XNZC 3RP1A 4LBEB 2EC9T 32C2B 5CBEA 3ZE0E 5C9JA 5I2IB 3T4AB 5HTSA 3HE6B 3RKPA 2F54B 5D7KD 3B9KC 8FABA 4CU7A 4GMSL 3RVVC 4H26A 5DMJB 3GMRB 3UX9B 3NABL 5HVWA 5IFJB 1JWUA 3FB6A 3I75B 3ZTJH 1HQRB 1JGVH 3BE1H 5I9QC 3B5HA 4GKZA 3BZDA 4HAGA 1KJ2L 2R8SH 1NUFA 4XCNA 5E2VL 4R26L 1DQDL 3L3DA 4RSVA 4V1DA 4RGNC 4R4NC 2L7JA 1ZWIB 4G6FB 3GMLA 5HGAB 4UOJA 2R2BB 1XGUB 4LASL 4ZUTA 2BXYA 3VE0A 4K8RH 4PJ9A 1BWWA 3EO0A 1MFAH 1NBYA 1KBGH 1KV3A 1SJEB 2OJEB 1Q72L 5DJCA 1Q0XL 5IMLA 1UEYA 1OW0C 3GRWH 4LVNB 1R3LB 4E42A 3KLDA 2ILLA 1WBYB 3DSFL 2F53A 2QR0A 3MRLB 4WFED 4Y19D 5T3XH 2Y9RT 4Z7QF 3QWRA 3T2PA 4FQIH 2B1AL 4J7RA 1LO4L 3BRFA 3ZYOA 5SWZA 4EI5B 4MA1B 4OLVH 5FO7B 5K9QI 1MRCL 4FQHB 3RWHB 1CGTA 3KYNA 1CGSH 1IGIL 3EOBA 4JDZB 2FWOB 2Q86B 3KJ4B 1J7VR 1J8KA 5E7FA 2XZAL 2J5LC 1AXTL 2RCSH 1AGCA 1VFMA 5IVXE 1SY6A 3DX9A 1IKNC 1KPRB 3ARFD 4F9LA 5JHDA 1A5FH 4QKXB 1QBMH 7CGTA 3SDAB 4EN3C 1OAXH 5D7LE 4S1DC 5DJ0B 1KG0B 1FVDA 3OGCA 5BVPH 3CLFL 1C5CL 1F6LL 2GUOB 5ACLA 4JDTL 2AJVL 4XCCH 3KLAB 5EIQA 3NCYP 4LRIC