1YEIL

Catalytic antibody d2.3 complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
219
structure length
219
Chain Sequence
DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIHLVSKLDSGVPDRITGSGSGTDFTLKISRVEAADLGVYYCVQGTHFPYTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crossreactivity, efficiency and catalytic specificity of an esterase-like antibody.
pubmed doi rcsb
molecule tags Immune system
molecule keywords PROTEIN (IG ANTIBODY D2.3 (LIGHT CHAIN))
total genus 50
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1998-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yeiL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yeiL01
4YDJB 4U1GB 1KCRH 3H9SE 1PVHA 2DRUA 1A14L 1G7IA 3UTQA 1QBBA 3MA9H 1IEAA 1GGCL 1KEML 5DSCB 2DYPB 5I71B 3U2SA 3GSNL 3DO7B 1B0GB 2IG2L 3EOBB 5E2WH 5FO7A 2PETA 2A77H 4OUUA 1T80A 1BHGA 1U0QA 4G6KL 4H88L 1LDSA 2ESVA 1TMCB 2DN7A 5IB5B 3DX8B 3FFCE 4X5XA 1HIMH 1XFPA 3IDYC 1QLFA 1A6VL 5I8EA 3GSUA 1QFPA 3T8XB 3VD7A 4DOHE 4QHLA 5C3LD 3Q1SH 4N9OB 4PG2A 2CJUH 5IOPA 4M8VA 4JAMA 4PV9B 3VE0A 5DRWB 4N8PA 2X41A 3LN5B 1Q94A 3QJFB 4XPFH 2X4PA 5IWLC 3IAQA 5CP3A 4S1DC 4IBLT 2P8MA 5L2KB 3ARDD 5HGBA 5I18H 5MEPA 5EPMA 4F58L 1Q0YH 3RZCC 5KOVC 1FFQA 5CIPB 5KVFL 1NEZG 1YMMD 4H25B 2IANE 2SEBA 2F54D 4JFZH 4ZFZB 1ZGLA 3FRPG 4FA8A 1JYNA 4KK6C 4N8VG 3CZFB 2QHRH 1AD0B 5T1KA 2HFEB 2CIIB 5J1SC 3EOAA 4J4PA 4TQEH 4GJTB 3MLWL 2XFXB 3CK0H 1P1ZA 3AREA 3VXRE 4ONGH 2QADC 4QWWC 1SY6A 4K71B 4QKXB 5A16B 2ZJSL 4QHMB 3EYVA 2YPLE 4TOYL 3OJVC 3O11A 3PWLA 1E4WL 3SBWA 4XNUH 3BGFB 4JN1H 4R7DB 3NIDF 4U0RB 2PN5A 2Q86B 1N5AA 5KTEL 5DR5H 2X05A 1LO2L 1QR1B 5FDWB 2ERJB 4I77L 2EXYC 1EHLH 2GFBB 4N0YH 2E7MA 1Y18B 1MCPL 2A6IB 3H7LA 5L2KD 1FNHA 3RZWA 4PRHE 5KG9A 2GW5A 1X5KA 5INDA 2BMKA 1IL1B 5GS1B 4K07A 3ILQD 4P3DB 4XPHL 2B7DT 4NM4L 5EIIA 1FGVL 3BP5A 2A6JA 5I19L 1UVQA 1EERB 4PV9A 4U05A 2Q8AL 4EDXB 43C9A 4WVRA 5D1XB 3QSKB 3D25A 2HAZA 2K7QA 3VXTA 3DGGB 4BH8A 3T2NL 4I3SH 3FB7B 4LARH 1Z5LA 3PP3K 4CADB 1KCKA 3MLUH 1TVDA 3WD5H 1X5LA 4DK3A 1MCPH 4ZD3H 1WAAE 5DDHA 4QOKE 4WO4A 4LFHG 3H0TB 4O4YH 3SQBA 1GYAA 2B1HL 3TJHD 2MSPA 4V1DA 4F37K 4GW1A 3KJ6H 1A6UH 1MJJB 4WU5A 2VAJA 1UWEH 3NIGE 5F8QC 3K4DA 5C0CE 3SE9L 5EU6B 4HFWB 2XWJB 3OAUL 1CXKA 4OKVA 2BSRA 4BFEA 3OR7A 3MRJB 5CGYD 3P0VL 4EI5B 3PNWB 3KNBB 1DSFL 4G9FD 2HMIC 4XVSL 2G2RA 3V6ZB 4WO4B 2HFFA 4LDEB 5EBLB 5FA3B 1ZE3C 1U8LB 3X11A 1IM9D 4ZXBC 4GLRI 4OUOA 4PJFA 4S1RL 1C7TA 5ITBL 5C0EB 4HUXB 4OFYD 5C71A 2ZG1A 5MEND 5KANG 1J0HA 4NN5B 4PRBB 1KPRB 4X4ME 2ZOLA 3CZFA 4XWOD 5I1GL 2E7BA 3QDHA 4OGYL 5JHDD 4LIQL 1QBLL 3E2HC 4G80A 1Z9LA 3V79C 3BEVA 1CDYA 2WW8A 4L1HA 3C09C 4JFEA 5GS0D 4CL7A 1WZ1H 3U30B 1MEXL 1FVDB 4EIGB 2NXZD 4FOMA 4I13B 1R24B 2G75A 1LO4H 3FO2B 5M7QA 3NCFB 4MB3A 4ZNEE 3MRRA 4R26H 1TCMA 3FMGH 5F9AC 2F74B 2FH6A 4K94C 3BZFA 5DURB 3FFCB 5FM4A 1J8HB 3QO0B 1H3UA 4MJ2A 4I8DA 4G80B 5F6IB 1OSZB 3NFNA 1YEHH 1RD6A 4XPGH 3BVNA 4FQHB 3TWCL 4UNUA 5DUMH 2FATH 3VFTA 4JO4L 4MNQB 1HINL 1S7QA 5DJ6B 4A2MA 3FCTB 2GTZB 4OGYH 5E8OB 3QO0A 4XI5C 1G7MB 1NMCB 1M4KA 5D1ZD 4LCWA 3BZFB 2ADIA 5D7LA 4PRPE 3CFIC 4GMTH 1H3XA 1QFHA 4KK5D 4K7FB 4JY5H 4NHUA 3N1MC 2EIZA 3OKMB 3QXAA 1CDJA 4XHJC 4JY6B 1N6VA 2GTZA 3KYNB 2OXHA 5C2BH 4P2OC 3MGTA 3O2DL 3CVHB 3NPSC 4KPHL 2P8PA 4JKMA 1KPUA 5ID0A 3U83A 1M7XA 4R4BA 4TTGA 4FZEL 1F8TL 3TWCH 4EVNB 5ICXB 1FGNL 4ONHA 2APXA 1TZIB 2DWEB 4UUJA 3WO4C 1JWUB 3V4UL 2C3HA 4X5WA 4LPYA 3FONA 4EUPA 4F7EB 1YNLH 1ZAGA 3BDYL 1R3LA 5IF0A 3LRSA 4M02A 2KQMA 5HGHA 3DUSB 2ZNWA 3FO1B 1ZTXH 2AJUH 1FRGL 1T83A 4I2XA 1YQVL 1UB6B 3BD3A 5C0IA 1OAXH 1ZHLA 3WKMH 2FD6H 4UNVA 2YKLL 4NDMB 1V3JA 3WDJA 3BKCH 2F53D 4G7YH 3JTTB 1S5IL 2X4RA 1Z9SA 2AEPH 5DQ9A 3VFPA 4Z5RA 1YQ2A 4I2XB 1KTLB 4M61A 5E03A 2OTPA 1L6ZA 3O3BB 3SO3B 1VERA 3QAZC 3CCHB 1IAKA 4G8FA 4QHKJ 3QQNA 1HSBA 3SY0A 1J18A 3CUPB 3G5VA 3TH4T 2OMNA 4N0UE 2IANB 3N9GH 1IQWH 3SGDI 3KG5A 3VD5A 2J6EH 1DBKL 3LEXB 4OF0A 4HMDA 5J3HD 4HH9A 2FD6L 3GJFA 4YDVB 4I3GA 1UM4H 5DUBA 4DK6A 4P2RE 4XH2A 5FO8B 3BPOC 3QNZB 4HQQH 1UG9A 4U1JB 2YUZA 3P4NA 1GH7A 4Z8FH 4NQDD 4DJMA 1CBVH 3GKWL 2P5ED 3NN8A 4HIEB 4DN4H 1XF5A 4ELME 5L2JA 3MRMA 2YD7A 2JK5A 3D0LB 3FT4B 2YN5A 5ITFB 1EEYB 1ZHKA 4CUCA 5LGHH 3O6LL 4F7EA 4LRNL 4QRRD 5T1LB 1CXHA 3QJHB 1HDMA 1JPSL 2HJLA 1X5GA 3ALXA 3U46A 4XP6H 4WNQA 3Q6GH 3FB6A 4RFEB 2EDXA 5T5NF 4UDTB 1A7QL 1UH3A 4JFDB 1AIFB 3NCEB 4NQSA 5HYSG 2H8PA 5C0DB 1QZ1A 1U3JA 1GL4B 3MOQA 2D4FA 5K9KA 1UWXK 4MXQC 3GIVA 1MCWM 1TPXC 4ODTH 1PQZB 4ZNEA 1EEYA 3PHOA 2X4QA 1IGML 4P2QE 2GT9B 4OCYH 5FYKH 4Q6IB 4A6YL 1G7JB 1U8KB 1MHCB 5E94A 4PR5A 4M6OL 3IGAB 1Y0LA 1KCLA 1M7IA 4D0DB 2E9WA 2ZKHL 4Z7WB 5KAQG 1VFOA 3MCLH 5D7IA 3TJEH 4LSTH 5CBEB 5F8RC 4KQ3H 3RTQA 2OL3A 5F3BA 4DVBB 2NZ9C 5FM5M 3VDAA 3GK8L 1UZ8B 4HV8B 4J3WA 3BW9B 2YD8A 3GJFB 3SKJH 1NEZA 4RFOH 1PFCA 3DVGB 3RWEB 2X4OB 3MLXH 4CN1A 2X10A 2QR0B 3PV7A 1PKQA 2OZ4A 2ARJB 4ORGA 1FHGA 4L4TB 1NGQL 2RJMA 3VXNB 4M7KH 5ANMA 4WW2C 4HV8A 4ONFL 5EU6E 5KANI 1UZ6E 1T1ZB 4ODSL 2MPAH 2E9BA 1B4JL 2ORBH 1WTLA 1ZEAL 3EHBC 3WS6C 4HUNB 4M7LL 2J6EL 1RZIB 4OQTA 4HKZA 3U2SB 3QUZB 1AD9B 1GC1C 4WEBH 2B1AH 2ZPKL 3GMLB 4O2FA 4LKCA 1UGNA 4UT9H 1B6DA 4RMSA 4AEEA 4DUXA 4KTEH 3IF1A 5D7LD 1NL0L 4Y5VB 3KPSA 5EOTB 4HC1L 5F7DA 4YAQB 3W2DL 4PJIA 3PXJA 3MZGB 1VADB 4NGHL 5TGBB 5CSZB 3MREA 1CU4L 1DUYA 2DLGA 1S3KH 1QYGL 5J1AB 1U8OA 1G9MC 5T33H 3WHXB 2ICWJ 2VXVL 1YMME 4GQ9L 2EH7H 5CUSH 3Q5TA 5DFVC 4YBHA 2ZUTA 3P77A 1J10A 2OZ4L 3G04B 1AGFB 3LRGA 1DUZB 2CRIA 2PW2B 4RGMC 4GKSA 2YRZA 2VSCA 4JPVH 1WZMA 1RJYA 4OCXH 3RHWK 1BBDH 3L9RA 5EO0B 4KK5C 3BKML 3IJHB 4BH7B 3VGHA 4W4NA 2A1WL 5GGSB 3AVEA 5IHUL 4K8RH 3B43A 2YPLD 3QPXL 4PLKD 3TGXA 3TBVA 1NSNH 4ZPTB 4LPUA 4P2RD 4KJPD 4Y1AE 4PJGA 5GQBA 3V5KA 1U8MA 3UZVB 1UCBL 2EYTB 2WM0A 4FNLH 5ETUA 2D7PA 3S5LB 3CH1B 5JW3L 5F70A 3A67L 1XCTB 3WN5A 4D0CA 4NO0B 3I2CH 3MLRL 1I7UA 1B2WH 4F7MA 4Z0XA 5AZEH 3C9NB 1ZLUK 3SJVB 3KPMB 4KROC 5C08E 4JPKL 1NGXB 2ZUXA 4HJGA 1A6TA 3B8YA 1A6AB 1A3RH 4OCNC 1I85A 1FC2D 1ZK9A 2R4SH 1ZGLB 5I0DA 2VAAB 3U9UA 3GBMH 2AJSH 2RFXA 4TULL 5ECJE 4FABL 1B0GA 2FJHB 1YEGL 2DLFL 5GS1C 3ZDYE 3X3GL 1CL7H 1KB5L 1HH6A 1YA5A 4LSVL 3STZB 4H26B 3G6DH 2Y06H 4KC3B 3TVMD 1CD0A 4PLKC 3DUHA 2QKIB 3CU1A 3EFFB 5DMYA 5IB2B 4QXTA 1XCQA 2YPKB 4XVJL 5CEZD 1LO4L 1X44A 4JFHD 5DFTA 2Z31C 4R2GB 2Y5TB 3QQ3B 5FEBA 1R5IB 5IMOA 3H0TA 2DLEA 1HKFA 3FQXA 4ZD3L 5GGRA 2L4OA 2IFFL 3I3EA 1HHJB 5T1MB 5AG8A 1JZ6A 1DQJA 2YPKA 5FUOL 3T2OA 1MI5B 4FQXB 5CGTA 4FQ2H 5F1OB 2NY4B 3A6OA 1IEAB 4PLOB 5DSCA 3WFHA 1KEGL 1QSZA 5HPOA 2RCSL 2VNCA 1S7SA 1QSED 1UJ3C 1NDMB 4KJYA 4PJ9A 3KPQA 3WFDH 3FO9A 5EZJB 1I1AB 2FYYB 5JXEA 1CE6A 3Q5YA 4G7VH 4UB0H 3MCG1 3ARGD 4JY5L 4FQJH 5D1XD 1ZSDA 1KLUA 2VXTH 4NM8H 1NKOA 1YUHB 3NABH 1U91B 2DIBA 2BNRB 2HG5A 3BD5A 5IB4A 3UYOD 3AUVA 3HE7C 5FOBA 2GSGB 3D3VA 4EDWH 4R0LB 2IBBA 3X12B 4LVNC 5E8NB 4J8RA 2KZWA 1FYTA 5DHVA 3VCLB 3GMPB 1FGNH 3QDJA 1ZA6B 1F4WH 1JHKL 5F89B 1T20A 4NRZB 1R3JA 1GZPA 1LDPL 1Y6NR 4KVCH 1D5ZA 4TYUA 1V3MA 4KRMB 4DQOH 3L3HA 1LEIA 2Z93A 3T2NH 5BQ7B 5DVOA 1AGEA 5D2NE 1MAKA 5LAXA 1KCUL 4YWGL 3ARXA 1HZHL 1AD0A 3SJVD 2HRPH 2VLKB 4MA7H 1KTDB 5I16B 3SDAC 4AMKL 3ROLA 5CEXA 5JXED 3HPJB 4MVBC 3CC5A 3EOTL 1CLYH 2QL1A 1JFQL 3C9NA 1MWAH 1MNUH 5DJ6A 5BS0B 5B21A 4JO4H 3UDWA 3GO1H 1MFEL 3O11B 4XBGA 5DMKA 1SHMA 1AH1A 4X7SH 2AEQH 4Z7WE 1DSFH 1J1PL 2DMCA 1TJIL 2X89D 5DEGB 3QULB 4X5LA 2YWYA 4WO4D 5T3ZH 4ZOBA 4I1NB 4N9GB 4H26A 3V7AG 3RWIB 5SWQB 2AXFA 1U8JB 1UM6H 2X7LA 2QHLA 4ESKA 3RL2B 4KJPC 4WHTB 3MYZA 1J8HD 1A5FL 3MBEC 2Q20A 2BY0A 5LWYL 4HFWA 2DQDL 1D5MB 1R5WA 1FYTD 2VDNL 1BJ1H 5K59E 2EXYD 1BEYH 5C92A 3GSNB 3SGJA 2VISA 3HUJB 4X9HA 3LKRB 5F96H 4M8QA 3WDIA 3GMPA 2J12B 2HTLC 2YSSA 4F33A 4MAYC 3QQ9D 5I1KH 2A0LC 3BAEL 1R3JB 5I17B 4GBXA 2DKSA 1JGUL 3H6JA 4MSWB 1JNLL 4C56E 5FM5O 2EDYA 4LNRA 4HPYL 3D9AH 1XH3B 3WS3A 4DVRL 3ZKND 2PYED 3VFMA 2JJUA 1C5DB 5TE6L 3V5HA 5HHOB 3WKML 3DJ9A 5C9KA 3RFZC 3U4BL 4WCYH 4KRLB 4RRPG 4KH2A 4NHCH 3TVMB 1P5UA 4GRMA 1NCCH 4W4OA 2EH8L 2XWBB 4OKVB 1CGVA 5GRUL 1UWGL 5BVPH 3JZ7A 4IMLB 4X0KB 4J23A 1T7VA 5F88A 5ACLA 4PS4L 4PJCB 1BP3B 2VL4A 2OR7A 4MJID 4NKMB 5JXAL 2VLJA 5DJXB 5AD0A 5K59F 4LU5H 4X5WB 5IF0B 4HUXA 4XGZB 4X8JB 9CGTA 1IKNC 3MCLL 3TJEL 1FDLH 1P7KA 1WCBA 1J05B 3SDDC 3TN0B 4LHUA 5IIEA 3KWWB 4HGWA 3FCTA 3C5ZD 4Z77A 1NGYB 2X70A 2HJKB 1UB5A 1S7VA 3TBWB 4GXVH 3HMXL 4K3HA 4V2BA 4WHYH 5DRNA 5IP4A 5KVDH 3FN9A 4LCUA 3MRMB 4X9FA 5TH2A 2FJFA 3B5HA 2EIZB 4Y7MA 5GGVH 1X7QB 1N4XL 5C0AB 4XPFL 3IDXH 4U2YA 1RSFA 5JLZA 1HN1A 3O45B 1T1XA 3VFSA 5ESQA 2MCG1 4KQ4H 4DUVA 3NOIA 3BEWA 2GK0B 3ARBB 3LMJL 4NQED 4ELMB 1DFBH 3ZT5A 3PXHA 4BSWA 5DUML 3MLVL 1TZIA 4N0FB 5JDJA 1U41A 4U1MB 3W9EB 2EEAA 4MNQA 2DLHA 1F6LL 5EIVA 3V2AR 5LBSH 1S7TB 1DANT 3V8OA 2YC1B 1I8KB 1I8LC 1MF2L 2G9HB 4OFPA 2G5BB 1A1NB 3BPCA 4ZYKB 1S7RA 3DUUB 3RDTD 15C8H 2EECA 1S3KL 1NANI 3W9EA 4NQXA 1ZHBB 1TITA 3UBXA 3WNPA 5IHLB 3V0VB 4APQA 2FCBA 1XF5B 2DYPD 2EO1A 4P59L 4DW2H 5IG7A 3BISA 1S9YB 3ZYZA 1V8HA 3CDCA 2NY3B 2Y7QA 2Z8WC 5JQ6H 2G5BA 3OB0H 5DTFB 5ESAB 3BO8B 5CEYB 4Y16C 3QNXA 2PKDA 1NLBH 3QCUH 1G7PA 4FMKA 2YD6A 3GKWH 3OHXB 2AAVA 4LSPH 1MY5A 1OPGH 2H8PB 3BH9B 4KK6D 3DMMD 1R3LB 3GSVA 3G5VB 1UB5B 1RZ8A 3C2AH 2VLLA 3V6FB 2VXSL 4XHQA 1JZ3A 2DIJA 2XYCA 4LU5L 3SDCB 1TZGH 4IJ3C 12E8H 4LSRL 2H3NB 4O9HL 5EUOB 1BVLB 1QFUL 5IVXF 2IALB 1ZGLP 3QIWC 1FFNA 2IC2A 5EBWB 4A6YB 1W0WB 2NW2B 3IS1X 4M9PA 3QCUL 2AJUL 3L5XL 1GOGA 5DYOB 2NY5H 1RHFA 5F9OL 2GJJA 2VXQH 1I7ZB 2DL2A 4DVBA 4U1NA 3T3MF 4JDVA 1X5ZA 32C2B 1FNEB 2BXYA 3BN9D 2ZCHL 3QDJE 2HFGH 1FZOA 3BZEA 3D2UA 1N59A 2WUCL 2ZP0T 1MVFA 3PJSA 5IKCA 5L8KB 1N26A 2H41A 2HJFB 1TETH 2QR0A 4A6YA 3T77B 1JHTA 1DQTA 3VFOB 1YEKH 1I8MA 5KZCB 5E1AB 1L7TH 3VXSB 1C16B 1YMHB 4QYOB 1JPST 4MDIA 3GSUB 1MREH 3UJIL 4JE4B 1ULVA 5KSBE 2VABA 4L3CB 4OFDA 5DR5L 4GG6F 5F9OH 1JYVA 4KZDL 1Q0XL 5B39G 2FBJL 4M6MH 4MGXA 2D31A 3JV0A 5IVXE 3GDBA 5DTFA 5ESAA 4D94A 3MUJA 3QA3A 5J0BA 1MF2H 5E9DA 4AIZB 3QEUA 2KL6A 2A9MH 4OT1L 3L3JA 2WWMD 1N64H 1PY4A 4OFYA 3IAPA 4DGYH 5DS8A 3T4YB 5E8PB 4PGZA 4ELKA 4L3EB 2C3WA 5HBBA 4Y2DA 1J88A 1TJIH 1E6OL 4Z0XB 4R26L 3N1QC 1EO8H 3KPMA 4W4OC 4NQSB 1FORL 4XI5D 4LEXH 1ZT7A 3U7WL 4FTVE 1S9KC 4YHOL 5DO2D 1AHWC 2OK0H 3X13A 2IAMA 4X7EC 2VDOH 3DVFA 2UUDK 4MAUH 3JWOL 5D71H 1PDKA 2D4DA 3GSXB 1D3CA 3VXQB 3BO8A 3MA7B 5CEYA 4OCSH 3T8XA 1LO3H 1AP2A 5CEZE 3C08H 5D2NB 3RGVC 2Q86A 5FCUL 4P3CH 3PV6A 4OI7A 2HVKB 1DQQA 5J7CC 2BHYA 4LKXA 3GRWH 3MQIA 1AE6H 1EDQA 4DQOL 4NKIL 4LLQB 4BSVB 1H8NA 2DM4A 3SGJC 5L2KA 2VLJD 3O9WD 1QEWA 5E8EA 5EPMB 2ADGB 4HKBB 3QIWD 1CFNB 3WNKA 1KELL 4M93C 1ITCA 4DN3H 4MNGE 1SBBA 4RMRA 1D7FA 1JRHL 3O3EB 5HGGS 1MH5B 1JPFB 4J1UB 4OCSL 2E5EA 2XA8H 1QHOA 5T1KB 3AB0B 4KKNA 1AR1D 5C8JB 4X5XB 1CD9B 2N56A 2QQLL 1OGAD 4YIQB 3EO9L 1MRDL 1D6EA 5TQ0H 3VRJB 1DCLA 3VD3A 5A2LH 3U6RA 4MQTB 4G7VL 4UB0L 3KVQA 4HUVA 4J4PD 4U6TA 4AYFA 4PJBF 1RJYB 4MDJA 3UTZA 3OV6A 2Y36L 3ULVH 3SO5A 3GMLA 4C58B 4CVZB 3Q6FB 3T0EC 3GZKA 2NCMA 1A7PL 4JPWL 5B3JE 3AGVA 1EGJA 5SWSD 4JPIB 4ENED 3JTSA 1OARL 4OCWL 3HUJE 1D6EB 3HFMH 4R0LA 3X12A 1T20B 3AS1A 3U6RB 5DQJB 1G6RL 4LAJH 1BEYL 3LEVH 5TQ0L 4NO0D 1K4CB 3WHXA 2Y07L 3CSGA 5DEFB 5IB5A 5IR1B 2YD5A 4MCZB 4JN2B 3RWHA 4JHAL 1UVQB 2VR5A 4G5ZL 2E6PA 4P57A 4I0PB 4XRCB 2F19L 3KLHC 4OF8A 1YN7B 3P0GB 3L5HA 2CUHA 5CLWA 4GKNA 3RIAK 4FQ1H 2VXSH 3B9AA 1U92A 4RIRA 5L6YL 5I2IB 4UBDC 4JFXB 3RWCA 5HYSB 1WBYA 1EMTH 4OD2A 3DLQR 5F7EH 4X6CA 3VWJC 4GKZB 3GMOA 4DTGH 5J12B 1FJ1A 3ZMRA 4PJBE 5J4MA 3M17B 2BNUB 1YN7A 5DO2C 1AQDB 4H25A 4LLMB 4Y2OA 5DF0A 5FYJD 5JOEA 4URTB 5DRXB 5E6ID 2C1OA 2D0HA 4CW1A 5BMFL 1F97A 3TO2A 4R0LC 2YRLA 4WY7L 4ZNCD 1E6JL 1H3WM 1D6VL 4JFXA 1FP5A 2R0ZL 4KJQD 5DEGA 3THMH 4CKVX 5FK9B 2ADJB 5H2BA 1XF1A 3O2WL 1CGUA 3IDIB 5D70H 4CVXA 2FB4H 1UQSA 4YGVB 4EOWL 1A5FH 4X8XA 4XNMB 1IBGH 2XTJB 4KXZH 4K7FA 2NX5B 5ISZE 3UTOA 3HPJA 3S4SG 2AVGA 4WENB 4RAUB 3G5ZA 1CICD 2YPLB 5DMGD 2Y5EA 5EN2B 1WSST 5D5ME 3LSOA 1P5VA 5IEKA 4M5YL 4FXKA 5CIPH 1BREA 3WKNA 2QJDA 1KJ3H 4G43A 5IW3A 1OGTA 2R9HD 4JHWL 4M6OH 5T33L 3VWJB 1GPOH 4V2CB 4RDQF 4N0RA 1S8DA 2A73A 3GJFK 3RY6A 3VI4F 3WNLA 4GKNB 3ZTJG 3QDJB 3VWKB 5GZOD 2WLYA 1UEMA 3X11B 4YFDB 4LEXL 3PWPE 3P9WB 1EO7A 1OW0A 3OR6B 1V7NL 3GMOB 5EC1B 1A9BB 3U36B 4P5TD 1AQDA 2V9QA 5DD0H 4MLIA 1LQSR 4YHZL 5JIPA 3LKRA 2HP4A 1INQB 1FFPB 4ODSH 1U8PA 3QEQE 5K9QG 3TBTA 2YK1L 2KPNA 5EC1A 1I7RA 1UC6A 1J05A 3CDGA 3QIBA 1OAUH 4EDWL 3C87A 1AE6L 1T7XA 3QEHA 5FKAA 5F7MC 2BSTB 5EZLB 1HHIB 3IU3A 4MB5A 2H32A 5EOQL 1RFDL 4XPTH 1IMHC 1JVKA 4G8FB 3RWDB 4NRYA 4X98B 2FBJH 4M6ML 2O5ZH 4QTIH 3MV7A 5JO5A 1IC5H 1CR9H 5DT1H 2A6KB 5D6DC 4AK1A 3UMTA 3SQOH 2DWEA 3OX8B 4HF5H 4Q74A 3IB4A 4KUCF 3RVXD 3CDGB 3QIBB 3BQUC 4X4XA 1LK3H 4Z6AT 4JPWH 1N7MH 4KY1H 4PBWD 1NFIB 4E41E 4F15B 5I1CH 2XPGA 5HHPA 2IH1A 3O2DH 1WCQA 4HWNA 1Z6JT 1MRCH 2VDQH 4WRLA 5GHWL 3FN0L 4OLEA 4OCMC 1JN6A 4U6VL 4JPVL 4ZAKD 1TJGL 4G8GB 3F6IA 1KXTB 1NGQH 4MNGA 3P30H 5IMMB 5D72L 5MP6L 3FB6B 3QHFH 5FXCH 2JCCA 2IPUK 4OZ4A 1UT9A 5LGJB 1Q1JH 4NQXB 2BY3A 1U93B 1YNKH 2PXYA 2YZ1A 1FRGH 2LVCA 3HZYA 3VMNA 3UPRB 5J11B 3R06A 1QFOA 3KXFB 4WW2A 4EN3A 4MNGB 4FXKB 1I3GH 2VB5A 2IANA 1NCDH 3MV9D 4PRPA 4LHQB 4CMHC 1D5MA 1R5WB 3PHOB 4MA1C 1Y0LB 4WFFD 1GOFA 2R8SH 4BFGA 1NLBL 3VXRD 3HC0B 3TP4A 3QEHB 5FKAB 3QXAB 3H9HB 1H3PH 3BAEH 2HLFD 5CHNB 4QRPA 3EYOA 3JTTA 3GMNA 4PRPB 3BZ4B 1JTPA 1LE9B 3BZDA 4L4VA 3FRUB 3WFBH 1MRDH 4K3DH 4U49A 2FIKB 1FIEA 2G60H 4AM0A 1SBSH 1HDMB 2E3VA 3OKYA 4ZFGL 4ORGB 5LCVH 1CDUA 1FYTE 3IDMB 3IJYA 1YN6B 5GRJL 3BUYA 3GHBH 3P4MB 2W38A 1E0OB 5IK3A 4KI5E 4ZOCA 3Q3GA 1DEEA 1ZANL 4MYWB 2OI9C 2W9LA 5E2TH 5F88B 4RBPK 3TZVD 5B39B 5I15L 1FNEA 1H15B 1VGKB 3JXAA 2BVPB 3H9SA 5HYJA 1UEYA 3HNSL 1EJOL 2X4RB 3NIFE 3DURA 3WFBL 1J7VR 3MRPB 3OB0K 2V17L 4CBPA 3CVHH 3ULUL 1T5XB 1BIIA 5IT2L 2VABB 3AS3A 4MQ7A 1P7KB 1ZKAA 1VGKA 4WEBL 5FYKE 1BGXL 3FN0H 4HGWB 1I7TB 5B4MC 5KJRL 5J1AA 3MV9B 1BQLL 4G6FB 1WBXB 2CMRL 1IKFL 4NZTH 2JCCF 3MLPA 4C4KT 1VADA 4EVNA 2OCFD 2ZUSA 3X17A 2WQRA 3SE3C 5TF1L 2ZCLH 5E70A 2F53B 3I85A 5FFLA 3LN4B 3G08B 4X80H 2EKSB 4KJWD 5JUEH 2WBJA 4HWBL 4NNYB 1JHKH 1I1YB 4UINH 4XB7A 3ULVC 2XIDA 1MQ8A 3OAYH 4M48H 2YXMA 1JV5B 3BRDA 4JRXD 2VXUL 5HI3D 1BQHG 4Z95L 2YS4A 3HC4L 4GMSH 4KHTH 1YMMB 3RIFK 2LAAA 2EDQA 2CKBA 1MJ7L 1J0JA 5CBAA 3MRDA 3SHSA 5GS0H 3BH9A 3EIFA 5HY9B 4GBXC 3GUTA 1CFBA 3V4VH 4E5XB 4WCYL 1BPVA 5FB8A 4ZYKA 5DVMA 4LEOB 4XWOC 4YDKH 5CJXC 2YN3A 3TT3H 2R2BA 1FPTH 5I19H 3WLBB 5F7KC 5DA4A 1DQML 1CXIA 5BXFA 5HY9A 1MELA 3HA0A 1FNLA 1CICA 1NCNA 2AXJA 1A6AA 3EO1A 4BSVA 2VLRB 1WFNA 4PJDB 5I1AB 1T5XA 1WIOA 4TVPD 6CGTA 4PR5B 1RUPH 3MOAH 3CMOH 4BQCA 1I4FA 3PWPB 4F8QA 4PJXF 4OF5A 2DKUA 3QIBD 3T04D 1LMKA 1RU9L 5C08A 2EEBA 4WHYG 5DK2A 3WO4B 3VXSD 1D5IH 5IB1A 2XWTB 5SWZD 4S10A 1IGJA 4HUMB 4QYOA 4JFFB 1CXLA 3GKZA 4RAVA 3KYOA 3MRHB 1F90H 2EICA 5T3XD 2M2DA 4XVSH 5BV7L 1HH9B 1N0LA 4N8CL 1CZ8L 1G9NC 4X4ZA 5KVGH 3TN0C 1IT9H 4LKXB 1AGDA 4PJIE 5K9OB 1XZ0A 5ISZB 3D85D 3ARTA 4LASL 2X4SA 1QACA 4N1CA 1BIIB 3O2WH 3QEUB 3VXUE 1ACYH 3DYMA 1FZOB 4PJ9B 3WIIL 1YJDH 4PFEA 3UXFA 4HK3N 1BBDL 2C7UA 2Y25A 2F8XC 5CSBA 4IRSB 3BIBX 5FDWA 1BQHB 3ULUC 3VWKD 1JGLL 3H9YA 5KVGL 2X4SB 4M5YH 1JE6A 3P4OA 1FYTB 5FGRA 3IDNB 3ARGC 2P42B 5HHNB 4PJAF 3PWJA 4PPTA 4PRNB 3BKJH 2I60H 1CD8A 2F5BH 3MLSH 2J3SA 4KAQL 4IRSA 3KHOA 2WSKA 4U31A 3UJTH 2H32H 2A9ML 1YY9C 3I50H 3QWRA 3DYOA 1CLOL 1BQUA 3RA7H 1UCTA 2IGFH 2ICEA 5EFIA 4JHBA 4PRIE 5C08B 5E08L 2DMBA 4Z78B 5CWSA 3WIFA 4PJ7B 1KCRL 5GS0C 4C56A 1FNAA 2CK0H 2I24N 3RWGB 1T2XA 2H45A 4L4VD 1FLRL 1AC0A 4TN9A 4UQ2B 4EI6A 4LVOB 3W5NA 2DM3A 4ZXBB 1QR1A 5EUKB 3U79A 3PDGA 4GAJL 3OKNA 4HPYH 2P46B 5MERB 2NLJB 1UQSB 3D5OF 1FAIL 3PHQB 3MACL 3T0VA 5JXEC 4DKEL 5DMKB 1CFSB 5DJYB 3DHMA 3WN5B 3QQ3A 2Y5TA 1Q9KA 1AKJA 4AH2B 3HE6D 4HBQA 1CLZH 5IBTL 4F7MB 5IGXL 3NFNB 3SCMB 2OSLB 3EO0B 2BVQA 5B38A 3SKUD 5AZ2H 1PZ5B 3RWGA 5CSGA 3S34L 1T22A 4HLJA 2PO6B 1NSNL 5DZLA 1HNFA 1I8IB 3INUL 4WI3A 3AROA 4ZUSB 2NPLX 3VFWB 3WO3B 1U3HC 2AQ2A 4YPGA 4RA0C 1FAKT 1PLGL 3REWA 5J56B 3U0WH 3C8KB 1FE8H 4BH7A 3RX7A 4TNWK 2R0KH 5B38G 5I1DB 4GXUN 4NNXB 5E5MB 4HWZA 4L3ED 4D9RD 3NACH 4FXGA 3IDIA 2P43B 3UO1H 4RGMB 1LP9F 1RUKH 5IMKA 4UIMA 1MCCA 4F7TA 3IT8D 2Z9TA 3S4SA 5TDNB 4ZFZA 4A6YH 3HN3A 3N85L 3OMZA 4L29A 3LZFH 4YHNA 2DLTA 4PYHA 5F6HI 2X4TB 3UROR 1BBJA 3RQ3A 4O2EB 5JTWA 5FA3A 3B5TA 2GHWB 3SN6N 2PCPB 1MVUB 4JKWA 8FABA 1NC2A 4FMFA 2MHAB 3RVUC 4IMLA 4YHKL 2D7QA 3I3DA 3JTSB 1OQXA 3VI3E 1I7RB 4HS3A 4J4PC 3RU8H 5IW1A 4YR6A 1HILB 3MV7E 2FL5B 3DSFH 1CE6B 3GSOB 4Q6YA 4XTRD 3UC0H 3NACL 3D69B 4ETQB 4RRPA 3ARGB 2DJUA 3SOBL 3VFUB 1QSFA 1IARB 3CPLB 4PJ7E 4NT6A 5JO5B 3OX8A 2IF7A 1V5JA 4NQCA 1HQRA 2RBLA 4HGKC 4L9LB 4CMMA 5FOBB 2QSTA 2VR9A 2I25N 5E8NA 2C4FT 1LO0H 2VSDA 2HA1A 2WNGA 4HSQA 5FYJU 5C1MB 1A4JB 3CX5K 3CPLA 1EEZB 1MLBA 1IL1A 3ALPA 4PJFF 4C4KO 5B8CB 5E99H 4ONHB 3VRLF 4WIQA 1P7QA 5D1QD 1T0MB 3H7BA 2DTSA 3SDAD 3ULUE 5BMFH 1A4JA 4PGBB 4CADA 5FYKL 4QRPE 2AJZB 3GSRA 2V2WA 3ZE0E 2VDRL 4LLYA 5H8DA 5C86A 4HMEA 3BN9C 5IMLB 5D7JA 1S7UA 2C26A 2FX7L 3MV9E 4LPWA 2CDFA 1IGYA 2CO7B 4DGYL 1AHWA 5D93C 5DJXA 5AD0B 4OZIF 5HVFB 2IPKB 1SEBB 6FABL 2OZ4H 3QEQA 2P8PB 4X6FA 1HWHB 5DUPH 2MCPL 4GRLA 1X4ZA 2CIKB 3RA7L 4OLWL 5JW5B 3MLYL 2Y6SD 4HS3B 4Y8AA 2AGJL 3H9HA 4ODHH 1UYWH 4XPAL 3JWOC 2FDBP 4RAUA 4B7IA 2BHUA 3PL6C 4U1GC 3W11C 5CD5D 2XQBH 3QFDB 4PJ9D 5GISL 4WHTA 4LHUG 3MUGB 3U4BH 3ARSA 3VRLE 1F2QA 3BIKB 4XWGL 1CLOH 3RWJA 4HFUH 3JV6A 1PQZA 5JW5A 3MLZH 1U95B 1OP5K 4QXUL 4YO0A 5TDNA 4HHAB 1DBMH 4P3CL 5C08D 3HE6C 1XF4A 4OTXH 4PRBA 3LVEA 3UTTE 5ILTL 4Z7VB 1PG7H 5AAWA 4NIKB 3QH3A 2I5YH 2WBJC 1DBAL 3C5SA 4P9MH 1QRNA 3RVUD 1DEEB 4MNQE 2OMBA 1X5JA 2NY1D 2OL3B 5F3BB 2XRAL 5BS0A 4IMKC 2I07A 3UP1A 4LDLB 4DAGL 3QDGE 2OP4L 1RY7B 1B88A 4YBQD 2DWDB 5D1ZC 3GB7A 5JQHC 1D5BA 3KLSA 3FHAA 3RUGF 1F45A 2UYLA 4QOKB 4LSVH 2IH1B 4HK3J 3PUCA 4KKCC 3TNNA 4PGCA 3BIAX 5IQ7H 5LJYH 3G6JE 3MRQA 1KIRB 1HHGA 5C0BE 5C0AA 2NY2C 1NQBA 5AUMB 1TLKA 1KB9J 5I6XB 4WEMB 1EEUA 1BD2E 2O5XH 4FQIL 4S1QH 5AEAA 1GHFH 3QEQB 3MV9A 3GSNH 5CKAA 4KQ4L 3FB8A 4K9EH 5EWIL 1RU9H 3BJ91 3G08A 3KPOB 4HD9A 4HEME 2A77L 5L7XL 1QSEA 1HOCA 1CLYL 2V7HA 3SDDA 4XXCA 4E41A 5L2JB 2DTMH 1MFCH 4LIQH 3RY4A 5DD1L 3UTPD 4WW2B 4TSBH 4P4KC 4I3RH 2ZSVB 4U6XB 4PJIB 4TRPL 1I9IH 3STLB 1UZ8A 1DL7H 1J5OH 3J7HA 1EIBA 1BVZA 3EYFA 2JJTA 1C5BL 3W9DA 4BM7A 2EIEA 1F3DH 1EJ6A 2W60B 3H42H 2F58H 1G9MH 4R9HA 3IYLW 5INCB 3V0VA 1WBZA 4APQB 1JPTH 4OGXL 1ZANH 5L6YH 3TF7C 5KVEL 2EDBA 4P2OB 3TN0D 2YMXL 3VGBA 3C2AL 3KLDA 5J6HB 2VE6B 4F2MA 3OXRB 2GT9A 3LY6A 4ZPVA 4YDIL 1PG7X 4BYHA 2KKQA 1JZ7A 1J8HE 3CAFA 4ZOAA 2DWDA 3H8NA 4FQQB 3MPCA 4ETYA 3LOWA 2N4IA 5CUSL 3BGMB 1BFOB 2R2BB 1TPXB 1CVRA 5CFHA 2BCKB 2Q8BH 4OD3L 1EFQA 1KG0B 4Z5RB 2IAMB 4Y4KB 1PBYA 4HUWA 4P99A 3BJLA 1AI1H 4OKDA 1RZGB 4OF6A 4MAYA 1I4FB 3PWPA 4NQVA 3IKKA 2ZKHH 1QUNA 2W0KA 4AIXA 3PV6B 4LLUB 2EZ0C 1H8SA 1HZHH 2R2CA 1HSBB 3DV4B 2R39A 5E6ZA 5CP7B 4JR9L 1EFXD 3O3BA 3OKDA 1RVFH 2ESVB 3JV4B 3CGTA 4ZO8A 4GQPH 3ZHLA 2CH8A 1DN0A 3MJ8A 5C0FB 5F9JA 4F3FA 2QTEA 3SDYH 4HAGA 4NUJB 3L3JB 5MENE 3HNVH 4QOKD 4XH2B 1DUZA 3DBXA 1KJVB 2WP3O 3LH2H 1QO3A 3QWRD 4K7PY 1MJ8L 5FYLE 3OHXA 1JI2A 4PRAA 1JJUA 3Q0HA 3STLA 3MLYH 3WXWH 2MOVA 5F1IA 2EDDA 4BSWB 3C5ZA 3ULSA 4B0MM 3DROA 2VC2H 3LKOB 4U1MA 1JRHH 1UM6L 5HYFA 2H3NA 1P84J 1YEHL 1QG3A 3E6HB 4PJGB 1DE4B 4JM2B 1XIWA 1AGCA 5J12C 3RTQD 3BHBA 3S96B 1JGDA 2HTKD 1W72L 1CLZL 2AV7A 5LQBL 2XXCB 2JJSA 3QIBC 3OKLB 2BVUA 2Y4SA 3BDBA 4LPVA 3QDGD 3MLWH 4OLYL 4GAFB 4JPIA 4Y1AA 4HKZB 4OCYL 4BQ8A 5C0BA 4UT7L 2Z8VC 3THML 1GGCH 3D85A 4JQXC 1DQLL 1M05B 5CILL 1A3LL 1IQWL 3N9GL 5IBUG 3V0WL 4MA7L 1HH9A 3PL6B 4I4WA 3KPRD 2J88H 1OW0C 3MO1B 3BE1L 5IBLD 4MJ6A 3IF1B 1A4KB 2FZ3A 4LLWA 3RVWC 1YYLH 4S0TD 5F7DB 5MEOA 4J1UA 1RUKL 2D9QB 2ZG2A 3UO1L 3IXAB 2XN9E 1XCQB 2EH8H 5GRUH 5D7IB 3RY6C 4RGNB 1SMAA 1RIHL 4NCC2 2CJUL 4XPHH 5I2IA 3W82A 4ZDHB 3ES6B 4CN4A 2C4FU 3V4PL 4YXLL 5TE7L 3DBXB 3P77B 2I26N 3IETB 4OD1L 3ZHDA 1MFBL 4KV5E 4GFTB 1HXMA 2X9XA 4XVTH 1U3ZA 4RFNB 4LP4A 4JFOB 4X6EA 3VWKC 3VXMD 4YHKH 1WZ1L 4ZUTA 1A7OL 2J88L 2R2HA 3L9RB 2QBWA 4YHIB 3BP6B 1KJMB 1A9EB 4F9PC 4JM2D 3EO0A 5B38B 5GGRY 4PP1C 2J8UE 3WD5L 1DANU 3TA3C 1DE4A 4JM2A 1SYVB 5GIRB 5EA0H 4PV8B 1OD7A 5MENB 5FK9A 4GXVL 1NCBH 4Y19D 3IFNH 5GZOC 5BCAA 2X4UA 1WT5A 4JG0H 2QKIA 4PB0L 1NC4B 2VO5A 4GAGL 2Y6SC 4G3YH 3BP6A 5EU6A 4K7PH 4PJDA 4C59B 4NUJA 3REWB 2PTUA 1KBGH 3QUYD 3KPRE 5EOTA 2XTJC 1TTUA 4IRSC 2G2RB 4RGOL 3PQYE 4U0QB 4O00A 1DQQB 4EI6B 3NIGF 2NR6D 4N9GA 3U48A 2YUXA 4OSUL 4X4YA 5E9DB 5AYQA 2ZSWB 5CGYC 4KK8C 2XQYK 3QHZH 1FL3A 4ZTOL 1EHLL 5IMKB 1T4KA 1P7HL 2O5ZL 4QTIL 5CGMA 4JHAH 5HHME 2GAZB 4QHLB 5IJKA 1AKJB 3RI5F 4LBEB 1IGTB 2DI9A 4ZMAT 4LL9A 4TVPH 43CAA 1T0PB 5F3HB 2FECL 2VISB 1BOGB 3W0WB 3NGBB 3GIZH 1J0YA 1FNGA 2DL9A 2P24A 3QHTC 4MCZA 2VZSA 4NWUL 4E0RA 4O2CA 3HI5L 1FAIH 4CDGC 5IB4B 2OJZH 4OM1H 5C0BB 1YEIL 1U8QA 1X6LA 3RWFA 2VZTA 5CWSB 3H3KA 1KNOA 3SGKC 1GZQA 4F37F 5J13B 1R0AH 1BM3L 4PJ5D 4PJ7A 1U8PB 2EC9U 5I1EH 3BXNB 3F7QA 2X09A 1CFQB 1QVOB 4HK0B 4LSQL 2CDEA 3WL9A 4XNXH 4DZBA 3LEYL 2XWBA 2ATPB 1MFCL 3CDFA 5J9PB 1AFVL 1ROWA 4EZMA 1MQKH 2V17H 3PWJB 4PRNA 5BRZE 5BRZA 5L9DH 1NPUA 1G1YA 2XY2A 2VLJB 3BMWA 4JQVA 5GRVK 3TZVB 3KLHD 1SM3H 2Z4QA 5HVHC 2FHBA 1ZT1A 3DVNA 3QDJD 1PGRB 2CLZB 3ZO0A 4L8SB 4WWKD 5SWSB 2EE9A 4HULB 2JB5L 1C1EL 4ODVL 5IWLA 4JFOA 1CIUA 2OBGA 2ZCKH 5EIIB 2E7CA 3QYCA 3K8LA 4NC1C 4LGPB 1MNUL 2D7OA 1A9BA 3QI9C 5I75B 4I5BB 4D3CH 2MKWA 1LO3L 1AFVH 1OCWH 3T0ED 1N8ZB 1QBMH 3LPWA 3D25B 2RCSH 4XP5L 5E2VL 3EGSB 2AW2A 1IZJA 1G0XA 2P44B 4RGOH 4G6JL 2EDNA 3S36L 2ERJC 4IDJH 1JI1A 3CXHJ 1JZ2A 4M1GH 1Z5LB 3HZYB 1QNZH 1U6AL 3VG0L 5F72S 4G9DA 3D18A 5ALBH 2NR6C 3KS0H 3TCXA 1W8NA 5GISH 2DLIA 4M8QB 1RVFL 1P9MA 4I18A 4GW4B 2DOCA 4TUOB 1QA9A 3BKCL 4G7YL 4PD4J 4PREA 1A7QH 5JOPD 3MLZL 3EGSA 1KCSH 4BQBA 3K2UH 4AEIH 3RTQC 5D2NC 3HNSH 2XNAB 3ECBA 4JFED 1DP0A 1WFOA 5C0ND 4HHAA 3L3DA 2YPLA 5F7HA 4F9LC 1OGAE 4PJCF 2AXFB 4K3GA 5IESL 4IDLA 3PWUB 4FZ8L 4YUEL 4GW4A 4OD1H 1JPTL 1QRNB 1SEBA 1D5ZB 3QWOA 1J0IA 4KAQH 2YMXH 4PRIA 4N0CD 4XP1L 3LKSB 3VA6A 5MHSE 1KPRA 2W9EL 2VLRD 4UU9B 4JFFD 1A7RL 1OTSC 1RIUL 2W92A 4M7LH 3RKDC 3GBLA 2NY0D 5TFSH 4FNLL 5EOCL 4P59H 4DW2L 1CR9L 3V5DA 1FZKB 3ZDZE 5KVFH 1DDHB 4KJWC 2VITB 5A2JH 1IGFL 2QQKH 5KSAD 5IFHH 4FQ1L 4X4XB 1MSPA 2RGSA 4PGBA 1VDGA 2EXWC 1IEHA 5FO9B 3MRLB 1FFPA 3VXMA 3LS4L 5I71C 5I15H 4ZTPL 4OAWA 1S5IH 3HAEB 3QXDA 4Y8DC 4M3KB 2AJSL 3OKKB 5CJOH 4P0DA 4MA1B 3UJJL 4ZS7L 4OM0H 2BNQD 4B41A 5C0CA 3BH8A 1D5BB 3S3PA 3O6FA 2XKSA 2R56L 1WBXA 3X3FL 2APTA 3ILPA 2DICA 3B4NA 3MJ9L 1Q9LB 4YQXH 2GK0A 1Z9OA 2BVOA 2VN7A 4NWTH 3HUJA 1MCBA 4AEHH 3RRQA 1GVIA 5C2BL 4CJ0A 2W0LA 1PEWA 1DBBH 2HRPL 3QUKA 1T6WA 2OM5A 3RTQB 2JTDA 1MCWW 5AUMA 1NFIA 3QZWA 3ARQA 3ZDZF 4EN3C 3L3GA 1S7VB 4RNRB 5BO1H 3EFDH 5HI4D 2CUIA 2XZAH 4TUKH 4NZUH 4FQPA 5D7KE 2VDKL 4O58H 1R0AL 5I8OH 5ANME 5FHAH 1T2JA 2R56H 4YEEA 1K8IB 4AIOA 4YC2C 4FFZH 4E41B 4WWKB 1GOHA 4YE4H 4WFGD 4YZFF 1OAKL 1M71A 2V2TA 4ONFH 1MHPH 4YC2B 4OIAA 5JXAH 4KTYA 3A6BL 5EZLA 3FO0H 1RZGA 4Y4HA 2PXYB 3MFGB 2MQ0A 3I02A 1OWRM 3P11L 4NC1E 1ZV5A 2G60L 2QV2A 2EDEA 3WIHL 5C7XL 3DRQB 3L7EA 3JV4A 1UZ6F 3GBNL 1F6FB 4XGZA 1NJ9B 5JPNB 3JV6B 4YDLB 4F3FB 4LVHB 1WIPA 4Y5VA 2HKFH 1NL0H 3WUZA 2A74B 3HC0A 5F7FA 2F8VA 5D8JH 1DBJL 1IKFH 4NZTL 1E4KC 1G9ML 3UYPA 2C3GA 5TH2B 4YXHL 3F62A 2W91A 5J57B 1OAYL 4OLUL 3MJ6A 1WFTA 3FRUA 1GRWA 2ADFL 4M6AA 5TF1H 3T0XA 1UXSA 4PRHD 5ABDE 1VESA 1L4IA 1KJ2L 2IPUG 4ELMA 4AL8L 4XBEL 1Q8MA 3BEWB 3O6MH 4WFGE 4Q2ZB 2YEZB 3ALWA 2VXUH 5MEPB 4CAGA 3QRGL 3NCBB 4NJ9L 1OSPH 3QG6B 3VGFA 5T1DH 5EIQA 1KBGL 1IAIL 2WBWB 3NGBC 2P5EA 1NAMH 3N0PB 4BZYA 4DKEH 5FOJA 1NCAL 4E9LA 4F9LA 3D48R 1UJTA 2C4XA 3DX7A 3L5WA 4MQSB 4Y4HB 2V7HB 2Z8RA 3BMVA 4OLVH 4G6AD 1C08A 2I9TA 4ZAKC 3PE9A 4KKAC 3IDNA 4NP4H 2HJFA 4XBPA 1MOEA 4P3WA 4WY7H 3BYTA 4JB9L 4N1EA 1MJ8H 2UVFA 1K4CA 1JGVL 4RMWA 3MJ7A 1IGCH 4U7SA 3KYOB 3MRHA 1HXMB 4P49A 3CVIL 1EJOH 5JR1H 3CX2A 3QUXD 4PJ5B 2BFVL 3QPQC 2Y06L 1HXYA 4UNTA 3WXVL 3ZL4L 3GIZL 4OZGB 1XZ0B 3CLFH 4S1DD 5DURD 4POUB 3QT2A 2YA2A 2APFA 5I8KL 1H15A 5KS9E 1D9KC 2BNRD 4NCDA 4PJDF 4KDVA 1HHJA 5T1MA 4HUVB 3DVGA 3GJEA 1YY9D 1DQJB 4JVWA 2NY5C 3ZKXB 4R4ND 1KG0A 2H26A 2OQJB 4FZEH 5DJYA 3GSQA 3GMRB 4HKJB 2O5YH 1D5IL 1RZFH 2K7PA 3IDGA 5CILH 1Q9WA 3NA4A 1KGCE 5EZJA 4MJIE 6FABH 1MH5A 2HT2D 1LD9A 1NCUA 4D2NA 2BNQB 4LCCA 5GGTH 1R3KA 2ZSWA 4U6VH 4HCRH 4X83A 1GGIL 4RGNC 2VJXA 3EO1B 5TE4L 4YX2H 5K9OA 7CGTA 5IGXH 4YPGB 5I1AA 5KVDL 4P23D 2PYEE 3RZCD 3VXUB 4JHZA 4M6NL 3LQMA 1RMFH 2W07A 1HSAA 3QIUC 1GCFA 3CFKB 3S9DB 5F7EL 3DO7A 3ABZA 2GI7A 1H3VA 4XAWH 2XQBL 4WFEE 1ZVSA 4MVBD 4CU8A 1RZKL 1TVHB 4DCQB 2ITDA 1U8OB 2VC2L 3P0YH 2X4UB 3OAUH 4YK4C 5JHDE 3I84A 1INDH 1AY1L 1URLA 2BOCA 1P1ZB 3AREB 1OAUL 3QUZD 1AXTL 1A6PA 1LO2H 5DRXA 4JVPA 2DQFB 3DMMC 2AJVL 3CFKA 4KKBD 1V7MH 3TO2B 3SKNA 1TXKA 3C6LC 4X7TB 3SKOB 3UCRA 3O0RH 5K33A 3ROLB 3MBXL 3TBVB 4OI9A 4WU7B 5TE6H 1SJHB 3DMMA 4HWEL 5A1AA 2ATPA 2ZCLL 4OZFB 2YD4A 4OFVA 1NC2D 3VGEA 1MCLA 3U9PL 5KSVA 5A3ID 4MS8C 4P5MB 3RBGA 1T0NB 5I1HL 3C08L 5JUEL 3D69A 4FQ2L 4X4MA 4AZ8A 1WF5A 3VXQA 4PRHB 1CGWA 1F6AA 3UTZB 3V0WH 2HKFL 3NBNA 4D0CB 5HYQB 4LVNB 1H0DA 3F8UB 4ALAL 2A83A 1Q9WB 5CMAA 3HS0A 1MHEB 4UTBL 5DJ8B 4LLWB 4WU7A 4PJ5A 4OUUB 4XTRC 3ZDYF 2HYMA 4Q97A 4HPOH 1JPSH 43C9B 4QRQB 4CVWA 3O3UN 3U0PA 2X1XR 3FB7A 1T89A 4IEFB 3WMSA 5BW7A 3GBML 4LCCC 4XP1H 1MHEA 3MV8B 2J4WL 4MHHI 3K46A 4TULH 4I2XE 4HK0A 1QVOA 2XN9B 1Y18A 4J7RA 3CSYA 5EFIB 4HXAL 4F33B 5EG6C 4O02H 1RPQA 1TVHA 4NZRL 4F9PA 5KG9B 3DHJA 3DRTA 1MJUL 1YPZF 1ND0A 3DECA 1XGTA 1CGTA 1NC2B 3KPPA 5GS1A 2IAMC 4FFWC 4NJ9H 5M94B 1G84A 5DMIH 1QFWI 1A1MA 3VFGL 5EO1A 4JKPL 5IM7A 5IB3A 1OD9A 4ZSOE 2F58L 1B6UA 1HHHB 2R29H 3V5HB 2IG2H 2IFFH 5D70L 2ZCHH 4LRIA 2GTWB 4AMKH 1H3PL 1R3KB 3NIDE 1GJIA 4I0PD 1NUNB 1A6WH 4BKLA 2WBKA 3W0WA 2P5EE 5EBGA 2BHZA 2HLAB 2Z8SA 4NQEB 4HLZG 3LN9A 4AH2A 5FGSA 4F7TB 2OL3H 4JKLA 4DKFH 1I9JH 5ALCL 2Q8AH 5A16A 1U93A 3LQZB 3MNVB 3QRFM 3KHQA 3PWUA 4J6RH 1AI1L 3VFGH 5D8JL 3T1WA 5BV7H 5F6HJ 4PGDB 4L8DA 2PO6A 3BP7B 5ENWB 1I8IA 4AT6A 3MRJA 1HWGB 3DETC 5I73B 1JF1A 1SY6L 3QHFL 4OV6F 5FIEA 4X7DC 2VKWA 5HDQL 4OBRA 2DQFA 4WTXA 2BSSB 2JKXA 5L0QC 4WGVB 4P2QD 4XC1L 2BY1A 2HJKA 3ZKMC 1HK6A 3UYRL 4OI8A 1UKQA 4MWFB 4Y4FB 1QLEH 3K2MC 3L3HB 2AV1A 3GMNB 3HNVL 2EDJA 4PJFB 3ZKMD 5D7JB 4LLVB 3G5XB 3VGGA 2WANA 1HYSC 3UZEA 2ZUQB 3D39A 1IEBB 1UADC 4Q0XH 1QKZL 4HC1A 2LE9A 2WINB 1TCRA 3RAJL 2LV4A 3ARBA 4N0UA 5E00A 1A1MB 1KIPB 1KTDA 5I16A 4RZCB 4LFHD 1R5VA 3HB3D 5T3XH 5F7UA 3CXDH 1FYHB 2FEEI 1IEBA 1IAOB 1LEGB 1OY3B 1HILA 1AXSA 3G5XA 3LQAL 1X6NA 1NGWB 3HI1A 4PS4H 4MD4A 2B8OT 4Z7VF 4RZCA 3OTTA 3QAZB 4P46C 3SO3C 4L3AA 5FYLL 1EVTC 1EXUA 3MNWA 4L4JA 1HQRB 4L9LA 5D2LE 2CLZA 4ZUVA 3ZE1E 3JUZA 2J5LB 1P69B 5DLMH 1RURH 3RVVD 3S3SA 3MRGB 2VLJE 3BPLB 1LE9A 3ULVF 3L3GB 2NZIA 3GSWA 5DC4B 4ERSL 5AZEL 4I5BA 5DQDL 4W81A 4XCCL 5EZIH 5GGUA 5C0IB 3OG6B 4Y4HC 5ALCH 4TRPH 3FTGA 1EH9A 2PCPA 1XGUA 1KPUB 1DVFD 2VH5H 1EX0A 3GRWA 4R6UA 5ID0B 5IT2H 3G6JA 4Q7DA 3L6FB 4PTTB 3W39A 1YPZA 3P9MB 4ODXA 1RK0B 3RJDA 3FFDB 3O4LD 3ILPB 4TNWF 1A7NL 4K55A 4J3SA 4JM4H 3R8BB 4BELD 1DBML 4U1HB 2OX5A 3JWOH 5D71L 5EBWA 3VFMB 4YBQC 4PLNC 4L4TA 4Z7VE 1LK2B 5FKPA 1PG7L 1HI6B 1INEL 4HCRL 5CJOL 3BZ4A 2A2QT 3ZE1F 5E8DH 5EU4A 1KF9B 1NDGB 2FSEB 2JCCB 5LGJA 2HN7A 1Z0NA 2A1WH 3HR5B 5FB8B 4Z8FL 5EA0L 2FEEL 2EYRA 1PKOA 5J6GB 1N0XL 4FTVA 1J1XL 1YZZA 3FT3B 1JZ8A 2NX5E 3OKDB 5F9JB 2ADIB 1MCFA 3BPNB 4N5UA 4HDIB 3T3ME 2F15A 4DZ8A 3VDBA 3DXAD 1AY1H 1KXVC 5D1QB 2ESVE 2HTLD 1KACB 3HR5A 1L9MA 5I8KH 5F6IC 4HLZH 2ZPKH 4M00A 1G9NH 2E9IA 3OJ2C 3U46B 3EBAA 2CGRL 4YDVA 4KTEL 1KFAL 5F44A 1QLRB 3QBTB 2CDFB 1J0KA 1IGYB 1NMAL 3W81A 1C7SA 5D1ZA 1F3DJ 4IJ3B 3SDCC 3U9PH 2XZCL 3OF6A 5FGCB 3M1BA 4TVPL 3O45A 1JN6B 2HH0H 2WAHA 4R3SA 3F7VA 2R1WA 2WP3T 5ADPH 1IAMA 2AJXL 4ODXB 3V95A 2B5IB 2N7BA 1JTTA 4Y88A 1WICA 1FZJA 3W9DB 4Y89A 4NUGL 5H94B 1CXEA 3L5XH 1YC8A 2H2SD 2WWMC 3DTXA 4MA3A 5JORA 3LEVL 4WWID 4LLAA 5E08H 4NDMA 1NCCL 3UPRA 1YDPB 4K8RC 2VDPL 3V4UH 4OB5L 3PWVB 4NNYA 4EN3B 3S5LA 5BJTB 1TTFA 5I8CA 2Z35A 3WDHA 3FQRA 3EYQD 3F7VB 3GSWB 4MJ6B 5ISZD 5EDXA 5DC9B 4GAGH 1DTUA 3QNYA 2G5RA 4EI5C 5A2IH 5MEOB 1OTTC 4FQQA 3LIZH 3B83A 1A4KA 2FZ3B 4GAJH 1U3HB 3EYUH 4Z0BL 3G6JB 4NOBA 1IGIH 3MACH 1SBSL 3IFPB 4D0BA 5TPWL 3QDMB 1K2DB 3RU8L 4JDTH 1S7WB 4YFLI 4GKOA 2P5EB 2FX8H 1YJDL 4JKPH 1JPGB 3O2DA 1WZKA 4LCIL 5D1QA 5GRZA 4PY7A 1AD9A 2DQGH 4ODTL 5MEQA 3ARBC 5ADOH 1U2HA 3TO4B 3HMWL 2ZCKL 1F4YL 2R69L 1KTKE 2WK2A 2BRRL 5L7XH 3KR3L 2RHEA 2O5YL 4XX1G 1OP3H 2AXGA 2FJGA 3S98A 1A0QH 3P4MA 3BUYB 1BVLA 1DEDA 4O9HH 1R5IA 2CDGA 2IQAB 1MPAH 3N1GC 3KGRA 3RVTD 1JMZA 2ARJA 3O6KH 4PJGF 1NCDL 2V2XA 4Z7UA 3LMJH 1K9TA 2X4OA 1FO0L 5L88L 3SDAA 3NPSB 1OT2A 3GNML 2ZUQC 3D6GA 4Y4HD 3GBNH 2R0LH 5DGQA 1JGUH 5DD3H 5FF6B 4H0GA 5TJWK 5D6CA 4QF1A 5IB1B 4OZGA 5DJ0A 4L1DA 5JPMB 3QO1A 1SQ2N 3HMWH 4XCFL 4LSQH 5H94A 3HE7B 2JELH 1NDMA 1KSRA 4U1KB 4H0IA 2ILLA 3TA3D 2ED8A 1S78C 5KSBF 1SEQL 4CVUA 3MSPA 4Q6IA 5DFWH 1A3LH 3KDMA 5DJ0B 1QPXA 1ZLSH 3CFCH 3HE7A 3Q6GL 3WJLA 2LTQB 4P46D 4HS8H 3KPLB 4TPRL 1DLFH 5E2UL 3PGFL 3NFSL 1T03H 2NXZC 2WLZA 3M1BB 2IBGA 3IDGB 4OZHF 4M62L 5JDSB 4E41D 2NY4C 2R0LL 1GAFL 4PRAB 1KB5B 1R3IH 3Q5OA 5SV3A 5ETUB 5EH1A 5F3HA 2V5SA 5CSZA 5ID1A 5CLTA 3QP3A 4HG4J 1ACZA 5E4IA 1CYGA 4PJ9C 5KN5B 3KDMB 2DQIH 3RZCB 4RWYL 4ZXBA 4O5LH 3TT1H 1QR4A 3SE9H 1AO7A 3O9WB 5MERA 3P4OB 2R1YB 4WHCA 1LO0L 5CAYB 4M9OA 4UTAH 3KYKH 5E2WL 5KSUA 1CN4A 4HH8A 4NQVB 1O7VA 2AXGB 4C54A 4UBDD 2AJYH 1E6JH 4NN5C 2X4PB 4JY4B 5KN5A 4DZBB 1CGSH 3MRIA 3QUMB 3QQ4A 3TYGL 4MQXD 1II4E 5TE4H 1U3HA 2GEEA 5BVJB 3K80A 3RNKB 4ONOA 5HHOE 1NGPH 5C09E 3WJJA 4K8RL 4YHPA 4KJQC 3GMRA 2DJSA 5KAQF 2CLRB 1T21A 4I4WB 1MFAL 4HZLB 1KJMA 3SE8H 1AKJD 4NM4H 1ZLVH 4QHUB 1EPFA 3EKCA 3DETD 35C8L 4OZHE 2J8UB 3RJQB 1BQHA 3FZUD 3U7AA 2IJ0C 2EO9A 3LD8C 4NFCA 5I18L 4K2UL 1GGBL 1KLGA 4FXGB 2WZPD 3S35X 4PJXA 1WJ3A 3FB5B 5J8OA 1CFNA 3WLWC 1ZTXL 1QEWB 5HYQA 3MFFB 5GGQH 3ESUF 4JAMB 3FOLB 1I1AA 4HC1H 4MNHA 3WN5C 3SDAB 1OPGL 3WEXA 1U36A 4RGNE 1AGDB 5D1XC 5HHXL 3OWEA 2XKNB 3HCVA 4Y5XC 4UIKL 3TPUB 2ZJSH 2DQEL 5J13C 3VRJA 4GRWH 3BESR 5IVXB 2NNAB 1T6VN 2E8ZA 3LQAC 4XNZB 3RI5K 3GM0A 4LVOC 3B8SA 5IQ9B 3SBWC 3C6LB 3MLTA 4Z7NF 4TQEL 2FLBT 3DX6A 3RNQA 1UH4A 4LBEA 4TPRH 2A6JB 3WNMA 4LMQE 2DAVA 4Q58C 2QADD 3QDME 4OLXH 1NANH 2UY6A 4IM8A 3EOAB 2NY5L 3AREC 1PZUB 3RBSA 3EJYC 4YHOH 3QUMA 1RUPL 3MOAL 2GJ6D 3VFVA 2CUMA 3B6SA 3EOTH 1J9CT 1MIMH 1HSAB 4AENA 4BSJA 5IM7B 4HJGB 1YECH 2BERA 4MZ3A 5KTEH 1ORSB 2HKHH 5DQDH 4JDZA 3F6LA 3IDJA 1E27B 3EOYG 5CD3B 3MUGA 3IETA 3L3KA 4U7MA 5EBMB 4NZRH 2VUOA 3PABA 5F7LB 2BOCB 3T0AA 5L88H 4OIIH 2CPCA 3B6SB 5DGRA 3QEGH 2BJML 1J8KA 25C8L 3SJVE 3W5MA 1KIQB 4ODHL 5I1DA 4Q9CA 1VEOA 1N6UA 4YGAB 3CJJA 4KZEL 5EUOF 3BT2H 4CJ1A 4PJ8C 4JCMA 1DVFA 2CKNA 5L9DL 4POZD 2XTLA 4YH6A 4Z7NE 3AFLA 1ERNA 1NAMA 3P9LB 5EUKA 5CD3A 2DQHH 4NZUL 1EFXB 3KJ4C 3VJ6A 3HG1A 1S7UB 3WJLC 4NJAL 3WS6A 5CEZH 1BZ9A 3C8DA 3ZKXC 1TJGH 5AZ2L 2LVEA 5JLZB 3AY4A 2NXYB 2VLKA 3HCVB 5TFSL 4FFZL 5HXMA 4K2UH 1Q9OA 2KUTA 1E6OH 5IEHA 1JGLH 1XMWA 3WFHB 2OSLA 4MXQD 4M7ZB 3TNMB 1I3UA 5B8CA 3LDBB 5L8LB 2XG5A 1PZ5A 2PNDA 4PGCB 5F1SA 5JNYA 1SVCP 4GS7C 3LIZL 4R97B 4FS0A 4H0HB 4Q9RL 4PBVC 3KXFA 3AS2A 1KT2A 1TNNA 4ZSOA 1MFDL 4XBGB 1BWMA 4NWUH 1X5HA 4QRQA 3GI9H 2MMXA 5IV2A 3EUUA 2HLAA 3BH8B 1N2RA 4ACPA 4QXWA 4K3EH 1Q9LA 1A2YB 3O4OC 3K0WA 4EI5A 4NT6B 2R23A 3DVNB 4RFOL 3KPOA 3WS3B 4AQOA 4LOUD 3FOLA 3MRFA 3PP4H 4MD0B 1HOCB 2Y72A 5C09D 4PTTA 4XPBL 3VXSE 2W65A 3W39B 1IAOA 4P2RB 4G5ZH 1EZVX 3DRTB 2CKBL 1XGUB 1OGTB 4HWZB 4OJFH 1OB1B 2YZ8A 1T2QL 1EEZA 1MLBB 3HZVB 4Q9RH 4YXKL 4RNRA 2Z0BA 1U8QB 2QEJA 4UOW1 3DX6B 5IFJA 5A2KH 1ZHLB 1U3YA 1GGUA 4HWBA 4XMKL 3BXNA 3ZLQC 3ZYOA 1YYLL 1IAIM 4MD0A 5E6YA 1K6QL 3QFJA 3PQYA 1I1RA 5IK3B 5T1LD 5D7JD 3PQYD 5DJ2B 1WC7B 4XXDA 3SDCA 4UV4H 4MSWA 2OTUB 4YBLC 3CZJA 5ICXA 5C0CB 5DK0B 5GJTH 5DEZA 1G7HB 4I48A 3B9KA 4JZOB 4J3UA 4MCYA 4Y5YC 3SE3A 1J11A 4K3JH 3D39E 1OL0A 1SEQH 3VXME 1XR9B 4X6BB 3O8XB 3BI9X 3MYJA 2BDNH 4KUZH 1CL7L 1KTRL 2UWEE 4MJ5A 3TNMA 4MHHG 4HDIA 3V5DB 2WIIB 4HX1A 4Y5VC 5JZ7C 4JZJB 4JFQA 4IS6B 3CFDA 3ZYJA 1OGAA 5GGVY 2HT3C 1KYOK 1E28B 4XZUA 4DEPC 3GO1L 2VDMH 3KPNA 2X1QA 4OZFG 1WV7T 4KKLC 3Q1SL 1W72A 4NNPH 1J1PH 3QZWG 1NAMB 3P9LA 2RB8A 5ICYA 4M43L 4NN7B 4ZO7A 4MJ5B 4NPYA 2F19H 3KPTA 5GJSL 4QWWD 3V8CA 4PRIB 3CVIH 1JWSA 5I1GH 1CDGA 3PGDA 3RPKA 1LP9A 3MROB 3MRGA 4LHUB 5IIEB 4Y4KC 3QJHA 2V2WB 4F58H 4F2MB 4LSUL 3OXRA 4NO2A 1Z9MA 4OZFH 4KRPC 5IMLA 1R5VB 4X99A 5D7LE 1ZXQA 3ZTNL 1FNSL 1H5BC 3S7GA 1GSMA 4JLRA 1MHHA 4WWKC 2W9DL 1X4YA 1X7QA 2UWEF 4S1SH 5LGKA 1FFOA 4Y5YB 5DS8B 3T4YA 3HPLA 4HUWB 4GRMB 4G9FB 2CO6B 3ECBB 4OIIL 2HVJB 3ILQC 4OT1H 3JWDC 3QCTH 5DI8B 1F58L 2OTUA 1F4WL 3NZHH 4OZ4B 2ATKB 4NOFA 1BD2A 4U1HA 2F8OA 3MXVH 1FV1B 3VRIB 1OF2B 3H9SD 3IFPA 4D0BB 5ITFA 4XVJH 1GC1H 4P2OA 3BDXA 2CSPA 4KUCD 4JFYA 4M61B 2BVOB 3BW9A 3PL6A 1U6AH 2ATKA 4NYLA 1KCVH 1XR8A 5GGUB 1R3IL 4K23H 5B3NA 2E6JA 1E4XL 2RIKA 5BRZD 3QDGA 3F5WA 4G3YL 1U8HA 3E6FB 5DYOA 5HYJE 1DDHA 5J11C 3VFRB 2AI0L 3D87B 5E5RB 2E8YA 1AGCB 1MHCA 5E94B 5JOPE 3QPQD 4KMLB 4I0CC 5F7YC 3UTTA 3T0BA 1TJHH 4I9WD 4OGAD 4UT7H 3IDMA 1CGXA 3O6LH 3HZKA 5C8JA 2VLLB 3V6FA 4M7ZC 1VFBB 1KLFA 5D1ZB 2E27L 4PB9L 5FYJE 4XP6L 2R4SL 1FQ9C 2GK2A 2I9TB 2R15A 5FYKU 5DWUH 4CU7A 4ZO9A 5BV7B 3K8KA 4PV8A 1YEGH 2DLFH 2GITB 3EJYD 4M4PA 3EJZD 4D9RE 3DURB 2PW1A 1SJEA 5T1DL 4JFPB 4YFEA 2JCCE 2DQCL 3VXUA 5KW9L 4HUKB 4YHLH 2H9GB 4BFIA 2GQHA 4LLUA 4MXVF 4C57C 4P2CG 3WXWL 4XC3L 2PW1B 2XXMB 3V6OE 5F21B 1WZLA 3CLEH 4MAYD 3ARFD 3N06B 1CE1H 3VDCA 4NO2B 1F3JA 1QQDB 2V7NA 1MY7A 1QLRA 4JB9H 1FG2A 3VXRA 1C16A 1YMHA 2YA0A 4R2GD 4F7CB 1KJVA 4Y1AB 2MQCA 3ISWA 1N7ML 1U58A 1U8MB 5LBSL 5KW9H 2R2HB 4HIJB 4YHIA 4QRPD 3MREB 1VA9A 2YBRA 2CIIA 4LVEA 4N8CH 3SQOL 4X6CB 4NKIH 4GBXD 5D2NA 3TO4D 4AIZA 1V7ML 4PGEA 1B4JH 5SWZB 5JHDB 4LLMA 1YDPA 2GY7B 1KCVL 2UZYB 3NABL 1U58B 3TO4A 1F6AB 4XNQB 5I1JL 4I18C 2YOCA 4K9EL 1T3FB 1OAXL 1ODAA 2IEPA 2X1OA 3NCCB 5AYUL 3KJ6L 2AS5M 5I75C 2VLME 3QI9B 1LE5B 4ZFOB 4J3OC 5GHWH 4LEOA 4WW1A 3VG9B 3OPZH 3ZHKA 2AI0H 3X13B 4U0RC 1BF2A 1KLGB 3AY4C 4PJXE 1ZT7B 1NFDB 4NO3B 4N5ED 5DA0B 4IOFC 2W0FB 4XVUD 5ICZA 3ULVL 3IKCA 1FNFA 3O8XD 3MJ8B 5C0FA 1JMXA 1TQCC 1A9EA 3UBXI 1L7IL 2QSVA 3TZVC 3U7WH 1JNLH 3QI9A 4MNHB 5HVGB 1JNNH 1RZ7H 3CDYA 3UTTB 4C83A 3GHEH 1TQBC 2BNQA 4LCCB 2BNQE 4OGAC 2O61A 3P73B 3FQNA 3CSYB 1ND0B 1XGTB 4FQLH 3G6AA 3BRFA 4CVZA 1T5WB 3QA3B 3U4EB 1L0YA 3EDDA 1VFBA 3MXVL 4WV1B 4KHXH 1OTUD 5BW7C 3E6HA 4JO2H 1UACH 4YHNB 2R69H 1KNOB 1YNLL 3QWQB 5C0JA 3K4AA 3BHBB 3S96A 1VHPA 3NAAL 5DQJA 1JPFA 3AMLA 1OM3L 3PIQB 1HEZA 1LP9E 4KZDH 1A3QA 2DD8H 5LGHL 1MFDH 5HGDB 1MPAL 5IJKC 1YEKL 1MLCB 1NBVL 3QEQD 2ICWB 5IW1B 5TQ2H 2E7LA 1MREL 1INEH 3H9ZA 1M05A 3MLRH 3DSFL 4MA8H 5LCVL 1G6VK 4JDZB 2BMKB 3C60C 3JV5A 4KRPD 4K8RD 1YEDB 1G7LB 4GXUM 1TENA 3AM8A 4L8DB 1EAPA 3EYQC 4C56D 1SJHA 3DMMB 3QQ9C 2PYEA 4WV1C 2V5YA 1D6VH 5C0NC 3MRBA 4PG2C 5I1KL 1FJ1B 3L7FB 1JF1B 4LOUC 4Y5XA 4B50A 1S9XB 1CT8A 1KIQA 5CJQL 1MCOL 2WUBL 5D1XA 1A6TB 1A47A 4YHML 2QQNL 1QFUH 1HKLL 4HT1H 4K94H 3FAWA 4QTHB 2IADB 1DVFB 2ADJA 3RKPA 3QWOB 4NSKB 2ARWA 1W72H 3K1DA 3UJJH 2A6IA 5AWNH 2YA1A 1WWAX 3EFFA 1IC4H 4S1SL 3RKDD 1Q9OB 1J8HA 1KIPA 3BWUC 5BRZB 4PJFE 1MEXH 2XTJE 5ERWA 4IIQC 3WFEL 3V6OC 4HKXB 3MRCB 2NX5A 1LD9B 1QFWL 3MFFA 4R4FH 3W11D 1A7NH 3V52H 4K3DL 4UDUB 2QQNH 1L6XA 1B0RA 1WT5C 2CK2A 4PREB 3Q6FA 1CFSA 3AB0C 2MJWA 4UOJA 4FQLL 1PD6A 5IVXA 3NCJL 4NZDA 2W9EH 1MRCL 2VDQL 4WW2F 5IFAL 1DR9A 5AAMA 2MFNA 1S7XA 2J8UA 4UT9L 5IQ9A 1I3RB 2FRGP 3TFKD 2VDML 2GJZA 3MRFB 1J5OL 5EU3B 3H3PH 3NPZB 3DARA 5HHVH 3SPVB 3TO4C 2NXYD 3DXAA 1ZSDB 1XIWD 4A2LA 2CKBH 2JIXB 1T2QH 3U4EA 3ME0A 3V52L 1U91A 5I1HH 3O6FB 4NQEE 2MQ3A 4K71C 4QGYA 3OGCB 2BC4B 1QYGH 4WI9A 4ZUWA 1IGTA 5C9JA 1D9KA 4GRWE 4LK4A 2VXVH 1HQ4B 3MV8D 3LQZA 1CCZA 5IFJB 5SWSA 4JN1L 4RIRB 4QT5A 5JNYB 5C0AE 5H35A 4OZFA 5IEKB 3ARFB 2C1PA 4M7JH 1P4LA 4ZUWB 1BIHA 4GW5A 1JZ5A 4OLZH 4TSCL 4O2CB 1F00I 1BBJB 3DI3B 3VI3F 1QSEE 2YD9A 3L5JA 2VDLH 4KRNA 1MCOH 4HG4K 4K7PL 1MQKL 4BZ1H 2HT4D 3WL9B 5I1CL 2H1PL 3MNWB 2AV1B 1T1YA 2LABA 4PJEE 4G8IA 3MMEA 3WUWA 1BZQK 1J1OL 3HAEA 3QXDB 5D5MF 3TIDB 4KTDH 2YKLH 1P4LB 1YNTB 1VENA 3EJZC 4O51B 5HHOD 3LAFA 4QRRE 3S37H 3VFNB 1OTUC 3CVHA 4JFDE 3HI6L 2AP2A 1B0RB 2FECI 2FL5A 3CLEL 2R29L 3LKQA 5EO9B 2BZDA 4AT6B 4XPGL 3TVMA 5HD8C 1EHXA 1OP5H 5DJZA 5DZOA 3L3OB 3CXHK 4YHZH 1IC7L 1W2KT 2KDGA 5SX4H 5F1KC 4XWGH 1KB5H 1TQBB 3VU2A 1DZBA 1REIA 1PG7W 1EUTA 2BRQA 1YJDC 4U1SB 3CNKA 5D1QC 4I48B 1K3IA 1UM5H 3U7YH 2NW3B 3SDXF 1CL7I 3NFSH 2DS4A 2NZ9D 2YXFA 3PGFH 1T03L 3WUWG 3BPNC 4QHKI 2OYPA 4N0FA 5F1NA 4JVUA 4UDUA 4P9ML 5FKPB 3HPLB 1N8ZA 4LCIH 3IU4L 1TNMA 2OK0L 2WMPA 4IS6A 4WUKH 2BRRH 3ZDXF 4OZIE 4XAWL 1RZJC 4UAOB 4S11A 2CR3A 4Y16D 4ZPVB 3JWNC 5T3XE 1MCIA 2VDRH 3ZE2E 3UYRH 3I6KA 1NBYB 3TYFA 4PGDA 2Y1VA 2JLLA 5C3TA 3L3IB 5TDOA 1XAUA 3L7EB 4TUOA 5IROC 3RUGA 2EYSA 5HDLA 2I9LB 3FO1A 1RJCA 5DVKA 1A6ZB 3ARPA 4XXCC 2AGJH 4Q9BA 1N5YH 1OP9A 1BFSA 3O0RL 2D7NA 4YUEH 4NYLB 2X2YA 3IU3B 2XI9A 4P2YA 3H3BC 1UWEL 2RQ8A 2DM2A 4Y19A 3GSVB 2J8OA 3WE6A 3NN8B 4HIEA 1DQDL 12E8L 4LSRH 4EBQL 5SWZE 3VFRA 5HHQB 5EC2B 2X40A 4JZNB 4ALAH 1NGYA 2L0DA 3B2VH 2NTSP 1W0WA 5GS2D 2NY2B 5HYJB 4QRRB 1BVKB 2DKMA 5DJCA 5D9SA 5ITBH 4YWGH 4Y19B 5I9QC 3LEXA 1A7PH 4M1CC 4X9GA 3TFKC 1AO7E 1NBVH 4J3VA 1FZKA 4MQ7B 1NMAH 4MQXC 4Z7UF 2GKIA 1P4BH 2P5WA 1I7TA 5HHXH 2VZ3A 3IJYB 1PEZA 4AM0B 2OJEA 4OZHA 5IHBA 3PJSB 5EOQH 5IKCB 3OL2A 4UTAL 1QLEL 3J8F7 5TF0A 3FZUC 5F93C 1BLNB 1KUMA 2ICCA 4FFYL 4RQQB 1KULA 4NC2B 1RQ5A 4YBLB 5HYEA 4YHLL 3DX7B 3L5WB 1SVZA 2EDFA 3TH2T 5D9SB 3BDYH 3FQWA 2V9RA 5DJZB 3MUZ1 2B39A 5IHZA 3GM8A 3I6LD 3DPBA 5D6DA 5T1LA 1FFOB 4LRNH 4Y5YA 3S8WA 2X6MA 2VXTL 2MTPA 4NM8L 2COQA 3KPNB 2R1WB 4UZGA 3K1KC 2VWEE 4Y2DD 2CR6A 1LEKA 2AKRB 4OZGF 3SE8L 2IQ9H 4R90L 3UTSD 2PR4H 3DIFB 3QUMH 1N64L 3HHRB 4WUUD 5K9KB 1HXYB 4F7CA 1I9JL 1LP9B 3MROA 5D7SL 5ID1B 3AS0A 3VH8A 1ZLSL 4JRXE 1JNJA 4FG6D 1FSKC 4X6DB 2AEIT 4G6JH 3LH2L 4Z7UE 3JWDH 2AKRA 3MV7D 2R0ZH 1AJ7L 1S9VB 3NZ8A 1BGXH 1QPPA 5I74B 1ADQH 3NCYS 4PGEB 1T3FA 2UZIL 2Q3ZA 3BT2L 3RX8A 4OQ1A 1J1OH 5J6HA 5D5MB 2OJZL 5TPWH 2VLRA 1A1OA 1VEMA 1S9VA 4FTVB 3NZ8B 5FECA 5FO7B 4OM0L 2DQTH 4YLQT 3D39D 5KSAC 3I02B 2AEQL 2KZ1B 4GRLC 3B9KD 1RUML 3MJ9H 3S97C 4YQXL 4XAKD 4R2GC 2BCKA 4OZGE 1FVEB 4OLWH 1F58H 3KJ4B 3NZHL 1YQVH 1Q9KB 4KHTL 5B8CC 4KRPB 4E5XA 1T21B 3O2VH 3BWAB 5I8EB 3QNYB 4GRWB 3GHEL 3TBSA 5E2TL 4KDTC 2V2XB 5DJ8A 5A40E 2LU3A 2N7AA 3UJIH 3VXOA 1M7DB 2AJ3A 4D8PA 1U3HD 2C3VB 5DJCB 5M95B 3G6AB 4NN7C 2ENSA 5INDB 1DLHB 5FHAL 1T5WA 5C6PB 2J8HA 1JPGA 1UFUA 4PJ8A 4NQUA 4WTWA 3SE4A 4L3CA 4OFIA 5MEQB 4LPCA 4OZHB 5KJRH 4Q9QL 4HFUL 1W0VA 3SGKA 1KENH 4GQ9H 1FNGB 2P24B 1T66C 5A2FA 4E0RB 2W0FA 5ICZB 4MXWL 4DOHB 3BGAA 5E4EC 1JGDB 5CBAB 4XT1C 1RK1B 5C7XH 2X9YA 4JFFA 2YD1A 2X4TA 4DUWA 3FQRB 2WV3A 2F54E 3O81A 1IC1A 5F9DC 3NCYP 2WBJD 4XAKE 3F12A 3P73A 4HBCL 3B5GA 4H20H 4JJ5B 4UT6L 3CFJA 1BAFH 5FYJH 1HH6B 1NMBL 2WWKT 3BP4B 4PD4K 1VKXB 4X6CF 4AY0A 1QRND 2DQIL 4HIHB 1MFNA 3SDCD 4M5ZL 1EAJA 5JHDA 5MHSD 4Y5XB 5B22A 4GAYA 4YXHH 4K3JL 5MI0C 3ET9F 3IDJB 2W0PA 3B9VA 4MD5B 1CICB 4RMVA 1CI5A 5JR1L 1I1CA 5KSUB 2ITCB 4K94L 1NGPL 1K5NB 3U82B 4HUUA 4JREB 5JQ6L 2B4CC 1QD0A 3RX5A 4NBZB 4U2ZA 2VL5B 3VXRB 4HIHA 3TBSB 4OFKA 4ZQKA 5EU7E 2GCYB 2QHRL 4PJIF 1BZ7B 5CZXD 1HCVA 3JBG7 5JDSA 3RNKA 1GXEA 1CE1L 5GS0L 3IXAA 2MNUA 3SCMC 4LLDB 3UAJC 3M07A 5E8EB 3MC0A 3NA9H 1YEJL 3K81A 4YXKH 3MUY1 2OS7A 3A6CL 2VDLL 4ZQKB 4TOYH 4WUUE 4JFEB 3A6BH 2J8UF 4QRUB 1E4WH 1MCKA 2VL5A 3RGHA 1TZGL 2DQUL 4ZUTB 2EH7L 1KLUB 5JW4N 3T65B 4P4KD 3QFJE 4FQXC 4XCYB 1NAKL 4YGVA 4DGIL 3M8OH 4GO6B 4OCRL 4G6ML 5HDBF 3OR7B 2VERN 3RWCB 5HYSA 3VG0H 5MENA 4QNPF 2A38A 4OD2B 1Q72H 3MNVA 4PP2A 4POYA 2AABL 4NFDA 3ARBD 3L1OH 5GRXG 3ZZ1A 4H8WH 2NQCA 1I85C 1Z2KA 3OKOA 5C0EA 4GRLB 3TPUA 5C0CD 4WI7A 4TNVK 2RAMA 3OKEA 4RFNC 5C0AD 2NNAA 3FAXA 4L8CB 1JNNL 3HS0B 3C6LA 4GAYB 5HPMA 4ZUVB 2AERT 4XVUC 1VGEH 1VFAB 5T3XL 1K4DA 4F8TA 3KPSE 3ARFA 4H1LB 4WFHD 4Y0GA 5CEXB 3HZVA 3S5LG 2XWJA 2LQRA 1FH5H 2FWOB 1EHAA 2X1PA 3E1F1 3GI8H 4WDIA 4H8WL 2PTVA 5HPMB 4HWEH 3QRGH 3LKNB 4X7TA 4NGHH 25C8H 3GJFH 5DJAA 4LSDA 3QIUA 1GZPB 2FIRT 5DJ2A 3LQAH 3SKOA 4QNPE 3X3GH 4W68A 2KQNA 4YPJA 3C2SA 3QFJD 1XIWC 4KTDL 3S4SB 4UQ2A 4JM2F 4WEUD 1RK0A 4IRZL 1LILA 4UIMB 3NH7L 1OAKH 2AK4D 3GK8H 3QEGL 1FNSH 5DJAB 1PSKH 4MD4B 3O4LA 4AEFA 3LKNA 1WQVT 1BD2D 1WISA 4Y4FA 1UKTA 3CSBA 1U8NA 4DKDC 1KIRA 4F57H 4JGJA 2VR4A 4JY6A 2WUCH 3C60D 1FLRH 1BZ9B 1BWWA 3ZTJH 1T04A 1UCBH 1NLDL 3WIHA 2JJSC 2ZZUT 4GRLD 3WLWD 4PY8I 2Z4QB 4X7FC 1OQOA 4AG4H 1NFKA 5E00B 5EB9A 3M45A 1JNHA 4U1IB 4UUJB 3BP5B 3T1FB 4OIBA 4QRUA 3E3QE 2O5XL 3PGDB 4FQIH 4GSDH 4S1QL 5L2KE 1CTNA 3HZMB 2NY0B 4NCC1 4MJIA 5FYJL 5IMMA 2IAND 4KDTA 4BK5A 1XGPB 4ONGL 3FFDA 3MRCA 3N50A 1MHHB 1FVCA 3TIEA 4HAFA 1YEFH 2GTWA 2OL3L 4DKFL