The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
95
|
sequence length |
382
|
structure length |
382
|
Chain Sequence |
HGEKSQAAFMRMRTIHWYDLSWSKEKVKINETVEIKGKFHVFEGWPETVDEPDVAFLNVGMPGPVFIRKESYIGGQLVPRSVRLEIGKTYDFRVVLKARRPGDWHVHTMMNVQGGGPIIGPGKWITVEGSMSEFRNPVTTLTGQTVDLENYNEGNTYFWHAFWFAIGVAWIGYWSRRPIFIPRLLMVDAGRADELVSATDRKVAMGFLAATILIVVMAMSSANSKYPITIPLQAGTMRGMKPLELPAPTVSVKVEDATYRVPGRAMRMKLTITNHGNSPIRLGEFYTASVRFLDSDVYKDTTGYPEDLLAEDGLSVSDNSPLAPGETRTVDVTASDAAWEVYRLSDIIYDPDSRFAGLLFFFDATGNRQVVQIDAPLIPSFM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of a membrane-bound metalloenzyme that catalyses the biological oxidation of methane.
pubmed doi rcsb |
| molecule tags |
Oxidoreductase, membrane protein
|
| source organism |
Methylococcus capsulatus
|
| molecule keywords |
particulate methane monooxygenase, B subunit
|
| total genus |
95
|
| structure length |
382
|
| sequence length |
382
|
| chains with identical sequence |
E, I
|
| ec nomenclature |
ec
1.14.18.3: Methane monooxygenase (particulate). |
| pdb deposition date | 2004-12-28 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF04744 | Monooxygenase_B | Monooxygenase subunit B protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Helix Hairpins | Helix hairpin bin | ||
| Mainly Beta | Sandwich | Immunoglobulin-like | Particulate methane monooxygenase, b subunit. Chain: A, domain 3 | ||
| Mainly Beta | Sandwich | Jelly Rolls | Particulate methane monooxygenase, b subunit. Chain: A, domain 1 |
