1YEWA

Crystal structure of particulate methane monooxygenase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
382
structure length
382
Chain Sequence
HGEKSQAAFMRMRTIHWYDLSWSKEKVKINETVEIKGKFHVFEGWPETVDEPDVAFLNVGMPGPVFIRKESYIGGQLVPRSVRLEIGKTYDFRVVLKARRPGDWHVHTMMNVQGGGPIIGPGKWITVEGSMSEFRNPVTTLTGQTVDLENYNEGNTYFWHAFWFAIGVAWIGYWSRRPIFIPRLLMVDAGRADELVSATDRKVAMGFLAATILIVVMAMSSANSKYPITIPLQAGTMRGMKPLELPAPTVSVKVEDATYRVPGRAMRMKLTITNHGNSPIRLGEFYTASVRFLDSDVYKDTTGYPEDLLAEDGLSVSDNSPLAPGETRTVDVTASDAAWEVYRLSDIIYDPDSRFAGLLFFFDATGNRQVVQIDAPLIPSFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords particulate methane monooxygenase, B subunit
publication title Crystal structure of a membrane-bound metalloenzyme that catalyses the biological oxidation of methane.
pubmed doi rcsb
source organism Methylococcus capsulatus
molecule tags Oxidoreductase, membrane protein
total genus 95
structure length 382
sequence length 382
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2004-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04744 Monooxygenase_B Monooxygenase subunit B protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1yewA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 1yewA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 1yewA01
3RFRA 4PHZA 3CHXA 3RGBA 4PI0A 1YEWA 4PI2A 4O65A
chains in the Genus database with same CATH superfamily
2FB4L 1KXTB 4XCYB 4P3CH 1GV9A 3ZDWA 2J25A 5K0UC 3NRFA 1L7IH 1ZRIA 1OHFA 4DK1A 1HI6B 5C0CE 1XH3A 1WD3A 1AD0A 2K6ZA 4J3UA 5ABDE 5M95B 2JJTA 5BZXA 5C09B 4FJCC 1MCRA 4RFEA 4MMZC 3QDHA 4R9DA 4M48H 1XSKA 2VN4A 3J7MA 1NGXA 4NUMA 2VTXA 3QNYA 2NUTB 1QR8A 1EAQA 4M93B 4RHV3 5JXAL 1QXJA 5DZ9A 4MZRA 3KZ4C 4QPGB 3ZRVA 4AV5A 2IFWA 4FZ8L 2JDUA 5F97E 1FNAA 1MPAH 2UWEB 2PHXA 1SACA 3VZJA 5L4MA 2XT9A 1NCWH 3MRJA 2AQ2A 5DFVD 1JPST 2P1BA 3IPVB 4XRCA 4JO2H 2BVPA 3R4DB 2IWEA 2LGWA 3CC5B 1TTGA 3L1OL 3WIAA 5DAVA 4IDLA 2K3TA 3MHHC 3TN0B 2H3KA 4YJ3A 2CO7B 3EOYG 4YHLH 3VWJB 3GYDA 1N2RA 1C12B 5E6YA 3RJQB 1Q90A 2D4DA 2ZUXA 1HQNA 1Q8MA 2P43B 1OM3L 2Y4SA 3MLLA 3GXDA 2L8AA 4HJIA 4W68A 4MWFB 4NT6A 1BQ0A 4POYA 3P9LA 3NIDE 3HC4L 2HKFH 5BMFH 5CGMA 1E5CA 3X1GA 4NRXA 5D1XB 3TFKC 4JFYB 2B5IB 4DR3O 2A4CA 2WUCL 1ZTXE 2YBRB 3ACHA 1VB9A 1OP5H 5A2QN 1W8OA 4GQQA 1DQMH 1INEL 5IV2B 5DZVA 4TQPA 1VENA 3PQYA 3WP4A 4YW1A 3NJLA 1BQLH 2JJ2G 1JG9A 1FGNL 3F6IA 4LHJB 3L4ZA 3F7PC 4XNUH 1CFQB 5I0VA 4MXQD 4JGMA 2KYIA 2EXWC 4IHOA 4QJ5B 3D3IA 3WAJA 4MNGB 4DUXA 1SMVA 3WSOA 4EB6B 5DRWB 5DFAA 5TQ0H 2C9AA 4GMSH 4QGLA 3CX5F 3BEVB 4NZTH 2LABA 3AS3A 3EGXB 4HBCL 2V72A 5AC92 4IMLB 4Y5SA 2VVDA 3QEQA 2HSIA 4DP4X 1EUUA 1O9VA 3CLPA 1WHOA 3DROB 2FJGB 1KP2A 1GH6A 3U6RB 4LLMB 1QLNA 1TF4A 3QT2A 3RFZB 5AUMB 4CYDA 4IL6Z 1HZLA 4GA9A 3EJTA 3RTQB 2YS8A 2N0KA 4XDOA 1DBJH 2WQUA 4RIRB 3A8TA 1CJYA 2KQXA 4RRPA 3OMAB 1PDKA 4HIJB 3U07A 1TTAA 2GTWB 4CU9A 1PZAA 4NJAL 1HILA 3DX6A 3P3NA 4IGBA 1J8KA 4MS8D 1BEXA 3MVSA 5LGHL 1V05A 4WWNA 4Z7NF 2E7HA 4JB9H 3V5KA 1M90W 1JV2A 3L3HA 4PS8A 3I5DA 1URZA 2DI7A 3CP1A 4YHHB 3MV8D 5FMCA 1J3QA 4FLUA 1KIQA 3MBEB 2VZOA 4A7VA 5EIBD 3Q2CA 4PY7A 4RR3A 1XMEB 1REIA 3DTUB 2Y1VA 4U0RB 2H26A 3TPUB 2VBPA 5KS9E 3E8UL 3HG1A 1XE8A 4LIVA 3SHRA 1AR61 2WO2B 2NLJB 2Q87A 1BXUA 1DHKB 5ACMA 5D1XE 2BSKA 2HEVF 4M61B 1CBVL 5IROD 1MIMH 1MLCB 3ZHTA 1KIRA 2XZCH 1ORQC 4Q0UA 1EJOH 4BK4A 1ENQA 5JH7A 2OMYB 1FUNA 2YOAA 5DUBA 3K46A 1OLZA 1J9CT 1W6MA 4LARH 2D43A 4ZONA 3IGAC 2IBZX 3B2VH 4L8DB 5ENWB 3TN0C 1N34B 4GBXA 2PHWA 5F32A 1PFCA 3KL5A 2LP7A 2JNZA 5BZWB 4E4DX 4UQEA 2CK0L 3S48A 4EUPG 5EEYA 4AQTA 3TBVB 2VKWA 2PLV2 4M6AA 2DTMH 1JR9A 1XEUA 3D0VA 1NBZA 3IE9A 3H3KA 5GISH 3N9PA 3VZNA 4I2OA 2JMRA 1AQDA 4KMLB 1CDYA 3CFTA 3MROB 1DE4A 5A32B 1KBHA 3FSWA 3NABH 4HLEA 3NJZA 1R3HA 4UV9A 3FSOA 2GITB 3OAZK 5D1XC 1U3HC 2QHRH 4KV5F 4C4KT 3IXAA 4PWFA 1SCRA 5J1AB 2HKHH 3PVBB 3L5XL 3LEVH 5AC93 4Q0PA 5IVEA 4TXVB 2EJ7A 4XO5A 1E9QA 2YD6A 2ZCZA 4OQTH 4XNAA 1O4YA 4CAGA 3QAQA 4Y4HD 3ZYIB 2X3AA 3ARDA 3ZX6A 2E32A 4U3XA 1V3KA 1UCBL 4E42A 5KZCD 2CL2A 3ACIA 3MBWB 3HKEA 5D7LB 4N8MA 5IGXH 4NQUA 3TWYA 1W9YA 2DJVA 4YHPB 1SXCA 3O1VA 5AWNH 1SLIA 3FBYA 2DYPA 2J2ZB 4R7XA 1DZBA 4OGQC 3VXME 4Y5XA 4GKKO 1QWHA 3ROOA 5FXCH 4KHPB 4NN5C 3MFGB 5FM4A 2XJUA 1SRYA 3KCPB 1MDTA 3CDFA 3GM8A 2CSPA 2R1YB 3NP3A 4FNQA 1JZ4A 5ACZA 5FPAA 4WCEV 1HN0A 5ITFB 2QR0A 2VSDA 3B8YA 3PLYA 4FTVB 4Y4KC 3RFZC 3ROUA 4KZDH 2PYEE 4UT7L 3TV3L 5JXGA 3WFHA 3CPUA 1OCWL 5FZHA 3OAYK 4LSTL 3SQBA 4AEIH 2FE0A 5AVRB 4N6QA 3BJLA 2WS92 3H6JA 5DU7A 3WJJA 4EBQH 4PDWA 3RIAF 5BR8B 1AO7A 4L3EB 2IH3C 1KGUA 1V6NA 4XMLL 5EH1A 5L9RA 3IDCB 4XBFA 3HZ3A 5FWQA 3E5UA 4X1KB 1MWAH 1OQEA 1UYWL 4JQIA 2DCZA 1KGWA 1AGDB 3O0WA 3VGBA 3QPQD 2X0UA 1ZVSB 2J56A 3G67A 2OKXA 5LCVH 2EYSA 3NACL 3AAZA 1ET8A 3P40A 3EYSL 4H25B 5HGAA 5INCB 1EBAA 2XR4A 4KGGA 3QPKA 2NNUA 1YIFA 2FQPA 4HEPG 3QDJE 3RX8A 4FTBA 3QR2A 3MLVH 2X44D 2VDOL 3MTRA 2CDOA 2XKPA 3CFKB 4CRPA 4JJHA 1N70A 2OMUA 2CHNA 3ATAA 3CE2A 1LO2L 5CWSA 2MCPH 3B5TA 2EUXA 4LK7A 1L0YA 4S2HA 4NB7A 4ZMTA 1HRV1 1VRBA 1MHHA 3E8GA 1N0XH 2ERJB 2BSRA 4EDWH 4DV2B 1AQKL 2V2XB 3I74A 4I85A 4UIKL 1AR93 4U7OA 2AFNA 5DZEA 3MW4A 3VZLA 5MENA 3QUMH 4N9IA 5FKPA 2XHBA 3UMTA 3DYPA 1MJJB 2O6EA 1RGSA 2BK8A 4Q0VA 5DRNA 3VE0B 4JPKH 3DGEA 5J11B 4HF5L 3RFRA 4U3FH 1USQA 2NY5L 4DK3A 2JJVA 1FNZA 4XF3A 1YRKA 3FCUB 4J1UB 2V2TB 2FBJL 2PTUA 3QPXH 3O6FC 1IGOA 3IDXL 4FTVE 1QR4A 2HT4D 5EN2A 3RWDB 1GPOH 3RZCD 1ZCRA 2WNXA 3MUGB 1NCQC 4X6DA 4HSJA 2XWXA 2EILB 4KXCA 2Y6LA 1KIPB 2D3PA 3G5YA 4ZUSB 4FG0A 2OK0L 2XLAA 3ZM8A 1BG9A 3RVXD 1K5MA 4LEJA 1ZBE2 4JY6A 4HPOH 4QXWA 1C08B 2ODMA 1R6NA 2ATAA 2UWBA 4IQPA 1H4HA 3SO5A 3KLHD 5JPNB 1BXXA 1LO3L 3OHMB 2WS93 2RN9A 3OOXA 2L04A 4FAGA 4HIXH 4PN6A 2P6HA 3FHIB 1MPAL 2W0KA 4WW2A 2A7AA 1LMKA 4A3ZA 1AXIB 1T6WA 3H9SA 1NA1C 4QY8A 2QTSA 4MDJA 4U1KB 2V5YA 4A42A 4P4RA 3MRQB 5EU5A 4M3CA 2Y6FA 3HUJB 4G9FD 4I9XA 4UM8A 3W56A 2IU3A 2B4CC 3IBEA 2NW3A 1UO9A 4X7SL 3PUIA 4OIFA 1TTRA 3WF1A 2X9WA 1ZLWK 4ODWA 1WBYB 3UPCA 5IE9A 3VFSA 2O5XL 1DQVA 3BXNB 4KX9A 4I1NB 4KJQD 4QTFA 1FNYA 3LQCA 3IJSB 5DS8A 2BDRA 5K7PA 1SBBA 3WP3A 2OTWB 1ZSDB 4ANXA 3IS1X 3L2NA 4OGAD 1GSLA 2QSCH 3RT3C 2WO3A 1G9AA 2JQZA 4M7LH 3VFGL 3MRHB 1DEEA 4MMXB 4XC3L 4XOAA 4MHUA 3SDXE 3UL4A 1V6KA 4OFYA 4AH2A 2WMPB 2APFA 5IMMA 3CN2A 3KT1A 5IVFA 1TYRA 1YEEL 4KKBC 2K1MA 4L4TB 4OZGE 4YSQA 4WIQA 4J39A 4AG4H 4UILH 4V2BA 2VLRB 5I17A 4E9XA 4ZFOB 5C07D 5LLIC 3FWEA 4KBZA 4YN3A 4NXSA 3AW5A 4Z3IA 3DKWA 4NUGL 2X2HA 1RTVA 4XNUL 4E4SA 1BS3A 2Q0AA 1HZHH 1QNZH 5IB2B 5ERLA 5IYYA 1IKNC 3U4KA 3D5OA 2OJZL 3TZVD 4XVJH 3AG4B 4I48A 5BZDB 2BCKA 2EE0A 3NN8B 4GMSL 4AI8A 2ERJC 3DX8B 1HWWA 5EBWA 5TDOA 4F6EA 3UO1L 2BRQA 4F5CE 3CLWA 1F3DJ 3HAGA 4Q9CA 4TRPH 1R47A 3RBGA 3RE0A 3ROLA 1VB4A 2IFRA 2Q8VA 4HLZG 4P5TB 1PJ9A 2EDKA 2JIZG 4LF7B 2VXUL 1R091 1RYYA 1AYN1 3MYXA 1A7RH 3GXMA 2YFOA 1X5KA 4EFBA 1LOBA 5H2FZ 2VDKB 4DR5B 3HI1B 4PRID 4RFOH 5B1JA 3SQOH 3LZNA 3V2AR 2UXBB 1ZBE3 3PVEA 2WVTA 4H7VA 2F23A 1DBKH 1P4UA 3PGCB 5D70H 3IDNB 4F37K 4TQFA 1TQVA 4E2LA 5BMVA 4GRWB 4UB8Z 2F5BH 3AREB 4LSSL 4NZUH 4Q6YA 1AZBA 1S9VB 3TYFB 3I3QA 3LN4A 5DABA 4NN6C 1ZL8A 1ZHLA 3K8MA 3GGWB 5AVYB 3QRLA 3T3PF 2FWUA 2K9PA 4M1GL 2GTZB 2K4AA 3BPNC 4GFXA 5B8CC 3MFFB 2ZUTA 4Y20B 2WYIA 4NSKA 1QYGH 4PQQA 3IDYB 1UU4A 1W8ZA 5CA6A 2A83B 4M7JL 1H9WA 1OH3A 1ZRDA 4R8WL 2DTWA 5C3TA 4OIAA 4GUOA 2R56L 5I1HH 2V4AA 2OTJV 4XVUC 4DTGH 4ENED 1RZFH 2WSKA 5JPNC 1KTJA 1ZEAH 1KCWA 3TWIA 1U9KA 2HG5B 2OCFD 3DGDA 1N32O 4RGNE 5A2BA 3LRGA 3T1LA 3C5ZB 1ACXA 5LY1A 1AKJB 2J1UA 2I9TB 3QR0A 3FU7A 1WFIA 1FAYA 5ACA1 1PS3A 5DLLA 3LDKA 2PXYD 2GUZB 1AL23 1JK8B 4LASL 3NFSL 1UURA 4G8IB 1O6UA 1TTBA 1OAQL 5D1QD 3VDAA 5FZ8A 4AQ2A 1KWGA 4R9AA 4HV8B 2X1OA 2LFGA 1QNYA 4U31A 4YXKL 9CGTA 1BYHA 3T4ZA 4ZD3H 3PNWB 3I6LE 2XPGA 4GH4A 3PFQA 4XPAH 2YO3A 2VQFB 3VAEA 4DXZA 5KSBF 4BZ1H 1BZOA 4ZW3A 3BESR 4JDEA 4CDQB 3NEOA 1RUI2 1J1TA 1JX9A 4AYDC 1U8QA 4X4ZA 2RDNA 1YITV 3N2GA 2Q86B 1CFNB 2P8LA 1B04A 2Q6WB 4HKOA 4QRRA 3QORA 1TJGL 2OKMA 2BQPA 3QCVL 3CRMA 4LCUA 3X13B 4NQEB 4B4QA 5F6LB 1SBSH 4XAWL 3LEKA 5AB1A 1ENVA 5JJJB 3KMDA 1E4WH 1KPRB 4BFEA 4YHKL 1H8HG 1DQ4A 3VBHA 4K2UH 4N0UB 3D52A 5D8JH 4WFFA 5DHYA 1PLGH 1MOEA 3ZDSA 2SEBA 3ST7A 1YY9C 4IK6A 3ZKMC 3WTVA 2UUAB 3L3DA 3VBRB 3AG4C 1U33A 3K7UA 2A9AA 4JREB 1FFOB 1RFDL 1UJ3A 2CKBH 5FY1A 4LK4A 1Z1WA 4XX1G 1CGPA 2KA3A 5ABJC 1DUYA 3B7MA 3MEPA 2HLAA 2VH5H 4HZLB 4RNRA 4X6DF 3WKMH 4FNRA 4KKAD 4PJ9A 4RZKA 1TZGH 4MV2A 2PR4L 4X8XA 3V6BR 3ARFD 5DQ0A 5LP6A 4FOYA 1FBIL 4PJ8B 1AR1D 3QZPA 5GZOC 1R0AL 4LOSA 2ZWNA 1W6NB 1FNFA 4AIXA 2WABA 1OE1A 3MLTA 2UZXA 1E3ZA 4G1EB 5C08E 4AOCA 4OX9O 1MJ8H 3FPYA 1FFXB 5LMNO 1CN4A 3P4MA 4QJ4B 4Z3JA 1SXBA 3QXVA 5CLTA 1QLEB 1N0LB 4OD1L 4KNQA 1GBGA 2X8KA 1MVFA 4P5SA 5E8NB 4WW2F 3FN9A 43C9A 3GEWB 1RUE1 1D5NA 2PO6A 4Q4EA 2JB8A 1P0SE 3MLRH 1KBKA 1WD9A 3CBJB 4WDIA 4AVIA 1FVEB 3O3EB 2FX8L 3BP7A 4W4NA 4LSDA 4DIQA 1WPXA 3HG4A 4NVPA 4TLKA 2ESVB 4TLTA 2VOKA 3ABLC 4Z7UE 3CFCL 1WZXA 2F19H 2V9QA 1PZ7A 3NNMA 5HD8C 1I4FA 4P59L 3KWVA 4EIBA 1D5BA 2H45A 3A4FA 2W47A 1RVFH 3IJYB 3ZYPA 4CP0A 1F86A 3C5SB 4K1ZA 3QIUB 2HG5C 1BQHG 3MOBL 2PHLA 3F7YC 3W38A 1RUI3 1H6UA 3C5ZC 3VBOA 4GT0A 1RI8A 4ASKA 1QJFA 4XP9H 3NCXA 3L1FA 4AQ1B 5D7JA 5DJ6A 1I9EA 1W0PA 4P9OA 2OCHA 4WI5A 2R8SH 4NJ4A 4OFIA 3WV0A 4A67A 4EDWL 5IEKB 5IQNA 3D82A 2BRRL 2YEZA 1IPJA 1CDBA 4IKKA 4U1JB 3OR6C 2XAGA 5BOZG 2ZOOA 4IRSB 5CS7A 5AVZB 1NBVL 2IXKA 2DQGH 2VBBA 4D7YA 3BE1H 3D4CA 3K5SA 5IT6A 2WIIA 2C4FT 3FULA 1JFFB 2DM7A 5SV3A 4R7VA 5FA3A 3VWKC 3GC3A 5B1BB 2UXDO 5IEHA 2IBGA 1IGJA 1O6SA 4XGZA 4R6UA 1V10A 3QA3B 4CDQC 1CU4L 1OF4A 1E43A 1RK1A 3UKMA 1G4MA 1Z78A 4PJAB 3KS0J 1RL3A 4PJCA 1IM9A 2BJML 2PI4A 1OB1B 3SPJA 3D25A 4LL9A 5FZMA 4XBEL 4XVTH 4HKXB 2WUBH 3WB1A 4LBNA 4XTRC 3PQYD 2D9QB 2FZ1A 3QJFA 4Q8KA 1T3FB 4KY2A 5T1JA 4EXPX 1QVOA 4N8VG 4QNPE 3MXVH 1INQB 1EAOA 3O4LB 3CZEA 1CIWA 4NIYE 2L0DA 4IL7A 2P5WE 4PGDB 1Q6UA 4NPLA 1TMQA 2OLDA 4RAIA 2Q2LA 2W9DH 3CDGB 3KWWB 3QG6B 3T2LA 2MCMA 2R2BB 5CJXC 4DO0A 4DEWA 2MEV1 2E75B 3S96B 5IG7A 5EDXA 1VMHA 2P26A 4QX2A 1R3KA 4PJFE 5E5LA 2OL3H 4YHIB 2K46A 3TIDA 3Q6FA 2ZDIC 2LE9A 3CD4A 3RDTB 1UA6H 1J58A 4NPKA 3NV3A 4K8RB 3O41A 2VTFA 5F2FA 2QWOB 4AVJA 4PJ8C 3ZO0B 2F61A 1SJVA 3IJ8A 2DVBA 1HJCA 4MNQE 4I18C 5DHVA 2Y64A 4JO3H 3N3EA 1ZDQA 4IGBD 3S4SA 2WGNB 3URFA 3TO4D 2A0LC 1JI2A 1LP9B 4NC1E 4NNYB 4NQDB 3KLLA 3BUYA 1Q0XH 2GP3A 4Q4W1 4ABMA 2HRGA 4DINB 4M7LL 1W0WA 3LX9A 4X7DC 3UZQA 3BRFA 1ZBA1 3HAEG 4Z0BL 3HG1D 3AABA 3IS0X 1IL1B 3GM0A 1FV2A 1EV2E 1F11B 1LD9A 1CGYA 1PG7L 2JQMA 1HK6A 1J0JA 1SJEB 4LFHG 5HYJA 4HQQL 3WCRA 2J5LC 1UB6B 4CCNA 1NC2A 3BFQG 2UY6A 2QGCA 1UQSB 4PJ5B 4BINA 3OPZA 1NAMB 4H20L 1JXKA 2FZ2A 2OYQA 1F2NA 3JD2A 5IW1A 4Q8BA 4DPRA 3NCBB 3LNEA 1UPGA 4MSVA 4YVSB 1AR62 2WN2A 3PDOA 2IBZH 1PSKL 3AWGA 3QJOA 4QKNA 4AV4A 5K0UA 4DB5A 4FOWA 2AP2A 1XC6A 3SYPA 4GBXD 5IWAB 4NC1C 4OGZA 4Y1AD 2I60L 2TRHA 4GUCA 2J5WA 3QZWB 4B41A 1DGSA 2JCCB 5CSZA 2G3NA 3T4DA 4AV0A 3BH8A 4FQ1L 3BOPA 1NC4A 5F2WA 3KVBA 5E8OA 1VRSA 4PGBB 2P24B 3UJIH 1JZ3A 2R041 4I7ZC 1LKNA 2G9FA 1XL6A 2Z64C 4JI3B 4RFOL 2AV7A 4TNFA 3GSQB 5IFHL 2J72A 3SQOL 2LTNA 2Y8KA 4YSEA 4NLAA 4W4LA 3O2DL 4CVUA 5DUWA 2AEQL 4K3JH 2C5DA 1G6RH 3REWB 5C9AC 3CAFA 4JHVA 1RXGA 1MRCH 4P30A 5JW3L 1HRI1 1ZAUA 3FSZA 3RVUD 3SDDB 5TQ2L 3W11C 1E4KC 2VLLB 4WO0A 1I3HA 1ND0B 1MVQA 1NT0A 4OLUH 4LBQA 2LVEA 4O2EB 2QDNA 4GZ9A 4XFFA 1IDSA 5A1LA 2VJ8A 3OSVA 1N33O 5C0CA 2YXSA 4LFBB 4R8HA 4OLVH 1PVHA 4RA3A 5ANMA 1XNRB 2VM3A 2LUWA 5GRVL 4XZUB 5D7SH 2Z92B 1IM3A 3D2TA 4MXWL 1ZVFA 5I6MA 2CIKA 3JTSA 1PL4A 1WW4A 3L3KA 4ABWA 2ZXWB 4PM1A 4Y8DC 2BUKA 2J42A 4CPBA 1VFOA 1YEGH 2WNVC 2ZJCA 1NCCL 4K8RC 2AR6A 5TK2A 4OKVA 5KC6A 3MNWA 4KO7A 4FFTA 3C87A 2IWGB 3DHPA 5DN6G 3AT0A 4LO6B 4JCMA 2QEXV 2BIMA 4HS3A 3ECUA 2J1EA 5CZXD 1RUOA 4I4TB 2H3NB 4TQDA 1UM6L 4NXMB 2A1WL 4M02A 1I1YA 1UZYA 3E2HB 4JFDB 1AO7D 3CFBB 3OPUA 2VNVA 3LKQB 3HBQA 4C56B 4QO1A 5I6NA 2AGAA 1KV7A 3N7MA 1B6UA 2WBXA 1SESA 2A6VA 2BNUA 2H1PH 2X4OB 4JFPB 2VUCA 2ENPA 1OXYA 1S6NA 1AR63 1DUZB 4QX1A 2EX3A 1K4CC 5FO7B 4DY3A 3D9AL 5IVOA 4PGEB 1MPXA 1H5BB 4AYFA 3BUQA 3W39A 4MJ6B 2JIJA 4UW6A 3I9AA 1DIWA 3ILDA 2AZ2A 3PHAA 5IBLD 2RNBA 1CAXB 2ZGUA 3ZTCC 2Y0OA 3H8XA 2RA1A 1N6VA 2B46X 1AZRA 2OULB 2AK1H 3HHSA 5EZJB 5GRJL 2BZ7A 4LVNB 2BIOA 1HAUA 3CHSA 4R7LA 2F5AL 1AR71 1W8FA 4PD4K 4NPRA 5D1IA 5T1MB 4PJEE 5TE4L 4JPIA 1S0IA 3HE6B 4JFZH 1QQCA 4XPHH 3RJOA 1MFAL 5EZPA 2JDIG 3ASWA 5GZCA 1JMKC 1OQDA 4NIAA 3P2TA 4MBOA 1FZKB 2VDMB 5DS2A 5MEND 1Z7S1 1N9PA 4AVHA 1X3DA 2W80C 3WKML 2SBAA 3PY9A 5FZEA 4MB5A 1TJHL 4ZZKA 1TIUA 4N87A 4DPNA 1FLRL 1FYHB 1RIVH 1RZIA 4QOKE 5C8YA 1HRV2 1WGOA 2EABA 3CJIA 1U12A 4FQCL 1JGUL 2AXGA 4K4KA 5CBHA 4JM2D 1ORQA 4RS5C 3VDDA 5EPAA 3BIKA 1S7QA 5J12C 1F56A 5GGVL 4HIEA 1MJ8L 4UCVA 4CGTA 2XDVA 4CUGA 4EDXB 1PY4A 4XFHA 2GZWA 2P3YA 3UYPB 1KJ2A 2ITEA 3IGAA 3PIQB 5IVJA 1VLNA 3BWUF 3BZFA 1MOFA 2XDHA 5INDB 3NDYE 3V6FB 2HFEC 1E6JH 2Y9RT 4OUUA 1YDPB 2OSLB 4L5FE 5EUOF 4WBNB 4GG6A 3ALQA 4A6YL 2IC1A 5GW7A 3MJ6A 1AJQA 1GHFL 3OX8A 2AJXL 3DVNA 5FYKE 3B37A 2ARJB 5H35A 4QXCA 5BNNC 5DZLA 2VOXA 3L45A 3K4DA 4BQ9A 3WIHH 4C8DA 3IDUA 3B8NA 2X53S 3H9SD 3AMNA 4PVMA 3U1SL 2ARHA 4FJ6A 1U3HA 2DW4A 2VERA 2VB5A 4GXLA 3GXUA 2C1OA 2VLME 3V6ZA 4BCXA 2W91A 3X11A 1JPGB 4ZYKA 4ZZ5A 3ZCCA 4AILC 2WLLA 1S2EA 2ED6A 2NY1D 1G6UA 5E56A 1C7TA 2YC1A 1LE9B 5T1KB 3V5HB 1RUF1 2YAFA 3NRUA 4LORA 5F3HA 2HH9A 4EEQA 3IMSA 4LHQB 2ITCC 3THOA 3EFFB 1QLFB 5CINH 4RQPB 1RZKL 3L3OB 4GI6A 2ICEC 1CE1L 3QULB 4QHNA 3STZB 4AQOA 1KIUA 4F27A 2UU8A 4GAYB 5I8CA 3O6LL 3VXRB 3H7YA 4DAGL 4X8PA 1A4KA 3OQ3B 4OJAA 5DMJB 5EU6B 2DMXA 1OM9A 1S7UA 3GWOA 2VR8A 5JOWA 1HSAB 3IMTA 3HW7A 4MAUL 2A6ZA 2VOWA 2VWJA 3L8QA 3QI9B 5IBTL 3UTOA 4Y4KA 1PO21 3DPBA 2WVUA 3BAWA 4CDHA 3RYIA 4LKXA 2YC0A 1X7QA 4HCGA 4WVMA 4ETQA 1HRV3 4LF5O 4RA0C 5F6IB 1FX5A 1FL3B 1THCA 5LHGA 2R2HA 4Z7QE 5I1KL 4O4HA 4NTYA 1SJHB 4OZFA 4XOBA 4Z3GA 4EAEA 4K1YA 2P5EB 3VYNA 2IH3A 2HVKB 1BM7A 5GZEA 1WF5A 1S3RA 3BWSA 1G9CA 1HQ4B 3JZYA 1G4RA 4FLWA 2YMXH 3QNZB 5DJ8B 4POZC 1GNHA 1QCEA 3JCIA 5CBLA 1XCXA 3VGHA 1ZTEA 2OXHB 5DXDA 3VBFB 4ZY9A 3ZXEA 1NAKH 3LOBA 3SGEH 1M05A 3WL9B 5DVLA 2R39A 4YFLF 5G55A 3V4LA 2NY0D 2YQBA 3VXMA 3ECWA 1WAZA 2WD0A 4AJWA 5EEWA 1T03L 2JDMA 3BIBX 3E9TA 5J9PC 3VH8A 1QDOA 1S0FA 2Q8CA 2VLKB 3UO8B 3B43A 3L54A 1KELL 2Q1FA 2E76B 2WV3A 1H1AA 3POFA 3FUEA 5ITZA 1I3GH 4FP8L 4LP5A 1EDHA 1Q38A 1HL5A 2WWKO 1N8ZA 3WUWB 1QDCA 5DC2A 2YD7A 1AYN2 1R092 3BGFB 1YEKH 2BTVC 4AQAB 5IB4A 4BH8B 3HR5B 4DH2A 2G4IA 1A6TB 2DQFB 1J1XL 1BSIA 1NUDA 5ICZB 2OZ6A 3B93A 4DCQB 3TVMC 3PP4L 1CVSC 5HY9B 2IH1B 3RPBA 4C55A 3SKNB 1W91A 2W08A 2EDWA 4LO4B 5K59E 5BNQA 2CLZA 1L1FA 5D72H 1GM8A 2CHZA 3WP5A 2A74A 3EZJB 1R3IC 3NESA 3NJGA 1UVQA 1U6AH 3QIBC 4P05A 1XYNA 2AQRA 2X4UA 2OP4H 1LLAA 4HMCA 4PJGA 1XH0A 3N42F 3O6FA 1DK1A 4G1MB 2VXTH 5IFAH 1D6EB 2WLMA 5JQGA 2KHAA 3D85B 1UENA 3QDJA 4ANVA 1X7SA 3F62A 3UG3A 1NCQA 3JCZA 1MCWW 4OIIH 3QHZL 1JD7A 4M5YL 3KBEA 5BQDA 5DVNA 1FXZA 1QNMA 2CBPA 1RV6X 2GC0A 2MPAH 3MRFA 5EF0A 5FOBB 3B02A 2P5EE 3WAKA 5IMLA 1JYCA 3KCCA 3PUSA 1H8EG 2PW1B 4B96A 3KVQA 5DDHA 5ACA2 1GP5A 3NGBC 4P08A 4HAMA 4LH7A 2EF6A 4LPVA 1PBYA 4YVWB 1AB3A 1I1AC 1GZTA 4ZSOB 4WVZA 4TOYH 2CNYA 5F9OL 5I8SA 1YY8A 1KJVB 3UGGA 5ISZE 3QORD 1NA1A 1NTDA 2NTSP 1T6GC 4HCFA 2BEOA 2VDRL 3JV4B 4H3WA 1G6RL 1JCKA 2YPLB 4UM9B 1DBNA 3UJJH 4LUMA 4HAFA 4JV5O 3I84A 3R06A 1JPFA 3I2JA 5EIVA 1QI5A 5F96L 4WFFD 2Y0IA 1V0AA 3CQOA 1GL4B 4LLUA 4QIWF 1RU9H 2E46A 4TSCL 2UYAA 1Q1JH 2FSEB 3P2BA 1LK3L 4Z0XB 3AG1C 3BAYA 5A2KH 5I6XB 3I2HA 2ZUYA 4Q1RA 2WN3A 5GZFA 3MO1B 3RUGB 3ZGHA 5AOIA 2Q7YA 2UYLB 2OMTA 4U7NA 2N7SA 5LHHA 4KKLD 4G71B 2WT1A 5CSGA 3W20A 3X17A 1R093 1I8IB 1IQDA 4DV4O 3NQIA 4PJ9D 1AYN3 3QISA 3FT0A 3WG7B 3EZ8A 1W0VB 4ZFGH 4K8FA 3MUZ1 5JHLH 3FQXA 4XHXA 5FJHA 2QADB 2ZUWA 5BO1H 2GDSA 5DG1A 4D0DA 4HK8A 3DX9B 3EH2A 5CKAA 4GG6F 5ECGA 1X4XA 2AJSL 3QQXA 5GGSB 1TE1B 4H7LA 5D7KE 1YF2A 3TM6A 3LXAA 1AYM1 3MR9B 1ORSB 3ETBF 1X5LA 1UASA 4LNRB 3FKSG 5HHOB 4C1XA 4AGQA 3KGZA 4D0CA 2NYYC 5EMYA 3EJZC 1OPOA 1HP8A 2PO6D 2GAZA 3LEXA 4KJYA 5AVWB 1XXNA 3P77B 1Y74B 1ICTA 4LKFA 3OW2U 1UOJA 1QSZA 5JVDA 4H0GA 1VERA 3GSOA 2IWKA 2AKRB 2P3IA 1PD1A 3S7EA 1BVNP 3D3AA 2EADA 1NGZA 1HINL 4HOWA 4HUVB 3QXDA 3SDXA 4IEFA 2D0HA 2RAMA 1H1IA 3H9AA 4K6BA 1ZLUK 1M9SA 4KHTH 5HXMA 2DIBA 4EJ1C 5KYUA 1DFQA 1RUE2 2YGLA 1DQ6A 1J95A 3RYPA 3UGXA 5ACA3 4GRMB 1JS9A 1EAPA 3UZEC 2Q8AL 2JKBA 2GK0B 4L1LA 3ES6A 2X5IA 4FTSA 2E53A 3MAQA 2CLRB 3TT1L 1QASA 4TUKL 4UWDA 5GIRA 4X6EB 1BQUA 2AH2A 4R6ZA 1KTRL 1NUNB 2F1BA 5D7JD 4FC3E 3ZTNL 4DV6O 3ZN0A 4QKBA 3WOGA 4H8HA 5B8CA 3WN5A 4PA4A 1SPDA 2VXVH 4L29B 2VW1A 2XIBA 1BMV1 4EN3D 1T22A 4LO7A 2VXRA 3ZSLA 3BDYH 3WFCH 4HC1L 1FNSL 4BCZA 1PNFA 2HZHA 5L0QC 1T6BX 4LOFA 2JB6A 3OXSB 3POSA 4M3JA 2AJVH 1UOWA 2W92A 4JCLA 2LQTA 4YVWC 1CD9B 1JJUA 4FLOA 4O4YL 4JI1B 4WV1B 5A2IH 2AC0A 4D9LL 1G7LB 2XC8A 3GK8H 3GRWL 4LO8A 3C09B 1GVIA 1IKFH 1CICA 4TV9A 1WE5A 3IJHA 1IBMO 3ZE1B 1DJYA 1AJPA 1FPTH 1R1CA 3A6OA 1V54B 1CLYH 1IGYB 1J3RA 3UKNA 3CLEH 4CGUB 3MJ9A 1VQ8V 2RE9A 3PUUA 4KU1A 4QXVA 5JDSB 4MVSA 2V7NB 3T6ZA 1MJ7H 4ZMNA 3AKSA 2MQ0A 4Z9KB 1ENRA 1ANUA 3BMWA 3TA4D 2B5HA 3BPOB 1A6VL 4UYQA 3IM0A 2NXYD 4HT1H 2HYMA 1MG3C 5EOTA 4KHXH 1WO2A 4H44B 5F9WB 3ZS8C 3LB9A 3Q13A 1P1VA 3O3BA 5JORB 3RWJB 1ACZA 5CCJA 2N1KA 3LRHA 3QBQA 4DPCX 4UTAA 5C6WH 1RHI2 5FA4B 3USUB 5ISLA 4XR8C 3FO1B 1F5FA 5I0UA 1QR1B 1R46A 1HW7A 4GS7C 4XOEA 3VXTA 3IMBA 4FFVD 4X4XB 2WTRA 4XJUA 2MEV2 2IPTH 1ID5I 1GIGL 5K9QI 2WSUA 4QMAA 3ASNB 3LQMA 5DJ2B 4FQQB 1OAZH 2CK2A 1L6PA 5T3ZD 4NOTA 2P7TC 2GCYB 3A67H 3P11L 1LE5A 3ULVE 2HMIC 3BAXA 4QB1A 1SM3L 4OFVA 1WCUA 4PJDA 5A16B 1RUE3 4ELMB 4DV3O 3BUBA 5L3EA 4B3TB 4JKLA 4X7TA 4PJGF 4ZQTA 1K85A 4X83A 2E7QA 1A1MB 4R90L 1A6AB 2HTKC 3JXSA 4XTPA 2B59B 1LNQA 4GKNA 3US9A 1YNLL 4NM4H 4A7SA 3K5LA 3F7RA 3RVTD 1JWUB 2G9KA 1MH5B 3HE7B 1QJY1 4E27A 4EWDA 5ABJA 4CEWC 2QELA 1WBLA 5C3RA 3BVXA 4P2OB 3EHKA 1W0YT 5CEZE 3US1A 2XAJA 4IRZA 4I50A 1X9PA 1B88A 5HYJD 4Q4W2 2YRLA 1H15B 1NC2D 3H2QA 5TF1L 3ZE0B 5BJTA 3KLKA 1JIBA 2DLTA 3D0LA 1BV8A 4V1DE 1C1EH 1GYAA 2FCUA 3CUPB 4OI4A 5GS0L 3K6IA 2JKRM 1ZBA2 4D3WA 1VF5C 3KXFB 1PMJX 5I26A 4S2GA 1B3QA 1B6DA 1BK0A 4AIOA 1D2SA 3T2MA 1WAEA 2QQVA 4YSOA 4OXSA 4BE5A 5DD5L 4ADIA 5ADPH 4YGDA 2F54E 2YMXL 3CFEB 1YFXA 2PI5A 3VD2A 2DQEL 4HFUL 4JRYB 4S1QL 3AMLA 2WLYA 4FKEA 4N28A 2D7QA 3CBRA 4YZ3A 2ZXDA 1NC4D 5E99H 3RWCA 3UAFA 5K5YA 1XF2A 4HSCX 2J4WL 3TBWB 4XIOA 4CC1A 4AGNA 1BPLB 3BWZA 1R5VB 4P9MH 1KD7A 3P1VA 3MSPA 2ORZA 2ISDA 3MLSL 2D6NA 4X98B 2X6CA 3V10A 5CGBA 2YK1L 2ZNJA 1UWEL 1B06A 1BBDL 1UY0A 1JWMA 3SBRA 2CGZA 3F7YA 3GHBL 5CU9A 4WNSA 1RUMH 1QW8A 3S37X 1JRHH 4KQ0A 3BP6A 1O0VA 1XR8A 3APBA 5H9PA 5C08A 2R042 2RQ6A 3ULUL 1V54C 3SE9L 3VDBA 4LBQD 4OI1A 3OAWA 4E9TA 2OX5A 1QA9B 1B35B 2MEV3 3VFOB 3EQEA 3BSZL 5C0CD 5I73C 1GC1H 4LEXL 3OR6A 3SYOA 3P30L 3JYBA 3S36L 3BPOC 4QGNA 1E90A 3A6CL 3VFNB 2NW2A 3S0PA 1VLXA 2F6BA 4B0MM 2W2IA 4Y19B 3NAPC 1TAEA 4BZ2L 5J6GB 2P47B 3SPVA 1RIUL 3VWKA 1BMWA 4ORZC 5C9AA 1IM3D 3ESUF 4XNZB 4NP4H 2D6KA 3TFKD 4BHUI 3TEXA 1S7SA 1U5XA 4MD5B 2NR6A 4LBEC 3MD0A 1EPFA 1U8MB 4ZUUA 1H3TA 3MLZL 4N2KA 3RNSA 1BFTA 4R97C 5DZJA 3ZQXA 4DP9X 2ADIB 2MPFA 5I1AA 3MJ8B 2E0PA 3DUHA 2VDLH 5IB5B 1GKEA 1JZ5A 2VY0A 4U1GB 3RPQA 3CCEV 4KO9A 4OCWL 1PMYA 1C8PA 3NCEB 3K79A 3ILQC 5AKVA 2NMOA 2RS51 2EXWD 1I53A 3KPNB 4NS0A 1HFUA 2XWJB 3MJ7B 5E9AA 4KKZA 3CQQA 4PJXB 4AZUA 1WCSA 1ZBA3 4ZX4A 4I0BA 2K8MA 5FQ0B 4JRYE 1I7RA 1XAKA 2X10A 3CFDA 4FLZA 1U2HA 5JDBA 2OXGB 1G7QA 4FCHA 4XWGH 2EXKA 1RJYA 2OCCC 3HE7C 2Z34A 3E97A 4P48A 5FYJL 4D94A 2XWZA 1SN5A 1JVMA 2W60B 3PABB 4HJJL 1P69B 4P2OC 1N3PA 3ZN4A 1OANA 3GT6A 5DYOB 4HSAC 5TD4A 1CYWA 1KOAA 4LNUA 3ZUNC 1AZUA 5EC1B 4B3EA 1JYIA 4L37B 2YBPA 1W6LA 2D3SA 3FF8A 5AYQA 1ZXQA 2WIMA 4I18A 5IT2H 4CP1A 5C0IA 3T3MF 2O14A 2VQ0A 3QJRB 43CAA 4XNBA 3T4AB 3MCKB 1KB9F 4G6AC 4J3TA 4LLWB 4KZCA 4XXPA 4RWUA 2XYBA 3BP5A 3S3SA 2WXPA 4NHKA 2P5WA 1UZZA 4QIRA 4D9RE 3R8QA 1UWFA 4OM0L 3UACA 1IBLO 4UM9D 1FJGO 1QAWA 2UUDK 4WJG3 3ZTJG 4YQXL 3A7QA 4Y19E 1WLCA 1NE4A 1XPWA 2ZE5A 1OV8A 2A7BA 2R043 4MASA 4PJFA 2W0XA 3KLSA 4BE6A 1B9ZA 4HKZA 3LKNB 3QIWB 4FFHA 4P9GA 1KPUB 1EO7A 4KVNH 4OAWB 4TNVF 4IIZA 4WEUD 2OYKA 4EKXA 5M7QA 4YDKL 1J5OL 4TSBH 1WCKA 2J1TA 5HJDA 5D9SA 2HB0A 4UVCA 5IHHA 1M53A 2UZYB 1YYML 3S8FB 2L3BA 2AABL 2NUPB 4ONGH 1HRI3 1I8LC 1WW6A 3ZMTA 2P44B 1Z7S2 5BV7C 4GAGH 1RHHA 2EVGA 2ENQA 3VFUB 5J2TB 4BFOA 3PAZA 3KH4A 2QQKA 2YXVA 5KBLA 3H9ZA 3HKZA 4JVWA 4K7PL 5JDJA 3L95A 3GJBA 3P0YH 2YFNA 1LRHA 5BY5A 4Z7WB 1DSWA 1MUJB 1BXAA 4U6XA 3U0PB 1JPXA 3UC0H 1W9TA 4CSSA 1JNHA 3QRFM 5EWIL 4Y4FC 3OJDB 1CAWA 5C0BE 2QDOA 1C1LA 5JHAA 1S7VA 4PJDF 2AJ3B 5E9DB 3RWEB 2JWPA 2Z0AA 4FFYA 4OLWH 3K03A 3O45B 4LPXA 4NAJA 2DPKA 5DRZA 3TT3L 3ZDXF 1QJX1 3SKMA 4W6YA 1ZWIC 5D1XD 5BZZA 4HJSA 5DQDL 3KMHA 1U3HD 2YUEA 3TN91 1NCOA 2I45A 1AF9A 3WLBB 5J48A 3FO9B 3QZWG 5E1AC 1W90A 3GI9L 2XN9E 1KCUH 4V11A 3SKOB 3OY8A 1HN1A 4H13B 1DDHB 1OOPC 5BUPA 4EQ3A 5CFAA 4YGCA 3DO3A 3O0RH 4LHUB 4HDIA 4RX4A 3C6LC 1XR9A 2ZKHH 3CDZA 3EYUL 5E8AA 1N64H 3L4YA 1CQYA 5CGTA 5FZCA 1NJIW 1IKPA 1KJ3L 5FEBA 3SKUD 4DO2A 1TJXA 1SHSA 2XL9A 1NVPB 1II4E 3ILPB 2XV2A 3KDMB 2J73A 2WNUA 2R0LH 4NO3A 5L2KE 1R5WA 4EWEA 2XX1A 2NN4A 3DARA 5A40E 3KPQA 3ZIMA 1QH6A 1RUF2 2EDNA 4KY1H 3M4FA 2YXHA 2PW2A 4M8QB 4J12A 3T1HB 2WNVA 1U5ZA 4R3SB 4UB6Z 4Z8BA 4HAGA 4Y4KD 1SY6A 1AP2B 3LGRA 1AR73 3MV7A 3BCFA 3QEHB 1LU1A 4N8CL 5EC1C 4K5MA 4JKPH 3K3NA 1M57C 1NCHA 4FBFA 3QJTB 2CE6A 2PHDA 4XZUG 4CBZA 4F7MA 1T0MA 2VCOA 2VW7A 3MRKB 4LSQH 2HR3A 4NKOB 4PIBA 4MCYB 1KN4L 4HCRL 4L3FA 1POV1 4O2BB 4YWGL 4Y24A 1Z7S3 5A1FA 1IS5A 3H01A 3RNKA 5JHMA 2ZWYA 4BD4A 3HKFA 3AP9A 3SXWA 5IW6A 4IEUA 4DP8X 5GGTA 1K4CA 4UTBA 4DVRH 1DGWA 4CS2A 4HWZA 5I66B 2EYTA 4HG4J 1C28A 5L6YL 4H2CA 3VXMD 1PZDA 5T1LA 2DQTL 1H2MA 2CDYA 1SLXA 5E9DE 4GKSA 5EOQH 3N85H 2ZGQA 5A6YA 3QIWC 3DGCR 4IOIB 4N0FA 5GGQH 1YO8A 2BNQE 2YPDA 4JTAB 2VXQA 4UVAA 3CZGA 3MZTA 5CD5C 5EZIH 4DJMA 3I6GA 4PJ7B 3QEGL 1BJ1J 4LFCO 3ESMA 4G7VH 2PYED 5D2LB 3GMOA 2Q8DA 2FAUA 4BLIA 1WPBA 4X5XA 4PBXA 2ZIMA 3U82B 3X29B 2OZ4A 1UZWA 1IC5L 2XZAL 4WW1B 5KVDH 3V55A 3BGMA 2IBBA 4LCWB 2AUYA 1YNKH 2BHFA 4TSAL 2DY2A 2A6KB 2J7LA 1Z6JT 3LKPA 4QRPE 1OVSA 1X44A 1QRNE 4M1DH 1ZHKA 2LGNA 4FPFA 3L3JA 5C6TH 4HWEL 5EYXA 3MMEA 2KSDA 2VW2A 3RP1A 3FSAA 3EFOA 3IAQA 5AALA 5DD0L 1V8HA 3LNHA 3L5HA 1IUZA 4RS5A 3O6FD 2Z1KA 2XWEA 2E5LO 4OV5B 5J6HA 2ZPKL 2UXGA 2Z93A 5CJ8A 3QDJD 2BS71 2DV6A 4NKDA 4OZHE 2QV2A 3M3EA 4DFSA 1JOYA 3IN2A 5DD1L 4PHZA 3B01A 1G9NC 1RUKH 3IBMA 1BJQA 4NHLA 4QM9A 2WZ6A 1TQUA 5HGBA 3RWFB 4FSJA 3MA7B 2FATL 1WG3A 4PJEA 1EM1A 4F6RB 1WMXA 4Q0XH 1Q9LA 1IZ3A 3FC8A 3NJIA 4ZAKB 4JDMA 1I8KB 5LXTB 1DSFL 2OMVB 4BYYA 1WFUA 3V0VB 3IDJA 1ULFA 1U2YA 4OCMC 1Q81W 4FI7A 3UTTA 4ZMLA 4HG6B 2A6IA 2O5ZH 2DCYA 2ZIDA 4JZGA 3FTZA 3CK0L 1QBZA 1CXEA 1UD3A 5HHNA 4CN4A 5BNNA 4B3RB 4DV5O 3GMMA 5FIXA 2G38A 2KUTA 5E4OA 4BV1A 4QOKA 4PBDA 5B38G 1PO23 3MW3A 4AMKH 2EDEA 1FP5A 1MCFA 5JOFB 4JZJC 4C4UA 4N26A 4QTIH 5LGJB 1OGAB 4OD2B 5ACZB 2ETWA 5SX4H 3EOAA 4FTVD 1ES0A 1GGIL 3R66A 3LF7A 4X1YA 4PBWD 5KOVC 4YHNB 4FJZA 4BH7B 1QEWA 3SCHA 5BUAA 1SYSA 1KNOB 2EC9T 2R2EB 4ATWA 1PNKA 3IVKA 3BWAB 4KFMA 4ZPVB 3GHMA 3EYFA 3H1MA 4Z76B 1PVC1 4JG1L 2ITCA 4JN2B 3RDIA 3HNVH 3RWRD 1HKFA 1NU1H 2ICEA 3WXWL 4F7TA 3KHCA 5CN2A 2M6YA 3JBG1 1QO3B 2XG4A 3P54A 3QD6A 1EHLL 4WKZB 1IAOB 3D39B 3IB4A 4NPMA 1U3ZA 1KFAH 5AEAA 3FAVB 3IDMA 1CESA 4FOQA 4YGBA 4MLOA 3LNMB 3QBTB 3DIFA 2QL1A 4PTUB 3AKRA 1YZZA 2HX8A 4P2YA 1YPZA 5HVFB 4QRSB 2NY5C 2Y34A 1R3JB 5LATA 4OFPA 3RX7A 3A0BZ 1GTNA 4Z7OE 4LT5A 3WFEH 3IB3A 1JTPA 5L88H 1Y67A 1CIUA 3FUDA 1Y9GA 1NWPA 3OEEG 4J10A 3G5VB 3HBZA 2UYBA 2W1WA 4RA0A 4JG0H 2PA7A 2HJFC 3GXFA 5L3FA 1P1ZA 3A0OA 3I6SA 2CTPA 3JWNE 5LQBH 3C8KA 1QHPA 1HR0O 3N41B 2VCAA 3EFFK 3OV6A 3VI4E 4LU5H 4J7JA 2NDGA 3W9EA 2F8VA 5GM0A 1P7HL 5CZKA 4LOUD 2ROXA 4NN0A 1UWWA 2HUHA 1MW3A 2YUAA 3BZEB 1AYM2 5F3FA 3Q3GA 1A6ZA 1FYTB 3T9WA 4LT7A 1FZOA 3ZPDA 2GHZA 3SCMA 1S7TA 3VXOA 3RZMA 1T2QH 4Y5YC 4YIQB 4J3VA 2A9NH 5FCUL 5GZNC 3UPRA 2QM8A 1PZ2A 3F2ZA 1AS7A 2QGBA 4KFZC 2BFVH 2VYRE 1W72A 5IT2L 1N1VA 5IATA 3O0LA 1OHZA 4I9WE 4JJOA 4M56A 5IMOB 3QZLA 1J0KA 2XOTA 3GLAA 3QNFA 3KEHA 3OLIA 5I0YA 4L2NA 1TU2B 1CR9L 1N19A 1K3EA 1LXMA 5F6HI 3JWNC 2AK4B 4KI5E 4L9LC 3TVMA 4LA2A 1EA9C 3D2UB 4XCBA 3JARB 3HKDB 4NRMA 4F8AA 2DD8L 4HGKC 3AG3B 15C8L 4W9ZA 1IPSA 3GMRA 4UF0A 2AF2A 3NA9H 1ZSHA 2P17A 4JGSA 4J3OF 5FDBA 1XH2A 3H2WA 4ECNA 1KEXA 1PK6B 3QIBA 4GSRA 3WUWG 1S0BA 3TXSA 2WPGA 4IHBA 1OAKL 2FDIA 1DL7L 2N3JA 4GW4B 3EFDL 2GBUA 4WI8A 1BMV2 1C5DA 4LPWA 4F2MB 5LNGA 1UXSA 4UFKA 1SA0B 2VDPH 3FUFA 1DLBA 4ZHQA 3ZDYF 1HQLA 3AYAA 4JDZB 2QJVA 4KVCH 3HRZC 2UXFA 3KBFA 1XEQA 3NL1A 3RWHA 3F7VC 4QPEA 3CSXA 4HW6A 5JQ6H 1T21B 3GBML 1TNNA 3A4UA 3BAKA 5JXEA 2EAKA 5CM1A 2HLEA 1I3VA 3VFWB 2X0VA 3IWZA 4C4KO 4KI5C 2A06H 1PLBA 1IJ9A 3OGIB 4DR2B 1BOGA 4TWTA 3UX9B 2V9RA 3IFPA 5C8JA 1I1AA 3B2UC 2Y1ZA 3LTVA 4N7IA 1M7DB 4ZU5A 5L6YH 4NENB 3HR9A 5K1VA 4OLWL 2MCAA 3RB7A 2ZACA 4KQ7A 4V2WA 5JI7A 3FMGL 4OLYH 5TDNB 2E7CA 4OD3H 3HS9A 4XB8A 1KJLA 3OUIA 1AACA 3PHQB 2K3HA 2UX6A 4RGND 2LQRA 4MLSA 2R30A 2FJFA 3H1ZA 2X4QB 4P2QE 4M7KH 5KYXA 1AYM3 1XGQA 1NQTA 1WN7A 1BZ8A 1U4EA 1U8KA 4KTDL 2O5YH 4XO9A 4I1PA 2ADEA 4JV4A 2YRBA 4AK2A 1FCGA 3LQAL 3O9WB 5EORL 1F6LL 3U9UA 1YY9D 2X7LB 3ZKMD 3ARBA 2H8PB 1XGRB 1OSYA 4WNQA 2GC3A 4R9HA 1M1KW 2MKWA 2A1XA 3I6LD 1S0VA 1MWAB 1ODMA 4U0QB 4JQRA 3WG1A 3FRUB 4B3NA 5IFTA 1CMOA 1GN4A 4I88A 5HPMA 2H6UA 3UTQA 1B3JA 1HXYA 2J6EA 3OKEB 1SQPH 4JQIH 5E2VH 2OPWA 4ISRA 1NGWB 4AW7A 1AJNA 2GJ6A 1UL9A 2CNAA 4XETA 2ATKB 5I1EL 4CU8A 3BUPA 4Q9QL 1QABA 2D0FA 3PHSA 5J13B 1CI5A 3K1DA 4MSWC 2LTQC 25C8H 1U8HB 5E00A 5ISZA 5GZOD 2YIBA 1PNDA 1UFIA 5L7XL 1WD4A 3AX4A 4ONFH 2PLTA 4AZ8A 1QJY2 1JZHA 5BRPA 3U11A 1GR7A 3LSQA 2QQNA 5EO9A 1AE6H 3QQ9C 3W0WE 3EBRA 1SDDA 4DP2X 5CGYC 1OPMA 1A7PL 1CT8A 2J8UA 4MCMA 3VQXA 4E9QA 2NYYA 5JCOC 3KPRE 4JJ5B 3Q0HA 3H3UA 3KYKH 5AYUH 3ZE2F 4HKBA 2FO8A 4M4RB 1I7FA 1CN1A 1ZK9A 1SQGA 1TQTA 3DXRB 5C6PB 2H3OA 2C26A 3QUMB 3AM2A 1SYVA 3S3DB 5C71A 1ZK5A 4CILA 2WXMA 2FH8A 1JCVA 1OKEA 3B09A 4JI6B 4N2DA 4IU2B 3X3GH 3S6CA 4X5RA 1SPPA 5HD8D 2K0GA 5DSCA 3ZJAA 2GMEA 4P5MB 1PLCA 4RGOL 1P2CA 1WNSA 4PJBE 3ZX1A 4NO2A 3DVFA 4JRXE 1MJUH 1UH3A 3NKGA 1S5LZ 5CBAB 4GW5A 1YHQV 1OY3B 4AW4A 4F9PC 1Q5OA 5C08D 1IC4L 1MCLA 1J1PH 3DRQA 2WXNA 1DZRA 1W3VA 2YJLA 5CJBA 3FQRA 5SX4I 2Y6HA 1AHWB 1QFPA 1ZUQA 1YPZF 4WO4C 4CMMA 3R19A 1D6VH 1ETZA 2GC1A 1Y18A 4WK2B 3JSLA 4LFAB 1HIMH 5F88B 2HRPL 4EFEA 3HLAA 3VSUA 4H33A 3SN6N 2GNDA 1MCIA 3VWKD 3AQDA 3EYVA 5I28A 2ZSWA 3CTTA 1N7ML 1OW0C 2Q1EA 1G1YA 4PB0H 4LOVA 2MNUA 2VMDA 3QO0B 3U4EA 2WWJA 5IYBO 5J89A 1TLKA 2DF3A 3ASIA 4S1DC 3VNZA 2YY1A 4IV3B 3ISWA 2OR7A 4DV7O 3CH8A 4XTRD 3UTSA 1OAXL 2GNBA 2KMWA 3SBWC 3V4VA 1XQNA 3RI5K 4HFSA 2N74A 1X33A 1MMMA 2AZ5A 4CC6A 1MZ6A 2E9QA 1DYPA 2O8QA 2C1PA 3JZ7A 2P6CA 5KHKA 2A6JA 3II2A 4PV8B 4XZ4A 1OCRB 1S7XA 4YL4A 3TBYB 2DL9A 3U0WL 1QJY3 2ZGMA 2XJTA 5DMIL 4HNAA 1LOGA 2O5ZL 2R15A 4Q9BA 1GNZA 1A2YA 2X89A 4LP8A 1WWBX 2WXKA 2Y07H 3MRDA 4U6TA 2OQ6A 1F8TH 5GKAC 5EIYB 4OCXL 2VRAA 4PRPE 4IGQA 2RS52 1O7SA 2IMMA 1OCCB 5E70A 2RB8A 1ZLVH 4QX5A 4XOGA 3HZYB 2JELH 1RZPA 4GAJH 4FLXA 2ATKC 3GHEL 3IAGC 1WMEA 4XUPA 1J8HA 1F0LA 4QTIL 3RQ3A 4MO3M 1KECA 3QUXB 4HHAA 2R4RL 3FT2B 4JKNA 2CH7A 4CEYB 4CP2A 1OT2A 2P7TA 1ZZ6A 3OB0K 4YFEA 2PHFA 2Q76A 5C3PA 1WAPA 3Q43A 3ABKC 1K42A 5EV7A 1NFIA 1A9EB 2F68X 4L0YA 3FH5A 2CR6A 2CMRH 2DKSA 4ODUB 4Z7VE 2QFRA 1U8LB 5T5FA 5BXFA 5L2JA 2D93A 4O4LB 5TFSL 2P5WD 3LMJL 1PLAA 1U8IA 3LUTB 4N53C 4JG9A 4Y1ZA 1BP3B 1JGLH 3MGAA 3K2UL 3RWGA 4W6XA 4H5SA 4CEWA 1GA2A 8FABA 3DPRB 1XDTT 2VMHA 4EI6B 3MJGX 1NANH 5MEQB 5KSUB 4MAYB 3JYCA 2A3XA 2DI9A 3ZFEC 4KROC 5GHWH 2O5NA 1YN7A 3AVEA 2IANB 3OE7G 4PWHA 1QFHA 1Y0LB 4BQ8A 4HLTA 5IVBA 4Q27A 2HLFC 2X40A 3ZKSD 4Y2OA 1W0NA 2UXCB 3HIZA 5CCHE 1AY1L 1CXKA 3HVNA 4HUXB 1B90A 4MNQD 4N1CA 5E51A 3CMOL 1GZPB 5CF3A 2XPZA 1RIHH 2VCCA 5B1AC 1ZTMA 2YZ4A 4JLRA 3GBFA 4U3JB 5HHVH 5KBPA 3CQPA 2LT9A 5K93A 2MNJB 1ZVYA 1XF5A 2OXBA 2O26U 3FW6A 5CG8A 2QGNA 1AHWC 2NY6B 1ZLWH 4FFBA 1HEZB 4BZ4A 1NDGA 1TCRB 2JKLA 4G3YH 4PREB 5F7HA 5A3TA 4EE2A 5EJ1B 3PWUB 1FIGL 4ADGA 1CWVA 3BAJA 2JICA 2ZQMA 4P9WA 2YD1A 3DIVA 7PAZA 5IQ7H 4XQDA 4AVAA 4B1MA 4EN8B 2E3VA 1DVFC 1MCPH 5DWUH 5SWSE 5LDUA 1P5VA 4HVRA 1QBLL 4CNIB 4V1DA 2O1QA 3W59A 1VAHA 2QV4A 5DAPA 1S3KL 2JKNA 3VI3B 4F3FA 3VQVA 3J81N 4FN0A 3W11D 4A5UB 2RS53 3SH4A 4Z2WA 1RUPH 1QJX2 4YHZH 5BOPA 2YQ2A 4JAMA 2OSWA 4E5XB 2VGDA 3NFPA 5HDRA 2ZKXA 4M6ML 3KL0A 2WOYA 4DUVA 4CCOA 3W21A 2F54A 3NAPA 3GLDA 4LSPL 5D5ME 4DZ8B 3JATB 3J7LA 5KHGA 2BHUA 1IKQA 1XF4A 5HDBE 4FAHA 2B2XL 2J8UF 2EIDA 3OGCC 3WIFB 4J7RA 5CR1A 3RL2A 2ILLA 5CA1B 2W59A 4LBEA 3VJ6A 4DZGA 1KXVC 3P3SA 4K8RD 3JSNA 1SXNA 2VDPL 2W07A 4PQXA 4UBDD 1XMOO 3CCRV 2E7MA 3O3DB 2WLNA 3QUXC 4QF1B 2QKCA 1A6PA 4K0KB 3ZW3A 4L92A 2ZSVB 1HNZB 3PYCA 5FLHA 4CEYC 2BVQA 3QFDB 3H53A 3RGVA 2EH8L 5ALBL 1VEPA 4BK8A 5EBMC 4P8QA 1Q0YL 5HDQL 2RR11 5KSAA 1TFHA 3NA4A 5JXJA 3FB6C 4N21A 1V7NL 4ODVL 3IFLH 1RM1B 2FEJA 2YXYA 3AG2B 3HS0B 1L0PA 1BZEA 2CKBB 2R70A 1RD6A 5E4EB 1LWJA 3B94A 5E88A 1F4HA 1QSEB 2VLJE 2YC4A 3ZFEB 1NIEA 2KBGA 2FECI 1YQVH 3HT2A 2DH3A 3JWDH 5T1LD 1YVWA 4PDRA 1NEZB 3LV3B 2PQQA 1Z9PA 1CE6A 1TVKA 4PRNA 3MLUH 1UXWA 4LCCA 1J05A 4KDTC 1NPJA 4NRZA 1ROPA 3S35X 1U93B 3VMNA 4CCMA 2WNGA 3N6YA 5D93B 3MLXL 1XGPA 1NLDH 2O5YL 4RCAA 2JGUA 4MQ7A 3RNQA 3IC9A 4QRQB 3VI3E 2WANA 2JD9A 2PELA 4XEZA 4DK0A 5T5PA 4G83A 3QUZC 3PHMA 1X5XA 1HNWB 3H9HB 5B39A 1N36O 1FFNB 1DQJA 2FBOJ 4QXGL 3X12A 2BNOA 3BKJH 3VBFC 1JGEB 4U33A 3PDQA 3PN1A 2Y2TA 4LE4A 1JPEA 3D09A 4NBXB 5IP4A 1CG9A 4AVBA 5EB9A 4KZEH 2CHWA 1QJX3 1XD1A 4YR6B 3BY6A 4AYGA 2X6MA 1B4LA 1T0NB 2VCBA 1K5NA 1RZGA 4BPZA 1DP0A 2H41A 3IU3A 2G30A 5DEZA 5IKCB 4NZRL 4U1SB 4XF1A 1HXKA 3EO9H 2ITDB 4M9OA 4YNYA 5D55A 4ONFL 2FX7H 4GQZA 2R0ZH 4W9LC 1I8LA 2XBTA 2XG5B 3T0VA 2E26A 3KYNA 1E28A 1K5JA 1UM5L 1LEKB 4FK5C 3JAKB 1Z9OA 1EEYA 2MQ3A 4Y5VC 5JW5A 3BMVA 3OZ9H 1IVTA 1D4M1 1URXA 4HZAA 1WEJH 1YCIA 2VS0A 2XPJA 4AXWA 4IBWA 2A6YA 5DQJB 5B1KA 1F1GA 2FKXA 3CZKA 4QGTA 4X64O 3CX5J 2FECL 4IIQC 5DK3A 2B4KA 2CXKA 4QPIA 4MG2A 4PJHB 1AIFA 5E89A 5MEOB 1DFBL 2NY2B 3BPCB 3U7YH 5GONA 1EHXA 2F15A 3VGDA 4Y4FA 4UDUB 4R5XA 1QSEE 5AW2B 3ZDZB 4LHNA 4HKJB 1T4KB 1CTOA 1YUKB 1ZZBA 5C7XL 1IGMH 1P4RA 1A7NL 1HWHB 1POV0 2B45X 1UT9A 1N1TA 2XL7A 4QDQA 5FF6B 1S9YA 4QOKD 5DHMC 4JQVA 1OPGL 4N6RA 5CP7B 1ZWIA 4Y2DB 1PGRB 2Y36H 1H8TB 2BVBA 2JE7A 2APWA 3C60A 5I18L 4DP1X 1U8NB 2KPWA 3A0HZ 1JOIA 3D33A 4K94L 3ULSB 4DQOL 2QDVA 3POJA 3WEXB 1DQTA 2ZGNA 4QU1A 5FY0A 5EG6C 4E41E 4KO6A 3FYIB 1UACL 1OOPA 2JK5B 2JRIA 2IEPA 5FZ6A 4CJ0A 1POV3 3GIVA 2MTAA 3LKSA 5DPNA 1GN3A 1L9MA 3FCSA 4UIMB 1LNUB 3C6LA 4B7KA 3PTYA 3TNQA 4DIXA 4NZFA 3RWIA 4G9SB 2IWFA 4Z18A 3F12B 1LJMA 1BD2E 4LF3A 1HNXB 3MPBA 3ECVA 1BK1A 3KLAA 1I3UA 2ILMA 3E80A 3NOIA 1UYZA 1RM1C 2OL3B 4KKQA 3AG2C 3HS0C 5CO1A 4XXDA 2D5FA 2YG0A 3MFAA 5E4EC 3MRCA 4RDQG 3MUHL 3DRTB 4JHWL 3EJUA 5I1IL 5C0BA 3WS3B 2HCZX 3CZUB 5FYKD 4CS3A 3FB7A 3EGDB 4ZO8A 4YHML 1Q8OA 1PVC2 2H6BA 3DSNB 2O0OA 3F58H 3FRPG 4BWWA 5FKBA 3GINA 4LHUG 4G9DA 2AGJL 3D51A 4ARXA 1BZ7A 1J83A 4Z77B 3E6HB 5HHQA 1SZNA 3JBG2 3G71V 3B9KA 1XTMA 2IDTA 2VLMD 2LLNA 3QXUA 1OB0A 2XN9A 3TNMA 3V9CA 6FABH 5T3ZH 5AW1B 5DHVH 5FMDA 4ZMOA 3LKJA 1YEDA 5FGCE 4HPKA 4IDZA 1BHGA 2FIKA 4J5VA 2WFF1 4JZOB 5HHPB 5T8IA 2ZCKH 3PUHA 3RKDD 2CK3G 1G7MA 3LS5L 1Y76A 4POZD 2VL4A 3WO4B 4P57A 1NCUA 5I0XA 4GUNA 1A1NA 2DDQH 4FADA 1JHLL 1OC1A 4XVOA 2QT6A 3APOA 2H7WA 4ZQKB 5L2KA 5I1CL 3I9IA 1W6PB 2DWDB 1EEZB 4X6CB 5EA0L 3O81A 3LSOB 3SCMD 3U4BL 5BVPH 1QUNB 2JELL 2FNWA 4KXRA 1IGCH 4XPGL 5FUCE 4IE6A 4XF9A 5D96C 4N5EC 4WWPA 5F70A 3VXPB 2G2RB 4P46A 1YN6B 1D2QA 2ETNA 1HCFX 1PW3A 3OPZH 3V8CA 4N2HA 5JZ7C 2Y06L 5E6IB 3L7FA 3TBBA 4JZ2A 1KACB 2WLKA 2EDRA 1FXHA 1I5YA 1KPVA 4JI2B 3P3PA 2RFXB 3CH1B 3QC6X 4ZT1A 1JSYA 2XQYG 1SETA 2IJHA 1K6QH 3TVMD 5GRYA 5KBNC 3VBSC 4JUSA 1KBGH 4YEFA 4G8EA 3HKBB 1XIWB 4ISQA 1MCHA 3KG2A 4Q89A 3QXAB 1AC6A 1BCCH 4R83A 2B1AH 1ZT4B 2ED7A 4D6RA 1RZKC 1OHHG 2XQYK 2PCPA 4U1HA 3GKZA 3QIBD 5TH2B 2R0KH 2WQSA 3Q8AA 3BKCL 5GHWL 1U3YA 1WLEA 1N68A 4G43A 4MA3A 1N6QH 1W2OA 3II3A 4PMFA 3MGOA 3VACA 4WM8B 2VTXJ 3B6SB 2BNQA 2RHEA 5FUCC 5GQBA 2WJ5A 5DTFB 2YGNA 2DM2A 5DK0B 5F7EL 3MRMB 3BYWA 5CBEA 5HHVL 1PVC3 2ZUUA 4JX0A 3RGHA 2EC9U 4BWTA 4QQLA 4YLZA 2MMXA 4AEHL 4FQJH 1HXMB 3PDGA 5KG9B 3BCWA 4F58L 5T1KD 4HMZA 5FYHA 3FXIC 3CEIA 3FQ4A 1CFVH 2C9PA 3N1PC 3JBG3 4ONHB 3HMYA 2VAJA 4RISH 4OHYA 2NX5E 1KCRL 3QG7L 2VJ0A 4QRPA 2X70A 4XBGA 1HQWA 1I1AD 3O1UA 3QW9A 4PRHB 1QRNA 3BVCA 1Z5LA 5L3CA 1H38A 3F2LA 2Z31B 3DKQA 1BMFG 4M5ZL 4HIIB 1ZRCA 2VN6A 1D7BA 2CHDA 4PWJA 5GS1B 4PS4H 2D6LX 1A0QH 3MW2A 4EN0A 3N0AA 2Z65C 4JZJA 5D7IB 5E8PA 4JY4A 1MCPL 3FQWB 4HK3J 3S5LG 4JPSA 3U46B 3UBXA 1IBKO 4BSWA 5J1TC 3SOTA 2AEPH 1VGKA 3CSBA 5AZEL 3LDBB 4ZI7A 4OZHA 2TUNA 2ZJSH 3SNMA 2IU0A 5T54A 5FUPA 1XGUA 2K0RA 1LEIA 2VERN 3HAEH 4UFIA 4QXUL 2PCYA 3JTTA 3ARBD 4FI6A 5F7DA 3K4ZA 5DDJ1 5FPUA 1VAMA 2W46A 5B3NA 2FZ3A 2P5ED 4XCEB 5CEYB 1V55B 2XJQA 2Q3AA 1VIWB 1E8ZA 1AKPA 1BGYH 4OGYH 2YDEA 1OD7A 1IAIL 3DV6B 4GW1A 4B5ZA 4YIPA 4JHUA 4XZPA 2BWCA 1W05A 2IH8A 3EH4B 3JV5A 3KPLA 2LAAA 2RS11 2OI9B 1M4WA 3HCVB 4DT2A 1KLFA 2BW4A 2D7TL 1OP5K 3O1SA 3KR3H 5ISZD 1HNYA 2YIBD 1YMHB 1E7VA 1U8PB 2JI2A 2E7DA 4KRLB 5BRQA 3H56A 3K48A 2XXFA 3RMYA 1YJDH 1E65A 3W7UA 1ZTXH 2E7LA 3TEWA 2VSMB 1KC5H 5JR2A 4EN9B 3RZJA 2NPLX 3L2MA 1UM4L 2HJFA 2NYYD 1PVXA 4GMP1 1RFYA 2EIBA 3EJZD 4JFXA 5E6IC 1FV1A 3T1FA 4X4YB 3F04A 2ZX6A 2NCMA 1N59B 4U49A 3EH5B 1QQP1 1O5PA 4FRWA 1IC7H 4XPTL 1DG6A 3ME2A 4GIPD 1XIWC 4XP1H 2BP0B 5JJNB 2EUWA 2JCWA 1S0CA 3T1CA 3QJZA 3EXUA 4GX0A 2BFGA 3GBNH 5IJDC 2VVFA 4Y5YA 3RYKA 4TNGA 5B7MA 3O9OA 2W9XA 3G6JB 4QPGA 4CDXC 4JFTA 2WLIB 2FO4A 3IJEB 3ETPA 2BE3A 2DYRB 2UWEA 4U1NB 4U3HA 4QDSA 3LRKA 4GIAA 3GO1H 5CJOL 3V0BB 5HI0A 3BT0A 5J2UB 4A2UA 1D5MA 1I9RH 4JRWA 4TVUA 5D7KD 5E2TL 4BFIB 1FAFA 3ZKQD 4COUA 5AOKA 3NJXA 5GGVY 1KJ2H 4UNVA 2R32A 4UT9H 5DJAB 4L9LA 1JXGA 4PYGA 5H4YA 1ALYA 3VWJA 5JUVA 1YC7A 3AS0A 1A5FL 1ZREA 1AGCA 4M43H 4DXSA 3VI4A 3CMEV 5ELIA 2NTFB 5A9GA 2YICA 1O7DE 2YA1A 3GJEA 3KHOA 4Z8FL 4LR3A 5CD3A 1G8WA 3C3SA 1X59A 4LLVA 4IHJB 1HJFA 4NQTA 1PPJH 1VB2A 3EBAA 4BKSC 4A3XA 4KKRA 1EMTH 3QRGL 4Z82A 3EBIA 3KPTA 3M8OH 5GS1C 3UJOA 1PFOA 2P8MA 4LPUA 5I19L 4XF0A 4G8GB 3HRZA 4IS6B 4DSYA 1U41A 2X6UA 1Z5HA 5LGYA 1INDH 1WEJL 3GMLB 3F7VA 5IV2A 3RYHA 3VFMB 1AR81 4CH3A 3SE8H 3PWNB 4O02L 4ODTH 5D71L 3NCYP 4PRAB 1SXZA 4XN9A 3UAJA 2R9RB 5AVSB 5EZOL 3SYQA 5LN4A 3VFPB 3ZYZA 3IC7A 1IQWH 2QSVA 5I1DB 4MH0E 3BVWA 3ARXA 3T8VA 1V55C 4Q0SA 2X89D 3TO2A 4ZMQA 4J6IA 4JFHE 3GIZL 1BFOB 4V33A 4Z95H 5F9TA 4N90E 3OMNB 2EE6A 4ZO9A 1Q6HA 1O7DC 1IMHC 5SV5A 1C5BL 3BW9B 1VFMA 3LA7A 4W9EC 3C8HA 2ADQB 5CB4A 3MBXL 4M00A 4UCUA 3DROA 4QAMB 1X6NA 4BMEA 1RB8G 3IETB 1TJIH 2FYYB 2IJ0C 5DEFA 2C9QA 4GUQA 2HMID 1JPSL 1C5IA 2WBJA 5KAQG 4DW2H 1KUMA 3OAUH 4N68A 1OURA 4U1MB 3ABMB 2UZIH 3TX4A 2GTWA 3EYOB 4O2CB 2HTKD 3K57A 4N86A 4MZIA 4OZFH 3ZIYA 3ZHQA 4ZXBB 3AB0A 2EIJB 3SLIA 5TPWL 3ZT5A 3FUQA 2Z4QB 2RDCA 4YDVB 4YHYB 2JF1A 2CZNA 4IBQA 3MV01 4ELKA 4YHOH 1B2WL 3MBEA 3FN0H 1DDLA 2A38A 1X4TA 5E7BA 2YPKB 1W9SA 5KX5B 3GZTB 5FY4A 2DU1A 1ZT1B 5C0EB 1MW1A 2H32B 1VF6C 2NNRA 4NC2B 1JJOA 1DHKA 1YAIA 5EZYB 4I0XA 2ZICA 1XCQB 1Q72L 2HVJB 2DV9A 1MLCA 4P2QA 2L7QA 4OT1L 4PF1A 3H9YA 1S7RA 3INOA 3E6DA 3ULVD 2WKGA 2XVBA 3GYRA 1XAUA 5JCOA 1S9WB 2EDBA 3WS6C 5DAXA 5BQ7A 4IT5A 5D6DA 2ZONA 3QJSB 5F3BA 1JI6A 1ZZ8A 2WZ8A 2XLFA 1KTLB 2PYLA 2K7PA 5CFDB 2B0SL 5LMUO 4HAKA 1T7YA 4NHUA 1ZLSL 1TKWA 5JIDA 4DR6B 2DDQL 1SBDA 3BKYL 1I5ZA 4B3VA 2FQDA 5I9QB 3MA9H 5CFHA 5IYZA 4R0LB 1U92B 3K8LA 4M0NA 1RULH 3DUSA 2ZAIA 3FH8A 4R7DB 4UOJA 5CEZD 1W8WA 4YPGA 3WLWC 3AMQA 2GK2A 2R83A 2AXFB 4Y8AA 5F7NC 3S34L 4CSZA 1VKXA 1IPKA 1P4BL 1P4LB 1WD8A 4LE8A 5DJXB 4MJIE 4BIKA 4NO4A 4CUCA 4AIZB 5A32A 4V1DD 3FZ3A 1JF1A 4N2GA 4XCNB 3IDGA 4F9PA 2R72A 3ZN5A 1KBPA 4OF6A 4FAAB 4XXAA 5A3OA 2WO7A 2Y5TA 2ZX1A 3W0WA 1LULA 5I16A 4DO4A 4URAA 2EQDA 3WR0A 1BHBA 5EC2C 4HUWB 2ARBA 3THCA 4OJFL 3KPRA 4LCIH 2UZPA 5A3MA 1KYOK 2X4RA 3OR7A 5D7LA 2GP5A 4WFHE 2F54D 1N32B 2F9BT 3R4SA 3RY6C 4NQVB 2B1AL 1FZJB 5FZKA 3TYGH 3WINE 3PL6B 2FDHA 4AEKA 4Y1YA 2PTVA 1G43A 1KP3A 3ZPOA 1JTZX 2MHAA 2BVVA 4IE5A 2L35A 5GLZA 1NGYB 4OZ4B 4CC4A 3MCLH 4Q9RH 4HUUB 4FCAA 4GXUM 4OUOA 1DQ2A 1JZ7A 2PMWB 4JPVL 5F1NB 4FKHA 2R9IA 1OV9A 2R1YA 3QAZC 1K8DB 4YBLB 1TYJA 4GXVH 4PJBA 3AP6A 2BNRE 4JRXA 3SBWA 1AI4A 3VU1A 4YUEL 5GS0C 4AGRA 3F00A 1ULOA 2AS5M 2FL4A 2EXJA 5GLUA 2O1AA 5KSAD 1GYVA 1W03A 3B9VA 4I01A 4GX2A 1T0OA 4JFSA 1AGBA 4KKCC 4YDJA 1RSFA 2UWEF 4W81A 3VQMA 5FPZA 2EXSA 4OY9A 4QB6A 4KUCF 3AEIA 5I1GH 2ZP0T 4GSXA 4X1KA 3HE7D 4NWWA 1OGSA 1TVHB 3FU3A 4PVBA 4MRBA 5GLWA 1CGSH 4P2OD 5I74B 1TPXB 4NFCA 3CWGA 1HYSC 3WFVA 1OGPA 1A0QL 4UUJC 2HLDG 1DJXA 1TJMA 1ZVSA 2ZWLT 3U25A 4QWWC 1G8MA 1PZ3A 1WP8A 3UGEA 1E6OL 5DR5H 4LP4A 1YJ9V 5IB1A 4PJ6A 4KK6C 2IZWA 2MKLC 4GKZB 3SY0A 4RQQA 4WTZA 2QSAA 1UFGA 4G6AD 4WK0B 4QUOA 1L0QA 1JHJA 3D36C 3I56V 3I02A 4U3SB 5FDYA 1K4DB 2ZP8A 4EQ2A 2ZGPA 3H7BB 4HU8A 2K70A 1D5IL 4F15B 3PURA 5FL7G 5I71B 2CNZA 4N7UA 5CFDC 3S3BB 5FLXN 2XNAB 4GPVA 2X2IA 3LYRA 4JRYD 1YI7A 4X80H 3N1FC 5ID1B 4MVOA 4M62L 4MMYB 2QQOA 1SBEA 3H50A 3ZYRA 2W65B 4QAWA 1TO4A 4R0LC 3V0DA 4PRPA 2NT1A 4PD4F 3VG9C 2VRQA 5BXZA 2E8YA 2G75A 3MIEA 4CC5A 2GSGA 1RAMA 1CVNA 2QUOA 3UESA 2XOKG 3ZHKA 1WFNA 3BZDA 2XIDA 5FGSA 2IAMC 4YAQA 4GINA 4KTGA 1Q8VA 2FGWH 3BTZA 3ZRWB 3AS2A 2H0PA 4J25A 3EO0A 3VA6A 1MNGA 3ENRA 1J7VR 4Q6IB 1LHWA 3DC6A 2N59A 4R84A 3TBTB 5FYTA 2Q2EB 4Z7VA 3RILA 3H0OA 1NH6A 4XDQA 1S7WB 1H0DB 1I7UB 2WZAA 32C2B 3NIGF 5LEJA 4D9RD 4F3JA 4Y4FD 1Z9SB 3QNEA 1ONQA 3N04A 4L8SC 4N85A 4W9JC 1D4M2 2GMMA 5JYMA 1QFWL 1W99A 4Y19D 1FZMA 4ZFQA 1RMU1 3F84A 4O65A 5F89A 2V2WA 3LS4H 3PL6C 3S6PA 2A3TA 4YWAA 3BSGA 3LD8C 3LNIA 1R6VA 4K7JA 2JDPA 4CW1A 1DVFA 4WHTA 1HAWA 4ZMVA 4Q26A 4U05A 2AHIA 2WR9A 1WFJA 1ZHNA 4U1KA 4AENB 1JMZA 4RMSA 5JOYA 3GKWH 3RA7H 4EI5C 3HUJA 1SLCA 2GV9A 2RR13 3CNAA 1UG9A 1J3PA 2FJUB 3GF6A 3MJ9H 3WF4A 4Y4HB 3DO7B 3C6LD 3BZ4B 2H6PB 5KZCB 5A2LH 3HKCB 1F4YL 4PJIE 1FNGB 1UD2A 2Y6KA 2VUOA 3BO8B 3C7FA 1PZCA 3PHOB 2FVNA 2ET1A 4HSLA 7FABL 4G5AA 2DLFL 4HH8A 2ZM6B 2CXGA 3BQUC 2A77L 1PYWA 5FHAH 5FBZA 3HZMA 4UAOB 3D8CA 5C0BD 5JMOA 4UTAH 4Y3OA 1OA4A 3RQ0A 5IMKA 1PNMA 3W9DA 1XCTB 1NMAH 3BN3B 2WMPA 1TGOA 5LB1A 4E5XG 1W2BU 1S0DA 1TPXC 3O2VH 4YGAB 3RZWA 2N4IA 3REVB 1WFOA 1SFNA 3VSVA 4IE7A 4DN3H 5KHIA 1Y7BA 3B9KD 2WBKA 2O72A 1E8YA 1AI1H 3LB6C 3NCMA 4ILDA 4WCYL 5SWSA 1CPUA 2XN9D 1EN4A 3KCWA 4GAAA 3GSNL 2VLRA 1NEUA 4TV3A 5EJ3A 5EBMA 1F4WL 5CBGA 1FVCB 1LUWA 2XWTA 1NCBL 4GQ9H 4UQ2B 1GZCA 3Q2VA 3DDGA 3KJ6H 1GAFL 3A6BL 4ZUVA 5C0AE 4XP4H 3UBXG 4AM0Q 1DYOA 2CAUA 4G7SB 5IB2A 1SFDA 3EGSB 3H7JA 5CN3A 3OL2A 1GYCA 3QWRA 1GS7A 5BZDA 4JQXA 4AC2A 4F15C 4OTXH 4R4ZA 5I71C 2HWZL 5B3SC 1N4XH 2X4TA 1FI2A 2I7OA 5D5MA 1KU9A 5L2KD 4NWVA 5FO8A 4QQHA 4JGZC 5F44A 1A7OL 3QIWD 2JG9B 3EBGA 4IRZH 1NZ6A 2WFF2 3F65A 5AFBA 4KDTA 3WW1A 2NQDA 3S88H 1OZ0A 5CD5D 4CKQA 4J1XA 2VIRA 5FMOS 3GHPA 1D4M3 3HI1A 2VZUA 2F7RA 4P46D 4PS7A 3JB8A 4RGAA 3O2DA 2JKXA 3ARYA 4PGZA 4JQTA 4DW2L 1GMIA 5IF0A 4JO1L 4LBKA 2E7TA 1WS7A 3AREA 4OI2A 4KDVA 4DVBB 2W1UA 5ETUA 1N5AB 1P84K 1AANA 1ZA3B 3KPMA 4D2NA 1NEZG 1AI6A 3TV8A 4EO5A 4Q6IC 1XGYL 4AQEA 3WKQA 1O6VA 2EIZA 2BS8A 2WQXA 1KKCA 4I55A 3ZQ9A 2BDNH 5EYPA 1RSOA 5ESQA 1YC8A 1TNFA 2HJKA 2CAVA 2VR9A 3HNTL 1FS0G 2UU9O 1FG9C 2VLJA 4PJ0Z 2A83A 1XSQA 2AMGA 4ORGA 2R69L 1KLUA 1WA6X 3G6DL 5E9DD 1SCSA 4MXWA 2JXMB 4UINL 3VRLF 4YZ1A 2QBWA 1EBPA 4XVSH 5ESVB 4WM7B 4PI0A 1EH9A 3PWLB 3KF3A 2BNQD 1HQRB 3O1OA 4NZDA 3QQ3A 2ZX8A 1QHDA 3KVAA 3ARZA 3O6KL 1USZA 4YM1A 2AV1B 3RZCB 3PJQA 1JFQH 5LGKA 1HHJA 3ILFA 5J09A 2FX9L 4BQWA 1ILSA 4IIQA 3D87B 1E50A 4QMEA 5IVNA 4HJEA 4JDNA 5H6RA 4HWNA 4GKYA 4HV8A 4ZOEA 4QXBA 1QLRA 4QRPD 1AG0A 2QVKA 3MOAL 5LK7B 1DTUA 1FO0B 4XC1H 2Y69C 1M7IB 2XFXA 1QRND 2V5MA 5CSBA 2DMHA 4YL9A 4BFGA 1YSCA 3UEQA 1X5IA 3KJ4C 3OM3B 2HN7A 5DGRA 4PSRA 4JGNA 1Z5WA 2YD8A 4KQ4L 1BLNB 3U4AA 1TYEB 4TSVA 1NDMB 3I97A 1IT9L 1XYOA 2VABB 4FX5A 2V4DA 2JTYA 2YJQA 1FCCA 1U97A 4I13B 5L7OB 1NQBA 1M7UA 1IGFH 4QHLA 1XBRA 2VDLB 4XMPH 1XNCA 5A33A 3X13A 4BMBA 4G9FB 1BVLB 4P49A 2COQA 5ABZA 2LW1A 2HHHO 1T80A 4GMTH 3KLQA 3B69A 3E6CC 1KPRA 4M29A 3CVHL 1UJWB 2AERT 3A4EA 5AAMC 3NZHL 4G5ZH 3UYOD 4LVEA 2WKOA 3B3IA 5E94B 2W5FA 2FJHA 4Q2ZB 3GJFK 2Q68A 3CSYA 4OF5A 4XJAA 3EJCA 3SE3A 3HPLC 5IHZB 4AC4A 4D8MA 4R26H 4F7PB 4XILA 3IWVA 4MA7L 3W9AA 4XN7A 1BLIA 1DLFH 2XKSA 2D4FA 1U58A 4FDWA 1RUQH 5DDJ2 1ASOA 1MFDL 3GB7C 3GI8H 4Q9RL 2X4NA 1A8JH 3NAAL 4PEEA 2CTRA 1JF6A 4BZYA 4JGJA 3ILNA 3M8LA 5J5EA 1MVUA 3D48R 2GDFA 4JFQB 4L11A 1JZJA 3DMMC 1DGRA 3V64A 3DVGA 4ONUA 4GKJB 1BGXL 3GSXB 5JWPA 1JYVA 5KOMC 1LTEA 4X5WB 3TWCL 5IFJB 3MLWH 2RS12 5C07B 2DF7A 4OLXH 2Q9OA 5SX5K 4E41A 3OGSA 4Z2AA 2ZYRA 1BAFL 3V0GA 4FTEA 1OAYL 2VL5A 4OZIE 2BVUA 2EXIA 2FBEA 1N0LA 3RBSA 3TZVB 2XQBH 3KAAA 1GJIA 5JNYA 2AQ3A 2ZGSA 3L5WA 1FXKB 5H9RA 3O6ML 3SEEA 4B9IA 4DR7B 1E8XA 2ZAGA 3WE6B 3HUJF 1F42A 4A6YA 4BQYA 1QVFU 3D18A 2BOCB 4J28A 5HFLA 1S9XA 2CBQA 2ZXBA 2WZEA 4FPJA 4ODHH 4NUJB 1AFVH 1L9PA 2IQAA 4M8RA 1N18A 3LSUA 4K71C 4LF9B 4PRIB 1IGIL 1QQP2 4AEDA 1OFNA 3DV4A 3CL1A 1CAVA 1A9BB 1BEYH 2DQDH 3SYAA 4G6KH 4WM7C 4RO2A 1DBAL 1MAML 3PXJA 4I4WA 4M01A 2Y72A 4RQEA 1SLWA 2X87A 3WFDL 4HU2A 4U6YB 3Q1SH 3SBPA 3GS7A 1EUTA 4L2YA 3BODA 2RM21 3KWTA 4V2CB 2ARAA 5EYYA 2W6JG 4QYOA 3L2HA 4UXAA 4Y1VA 3VBSA