1YEIL

Catalytic antibody d2.3 complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
219
structure length
219
Chain Sequence
DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIHLVSKLDSGVPDRITGSGSGTDFTLKISRVEAADLGVYYCVQGTHFPYTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IG ANTIBODY D2.3 (LIGHT CHAIN))
publication title Crossreactivity, efficiency and catalytic specificity of an esterase-like antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 50
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1998-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yeiL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yeiL01
3O2DA 5F6IB 3RWJA 1WV7T 1YEIH 2BNUA 2BY1A 1GIGH 1OAYH 4NQSB 4WRLA 1C7TA 2HJLB 4NZRL 4K8RD 1JZ3A 1HKLH 1HQ4B 2ITCB 5CEZL 1JPST 4I8DA 4ZMAT 5CSGA 1P69B 3SKOA 2VE6B 1ZTXL 3GMOB 5IQ7H 4BKLA 4MDJA 1I7TB 4X4ME 2F5BH 1HWGB 5FDWB 4PJEE 4PJGA 4I0PB 4CADB 4WNQA 3IDXL 1AGCA 1I9IH 3HMXH 2AAVA 3S34L 1Z0NA 3RI5K 4KQ3H 3RVXC 3TT1L 3T0DA 3AS1A 3ALXA 1RI8A 1YECL 4NQSA 1U91B 1MIML 2VXUH 1SEQH 2HJLA 2VLJD 3CK0H 4KH2A 5T1KB 1HQ4A 2ITCA 1P4BH 2PW1B 5CINH 5SX5K 3FB5B 2VE6A 3GMOA 4GJTB 1I7TA 4L4TD 4UV7L 4V1DE 5F9WC 2DTML 3IS1X 3FFDB 2E7HA 1CBVL 4JY4B 1T7VA 5FDWA 5CZVH 1U3JA 4I0PA 3RVVC 1AFVL 2HN7B 4QXGL 5E2VH 4CADA 1H3PL 4WWKB 4KZDH 1A22B 4OZIE 3TV3L 5JHDB 4FFVD 2X9XA 1AXTL 1U91A 3S37H 3K1DA 4DKEL 3QCTH 1U0QA 3D39D 5T1KA 5CWSB 4F80A 2PW1A 4V2CB 5E08L 1SJXA 5E2UL 3FB5A 5GS0D 2ZPKH 2L7JA 4UB0L 5C6WH 3BP7B 5CJ5A 4YX2H 3B9KB 3BRDA 3FFDA 4JY4A 2JJTA 5J06A 5ISZE 4JDVB 2HN7A 3RX8A 3EW3B 3PHSA 3GNML 3U7AA 5JHDA 5MI0B 3BT2H 3O2VL 5EORL 3EJJX 2A73B 1LDSA 1N5AB 4H0IA 2PXYD 3OB0K 5CWSA 3DO7A 3K4AA 4I18B 1HNFA 1MRFH 1F2QA 5C8JB 1VACB 3WIFB 3DX7B 4YXKL 4X8XA 5BS0E 1MF2L 3BP7A 3B9KA 5SWZD 1X3DA 5C0CE 3CLFH 1FVCB 4OCWH 1IMHC 2FBJL 3QH3B 4RFNC 2HYMA 3RWFB 4NQXB 2QQKH 2D7MA 2ZUXA 1VFMA 4RGOH 3C60B 2A6IB 2E6PA 5GHWH 2A73A 1HSAB 1MCJA 2UY7A 5CS7A 4I18A 5DMIL 5C8JA 1VACA 3WIFA 2QSCH 3S88H 3DX7A 4C59B 5IVNA 2A77H 2LU7A 3T3PE 1Z2KA 3C2AL 1JWUB 3UTTB 1INDH 4HXAL 4DZ8B 4X7EC 3QH3A 3WUZA 4DKDC 2NX5B 3RWFA 4NQXA 1L4IA 4JM4L 2PYEB 4MGXA 1G7JB 3C60A 2A6IA 5HHNB 1KNOB 2VDQH 1EZVY 2VDRH 5K93A 1I1RA 3Q48A 4HJJL 1PAMA 1DBKL 4O5LL 4V2BA 1V5JA 4FOMA 3DX9B 4N8CL 2NXZB 5SWSB 3GMQB 1NC2D 4J3WA 3TBTB 1JWUA 3UTTA 2JCCF 3G6JB 4JB9H 1BF2A 4DGVH 4DZ8A 2NX5A 5C9KA 4KTDH 1X6LA 2PYEA 4LGRB 1G7JA 2JTDA 5HHNA 1KNOA 4KGLA 4EUPB 2DYPD 4XC1L 4UV4L 5F3HB 1JGLL 3CFKB 1YA5A 4ZTPH 5FV2A 2VDNL 1JVKA 3MJ7B 4RZCB 4QRPB 3CH8A 3DX9A 3GUTB 5SWSA 3GMQA 5ALCL 1HXYB 5I15H 1S9XB 1ZANH 5HSFA 1Q94B 2XKUA 4FG6D 2BJML 1BVLB 4K71B 5CLTA 5TPWL 1BOGB 3G6JA 3VGDA 1ZMYA 4ZOEA 1CXFA 1A4KB 4OLXH 3MSPA 5JQHC 2AEWA 3SDYH 4U1SB 2FX9L 2WBKA 1ZVHA 4LCWB 1N0XH 2ED7A 4X7TB 4EUPA 3PWNB 2OK0H 2MPAL 3TCXA 1AY1L 1H8OA 5F3HA 3ARGB 3CFKA 4AIZB 3GBLA 5ILTL 2FATL 3BISA 4U0RC 3KPNB 5CZKA 3V4VH 2EXWD 3MJ7A 4RZCA 5FUZL 2WUCL 4QRPA 3QDME 3GUTA 3PXHA 1A7RL 5BRZD 1DQLH 1HXYA 1H8SA 1NKRA 4JREB 1S9XA 1NCTA 1Q94A 5DRWB 2BSRB 4MAYC 3NN8B 4HUMB 2NY7H 5DVKA 1BVLA 1WICA 1J1OH 1BOGA 3BZFB 5TE6H 1A4KA 3ZL4L 4G7VH 4U1SA 1ZWIB 3T4AB 4LCWA 4X7TA 3PWNA 3NFPB 3X3FH 4MD5B 3ARGA 3WJJC 3RHWF 2UWEF 3KPNA 1I3VA 1KN2L 3BIBX 4XNYL 3RWCB 5A16B 2ERJB 1BQHG 3WYRA 1YEHH 3HPLA 1W0WB 2L0DA 3MBED 3WHE0 1OPGL 1U8HB 2XNAB 3MLPA 1ROWA 2J8UB 4JFED 2BSRA 5DRWA 4CKVX 5KSUB 1A02N 2OI9B 3BZFA 3QYCA 3RRQA 2DDQL 1URLA 1WWAX 1ZWIA 3T4AA 4CN1A 4WCYL 1XAUA 1LQSR 1RJLB 3NFPA 1RZKH 4GAGL 4MD5A 4PJFB 4WEMB 3EYOB 5CCKH 1BQLH 1PZ5B 4P46D 4CUCA 3GM0A 1IQWL 5IMOB 2D7TH 4MA3B 3U6RB 1UZ6E 4BZ2L 4TTDC 1PFCA 3RWCA 2P5EE 5A16A 3ULUF 4TULH 3I6LE 4YHYC 1W0WA 4X7FC 4M6ML 2XNAA 1U8HA 2J8UA 4QTIH 5KSUA 5LBSL 3VFWB 4ELMB 2FJGB 3W39B 5LGKA 2X4OB 1A1NB 3KHQA 4Y5XB 3ZE0F 2OP4L 3JWOC 4IM8A 1JTPA 3QFJB 4JFPB 4WO4B 4ZFFB 3MRMB 1JRHH 4NJ9H 1ZLSH 3SGEH 1RJLA 4J12A 3BAEL 4PJFA 4MXQD 3EYOA 3WNPA 5I1EH 4OCNC 1PZ5A 3REWB 1LEKB 2J4WL 5F8QC 2D4DA 5IMOA 4OCYH 3U6RA 4MA3A 1KF9B 4QEGA 4X83A 4P2RB 4Y16B 3CZJA 2JLLA 1Q38A 4HCRH 2PN5A 2ZCKH 3CAFA 1ZVYA 3B9EA 4O51B 3AB0B 3CJJA 3VFWA 2FJGA 2DD8L 4MJ5B 3L1OH 2X4OA 1A1NA 1KJ3L 4Y5XA 3V4UL 1VERA 3V0VB 2F8OA 5CGMA 5EWIL 2HTKC 2VQTA 4WO4A 3QFJA 4JFPA 4ZFFA 3MRMA 4FABL 5EO1B 4Y4HB 1MWAH 2DQCH 3CIQA 2HJFB 4UNUA 1WFOA 1U6AH 3UTQB 3NA9L 4I0KA 4P5MB 4GKOA 1LEKA 3REWA 2HT2C 4I5BA 4LVEA 1KIRB 3UTSE 2V2TB 4P2RA 4Y16A 5TF0A 4HWBA 4M43H 5A1AA 1CCZA 3VG9B 3T0EB 3V6FB 4KZEL 3NIDE 4O51A 1BBJB 4Z7QE 3HE6C 2D9QB 4MJ5A 5ESAB 4KRMB 4LQFH 5DJCB 3NTCH 1KTRL 1XH3B 4OF7A 3V0VA 2Q20A 4UTAL 2ICWB 5EO1A 4Y4HA 2E8ZA 2IBGA 2HJFA 4JPVH 3H6JA 3MLSL 5EN2B 3UTQA 4MA7L 3D0LB 4P5MA 2V2TA 1KIRA 1Q9KB 5C0ND 1F11B 1H9VA 5J13C 5KSBF 3T0EA 3F7PC 3RZWA 3PWJB 3V6FA 1FAIH 4Q9CA 1BBJA 1Q72H 1KCVH 1W72L 4ACPA 5ESAA 3EO0B 5DJCA 1QTYT 1XH3A 2B7DT 2BOBA 1F4YL 2ICWA 2YUZA 3HUJB 3IFLL 2E9WA 2RBLA 5EN2A 3ZKMD 3D0LA 1Q9KA 5DJYB 3T65B 1F11A 3JVGC 5DD5L 3VFSA 4U1KB 4JO1L 4HS3B 5C0BD 3ILQD 4M7LT 3PWJA 4L4VE 2VDOH 2IPUK 3F8UB 3D85D 1VFBB 2EDLA 1TITA 3MLYH 5AYUH 3EO0A 4IRSC 1JYXA 1ETZB 3CD4A 2X9YA 4Y4KB 5D7JA 4M7JL 3O3DA 4GMSH 3HUJA 4EOWL 3OPZL 4JHAL 2Q7YB 3DX8B 1MFAL 5FYJD 2AERT 1YN6B 3THML 1PG7H 2DQUL 3ZKXC 2VN4A 5DJYA 3T65A 5SX4H 5D8JH 1KIQB 5GS2D 4U1KA 5KW9H 4HS3A 4Q6YA 4CRPA 4WTZG 3UZQA 1NGPH 2EE2A 1VFBA 4O2CB 1WBXB 4HS6B 3L9RB 1JWSB 1ETZA 4G5ZH 5AD0B 5LAXB 4DUVA 1X5AA 4Y4KA 1TJIH 3M17B 3FRUB 4RQQB 1QSEA 4E0RB 1ZHLB 3MJ9H 2Q7YA 4OM1H 2AJUH 4Y1AD 3DX8A 3NPSC 1RAMA 4OSUH 1YN6A 4AG4L 2DJ4A 3IDYB 1QHPA 1OP9A 3PP4H 3DXAB 1KIQA 2CLRA 5E8NB 1JZ6A 5C92A 3WIHH 4FTVB 4L29B 5FYKE 4ZUTB 3NZHL 3QIWD 5HYJB 3MZGB 3MLVL 5C6TL 4O2CA 2R1XB 1WBXA 2PO6B 4HS6A 3L9RA 2ENSA 3B2VH 2V17H 1JWSA 4GRLB 5E6IB 2C4FT 4S2SB 1MAJA 5AD0A 5LAXA 1KFAH 1ZLUH 4F58L 3NCYP 2HKHH 4XHQA 4MJID 3M17A 3FRUA 2XWTB 4RQQA 3MPCA 4F7CB 1JGEB 1BZQK 2UUDK 4E0RA 4LCCC 5TQ2L 3C8DA 1LD9B 4JVPA 1ZHLA 3WNNA 1OGAE 1SY6L 1U95B 2DKSA 3C08H 1I8IB 4KMTL 3S96B 3WS6A 4LPVA 5GISH 1JNHB 2X9WA 3C5SB 5CGTA 3RVTC 4TUKL 3DXAA 4K07A 5DJXB 4FTVA 4L29A 4ZUTA 4BK5A 1A5FH 1SMAA 3I50L 3NCFB 3TPUB 5HYJA 3GI9H 4KY1L 4C54A 2VLKB 2R1XA 3SO5A 2PO6A 3KPQB 2EZ0C 2NY1C 3KXFB 3UC0H 4NZUH 2B20A 4GRLA 5E6IA 3D2UD 3KPRB 3EDKA 4S2SA 4PG2A 3KWWB 4F7TB 2XWTA 3RWDB 2VDML 4F7CA 1JGEA 4R26H 4JR9L 2XQBL 3WIIL 2X1PA 3QIUC 1U95A 1I8IA 3S96A 2VLRE 5IF0B 1JNHA 2XA8H 3C5SA 4ENEC 5KSVB 5DJXA 2VDKL 3S3SA 3UTOA 2DLIA 3QDJB 2P45B 3MRFB 3TPUA 5LXGL 1D6VH 2GTWA 3NZ8B 2VLKA 4LVNC 2FSEB 3KPQA 4OZFH 3KXFA 4HIIB 5C3LD 4LHUB 3KPRA 5DEGA 4ZAKB 3TYGH 3KWWA 4PJXB 4F7TA 4MAUL 3RWDA 1DUZB 2OJEB 5CGYC 5H37G 5ETUB 3GFUA 5IF0A 2YD6A 5KSVA 2XRAH 3PWPE 1MAKA 3HFML 2AJVH 3QDJA 2EDRA 2CUHA 3MRFA 1CXKA 3JXAA 3NZ8A 1J88A 3ARED 1FNFA 2FSEA 2R9HD 4HIIA 4JFQB 4JFXB 4ZAKA 2R4RH 5C0FB 1NL0H 1OSPH 4N90E 4LCIH 5DZNA 4RSVA 4YBLC 1DUZA 2OJEA 2IGFL 5ETUA 2DLTA 1UWXH 3RY6C 4MJ2A 5FAAA 4JRWA 5MEQB 2YUVA 1ZKAA 1PSKH 1L7TL 3MV7E 1BM3L 4LVOB 5HHVH 3FN0L 4NM8H 4L3ED 5C0RH 4L5FL 4APQD 4JO2L 4R97C 3QNXB 3RDTB 2EKJA 5DMGC 1KCRH 5DVOA 5DZLA 5T1DH 1CZ8H 4WTWA 3WUWG 4JFQA 4JFXA 3HZYB 4JN1H 2QQLH 2IFFH 3KLDA 4DVRH 3RWIA 5C0FA 3QCVL 2CIKB 4OIIL 2VB5A 1OB1B 5ADPH 1L7IH 4EQ2A 4RFOH 3VDAA 1GC1L 5ACZB 4C58B 2Q6WB 2UZIH 5MEQA 3AAZB 3D3VD 3VJ6B 4HPYL 3I9GH 3MCLH 1RY7B 4LIQH 1B4JH 4U1JB 4JJ5B 4F9LA 4AMKL 3ARFB 3RDTA 1CGUA 1DJSA 3BKCH 3HZYA 2ED8A 5JZ7D 1FV1B 2CIKA 5D71L 5IFHL 1OB1A 5JHLH 4XX1G 3SBWC 3W5NA 2XWJB 5ACZA 4UTBL 3Q6FB 2N56A 2WUBL 2Q6WA 3HC0A 2YXFA 2V2WB 4FQCH 1G6RL 5HVWA 3AAZA 4W6XB 3VJ6A 4NNXB 2COQA 4M02A 3TVMA 3VD4A 4U1JA 2GCYB 1BBDH 4G7YL 4BK4A 3FJTA 4O9HL 5D72L 3ARFA 1SBSL 2K1MA 2C3XA 2Z93B 3T4YB 1QD0A 1R3IH 1T6WA 3LKRA 4L3CB 2YD7A 5J8OA 2OR8A 5D1XC 1FV1A 3BZDA 2P43B 4G6KL 1PLGL 4PJEB 2VSDA 4R0LC 2XWJA 3Q6FA 4IRJC 3AY4C 5DFWH 4M3KB 4TRPH 3HR5B 4BQ9A 4RMSA 4AIOA 4KI5C 4NNXA 1C5BH 3V0WH 1SMOA 2GCYA 3O8XD 4XNZC 3RIAF 4LSPH 5A2FA 4YHMH 4OTXL 3V8CA 2Z93A 3T4YA 4QRRE 4V1DB 2C4FU 5FA3B 4X4MA 5INCA 4PJEA 3ZE2F 1MY5A 3B83A 5ESQB 1UH2A 1L0QA 4HJGB 1QG3A 3QG6B 3P40A 4HAFA 3HR5A 4WI8A 4WY7L 1K8IB 3UEZA 5IP4A 1RFDL 1QR4A 1RZFL 1ZEAL 1PW3A 3VWJD 4LLVB 3BQUB 5C0DB 4V1DA 5FA3A 3LIZL 2Z8RA 1LDPH 2AJXH 3S6CA 3C09B 5I19L 4XNMB 5ESQA 1MNUH 4Y2DB 2VLME 4HJGA 1RIHH 1VGEL 4DWHA 4G8GE 5B39G 3BPOC 4XAKE 3QG6A 1O5DT 4OZIA 3IFNL 4H1LG 5GGTL 3CC5B 1SJVA 4I4WB 1K8IA 5D4QA 3WNKA 3MRDB 4NQED 5AUMB 5K59F 1YZZA 2BDNH 2BVPB 4LLVA 4M1GL 4Z18A 3BQUA 5BS0B 5C0DA 5BVPL 1R0AL 4KV5F 1HILB 4Z7WE 3U9PH 1U8PB 5C0CB 1FBIH 2FL5A 3OZ9H 5ISZA 1OAQH 4M4RA 4XNMA 1CQKA 4H26B 4Y2DA 5GS0C 1CL7H 2AW2A 1XIWB 3MQIA 5EUOE 5IIEB 1DFBH 3CC5A 4I4WA 1ZAGA 1RIUL 2AK4D 1A7OH 4BJLA 3OL2A 3MRDA 3LEYL 3MJ8B 4P0DA 3MO1B 3BIKB 4NC0B 4WW2F 5IB1B 3EDJA 2BVPA 2IPKB 4ODVH 4PRPD 4BSWA 1YMMD 3HI5L 1KBGH 5BS0A 5FYKU 1HILA 3ARDB 3UTPE 1U8PA 2PXYC 5C0CA 1QLEL 5I1HL 3S36X 1B2WL 4H26A 1GYAA 1IZKA 4NZTL 5EBMB 3RBGA 3VRLE 1XIWA 2P8PB 3LQMA 3SDCD 5IIEA 5KSAD 1CVRA 4FFWD 1MI5D 1Y6NR 1CLOH 4LPYA 2E9BA 1CXIA 1FL5B 4IRZL 1AGDB 4RWYL 1J1PH 4DEPB 3MRRB 5D9SB 1CGVA 3MJ8A 4O58H 4TVPE 3MO1A 3BIKA 4Y4FC 1LK2B 1ZV5A 5IB1A 2IPKA 3G6DH 1QFUL 4PJBF 3KDMB 1AC0A 4J3UA 1X44A 1J0KA 1E6JL 3MNWB 1QNZH 3ARDA 5EOCJ 5DQDL 2YK1L 1N64L 1BAFH 1VSCA 5DHVB 1T1YB 2QQNL 2Y9RT 1HE7A 2P8PA 4XMKH 2H32H 4I77L 5GZNC 1I3GL 4N68A 1FL5A 1AGDA 1BD2D 1IGIH 4O2FB 3MRRA 5D9SA 2QL1A 2AJSL 2X1XR 1LK2A 3WNLA 1IKNA 3KDMA 4P5TD 5FUOH 1HDMB 1NBVH 2X4TA 4PS4H 3MNWA 4ZPTB 4N0YH 5T33L 5DHVA 1T1YA 2B1HL 4RCAA 4WFEE 3BUTA 5HHOE 3RAJH 2E7BA 5ICZA 4KI5E 1OAXH 4O2FA 3O41B 2FB4L 2GI7A 5DSCB 2EH8L 3JTSB 2XI9A 4F57L 4Z7NF 3QDMB 3QJFB 1X4XA 5F9WB 4UT6L 1HDMA 1KCSH 5CUSH 4ZPTA 4YE4H 5CJBA 3V52H 3NCMA 1CD9B 3U46B 1J1XH 5DR5H 1I9JL 1CE1L 4JVWA 4YHZH 5J6GB 3RP1A 3R4DA 3N1PC 3ARBC 3SDDD 4EI5D 5FFLA 4OV6F 1BFTA 1RURH 3X14A 3TESA 3O41A 5BW7C 5IWLC 1L0YA 3DVGA 1IEBB 1K8DB 1H3TA 5DSCA 4AEHH 3JTSA 3QUKB 3QDMA 2NPLX 3U30C 3QJFA 4K3JH 1I1AD 1NCBH 2UY6A 3GSVB 3QWOB 1XGYL 5ESVB 3RY5A 3G04B 5HPOA 4MXWL 1QACA 3U46A 5L6YH 2EXWC 4DKAA 3ZKQD 4K7FA 3HRZB 4L4TE 4NQTA 4IDJH 3SGKC 1G7LB 4KHXL 3DTXB 4K8RL 4FXGB 5H2BB 1X9QA 3FQRB 2R0ZH 1HWHB 1IEBA 1K8DA 1WIPA 1P9MC 2YWZA 3QUKA 5DHYB 2OMBA 3MRQB 3KYMB 3GSVA 3QWOA 4JFHE 2DF3A 5ESVA 2MCPL 1RJYB 3KR3L 4HZAA 4OD1L 1R5IB 3RKDD 3N85L 4RFNB 3IDGB 5D5MF 4FQ1H 5HHMD 4HFWA 3HRZA 4KVNH 3MBEC 3PWUB 3PHOB 5I75C 1G7LA 3DTXA 3OAYH 4FXGA 5HGGS 5H2BA 3FQRA 3GSWB 4X4ZA 4Z0BL 2P5EA 3MRQA 2Q8AH 1DQMH 3KYMA 4ESKA 2ZUVA 1RJYA 3FQNB 4LARL 3T2PA 3L3HB 4QHMB 1R5IA 4P46C 3TC9A 1VEOA 3IDGA 3QEGH 4WTXA 3SGDH 5DEFB 3ZT7A 2CRYA 1FRGH 3RA7H 3LS5L 3V4PH 1FLRH 5SWZE 3PWUA 1UACH 3PHOA 3U0TB 1RUQH 2EXYC 3H42H 5K9JL 1A4JB 1W72B 2APTA 3N06B 5J1SC 4NBXB 4ZS7H 1SEBA 2KQNA 2QHRL 4JPWH 3S5LB 3V0AC 3I6KB 2DOCA 1JZ7A 2DMCA 3EYVB 2QEJA 3EIFA 3FQNA 4HWUA 1A6UL 4MXQC 4HUNB 3L3HA 3V6OC 4QHMA 1FCCA 5DEFA 3QWRD 1ADQL 4AIXA 2R1WB 1B6DA 5FHBH 2F5AL 3HZKB 3ZTJH 4FQJH 2DWEB 5HDBE 1RUKH 1UM6L 4TQEL 1A4JA 4HBCH 5GJSH 3SE9H 4PJFF 5E2WH 2DQIH 43CAB 4ERSL 3MRJB 3L3IB 3PDDA 2EH7L 1Z9OA 4ZOAA 1GHFL 3S5LA 4YZFF 3I6KA 4LHUG 1QFOA 5DD1L 3EYVA 5F3BB 4DKFH 3LD8C 1XCTA 1QFWH 2OL3H 2ORBL 1EHXA 1QBBA 4KJPD 2X4UB 1FDLH 1A3LH 1NLDH 1U8OB 2R1WA 3HZKA 1NCCH 3IVKA 3VXSB 3CGTA 2DWEA 4F9PC 1W8OA 1BREA 1FHGA 2PYFB 2NY4D 4R90H 2V5SA 4M7ZC 4U0RB 3T2QA 3LHPH 1FORL 1UXWB 3OF6D 4PRBA 2Y06L 43CAA 3MRJA 3B6SB 3L3IA 1RZ7H 2EC8A 1FAKT 4L4VB 5F3BA 4Q58C 4YIQB 4MAYB 12E8L 4B41A 3GI8L 4NM4L 5E94B 3VFGH 2X4UA 2E27L 2C1OB 1OCWH 4KXZH 5C0NC 4ZFGL 3VI3E 1CR9L 2XZCL 5DJAA 1HH9B 1EJOH 1EH9A 5T3XH 2PYFA 4LBEB 5DJ2B 5I9QC 3C6LD 1OAUH 3U0PB 4ETYA 32C2B 3OKOB 3EFDH 5GJTH 1UXWA 3F58L 2AQ2A 5KAQF 3B6SA 3BKMH 1MJ8H 3TIDB 5L0QC 3EOYG 7FABL 4HFUL 2KUTA 4HIXL 4L4VA 5I1KH 3H0TB 4YIQA 4MAYA 4M1DH 4WI7A 4LAQL 4QNPE 3ZKMC 4POZD 5E94A 5KJRH 1FIGL 1MFEL 2C1OA 2WIMA 4RA3A 1WGOA 3B5HA 2VC2H 5BRZE 3ILQC 2XQYG 1HH9A 3I84A 3HAEG 2QJDA 4LBEA 5DJ2A 3ULVD 1JZ8A 4P2QE 3WJJA 4TSCL 3U0PA 3ARQA 32C2A 2R69H 3OKOA 4KKAD 1GAFL 4JGUA 1MFNA 4JY6B 3UYPA 3TIDA 4YHYB 2W0PA 4NRXA 4WI6A 3DHMA 3H0TA 3QXUA 4J3VA 5TH2B 1NH6A 5FM4A 1MOEA 1WZKA 5EUKB 3RNQB 2SEBB 4W81A 3JWDL 5IQ9B 1KENH 1DE4B 4XXDB 4ALAH 4KQ4L 4XWOD 3MLTB 4G6ML 4OCXL 4CMHC 1OGAB 4XNUH 2Y4SA 2BY0A 3IRZA 2AXJA 4LGPB 1C7SA 1X5LA 3PE9A 3L3DB 4JY6A 5IBTH 5EZLA 1N26A 4J4PD 4NO2B 3DVNB 5TH2A 3S8WA 3K80A 3KVQA 4XP5L 2ZUYA 5FUCC 3FFCD 5D7LE 5EUKA 4K94H 3RNQA 4G3YL 2SEBA 4FQHB 3SDAD 1M05B 4FN0A 1RUPL 1PQZB 3M07A 4YXHH 3LH2L 4JKWA 3KHOA 3SE8L 4EEEA 3WFBH 1KLUB 4M6AA 4XXDA 1S7TB 3QIWC 3MLTA 4X4YB 1QOKA 1OGAA 3TBWB 1A6WL 4BH8B 3CFDB 3HC4L 2G5BB 2ZUTA 6FABL 2N7BA 1AO7E 3L3DA 1TZIB 5LGHH 2MNUA 2R56L 1IGFL 1T83C 4NO2A 3DVNA 3T3ME 4QHLB 4FQIH 4MLIA 3HE6B 4TPRH 3V6OE 2IPTL 2MHAB 2ICWJ 2EDFA 4P57B 5EOQH 1NFKA 3RQ3A 4FQHA 1M05A 4GKSB 1PQZA 1NGQL 3LQAC 1KLUA 3FHQA 5T1LD 2J5LC 3BZ4B 1F4WL 4X4YA 3K46A 5ICYB 3TBWA 1WISA 3E8UH 2VLRA 4BH8A 3EHBD 4R4FL 3CFDA 2G5BA 5J13B 4HV8B 4RRPA 3PWPB 4GBXD 4YFEA 1TZIA 2FWOA 1FO0H 4QHLA 2F8XC 4HT1H 3HE6A 5IROC 2MHAA 4P57A 1CDCA 4KJQD 3VXRB 1NAMH 2FX7H 4GKSA 1X7QB 5JNYB 5I71C 5E1AA 5D1QD 4Z7UB 3PJSB 1CDYA 3MC0A 4GAFB 4PP2B 5ICYA 3DX6B 3NIFE 1ACZA 3P3YA 5CEYB 4TNVK 3HMXA 4XPHH 5IW3A 3R1GH 4HV8A 3PWPA 5E95B 4U7KA 1I7UB 3BO8B 3MV7B 4K9EL 5FGCB 4JRYE 1YEEL 4JVUA 5IKCB 4X9IA 2P44B 1OGTB 4GRWF 4GAJL 2Q87A 4WEBL 3K8MA 1KYOJ 1EGJH 4IRSB 25C8L 1S9WB 1X7QA 5JNYA 1KG0B 4Y88A 4XC3H 2G60L 3QQ9C 2ENYA 2E3VA 3EYUL 3PJSA 4LLYB 5DUPL 1T2JA 4PP2A 4PYHA 2P8MB 3DX6A 4HBQA 4ZDHB 5CEYA 3GSXB 1FC2D 3Q0HA 3JVGA 2LV4A 3KJ6H 1JGVH 1I7UA 1IGML 3MV7A 3BO8A 5IKCA 2IC2A 1DSFH 2J88H 4NKIH 5CD5D 4IRSA 1JZ2A 1S9WA 1KG0A 1UYWL 4LPCA 1YJDL 2DL2A 4F33A 1FVEB 1MFCL 4LLYA 2MQ0A 3NPSB 3OV6A 2P8MA 4ZDHA 1KC5H 3GSXA 4KAQH 4JZNB 4GOSA 1YQVH 2BFVH 3SJVE 5C6PB 3VMOA 5FYJE 2CRMA 4O4YH 4IOFD 1Z6JT 1EEZB 3D1MC 5BV7C 3UJJH 3O0RH 4WFGD 2XXCB 1R3HB 4KDWA 1I85A 4R8WH 1J05B 3IT8D 1NDGB 1TVBB 2YHGA 1G9MC 4LCCB 1FVEA 2IADB 5D93C 3P0VH 1PX3A 1I8LC 1BEYL 4JZNA 2W9EH 4MJ4A 4XVSL 5AZEH 1AE6L 3O6KH 1TJGH 5HPMB 4J2XA 3J8F7 4XCFL 2BY3A 4JM2D 4D9RD 4DGYL 3UJIL 3DSFL 2NY1B 4PJAE 1EEZA 5D6DC 4JDZB 4QRRB 3V5KB 4LMQI 1WZMA 5AAWA 3X12B 3UP1A 4NUGH 3SPVB 3VFPB 1J05A 1NDGA 1TVBA 5MEND 4LP4A 4LCCA 2FGZA 4U1GC 2IADA 4K55A 1YC8A 3QIUB 3WD5H 3P11H 5FYLL 1CDJA 5FYJL 4N0UE 2NY0C 1INEH 4DOHE 5FCSH 1IQDB 4KK6D 1J11A 1C5CL 4X7DC 4LVNB 1GOFA 3U7YH 5GGTA 1HH6B 4JDZA 3B43A 4MJ6B 4QRRA 3Q3GB 3V5KA 3X12A 3LMJH 3SPVA 3VFPA 1MRCH 2YWYA 2EDJA 2X4SB 5JMRA 1A7QL 3IETB 3QIUA 1ZT1B 4G8GB 3QIBB 4KGJA 3LPFA 1NMAH 1VGKB 4H8WC 5I0DA 5JLZB 2A9MH 4DUXA 2HH0L 3DIFB 1VPOH 4MA8H 1S7UA 4U3XA 2KKQA 1IQDA 1FE8L 1G6VK 3EYQD 4I3SH 2BVTA 1H3VA 1HH6A 4MJ6A 4JO4H 4PJDF 3Q3GA 2XICA 4M7LL 3ARWA 5I2IB 3LKPB 4WI5A 4YBLB 2X4SA 2WM0A 3IETA 3SDXF 3T0BA 1ZT1A 3VWJC 4G8GA 5EUOB 3DBXB 4RX4A 2VXVL 1SVZA 1VGKA 1JNNL 5JLZA 3R06A 3DIFA 4OLVH 2H45A 3IXAB 4HPOH 1MFDH 4GSDL 4R97B 1S5HB 2O5XH 2WMPA 3QXVA 1EMTH 3QR2A 5E2JA 3LCYA 5I2IA 4Z7WA 5GSVB 3LKPA 2MKWA 35C8H 4N5ED 2CLZB 3RX5A 1LEGB 5EUOA 3DBXA 3RY6A 2G75B 1QSFD 4TOYH 3QDGD 4OZIF 4KKLD 3RUGE 2M2DA 2NR6D 1F8TL 1K5NB 3IXAA 4WFFD 2XG4A 3NOIA 1RIVL 1T03L 1S5HA 4OF8A 1U8QB 4R96A 3ARYA 3RVWD 1IGCL 3NACH 3HN3A 1HI6B 1WZLA 1S78D 2FO4B 3EO9H 1JZ4A 5GSVA 3J7HA 1G0XA 1GCFA 1YNLL 4L3EE 5E8EB 5C1MB 1LEGA 2LU3A 1M1SA 4GG6B 2G75A 3OGOE 3LKQB 4FQLH 5DTFB 1EHLL 1K5NA 5EOCH 2P8LB 3CCHB 1QRND 5CSZB 3QCUH 1U8QA 5FM8A 3SDCC 1U8NA 3ALPA 4QGYA 1WBYB 4FFWC 4NYLB 2P4AB 4YDIL 2F54D 3D3VE 4NNPH 2FO4A 2R1YA 5F88B 1IKFL 5HYQB 4QOKD 3SBWA 4R0LB 3C8HA 5E8EA 2DM3A 3L5HA 2DJSA 4GG6A 4HUKB 4IRJB 4K94C 1ZA3A 5HHOB 4LASH 3GMNB 3GBNH 1RPQA 4W4OC 3LKQA 3RY4A 5DTFA 1L6XA 3DECA 5B22A 4ZNCD 2IFGA 2P8LA 3CCHA 4IEFB 4PGZA 3MRHB 1CF8L 3AXLB 4XNZB 5CSZA 1NANH 4M6OL 2ZP0T 4L3AA 4RIRB 1OQXA 1WBYA 2ZZUT 4NYLA 1T2QH 3BJLA 2HJKB 5D1XA 2VQ1B 3GHEL 2AABH 5HYQA 2XZQH 3FL7A 4XAWL 3ARXA 4R0LA 1MAML 3CFBB 2IF7A 3O4LE 1A3RL 1XGUB 5F1IB 4IRJA 3AY4A 3FCTB 4P5TC 1IARB 5HHOA 3GMNA 5BV7L 5E24E 3K1KC 4HUVB 3D9AL 3MRHA 4UIMB 4XVUD 3AXLA 5JOPD 5H37H 4ORZC 1F6FB 4RIRA 1T0PB 1J5OH 4NJAH 2BY2A 2GY7B 5IVXE 2HLFD 5I8OL 3GBMH 5T3ZH 2HJKA 2VQ1A 3FN9A 4WHYH 3OTTA 2UZYB 5IGXL 4YHLL 1FL6B 3CFBA 3BPOB 3G6AB 3U7WH 1XGUA 4JAMB 3FCTA 3SE3C 4L4TB 3S4SG 1E4KC 1FNSH 4HUVA 3DETD 4M8QB 5B38B 1MJUH 3X3GL 3MLXL 2DBLH 1WWCA 4UIMA 3PV7A 5C0AD 4OCSL 3WFCL 1RSFA 1CLZH 2XTLA 5DJZB 3SDDC 4Q0XL 4EI5C 4HG4K 1OP5K 2FX8L 1FGVH 3QPXH 1NGZB 1FL6A 1I3RB 5A43C 2FGWL 3AM8C 4LCYB 5TDNB 2DQGL 3G6AA 5CILH 4JAMA 4TYUA 4L4TA 3V9FA 1I1AC 3MLZL 4DK6A 4M8QA 3TT3L 1U93B 3U4BH 4P49A 3LN9A 3BH9B 2EDTA 5IUSA 3RKPA 2YMXL 1FZJB 5DJZA 1YEGL 4XPTH 1JGDB 5GRVK 4YWGH 5F7EL 2PXYB 3O81A 5F9OL 1NGZA 4XPAL 4NQEE 2HRPL 5FYJU 4Z9KB 3FQXB 3TM6A 5A3ID 3TN0D 5TDNA 1UENA 1GIGL 1OAYL 2NY5H 1OAKL 3FT3B 5SWZB 2EDOA 1U93A 4JHWH 5C0IB 3DROB 3C6SB 3RKDC 3P9LB 2P5WD 3LS4L 4Y4FB 3BH9A 1TNNA 2YN5A 1FZJA 4BYHA 3DGGB 1FVDB 1JGDA 1F4XL 2F5BL 5I1GL 3QDAA 2AK4E 2NTSP 1UJ3C 2PXYA 1KUMA 4ODHL 2Q8BH 1RK0B 5DFVD 3JV5A 4ODWB 3FQXA 4KQ3L 4UAOC 2UV3A 1YYMH 1YMME 2FECI 3TYFB 5SWZA 3FT3A 4NCDA 1GGCH 2W0LA 3CK0L 4GXUM 3B3IB 2ZOLB 5CINL 5C0IA 3DROA 5GGSB 3C6SA 1MPAL 3P9LA 4EUPH 4Y4FA 3MJ9A 3QQ4B 1J10A 4L8DB 3DGGA 1FVDA 1MI5E 2X44D 4ZSOE 1U3YA 2XZZA 5L9DH 5CZVL 3QWQB 5DGQA 1RK0A 4PUBH 4LCUB 5KVFL 2CH8A 1XGQB 4KZDL 4ODWA 1K4DB 9CGTA 3S37L 3TYFA 5I1CL 3QCTL 1NC2B 1NPUA 3B3IA 2ZOLA 5GGSA 1TZGH 3WFEH 2R0KH 3FB6B 4DTGH 4L8DA 1A6TB 3WHE1 2PNDA 3K8LA 4YX2L 3ZE1F 2DYPB 2Y1VA 5KS9E 4OQTL 1FNGB 1K4DA 5C09D 3SKJL 2P7TB 2XYCA 3OR7B 5EU4B 2JK5B 3F65A 4S1RL 4NQDD 4Y19D 2X41A 3ARBB 5GXBB 2FJHA 1D5ZB 1CXHA 2Z8VC 1FPTH 4EBQL 5JDSB 4E41D 1GGYA 4KJPC 2AK1H 4IMKC 3FB6A 1A6TA 1N4XH 2XA3A 1K6QL 3U30B 3ULUD 3TO4D 1TCRA 5BOZG 2DYPA 3TGXA 5HYEA 4QHKI 4OCWL 2JB6B 1G9NH 2D3VA 1JYNA 5DFTA 3T0XA 1IGJB 2D31B 1FNGA 4MCYB 4OF3A 2P7TA 5DD3H 4KJYB 3U36B 3OR7A 8CGTA 2O26U 1MCQA 5EU4A 2JK5A 3GM8A 4OZFA 1QBMH 5BRZB 1FQ9C 4YHPB 4GXUN 3ARBA 4NHUB 1NBZA 1DVFD 5F6HI 4MA1C 2KZ1B 4C4KT 2AV7B 4JO3H 1D5ZA 2DL9A 3BD3A 5DMKB 2YA0A 1AQDB 4P2QB 5JDSA 4P23D 5ECJE 5BW7A 4QF1A 5IWLA 4S0TD 4NCC1 3RWEB 5EOTB 2CKBB 3S35H 2JB6A 1INDL 1IGJA 3K0WA 2D31A 1AGEB 4U31A 4KJYA 4U6VL 3U36A 4Q9QL 1DBJL 5DMJB 5BRZA 4P5KB 3MBEB 3ARPA 4YHPA 4NHUA 2VDQL 2VDRL 3SGKA 5I75B 5J11C 1JHLL 2AV7A 3IU4L 4IOSD 5DMKA 4P2QA 1AQDA 4POZC 1IC5H 4I13B 2A9NL 2FD6L 2IWGA 1MCPH 3RWEA 1P9MA 2R29H 5EOTA 3ULVC 2CKBA 2GAZB 4HWBH 3EJZD 1DTUA 4MYWB 3DRTB 4JB9L 4P46B 3NFSL 1AGEA 4KKAC 1RV6X 4KTDL 2ZOKA 3VD9A 4P5KA 3MBEA 4X6DF 4JY5H 1C1EH 1N6QH 3LPGA 4ZTPL 1PZUB 3BPNC 5IT2H 4QXUH 4NZJA 1MELA 2FRGP 4LU5H 3EBAA 4KUCF 4MCZA 1KGCD 4X80H 4ONGL 4XWOC 1ZANL 1Q9WB 2W9DL 1A6VH 2GAZA 4Z7VF 5SV3A 3RTQD 4NNYB 5DMYA 3DRTA 5D7LA 1Q1JH 4P46A 2OSLB 3SDYL 1NFDF 4OZGF 5C0GB 4OLUH 1U36A 4J4PC 1QFWM 4KMQA 1A64A 1KXQE 2DQEH 4WW1B 3SDAC 5DURD 2KDGA 4J1UB 1DQLL 2AEQH 2CJUL 3VFTB 4G6FD 3ZT6A 1WITA 5EU3A 5I1AB 2C3HA 3LD8B 4XWGL 2X42A 4NNYA 3V6OA 1MLCB 3CZFB 2JELH 2IALB 2OSLA 5E9DD 4WHDA 5DS8B 4UI2A 5C0GA 1XEDA 4N0FB 4PTTB 4S1DC 5DI8B 4WW1A 4M7ZB 4Y89A 1FYHB 3RGVD 5JXED 1P2CB 2UVFA 1YEHL 4J1UA 1OP3H 4PJ8C 3FN3A 3VFTA 1NBYB 4JRYB 5I1AA 5GGVY 2DQDL 2VDPL 2OMNA 1MLCA 3CZFA 2IALA 3EHBC 1HINL 4PB9H 1F00I 5DS8A 1H3XA 2VL4A 2BNQE 1RZJC 5CP3A 2DIAA 4OJFH 5IHUH 4GBXC 2V5TA 1K2DB 4F9PA 1MJ7L 4HD9A 4N0FA 5L2JB 1P7QD 5I9QB 1BQLL 5DI8A 3I2CH 4TULL 1P2CA 1L0XA 4OKVA 4O02H 5L0QB 1NBYA 3MX0A 4JRYA 4LEOB 4LQ1A 4PJ7F 1JRHL 1K2DA 3DMMA 4NJ9L 1ZLSL 1S3KL 2Y23A 4HAGA 5L2JA 3CUPB 1ZA6B 3O3AB 4HK3J 4RMUA 3BVNB 3F7VB 2Y36H 3I3BA 2FIKB 5ADOH 2XG5A 3G5XB 3KYKL 3X17A 1A9EB 5F1NB 1LILA 4LKCA 4P3WA 4LEOA 4PJHE 1JP5A 3DV4B 3VXTB 1CG9B 1IM9D 4P9HC 3QI9C 5DWUL 2OZ4A 2BRRH 4OFPA 4OGYH 1MWAL 1B0WA 3PDGA 4CMHB 4HWEL 2ZJSL 2PUQT 1FFNB 1ZA6A 1QQDB 3O3AA 3CUPA 3BVNA 3F7VA 2X70B 2FIKA 5CD5C 1BWWA 1LMKA 2KH2B 4M43L 1A9EA 3LZFH 5F1NA 5TE4H 4Y7MA 1ODAA 4NBZB 4UDTB 1J8HD 4KK9D 4Y1AB 3DV4A 3O3EB 1OT1A 1U3HC 3VXTA 3WEXB 1CG9A 4PJIE 1BFVL 4PJAB 3NTCL 4S1SH 1Q0YL 3LPWA 1RVFH 2F19H 4LKXB 1KLFA 3QIWB 5I8EA 4AH2B 4KK8D 5JW4M 4WUKL 5CJXC 4RISH 1QQDA 5JW3H 2X70A 3MV8E 3VXME 5TE7L 4N0UB 4M5YH 4P59H 3A6BH 4UDTA 4LSRL 2D0GA 4Y1AA 3O3EA 3V8OA 3PL6C 3WEXA 5EZOH 4HKZB 3MRPB 4PJAA 1VEMA 3EOTL 5ID1B 1C5DB 5D2NB 1MCOH 1OL0A 3NGBC 4LKXA 3QIWA 4YK4C 2J5LB 4AH2A 4JM2C 4PREB 5IFAL 3OKNB 3ULVL 2LTQC 4D0DB 2AEIT 2AGJL 3D2UB 1JPSH 4PTUB 4N0UA 3VXUD 3PABB 5ITBL 2VDOL 1T83A 4LSTH 4CW1B 1II4E 4QHUB 4F2MB 2FEEL 5I18H 4HKZA 1X5IA 1QP1A 3MRPA 3IDIB 5I71B 5ID1A 1C5DA 2J8OA 4KPHL 4KK6C 4PREA 1HKFA 3ZDXE 3OKNA 5B38G 4D0DA 1I1YB 3HNVH 3D2UA 5IVZB 5D8JL 4PTUA 5AEAA 3PABA 3LKNA 3MYJB 3UX9B 4JQVC 4CW1A 4QHUA 2HKFH 5IROA 4JG1H 4K23L 3IDIA 3BP6B 1N0LA 3CDCA 2ZUQB 5JW4N 3D48R 4HW6A 1DEEB 5D6CB 3O6LH 2QQQA 4NZRH 4OM1L 3EYQC 5CEZH 1V7NH 1I1YA 3SQOH 3TZVD 4ONFL 5IVZA 3PP4L 3TNMB 3KNBB 1FSKC 3WIHL 1ZTXH 4ZD3L 1R3KB 3MYJA 3PP3K 2J8HA 2VSCA 3B2VL 1GL4B 1D6EB 2V17L 2DLGA 1FN4B 3IDXH 3BP6A 5D7IE 1KFAL 5DRNB 3BJ91 2HKHL 4P3DA 3V2AR 3PGFH 1YECH 3QZWG 1DEEA 5D6CA 1MIMH 4L3EB 1MJJB 2NY6C 1TTUA 3C08L 5EFIB 2J12B 4BZYA 1QKZH 1AR1D 3LQZB 3TNMA 3KNBA 2DAVA 1FC1A 1R3KA 1A5FL 3MZTA 4UV7H 3VG0H 4ETQB 3GI9L 4OFKA 1X5FA 1CBVH 1AFVH 2ZG3A 4QXGH 4J6RL 5BV7B 1FN4A 1H3PH 2V7HB 5DRNA 4KC3B 4KKLC 3ISWA 4JQIL 2NR6C 1CLCA 1IEAA 3D3VB 4R26L 4QKXB 1NJ9B 4L3EA 1MJJA 4Z7WF 5D93B 1TLKA 1GZPA 4KUZL 4P2YA 2A0LD 2XA8L 3MOAH 3RVWC 4XNXL 4GO6B 3W0WE 5ENWB 3UTZB 4UB0H 2XPGB 4XCCH 1I3UA 1S78C 1D3CA 4ETQA 3CU1A 4ZS6D 1RK1B 3BXNB 3RU8H 2PTUA 1KOAA 3GJFK 4ZQKB 1KACB 3P73A 2AJYH 4XX1E 5DRXA 2V7HA 1MVUB 1KT2B 3D3VA 1EV2E 2I9TB 2B0SL 3BKYL 3WNOA 3O2VH 1NJ9A 3LRGA 5EORH 5E99H 3CXHK 3MLRH 3WS3B 3O4LB 1I8LA 2D03H 5F7NC 4WFGE 2ITDB 3VFUA 2XRAL 2X89D 3MYZA 5ENWA 3UTZA 1YNTB 3R8QA 4QWWC 3UROR 2NY0B 2XPGA 2EE3A 4HH8A 5C7XH 5IFJB 1HN1A 1RK1A 3BXNA 2XT1B 4ZQKA 4M1CD 2EYSB 5DK0B 3I6GB 2FBJH 5HDQH 1HZHL 3FHAA 5D6DA 5BMFL 1MVUA 5IVXB 1KT2A 4LCIL 4Z95H 3ILPA 4YUEL 1JE6A 3OKLB 2XZAH 5JR1H 3KPSD 5D7SH 3WS3A 3O4LA 5DMIH 4MQSB 2ITDA 3MLWL 4A2MA 1A1OB 1P4IH 1YNTA 5EIQA 3FQWB 2DQFB 2VR9A 2YRLA 3CSYB 5MENE 4MSWB 4XB8A 4NM8L 1K85A 2JJSC 5IFJA 4HLJA 3RHWK 5KG9B 1EBPA 4NRYB 4YFDB 5T1KD 4G8IB 4S11A 3ET9F 1YYLL 3LY6A 2EYSA 1KB5B 5DK0A 1CZ8L 3I6GA 5T1DL 3W2DL 3LN5B 3GGWB 4JN1L 1SM3L 5BXFB 2QQLL 4HGKC 1U8MB 2IFFL 5IVXA 6CGTA 5CJ8A 4JM4H 5ADPL 3OKLA 4XVUC 1NUDA 4EJ1C 1BGXL 4GLRI 3VWJB 4HJJH 4RA0C 4O5LH 1A1OA 2HLFC 3KPMB 2CMRL 2X4RB 1LP9F 2DQFA 2VTFA 3BD4A 3CSYA 3I9GL 3LVEA 3MCLL 4MSWA 4XPFH 4LIQL 5KG9A 1B4JL 2B2XL 3QDHA 4NRYA 4KKNA 3C87A 4ZODA 4G8IA 3MXWL 4P48A 2ESVD 3BKCL 1KB5A 4U1LB 2CXKA 3LN5A 4M9PA 3GGWA 5BXFA 1U8MA 4MQXD 3DETC 3AMKA 3B9KD 1QRKA 3R0MA 4XC1H 5FDYA 4Z6AT 4NQEB 4UV4H 2EEAA 4LDLB 3VWJA 1G9EA 4FQCL 3CU7A 3KPMA 2LAGB 5L8LB 4ZFOA 4PJCE 4Y5YC 2XQYK 3IJHB 5C08E 5E5RB 1BBDL 3ZDYE 1TJHH 2BJMH 4U1LA 2CR3A 1ZLVH 1R3IL 2OTPA 1NGWB 1JZ5A 1UWEL 2AK4B 3C5ZC 2IAND 2FLRT 3MGAA 4GW4B 4W70A 2MPAH 4NQEA 4OB5H 4XP9L 1AY1H 4UQ2B 2ZCHH 4CVXB 4JEGB 5ILTH 4PRPB 3GSQB 1YMMB 4HLZG 4TRPL 4X5WB 1EAJA 4ELME 5FUZH 2WUCH 1A7RH 4NPYB 4A6YL 4K3GA 3DJ9A 1C5BL 3IJHA 3V0WL 3JBG7 5A3IC 1AD9B 3Q1SH 1UFUA 5B3NA 4YHML 4MXVF 3SDCB 4DGIH 5KSAB 5JPNB 1F90L 1MI5B 1XGRB 4X9FA 4ZSOB 1NGWA 3ZL4H 3G5YB 2AK4A 4WFFE 2P46B 3L6FB 3EKCA 3P0YH 2A83B 4GW4A 4NGHH 3MA7B 1I7RB 1EEYB 1N6UA 5SV4A 4FA8A 2W91A 4CVXA 2AV1B 3UTTD 3ZHDA 3GSQA 1YMMA 5J12C 1T1ZB 4X5WA 1KN2H 4OKDA 1P84K 2PYED 5F7UA 2V2XB 5DFVC 4NPYA 4JKPL 4OQTA 1OPGH 4CAGA 1AD9A 3B8YA 3BOVA 2ARWA 4YQXH 3SDCA 3D69B 2ADFH 3CVIH 5JPNA 1MI5A 1XGRA 3F7YB 4ZSOA 1LDPL 1X5ZA 2AJXL 1P53A 3G5YA 2NXZD 4OLYL 5KS9B 1QRNE 2DMKA 2A83A 4JFFD 3MA7A 1EEYA 1MCKA 1RIHL 2OXGA 4GAGH 2BSED 2VXSH 1FFOB 1A2YB 4ODUB 4P5TB 4W4OA 3U83A 3X13B 3UZEA 1IQWH 3QNZB 1T1ZA 4BZ2H 1BECA 2F54E 3B8SA 2ICEB 3AROA 2V2XA 4Z8FH 1N7MH 3GKZA 1U2HA 3NCEB 3WO4C 4KTEL 4TNWF 1KB9K 3QUML 5KZCD 4FP8H 3P4LA 2BDNL 3OJVC 4FHBD 3D69A 5IM7B 3F7YA 4AEIH 4I1NB 3O9WD 3ZKSD 2YOCA 1RJZB 3OZ9L 4XHJC 5DHXB 5KS9A 1OAQL 2O93L 3BAEH 3O3UN 1FFOA 1A2YA 3HNSH 4ODUA 1NGXB 4P5TA 2WBJD 1E4XH 4JG0H 3QNZA 5TQ0H 1CDIA 1A7OL 1CGTA 2ICEA 2YR3A 5GZOC 5MHSD 3IDMB 2ZG2A 1KBGL 2E9JA 3V4UH 2YN3A 5IM7A 3SDDB 4EI5B 3RWHB 2H6PB 1J7VR 5HI5C 2BP3A 1RJZA 1WC7B 2DI9A 3WJLC 1GGTA 3SY0B 3DGCR 5JOPE 3JSSA 4AK1A 3EJYD 1NGXA 2KZWA 3SE3A 3ULUC 1CT8B 4GS7C 4ZO8A 1CLOL 1I1AB 1E4KA 5EULV 3TWCH 3CFJB 3H9ZA 2DRUA 3BUYB 5M7QA 2I5YH 2E7MA 4FRWA 4O58L 1BQHB 4KZEH 2Z31A 3G6DL 5E8OB 4WHCA 2B4CL 4UBDD 2JJVA 4PJ9D 1ORSB 3SDDA 4EI5A 3NMEA 3RWHA 2H6PA 1QNZL 4UTAH 1DVFC 1E6OL 1WC7A 1BAFL 2ICCA 4AYFA 4RMTA 4P23C 5C0AE 1I9RH 4ZOCA 3SY0A 3AM8A 4PG9B 1CT8A 1I1AA 1DN0B 2IEPA 3CFJA 1IGIL 1BZ9B 3BUYA 1P6FA 1PY9A 1BQSA 4O00A 1BQHA 5EB9A 1FJ1A 2NNAB 1W72H 5GGSY 5E8OA 1H15B 1Q0XL 5HBBA 1XCQA 1ORSA 2Z91A 4PS4L 1IC4H 2Q7NA 1UJ3B 1FLTX 1J0JA 2XY2A 1MVFA 3IFLH 1XZ0B 1S7SB 4Y0GA 1G7MB 4UAOB 4PG9A 1UT9A 4OUUB 3RAJL 1RQ5A 3RVUD 3RL1B 1FNEB 2CLVB 1DN0A 1OAXL 4JO1H 1BZ9A 4JFDE 3EJZC 4L9DA 2JCCE 5I16B 1F13A 2NNAA 3U0WL 3VH8G 5LQBL 2GK0B 5K33A 3BP5B 1H15A 1HHIB 2OJZL 1QYGH 1KCSL 1BQUA 4Y16D 4YE4L 5K9QI 1UJ3A 2NZ9D 4ODTL 4HKBB 3V52L 4MVBD 2P5WE 4EOWH 3OPZH 5DR5L 1UCBL 1S7SA 1XZ0A 4JHAH 1G7MA 4BSJA 1MFAH 3E0GA 4OUUA 3THMH 2DQUH 3UMTA 1QBLL 3NCBB 3RL1A 1FNEA 1C08B 2CLVA 5SX5H 1CFVL 5BCAA 3RTQC 4Y4HD 4M7KH 5I16A 1FFPB 4AEHL 2GK0A 5D2LF 3BP5A 1HHIA 1ZHBB 3GMMB 1EVUA 3SKUD 4HKBA 1JMXA 5JIKA 1ZLWK 2QHLA 3A67L 4LLQB 3GSRB 3BRFA 3VGFA 2BNQB 5LJYH 4AG4H 4KU1A 2HT4D 5HYSG 5ABDE 1C08A 4IDJL 1TTFA 4XVTL 3NZHH 1E27B 3RJDA 4Y2OA 2AXHA 5FGSA 1FFPA 2Q76B 3QWRA 2DWDB 4Q9BA 4PJXE 4OAWA 3V95A 3EOAA 1ZHBA 2Z35A 3GMMA 4F58H 5GGVH 5F93C 4HUWB 5DZOA 3CSPA 3T3MF 2M8XA 3ARSA 4LLQA 1LO2L 3GSRA 5GGUB 2BNQA 3OB0H 2J6EL 4LSQH 1UM4L 5D7JD 4MA1B 4EIGB 3L3JB 4OV5B 4YBQD 1E27A 4DCQB 1IZJA 4IMKA 3U9UB 2Q76A 5CIPB 4F8TA 1OY3B 2GEEA 4NQDE 1W8NA 1DQML 2ZWLT 3VWKC 1X5XA 4OGZA 4HGWB 4GQ9L 4R2GD 4BFEA 1I75A 5FYKH 4E41E 3L5XH 4HUWA 1SYSB 2XQBH 3OF6A 5GGUA 3ULUE 1IAIL 1FLRL 1AC6A 2EDBA 3JWOH 3H7LA 2VDKH 1HNGA 1S7VB 5J11B 3H42L 1QSED 3L3JA 4OV5A 5I73C 3I3DA 3ZE0E 3U9UA 1VB9A 3UBXI 4UILH 5CEZE 2OTWB 4WDIB 5CIPA 5DF0A 4JPWL 1UWGH 4I0CC 2HFEB 4JPIB 4HGWA 2PTTB 4PJHA 2X05A 1CYGA 5E7BA 4PJIB 1O0VA 1SYSA 3MFFB 4D9LL 2GT9B 1YEKL 4NO0D 5FHBL 3FMGL 5J89A 1RUKL 1S7VA 2WWKO 4HBCL 4R4ND 5GJSL 3BPNB 3ROLB 3MACL 4WTZA 5HYIA 1EUUA 3U48A 2D4FA 3GIZH 1F3DJ 5E2WL 3MV8B 3BIAX 3HC3H 3VXMB 2DQIL 2A1WL 2OTWA 4YHNB 4WDIA 1U58A 3FT2B 4OGAD 2HFEA 4Z7OE 4JPIA 2PTTA 4ZUSB 2E7LC 4XTRD 2OL3L 3RIAK 1A7PH 3OKKA 3K3QA 4PJIA 3MFFA 1FDLL 1ZOXA 2GT9A 1CD0A 2C3VB 1OTSD 3BKJL 4PV8B 1T0MB 3H3KA 5E6ID 1H5BB 4POUB 5DT1H 5D7KD 4XMPH 5C0EB 1OM3L 1EEUA 4OI9A 3I02B 4KK9C 3MLUH 3FFCB 1BM3H 3WCYA 3ROLA 2YBRB 4Q2ZB 3LHPL 4L5FH 3SDAB 3MV8A 3VXMA 4JO2H 4YHNA 5LGJB 1RZ7L 4LNRB 4YLQT 3GSNL 5FECB 4ZYKB 4KK8C 4ZUSA 1F4AA 3QCVH 1WEJL 3FB8B 4OIIH 4JKKA 2HTLC 3VFGL 1OCWL 2IQAB 5EIIB 2VLKD 3HRPA 4PV8A 1T0MA 5KSBE 4Q9RH 2GTZB 1KGCE 5K9QG 1EJOL 1NCUA 4P2OC 5T3XL 4OI8A 1OSZB 3BDBA 5C0EA 1EA9C 2W92A 3I02A 5D70L 4HPYH 3S36H 3PUCA 2DI8A 4CJ1A 3FOMB 1P1ZB 2YBRA 4Q2ZA 3EFDL 3SDAA 4R4BB 2F53D 5BZWB 4AMKH 4MX7B 1WIOA 3QAZC 5LGJA 1JPFB 4LNRA 5T1LB 2H9GB 4PJ8B 5FECA 4ZYKA 5I1KL 4JDTH 4M1DL 3FB8A 5CEXB 5D71H 5IFHH 4JFYB 5KJRL 1WFNA 1QR1B 2IQAA 3KS0J 5EIIA 3B5TA 3QT2A 4PRAB 2GTZA 2VC2L 4GBXB 2WUBH 2DIJA 5E8DL 4ZAKD 1OWRM 2AI0L 1G6RH 3O6FD 1OSZA 2BVOB 1ORQB 2CUMA 1E4WH 2YA1A 3FOMA 2D9CA 1P1ZA 5E9DE 1GPOH 3IJSB 4LLUB 4R4BA 4G7YH 1F6LL 5D72H 5BZWA 1SBSH 2R0LL 4HUUB 1JHKH 5T1LA 2H9GA 2OX5A 2VMFA 4PJ8A 4B50A 4WWKA 1CGYA 4XT1C 5CEXA 2V6HA 4JFYA 3VFRB 2APXA 1J0IA 1QR1A 2YPKB 2BVUA 5D7IB 1NUFA 4PRAA 1KENL 4GBXA 3BWAB 4DW2H 3DPBA 4OCRL 2V9RA 2BVOA 1ORQA 1KEMH 4XNUL 2P49B 2Z8SA 4QTHB 4E5XB 5EO9B 2QADC 3IJSA 4LLUA 3CDYA 2KBGA 1SJHB 4R7NB 4JDVA 3WUWB 5D96B 4NOFA 4LPXA 2YRPA 2I60L 2E7CA 3VFRA 2DMBA 3TZVC 2YPKA 2IQ9L 3LOWA 5CBAB 3QI9B 5D7IA 4CU8A 1N5AA 2BCKB 3O11B 4LEXH 3WFBL 3BWAA 5DGRA 1UB5B 3OJMB 5JO5B 3QUXC 4G9FD 3HB3D 5HD8D 4E5XA 4QTHA 1RFDH 5EO9A 4PY7B 3HA0A 1SJHA 3W0WB 3NVQA 4R7NA 2EC9U 5LGHL 1FVCA 3PNWB 1TETL 4XP6H 3WUWA 4GXVH 4U05A 3LIZH 5TJWK 2RIKA 3WFDL 4WI2A 4FQIL 1GJIA 1U3HB 1JUFB 2BHZA 5I19H 4X6EB 3TVMD 4ZXBD 3UBXG 4A2LA 1XGTB 5CBAA 1HSAA 3QI9A 1VGEH 2BCKA 3O11A 3GK8L 3IFNH 3ROOB 1M7IB 1I9EA 5GGTH 5KVDH 1UB5A 5JO5A 1JRHI 5AYQA 2LFGA 1S7QB 4NQCD 5KTEH 1QSVA 3UPAA 4M93C 2C9AA 1ES0B 1UGNA 4PY7A 1UM5H 1YPZF 3W0WA 2K7PA 4R9HA 3PNWA 4MQTB 4I9WE 1T6VN 4PLKD 1FO0L 3RUGF 1KCUL 5BVPH 1EFQA 1U3HA 1JUFA 3PL6B 2A0LC 4X6EA 4UINL 1XFPA 1NAML 1XGTA 3VFNB 2EIDA 2AQ1A 3ROOA 3NGBB 1M7IA 4YK4B 3K8KA 1J8HE 1JPGB 2DQHL 4JM2B 4OFVA 5E8PB 4ZS6C 1S7QA 5CJXA 2LTQB 3LEYH 1ES0A 1A14H 4LSUH 4LRIC 4XPHL 4AY0A 1EXUB 2C3WA 2X6MA 3R1GL 1T22B 2O5ZH 4UT7L 1MHCB 3A0OA 3TBTA 2L4OA 2VLLB 5MENB 1FH5H 1KSRA 4G9DB 3PL6A 5GRYA 3MGOB 5I1HH 4JN2B 3ZHKA 4DFIA 4GRMB 3VFNA 5IR1B 2CXGA 4Z5RB 5I17B 2EDDA 1JPGA 4JM2A 4WUUD 5E8PA 4RWYH 5T5NF 1QLRB 1ZVSB 4M1CC 5HVFB 5KBNC 5FA4B 3QEUB 3HLAB 3FB7B 1T22A 3U1SH 3KJ6L 1MHCA 4PBWD 4PRID 4YAQB 5MENA 4JZJC 4ZUVB 2XTJC 4G9DA 1DSFL 4JPKH 2YK1H 3MGOA 3BP4B 5KVEL 2QQNH 4JN2A 2Z8WC 5CP7B 3V6ZB 1T5XB 3DURB 4RWHA 1XGPB 4GRMA 5IR1A 3LKOB 4AIZA 2FBOJ 3GDBA 5B39B 4A6YB 1HYSD 4I77H 4H1LB 4Z5RA 2ZNWA 5I17A 3WFHB 1QLRA 5ISZD 1ZVSA 4WW2C 3PWVB 1AI1H 4KAQL 5FA4A 3QEUA 1BMGA 1FSKB 3HLAA 4M62H 3NN8A 4FFZL 4H20H 4PJCB 4YAQA 2BFVL 4JQVA 4ZUVA 1KJ2B 5C08B 3OJDB 5T33H 4O4YL 3E6HB 3BP4A 2FEEI 2I26N 3O0RL 4BSVB 5CP7A 3V6ZA 1T5XA 4NP4H 3DURA 4TVPH 1XGPA 2ZKHH 3CLEH 3LKOA 4R8WL 3OGCB 5B39A 4UOJA 3CFCH 4H1LA 4OFYD 2NY6B 1F3RB 3WFHA 3T1FB 1U9KA 3JV0A 3NCJL 1MCNA 3PWVA 3RBSA 2A6KB 3IYLW 2W9EL 1K9TA 3QO0B 5SX4I 2EH8H 4MQXC 4F57H 3O6KL 4PJCA 1TPXC 3F12B 4H0HB 1KJ2A 5C08A 4GUPB 3OJDA 3F7RA 4MLSA 3E6HA 5EZJB 2VZVA 1QSFB 2UUDH 3TJHC 1LO3H 2BVQB 1CE1H 1XR9B 2MKLC 3OG4B 1EFXD 1WTGT 4NUGL 3OGCA 1OLZA 3EGSB 4LFHG 2VJXA 1H3GA 4WI4A 5C3TA 4DZBB 2NXYC 1CQYA 1KV3A 3P11L 3OQ3B 2A6KA 3QPQD 1NCWL 3QB7C 2D7OA 3QO0A 4ELMA 2RCSL 2VZ3A 5GGQL 3W39A 3F12A 1J9CT 1XGYH 4GUPA 3V7AG 2I9LB 1TFHA 5IMLB 5EZJA 1HHHB 2EIZB 2BVQA 1XR9A 2K3TA 3LMJL 2ZG1A 3HI6H 4GKZB 1MRCL 3ARZA 3EGSA 1JNLH 1QRNB 4D9QE 4DZBA 2HFGH 4OLEA 4KHXH 3OAZK 1NMAL 4JKMA 2A9ML 2VDLH 2X7LB 2F54B 4MA8L 3ZTNH 5CFHA 2VAAB 5C70A 3BN9D 3ZE2E 2MCPH 4ELKB 3ZKND 2I9LA 4PGEB 1HHHA 4JKLA 2EIZA 4JO4L 1BF8A 4B7IA 4GKZA 5EA0L 4K3DL 4OGXH 1QRNA 3T2OA 1CD8A 4NKMB 3IKCB 4P4KC 3R8BB 4FZ8H 4M48H 1GC1C 4K3EH 1MCCA 4B7LA 4OLVL 2F54A 4Z0BH 3VXNB 2VAAA 4HUXB 1MFDL 4R3SB 1VHPA 4X6CF 4LARH 4UU9B 4NKDB 4ELKA 3BHBB 5J7CC 4PGEA 4QRSB 3VXSE 4CGTA 3C8KB 4YHIB 2DBJA 5B3JF 2Q3AA 1N59B 2LU4A 4LMQE 3MODH 4WGVB 1RUML 4NKMA 3RVVD 5K59E 5K9JH 3IKCA 4OLZH 4YNYB 1CDBA 4TOYL 2JB5H 1MEXL 5GS0H 1KTLB 4QY8B 4KV5E 4NC1C 3O2DL 3O9WC 2PW2B 2FIRT 3FZUD 4HUXA 2QHRH 4R3SA 2Q86B 4YC2C 1YY9D 2JJSA 2XTJE 2LVEA 3OKYA 3KPSE 4UU9A 4NKDA 1A6UH 3BHBA 4DAGL 4QRSA 3SE4C 4X8JB 3QG7H 3C8KA 4TTGA 5C9JB 1AQKH 2WBJC 1OAZL 4YHIA 4XCNB 3NACL 4N1EA 1ADQH 2BMKB 3EO9L 4BUHA 2BNRD 5FYLD 1DEDA 2F5AH 1MHPL 1N59A 3ZZ1A 5A2KH 5C0AB 1I7ZB 5IJKC 3LV3B 4U1HB 3QISA 2ZNXA 4LAJH 4YNYA 3CVHB 1GVIA 2P24B 1KTLA 4QY8A 1KTDB 2PW2A 5EOCL 2Q86A 4Y5YB 5E56A 1L9MA 4CL7A 3IDNB 1KIPB 2FHBA 4X8JA 3EJYC 4M03A 5C9JA 5A2JH 3NH7H 4XCNA 3FONB 4KRPD 2BMKA 4NNPL 2P5ED 2FLBT 3C5ZB 5GRUH 2CK0H 5C0AA 1I7ZA 3LV3A 1U8LB 4U1HA 4KDVA 2ESVE 2CQVA 3GIVB 4PJBE 4LASL 3CVHA 2P24A 5DA0B 2ZCLH 4PJ9C 1I8KB 1FORH 1KTDA 4G8FB 2MQCA 4JRXE 4RBPK 4HXBH 4Y5YA 4JFDB 4XVJH 2JCCB 1KIPA 3GI8H 4KJWC 4TSAH 4DQOH 4NM4H 1AKJB 2E27H 1FZOB 2APFA 4NSKB 3FT4B 3FONA 2XZQL 1CR9H 3C5ZA 5I8KH 2P5WB 1MCDA 5E8NA 1U8LA 1DQQB 1EEQA 3GJFB 3GIVA 4RGND 5J12B 1I8KA 4K2UL 2AKRB 2OM5A 4G8FA 2NY2D 5GRJH 1ZT7B 2MQ3A 3WV0A 4CVZB 1GOGA 4JFDA 2IANE 7FABH 2JCCA 2DKUA 2EDHA 4YGAB 1PBYA 3V5HB 4LAQH 5EPMB 1ITCA 1AKJA 3UTSD 3RVUC 1QZ1A 1HSBB 2Y72A 1FZOA 4CMMB 1YDPB 1LD9A 2VQUA 3GBML 4NSKA 4NRZB 3FT4A 5T3ZL 4QXWA 1JI1A 1RU9L 3BSZH 1RUAL 1I1FB 1HXMB 2A74B 2P5WA 3HNTL 4UIKH 2IAMD 1DQQA 1D9KC 3GJFA 4LSVH 2GJ6D 2FZ3B 4Z7NE 1BIIB 1FIEA 2EDWA 4WI9A 1GAFH 2AKRA 1ZT7A 4JHZA 4CVZA 1MJUL 1JYVA 5EDXA 4CDGC 4MVBC 4URTB 2DBLL 1Q9LB 3WO4B 2DLEA 1JNJA 3V5HA 1CLZL 1MCWW 4L4JA 5EPMA 1H3UA 1DBBL 2VITB 1HSBA 4CMMA 1YDPA 4NRZA 5EU7C 5DUBB 1FGVL 1FYTE 3QPXL 4JCLA 3QIBC 5E00B 3ZSTA 1I1FA 1HXMA 2A74A 4NWTH 4JLRB 3CSBA 1MRDL 3IFOB 3LB6D 1BIIA 1RZGB 4W4NA 2Y07H 5HGHB 3AUVA 4X5LA 1IM3B 5EC2B 3U4BL 3VXRE 4HF5L 1Q9LA 2EEDA 4LHUA 3VGGA 1GSMA 4Q7DA 5CMAB 4PJXA 4Z7UE 4G3YH 2VITA 2HT4C 1KPVB 1OT2A 3DYOA 4NQDB 4Y19B 4YWGL 3WN5C 5FKAB 1RUPH 3GB7B 4FQ2L 2QLVB 3SE8H 1DLHB 5DUBA 5E00A 5ID0B 4E41B 2PF6A 1CFNB 5DD0H 4IJ3C 2K7QA 5FO7B 2CKBH 3IFOA 5FGCE 3PGDB 1UKQA 1RZGA 2NY5L 4M5ZH 4GS7B 5HGHA 3HC4H 4I2XE 2HA1A 3W81A 1IM3A 5EC2A 3ZMRA 1IGFH 4WI3A 5D5ME 5CMAA 4TUJB 5AWNH 4KUCD 1KPVA 5IK3B 4NQDA 3ECBB 4Y19A 5FKAA 5D7JC 3GB7A 1NGQH 1YEJL 1DVFB 1DLHA 3WJLA 5ID0A 4P23B 1F4WH 4E41A 4J8RB 4U7SA 5MHSE 1CFNA 4I3GA 3HAEB 4OZHF 1YYML 3PGDA 4AEFA 2VZOA 5IBLD 5JQ6L 4R2GC 3FQUB 3QNXA 2X1OA 1CWVA 3WLWD 4TUJA 2X09A 3V7MA 3P4NB 5IK3A 3ECBA 1CS6A 1V7ML 1DVFA 3BGAA 1XF5B 4PUBL 3WXWH 4P23A 4J8RA 1F3DH 3HAEA 1X5YA 3P2TA 2YUXA 5T5FH 4NKOB 4JJ5A 3FQUA 4OFIA 2Z9TA 4YBHA 2FH6A 1YEEH 2R0KL 2F58H 1FG2B 3BWUC 3NAAH 4DTGL 4GAJH 4WEBH 5HI3D 1FZKB 5I66B 4K3HA 3P4NA 2F74B 1NAKL 3ZYJA 5F44A 3U4EB 4R4NC 1XF5A 3BDYL 2YC1B 4PJHF 2V2WA 4NN7C 5ICXB 4YPJA 1JK8B 5KSBB 2F8VA 4YZFE 1MHHB 4NKOA 3K2UL 4OGAC 4XTRC 1NCAH 1SBBA 4H5SB 5CP3H 1FPTL 3RTQB 3V79C 2BHUA 2XN9E 4L3CA 1FG2A 1CGXA 5E2TL 1OTSC 1QLFB 1RJCA 3K81A 4K8RC 1FZKA 5I66A 2VLRD 2F74A 4YDKH 3VGAC 3GHBL 3U4EA 4RAVB 15C8H 3QUZD 2W07A 1G9NL 4DN3H 3Q2CA 1YJDH 1GOHA 2YC1A 1MFCH 3OKEB 5DD3L 5DURB 3HE6D 5ICXA 4X7SH 1LO0H 1JK8A 5KSBA 1QBML 1MHHA 1QFHA 4G6FB 1Q9OB 4JO3L 2HAZA 4H5SA 4OI7A 1T7ZA 1DANU 5E9DB 3FRPG 4OUOA 4LNVA 4KI1A 1QLFA 4BQ6A 1R3JB 2DTSA 1ZSDB 1B6UA 4PJGF 1IAMA 3PWPD 3S35L 2V5YA 4RAVA 3WLBB 5I76B 4YHOL 4AZ8A 3OKEA 4YDJB 4HG4J 2VXQL 2CRIA 1BEYH 2W0FB 3EZJB 1E4JA 1Q9OA 4XVSH 1TTGA 1AE6H 3CDGB 4FFVC 2OZ4H 1ZHNB 1IC5L 5E9DA 4DGYH 1YMHB 1REIA 1R3JA 2VZ1A 3G5ZB 5IVOA 2A6DB 2VUOA 1A1MB 1MIEH 3VWKB 2R29L 3O6FC 1ZSDA 3MV9D 4HWBL 2FECL 3WLBA 3HE7D 4JGMA 3RX7A 5I76A 1P7QB 3FAXA 5IB5B 5DDHB 4GLRH 1RHHB 4IIQC 1LGVA 5BVJB 4YDJA 2H2SD 2AXGB 2YD5A 5FYJH 3IB4A 2W0FA 2PETA 1N6QL 1C1EL 5AUMA 2BX5A 3VI4E 3GZKA 5GS2H 3CDGA 3L7EB 1FGNH 4QXUL 5I73B 1ZHNA 1YMHA 3VU2A 4LU5L 1C5CH 2OR9H 3LRSB 2DM2A 3G5ZA 3REVB 2A6DA 3OAUH 3VWKA 1R5WB 2GITB 2NTFB 4WENB 1P7QA 1UA6H 5IB5A 5DDHA 1BIHA 1X4YA 2W60B 1RHHA 3ZYZA 5BVJA 5I1LB 2AXGA 3TEUA 1DL7H 5L2KE 2Y5EA 3GSOB 2HH0H 3NCYS 5CBEB 2R2BB 3QRGL 5HVHC 3KJ4B 3M8OH 5DVNA 1IM9B 1FE8H 4QRTB 3UZVB 3PQYD 3LRSA 4LOUD 5JXAH 3FKUS 3ESVF 1AXIB 3AU1B 1JTTA 1R5WA 3PXJA 2E8YA 4Y5VC 3PV6B 5EBMA 4GG6E 2GITA 2NTFA 2BSTB 1TDQA 3ARRA 3HB3C 3AGVA 5L8JB 4M8VA 5HY9B 5HD8C 2W60A 1FNHA 5JPMB 2VL5B 5F89B 5I1LA 3SGDI 5DRZB 4XGZB 4E42B 2VXVH 1JNNH 1IAII 3GSOA 1J8HB 4HDIB 4HK3N 3LQAH 5CBEA 4BFGA 2R2BA 3HKFA 3TVMC 4ZXBC 1IM9A 4QRTA 4GSDH 4J3SA 4NWUL 4HWNA 3AU1A 1OHQA 3PV6A 1ND0B 2E7LA 2NLJB 2BSTA 5HY9A 3H3PH 2UZXB 5JMOC 5JPMA 4PB9L 2VL5A 5F89A 2VISB 5DRZA 4XGZA 5IHUL 2XXMB 4IOIB 4P2OB 4PLKC 3MJGX 1J8HA 4NKQB 3RWGB 4HDIA 4XH2B 5E1HB 1RIVH 1T03H 3L7FB 3QAZB 4R6UA 2MOVA 5D7KE 2B8OT 1ND0A 2NLJA 3T77B 4YPGB 3NBNA 3LEXB 3RIFF 5TF1H 2VISA 4FG6C 4IOIA 4P2OA 1S5IH 1Z9SA 1IBGL 3JWDC 1UG9A 4GRWE 1EHLH 4XH2A 4UT9L 1K3IA 1Z0MA 1A3QA 2Y36L 4B0MM 5ADOL 4XP4L 2GK2A 2VLMD 5CGYD 2VLJE 3L7FA 1UKSA 1YEFL 3JV4B 4RX4D 4CNIB 43C9B 4OLWH 1WLHA 4YDIH 3L5WB 4JE4B 3T77A 1W2KT 3GSUB 4YPGA 3LEXA 1IKFH 3G6JF 1I8MB 5J6GA 2O5YL 5FHAL 2F53E 4KHTH 1A0QL 4OGYL 3MRBB 3ZHLA 5ALBH 4D0CB 2QADB 4MNHB 1CF8H 3ALWA 3QQ3B 3D39E 4M6OH 3G04A 5HGBB 4XNQB 4OIAA 3JV4A 5TE4L 4CNIA 1HYSC 1U42A 43C9A 4OF6A 3L5WA 3GHEH 4PB0L 5H8DA 3GSUA 4UDUB 1I8MA 3MUY1 3TZVB 1MAMH 4HJ0D 4AQ1B 5E4EC 3VMPA 2P48B 3ZT5A 5BV7H 1QUNA 3MRBA 4EXKA 4P9ML 3QUXB 3D9AH 2FHFA 3UTPD 4NBYB 5HVGB 4GH7B 5DHYA 3SOBH 4LFHD 5JIHA 4D0CA 1DBAH 5JW3L 3UPCA 1G9MH 4MNHA 5HGBA 4XNQA 2QBWA 3TO2B 3INUL 4YR6B 5MP6L 4M5YL 1UH3A 5I8OH 1DP0A 2DQTH 3W11D 3PG2A 2HWZH 5EZOL 1A7NH 1WK0A 5IGXH 4YHLH 3TZVA 4X6BB 4IDLA 4P4RB 5TFSL 4L9LC 4TSBH 3QUXA 5AG9A 3GSWA 1GGBL 2B1AH 3X3GH 2OTUB 1LE9B 3MLXH 4M93B 4HMDA 1JPSL 4OCSH 3WFCH 3TO2A 2NZIA 4YR6A 1NUNB 4LSTL 2J8UF 5FCUH 4Q0XH 5JDJA 4G9FE 1OLLA 1OQOA 5I18L 2FX8H 4HX1B 4K9EC 4HSQA 4X6BA 3QPQC 3U0TA 4P4RA 1M7DB 1W72A 4NFDA 4JZOB 3KYAA 5D1XD 3STZB 1UCTA 5GGRB 3UYRH 1LE9A 2OTUA 3TFKD 3ABZA 4WVRA 3HNVL 1V05A 3SKOB 5JIIA 3OWEA 4WFED 3H3BC 5HHOD 1F45A 2A38A 4ELMF 4H8WH 1MH5B 4NQCE 2HKFL 5F7EH 4HX1A 3QHFH 3VFMB 2HRPH 3TA3D 1QSZA 2C1PB 2VWEC 4NO5B 2D7PA 1VADB 5FO8B 1M7DA 3WDJA 4LSSH 1KB5H 4AL8L 3BN9C 4JZOA 5A40E 2DS4A 3O6LL 1OAKH 1DQTA 3STZA 5GGRA 3ZKNC 1V7NL 4U3CA 3SQOL 1YJDC 3LS4H 1HIMH 4LRIA 2APVA 4PJDE 4U1NB 1A21A 3ZTJG 4D2NA 4OT1L 4N9GB 5IW1B 3IRPX 4JZJB 5F96H 1F4XH 2XTJB 1MH5A 3SDXE 5I1GH 5I1IL 3KPSB 1U8OA 4ODHH 2RGSA 1OARL 3VXSA 3VFMA 4XMLH 2C1PA 3O4OC 1JMZA 2X89A 4NO5A 3MOBL 5FO8A 1VADA 3PGFL 4XPBH 4HS8H 3S4SB 1IFHL 3QRFM 1QKZL 1RD6A 4FZEL 4WW2B 1LO5B 2R4SL 1MPAH 1DQJB 4U1NA 2QSVA 2VNCA 3Q5YA 1OW0C 3GO1L 4N9GA 3VG0L 5IW1A 4JZJA 4WUUE 3TPKA 3KPSA 5IMMB 3GMLB 5KVFH 3UYOD 4PRIE 3FZUC 1Z3GH 1YY9C 1B0GB 3S4SA 5I1CH 4JFHD 4K7PL 2HMID 3DO7B 3DOSA 2ESVB 4WW2A 1LO5A 2FDBP 3MOAL 4PJBB 3S9DB 1DQJA 1SY6A 2YUWA 4XCCL 4JRXB 1TPXB 1SJEB 1EO5A 3RU8L 2J7LA 4YEEA 3OX8B 5IMMA 2AJYL 3GMLA 4OQTH 2I24N 3UJTL 5F21B 3SKJH 4JFEE 3HUJF 4QT5B 4S1RH 1B0GA 1ONQB 2R0WL 5E99L 2NXYB 5BOPA 3MLRL 1T7WA 3QP3A 5ANME 1BLNB 2ESVA 2D03L 4EBQH 4PJBA 1FNAA 1EBAA 5I1JH 4KRPC 2ZSVB 1M6OB 1IE5A 4JRXA 5C2BH 1K6QH 1UEMA 5C7XL 1SJEA 2IANB 5IQ9A 5JOFB 3OX8A 4HMCA 3DHJA 1VCAA 2ADIB 1DE4A 5HDQL 3NABH 4Y4FD 1IL1B 4IHOB 4WFHD 3FO9B 1KXTB 4Z95L 1B9ZA 1GGIH 4QT5A 2XZAL 1ONQA 5JR1L 5D7SL 4PPTA 4ZTOH 1BLNA 1KN4L 4LP5A 1P4IL 1JN6B 1BVZA 5F7DB 2ZSVA 1M6OA 5GZND 1FP5A 1HQRB 1X5JA 4UOW0 4N8VG 2IANA 1TXKA 5L7XL 2A6JB 5JOFA 5D2NC 2ADIA 3EO1B 1S7TA 5C71A 2N4IA 4RGNC 4UQ3B 1IL1A 2NYYD 4IHOA 3FO9A 4P99A 4X0KB 2NY2C 4U6VH 4Q9QH 1DBJH 1MY7A 1FYTB 3QA3B 4FQPA 5F72S 1FG9C 1PVHA 2XIDA 1JHLH 3IU4H 1OD9A 4P4KB 2HFFB 4LHJB 1QBAA 2VZSA 1JN6A 3RGHA 3B4NA 2A9NH 2FD6H 5F7DA 1D5IL 1B88A 4XPFL 3N1FC 1HQRA 1A9BB 4JFFB 2IAMC 5LWYH 2A6JA 3EO1A 4KKCD 4BZ1L 4LRNH 4TN9A 2VWEE 4UQ3A 1R24B 3BZ4A 3NFSH 4Q74A 1NSNH 4X0KA 4MMZC 1WSST 4XCYB 1FYTA 3QA3A 5F1KC 4MNQD 4X98B 3HR6A 1NCDH 5KZCB 4CN6A 2CGRH 3SN6N 1IILE 4P4KA 2HFFA 2GY5A 1B0RB 4YHKH 3CXDL 4OZ4B 3P9WB 3O9WB 4I2XB 4YC2B 2WQRA 1A9BA 3ARBD 4ONGH 3VXRA 4JFFA 1G6RB 2W9DH 1TJHL 1MREH 5D5MB 3LB6C 1MCIA 3AC0A 2ZUQC 4Z7UA 2WBJB 1R24A 4HC1L 2RAMA 4Y8AA 3AREC 3RJQB 2R9HC 4XCYA 4LLAA 3JWNC 4X98A 3B9VA 3WXVL 4OB5L 1U92B 1LO4H 5LCVH 2ZCHL 1RULL 3QHZL 3SKMB 1B0RA 1LE5B 3PWLB 4OZ4A 3UO1L 1OGTA 2CDFB 3O9WA 4I2XA 5GS1C 3HPLB 2CJUH 3CH1B 3KLSA 5MERB 1G6RA 1TCMA 3Q1SL 4XWGH 5C0BE 4P2QD 1Y6MR 4K7PX 4NHCL 5D5MA 1QA9B 3SE4A 4H88H 4DGIL 1QO3B 2WBJA 4PJXF 4APQC 4AEEA 3C9NB 3MRIB 3P0YL 4NGHL 2DM4A 5IJKA 1U92A 1CFBA 3BW9B 5MEPB 2KPNA 3NFNB 3SKMA 1LE5A 4PJ9B 3PWLA 1BHGA 1E0OB 4S1QL 2CDFA 2BNRE 5FYLE 2F15A 4MNGE 3B2UD 3HG1D 4FXLA 3CH1A 5MERA 5HHXL 2DQDH 2VDPH 4YQXL 1QA9A 2ADFL 1YNKL 3CVIL 1QO3A 3VFVB 1HINH 4WV1C 5IBLC 4L8BB 2Y5TB 3MV11 1JJUA 1MJ7H 3C9NA 3MRIA 3T2NL 3BW9A 5MEPA 2VXSL 2H3NB 3WLWC 5JZ7C 5D7LD 3NFNA 3CX5K 1J8KA 1IAKB 2EE9A 4JFZH 4PJ9A 1IT9H 3TLRA 1WVZA 3WKML 4Y1AE 5FUCE 3CXHJ 4Z8FL 1N7ML 1PEZA 1IAOB 2EXYD 4FP8L 1BVKB 2XN9B 3KYNB 1R3HA 4QO1A 3VFVA 5J9PB 2ADGB 4AEIL 4P3CL 4L8BA 1AO7D 2Y5TA 1F97A 1S3KH 4RDQF 1AJ7L 2YKLL 2IMMA 2H3NA 1D9KB 4L1HA 2V5RA 3HNSL 4JQXC 1UADC 4MJIE 4NC2B 2YD2A 3VW3L 5HI3C 5HPMA 1E4XL 4I5BB 4JG0L 1IAKA 4PD4K 3ZE1E 4OD3H 2CO6B 5TQ0L 4OM0L 1A6AB 2DICA 1D5MB 3KYKH 2D2OA 5CJOL 4U6XB 1IAOA 4XP1L 4ISVB 1BVKA 2XN9A 2R8SH 5D2NE 3KYNA 4DN4H 1NANI 4RGNE 1HHKB 1S8DB 5J9PA 2ADGA 3SCMD 2HVKB 3O8XC 5E70A 5DWUH 4Z7OF 1BWMA 5IBUG 1KELH 4HWEH 2ZJSH 1JPTL 1D9KA 4NT6B 3IKKA 3X11B 2AQ3A 2KQMA 3TWCL 5HGDB 4CVUA 2CUIA 3C2SA 1A6AA 1D5MA 3GKWL 2I5YL 3QUZC 2YPVL 4U6XA 3CX2A 5M94B 4ISVA 5TDPB 2GJ6E 1F58L 1MQ8A 1OP5H 3VD7A 1HHKA 4F37F 1BFVH 1ZGLB 1S8DA 1DLFL 2I07B 3WN5B 2BOBB 1A6ZB 1Q0YH 2HVKA 3M45A 4PJEF 1Z9MA 1QFPA 5CIPH 3QIBA 1J0ZA 1I9RL 4JRYD 4LF3B 4P2CG 1Y6KR 5FXCH 4WUKH 1BJMA 3D18B 4IJ3B 2RHEA 4NT6A 3X11A 4Z78B 3F7QA 5HGDA 5TE7H 3VFSB 4X9HA 1NEZG 3CMOH 3DMMD 4OBRA 5IESH 3AVEA 2ZSWB 4LSRH 4HEME 3VFOB 5FIEA 5EH1A 5TDPA 4EN3D 4X9BA 1ZGLA 2I07A 3WN5A 1A6ZA 1IC4L 3EOTH 4LLWB 1IC7H 5D7JB 3TJEL 5DLMH 3O3DB 1J18A 4MD0B 3A6CL 1IGTB 4LF3A 2AEPH 1CK0L 3D18A 5IFAH 3SHSA 3ULVH 2R2HB 2HFTA 2W59A 4Z78A 2JF1A 5E7FA 2AGJH 1WFTA 5L2KB 2E6JA 4R2GB 3HE7C 2AJZB 5ITBH 2FEDD 2ZSWA 1IEHA 3BI9X 3F6IA 3VFOA 1U8JB 1T7XA 2H2SC 3VGHA 4C56D 1QYGL 3GRWL 4X6DE 2CLZA 4LLWA 2NY3D</