1YEWA

Crystal structure of particulate methane monooxygenase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
382
structure length
382
Chain Sequence
HGEKSQAAFMRMRTIHWYDLSWSKEKVKINETVEIKGKFHVFEGWPETVDEPDVAFLNVGMPGPVFIRKESYIGGQLVPRSVRLEIGKTYDFRVVLKARRPGDWHVHTMMNVQGGGPIIGPGKWITVEGSMSEFRNPVTTLTGQTVDLENYNEGNTYFWHAFWFAIGVAWIGYWSRRPIFIPRLLMVDAGRADELVSATDRKVAMGFLAATILIVVMAMSSANSKYPITIPLQAGTMRGMKPLELPAPTVSVKVEDATYRVPGRAMRMKLTITNHGNSPIRLGEFYTASVRFLDSDVYKDTTGYPEDLLAEDGLSVSDNSPLAPGETRTVDVTASDAAWEVYRLSDIIYDPDSRFAGLLFFFDATGNRQVVQIDAPLIPSFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords particulate methane monooxygenase, B subunit
publication title Crystal structure of a membrane-bound metalloenzyme that catalyses the biological oxidation of methane.
pubmed doi rcsb
source organism Methylococcus capsulatus
molecule tags Oxidoreductase, membrane protein
total genus 95
structure length 382
sequence length 382
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2004-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04744 Monooxygenase_B Monooxygenase subunit B protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1yewA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 1yewA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 1yewA01
4PHZA 3RGBA 4O65A 1YEWA 3RFRA 4PI2A 3CHXA 4PI0A
chains in the Genus database with same CATH superfamily
1COBA 3FT1A 1NGXB 1A14L 1XAKA 3QEUB 4PB9L 5CILH 5E2UH 1G5AA 2Y0PA 3T3PF 4ZTEA 1JS9A 4IRSB 1PD6A 4X6CF 1FJ1B 5CU5A 1S7WB 2QGBA 3H3ZA 4KXDA 4NKDA 4JI6O 3IDXL 5MERB 3HS0B 3QUZD 2R0KH 1MCQA 1A2YB 4WK2B 1FMD2 2DYCA 3AX4A 3SC7X 1LEGA 1UWEH 3A2FA 4GMTH 1ZAUA 5FLJA 2P17A 1XC6A 2X1PA 1AF9A 3M70A 1NIAA 4YVNA 4OZOA 1A6TB 2IV9A 4CCLA 2NNRA 4Z7QB 2ZAAA 3B9IA 3BCFA 1TVHA 3KPQA 5EN3A 4DGYL 2X4UB 2E9IA 3OMIB 1LMIA 3ZXEA 3VQYA 5K5YA 4MZUA 1K2DA 3CCLV 1KCSL 4YVSC 4JHWH 4XDJA 3AVSA 2AJZB 4CCEA 2ZX0A 3BPSA 4NO5A 5BYNA 4K7PY 2HJDA 1I7ZA 2E6JA 4U6TA 4FG0A 1QPXA 4EMZA 2HKFL 2ZMNA 1BQHB 4YDIL 4ORFA 3ARBC 5LATA 5GLWA 4JI6B 2LW3A 2CL2A 1DJGA 5C9AB 3N06B 4XW3A 5BW7C 5I1IH 3C8HA 4E4ZA 1JYTA 4HIEA 1DE4A 1SLLA 4UV4H 5TE6H 3TCXA 4BKSC 5IM7A 2LW7A 2OM5A 2R69L 4UM9D 5JXAH 5EFUA 2RDNA 4XNUH 1WFJA 2QELA 4G7RB 3K03A 3D07A 3L3OB 1ALYA 4YVWA 3ZIAG 2A9MH 3OVUB 1PNDA 4R9AA 1KELL 5KVFL 1SLIA 2WP3O 2XZQH 4UTAA 4AUUA 3MRLA 1NA1C 4Q97A 2V3EA 3FMGA 1IGML 5FZ1A 3HG1B 4FZ8L 1JVLA 4AQ8A 3RVXD 2HWD3 5J98B 2UXDO 3BQVA 3C3TA 5D5ME 1AZZC 4UILL 1HIML 5JOPD 3GF6A 3X2QB 1FDLH 3ZXJA 2DQGL 1HH6B 3BB6A 1GN4A 3U79A 1QR9A 3Q9PA 4QXGL 3ILQC 4EEEA 5JPMC 3EG9B 4CDQC 5H94A 3HAEG 4WV1B 2JDAA 2IAND 1AGFB 4IGGA 3GLAA 3VFSA 5D7IE 2HLEA 4GB32 2P3YA 3CFJB 5FNVA 4JFFB 1BXUA 2I9TB 4PV1C 2V73A 2MHAB 4OSUH 4YE4L 4CDGC 1JI2A 4J3OH 1AR72 3LUTB 3O2WL 3WLUA 4LHJB 5F1IB 1KGCE 1K5SA 2V17L 2VXUL 4F9LC 1MY7A 3M3QA 5JUVA 5FJKA 5MHSE 1JZEA 1PCXA 2IWKA 1TR7A 3RHWF 5FUZL 5JW4N 1A7RL 2QR0B 2UXDB 3K04A 4LCWD 1E5BA 3RWNA 2WS91 4UXNA 4L4TB 3VCLA 4U1HA 2CBPA 1OGAB 2JDUA 4YW6A 4ZXBB 1IVSA 1NBQA 3PDGA 4Y1UA 1ZWIC 3BWSA 3QAZC 3AM2A 4XPFL 4HOOA 3CBKB 5CKQA 1MVQA 3FT0A 3BGAA 3RA7H 4NQDE 4IK7A 2W87A 4LHUG 1PMIA 3J7AU 3DC6A 4IHJB 3BSHA 2ZYHA 4EUPH 4RA0A 3H7BA 1AX1A 4Q4X3 2FWLB 4MBRA 1INEH 1M9WA 3I6LD 4KKLD 3K3QA 3HC4H 3ARSA 2CO6A 2H9GB 2ADFL 3L9BA 3QULB 5C8CA 3ARBD 1FZMA 3TC9A 5HI0A 2FK9A 1A3KA 5E7BA 1QEWB 2ED6A 3MUY1 4NLAA 1GM9A 4F7PB 3ACLA 1IJ9A 1JUFB 4H0GA 4UFZA 4XC3L 1OT2A 1AY1H 1C5IA 3E89A 2VAJA 4KTYA 2Z79A 4B5ZA 4NAMA 1LP9A 1R4XA 3OV6A 5KVDH 3AACA 5DUUA 5EPMA 5IK5A 4YAQB 3BDYL 4ISVB 2FAUA 1KTKE 3D0VB 3QZWB 1BSMA 2PXYA 1V54C 4D0QA 4U4IA 2YJQA 3AQDA 4AW4A 3P3PA 5ESAB 4ET7A 3ZYJA 1J1LA 3POFA 3GMPB 3DRTB 1F5WA 3KBHE 4JCKA 4KROB 2AMUA 5T1LD 5A7EA 5IWAO 4NQQA 1MUJB 4S2DA 3H1WA 2AP2A 3FAWA 1N2RB 4TUJB 5AFBA 4BFNA 4Y4KA 2XQYA 1J0HA 2E7AA 1F8TH 1P4UA 1JWSA 4TOIA 3OB0H 4U6YB 2P45B 2J1WA 4IU3A 4ENZA 2IM9A 4QHKJ 4N9GA 4PD4F 1VP7A 3ABTA 3BYYA 4SBVA 5IW1A 1XGYH 3QNXA 1PD0A 4G8EA 4NOBA 4UUJA 3VFOA 2O1QA 4BM7A 5FK9B 1MWAH 4PIXA 1N7MH 4G7YL 5KX5B 5IVCA 4Y20B 3RFZB 5EHFA 3FULA 1WJ3A 5AAMA 3ZPYA 4AQOA 1YO4A 5L8KB 3KF5A 4LC1A 1TPXC 3ZS8C 2YLKA 1RLBA 3QJTB 3UAFA 1E5ZA 1XEQA 2WVSA 2GC3A 3RVUD 1YQVH 1R46A 3ZYRA 3OLDA 3USUA 4KHTL 2ZGTA 1KZQA 2ROYA 5MP6H 1NH6A 5AYUH 5IWAB 2ZKLA 4OFKA 2BNQE 3TBCA 3A6CH 3EBRA 2K9PA 1P53A 3U4BL 4L23A 2XTJB 4PJ5D 3QPQC 1UZYA 2HCZX 2LW8A 4DR5O 5AEAA 4RH4A 4FXKA 5TE7H 3KYOB 2RVAA 3H56A 5DZFA 3AXLA 1XGTA 3W39B 4FFIA 5KSAB 4XP9L 4ZX3A 3OGCB 2V72A 4B1LA 2VZ3A 2C4XA 2OQJA 2X9ZA 2D3VA 3OAWA 1CZTA 4AC4A 2E86A 5LW9A 3U6XS 1UJ3B 2F4PA 3LIUA 2R51A 2F1EA 5FFLA 1HFUA 1SY6A 3NP3A 4GQPH 4JG0H 4KKBD 2F08A 4K1YA 2GJ6E 1A7OL 5I1KH 1G6RH 4F3FA 3O81A 3BKCL 1S78C 1EEZB 1E9QB 2VMGA 1MF2L 2CO4A 3AP7A 1JD9A 4PSRA 4J1XA 3JTSB 2P3IA 2WA4A 1EANA 1OZ0A 1FAIL 5JMOA 1WB7A 2Z31B 1J87A 5CIPB 3CZKA 4KJPC 4LL9A 3TH4T 3VYPA 4CVUA 2Q9OA 1TE1B 4B7IA 3O1MA 4DR5B 2ZM6O 4PRAB 1EJ6A 3WMPA 1Q9LB 2GAZA 3US0A 3MIEA 1UU5A 2ORBH 4Y5VC 5T5PA 1UH2A 2HFTA 4CVXA 4S2FA 1NUNB 1XEUA 3QF7A 2VW7A 3QEQA 4FXLA 1DGWX 5FUPA 4Y5SA 3BW9A 4OHZA 2EXKA 3BEWB 1ET7A 1D5MA 5IHZB 2DIEA 4GKNB 1ZT7B 3JTBA 1WRFA 1J48A 1D7BA 2VLRD 4RA0C 1PZDA 5EB9A 5ISLA 5AVUB 1ASJ3 3SE3C 4Q0UA 3JV6B 1KS4A 5GS0D 3OYWA 2PPAA 2V5TA 3OQRA 3RI5F 2G0LA 4MYPA 4KX9A 5K9KB 4EFBA 2YPLE 1R1CA 1RJZB 2ZOOA 3ETBF 4LHUA 4LIQH 5GS1A 4B3RO 4WO4C 1C5DB 4F8PA 3FTXA 2EDDA 3AY2A 2ATFA 3DEMA 2ZM6B 1JZ6A 1L7QA 4G8GD 4HK0A 4N2GA 1WZ1L 4PJGE 2LTQC 5EEVA 5CD3B 4M3CB 1F86A 5I71B 1QNIA 4XC1H 4HJUA 1YIJV 4YDJB 1J18A 1FNZA 3QXDA 1QJU3 3QUKB 3ZDZF 3BVWA 3SKNB 1YNLH 3QJHA 4PGBB 3SOBL 3VD1A 3D4KA 5TSWA 4U1LB 2H2SC 3QPQD 1UJWB 2JKNA 5KVGE 4J3BA 1NC2B 3DNKA 1AFVL 2P52A 4JKPH 4JZNA 4F8LA 4MGKE 4YDMA 1X5IA 2FWOA 2X88A 2QQLA 1IC0A 1CICC 2CUHA 1F4WH 2KERA 5AG9A 1X5LA 2N1TE 2HTKD 5CEXB 4S2SA 5AW1B 3HZYB 5GZNC 4B3RB 4JQRA 1PIV2 2C4FT 2N0KA 3DI2B 4YO0A 5FYJE 5IB3B 4QB1A 2EXWD 2UUCO 1UYWL 4QWWC 2FYYA 1JIBA 3U7YH 1EHLH 2Q7YB 1F90L 2WXLA 3NAPB 4DUZO 2HFEA 2UWEA 3PHQA 2F1AA 5LBSL 4R2GB 3CXHF 4MCZA 5LGHL 2IU0A 4WDIB 4GKSA 4IJTA 5FL7G 1ZIAA 4X0KB 5ICYA 3KGLA 5M0TA 4WAFA 4NXSA 1CYGA 3P3YA 3RVZA 1CDJA 2V8LA 4HIIA 1U5IA 1YFYA 1ZD6A 3P4OA 4BZ1L 1GTNA 4DINB 1EO8L 4W6WB 3KHQA 2BGOA 2XV2A 1R64A 5HGBA 1B35C 4PRIE 1GTFA 1AC6A 1JPSL 1YMMD 1W0OA 1HQRA 2UUCB 2C7UA 2PYEE 1G9NH 5KSVB 5IB4A 2NLJB 4RMQA 5I8OH 1TA8A 4PQQA 3AVRA 1NH2B 3KWTA 4GRLC 1QR1B 2Q8VA 4DUZB 4QMEA 5EZYB 4QB6A 1SMOA 3UL2A 2JEMA 1QRNA 3KLDA 3NIFE 1ZBA1 4U7OA 4HWZA 5IQ9A 3OGGA 2GTZB 2ITDA 3IN0A 5J9PB 3BP6B 1PNGA 2QGNA 4CP9B 5L3GA 1IBKB 2FSEB 4F8TA 1A3LH 4NUBA 3QRGH 1Q0YH 4AUYA 2DL2A 1HHKA 1ND3B 5F1NB 4YWGL 1BV8A 4AYBA 4DR6O 1MNUL 4MB1A 5D1XD 3DV4A 1UYYA 3G5WA 2WQUA 4X8GA 1PYWA 1UKGA 2ZSWB 1CXLA 4MW3A 3QJSB 2FQFA 4F2FA 4ZOLB 4UT7L 1SFHA 3FT4B 2H2SD 3BIWE 3VG9B 4JDEA 3VVVA 4XZPA 1C8NA 3FB6A 1KN2L 1OD3A 3ARDC 1K4DB 1JMZA 2G2PA 2FQGA 4PJEA 1CICD 3DGCR 4YSCA 2LGNA 1US2A 4KO7A 3CC5A 4D0BB 5A2BA 3R4SA 1ZRIA 5DK0B 4ATWA 3EXAA 4G82A 4L9BA 1B9ZA 2RACA 2WQRA 2VXTH 1VKXA 3VL8A 4M02A 4XXWC 4IEYA 5DD3H 1XCTA 1MXGA 2FX8L 4XPAL 4B95C 5HCHA 3QIBC 1AMXA 2CRZA 3TPUB 4WM8B 5E16A 1NKGA 1LEDA 4DR6B 3GYRA 4K8ZA 1UEMA 4WKXA 3IE9A 1U8HA 2DVGA 1DDHA 5FLHA 1BCIA 2HMIC 4WVWA 5DHVB 3V6OC 5KJ7E 4S11A 5FGBA 4U1NB 3AXEA 4XJ9A 4QJ4B 4L48A 1SEQL 4EI5C 4JCMA 4Y5XB 5FHBH 3TPKA 5B1JA 2Z0UA 3H0TA 4N0CC 3IJ7A 4GRWB 3L2MA 5B7EA 4UTAL 3FMGL 1I1AB 4WW2C 3T2NH 1L9TA 4ZMTA 3ATFA 1TQBB 1YVLA 1WVZA 4IRSC 1KIUA 3VXQB 3BSZL 1WLDA 1R3IH 5IMLB 3WO4B 1XNTA 1U8PA 4DUXA 2WPDG 1WB8A 1I8LC 3DSQA 1RM1B 4YG6A 5E8PB 1KT2B 4LCYA 5FPXA 4GRLD 4WI3A 5CVRA 1QQP3 2SODB 2YMXH 3FFCD 4P9HL 3UO1L 5MEPA 4H26B 1KXVC 2EABA 3H42H 3QFDB 1GYKA 4F7TB 1PPIA 1YQCA 2ZICA 2FX7L 2EYRA 3D5OA 2KZWA 1G5GA 2Y4SA 5EU5A 2IBBA 3DVNA 3N44B 4JR9H 3H1MA 5C6WH 3IDYC 1Q3EA 3QUZA 2AENA 2EIMC 3IGAA 3MBEC 4PJ6A 3MRQB 1GO3F 3B3IA 5IJRA 1PV0A 4S10A 3CVIL 4I02A 3KT7A 5HYSB 1MFVA 5CJBA 4DEQA 1OCZB 4GI9A 1RURH 4JPVH 1JZ7A 4HJ1A 1AJ7H 4R0LA 2H8PC 2VSKB 5CLWA 1ND2B 1HDMA 2CJTA 4RVBA 5DI8B 4KWLA 3WF3A 4X7EC 1YXWA 5IDJA 3QDGB 1V7NH 3ARDD 2G3NA 1M57B 3KDMB 2PWEA 3UT5B 4RAVA 3WFDH 2NY4C 1ET5A 4OCWH 3DJRA 2OPWA 3ILPB 1D5IH 3EGDA 5IQNA 4LMFA 1P4RA 4NGHL 3LS4L 2A6YA 1NVPD 3L3OC 2I69A 4EBQH 5IESL 3UO3A 1FOD3 1GGCH 5DUVA 2VDRL 2BP6A 3ZHVA 1HXS3 4Z9KB 3C7EA 3HNVH 4NTWA 4O4LB 2ADGA 4FE9A 5KANG 3UK9A 2EC9U 3LZPA 5HP5A 4Z77B 2IGTA 3ASOB 4UM9A 2ZWLT 3LNIA 3CCSV 3PGFH 1A5FH 1ES0A 5FS5A 2HMID 4LSPH 5ANME 1V6LA 4P3CH 3EDEA 3MIGA 2ZXGA 4WV1C 1YEEL 4DAGH 3UYRL 2E7LC 3HMYA 2EO7A 1LUWA 1LO3L 3GMQA 1ACXA 2XFGB 3LKSB 3OKYA 3CH1B 4LSUH 1K73W 2DQEL 3HBGA 4N0CD 1DJSA 1KC8W 3LPGA 1EV12 3KWWA 4G9SB 3A0RA 1ZE3H 4M43H 4X4XB 4J2QA 3LOWA 4M7ZC 4MGQA 3ZMZA 1S7QA 3JTTA 4LPWA 5JIDA 3BE1L 1KCBA 2P3KA 3O12A 4CNIB 3VXRB 2NTSP 3NJXA 2FSDA 1X5KA 2IANA 4RUFA 1EX0A 2QVIA 4NKDB 5K9QG 4P02B 4SLIA 2BRRL 3RAJL 3L75H 3J4UH 5I1JL 4YFWA 1KD1W 1LEGB 2ZGPA 4P9OA 5HHOD 3HUJA 5D7SL 3T0VA 1T4KA 3VWJC 1N33O 1U3JA 3JQOB 4LLUA 4KKZA 5D7EA 5GPRA 3ZT7A 1MJJA 2UXFA 2Z1KA 1TVHB 3KPQB 1GWKA 3DIFA 4MGTA 2R9HC 1OV9A 3QDME 1OM3L 4LRIA 4JGSA 1K2DB 4LCWA 3HNMA 1CXIA 1Y07A 2HT2D 2RIKA 2I74A 1IQDB 4N85A 5I17B 3VFVB 4IEVA 4CCMA 1K97A 4AGPA 1I7ZB 1IBBA 3C09B 3OMZA 2X2HA 4FKHA 2K7QA 4UYPA 4AITA 3UKTA 3ZCCA 4ONHB 3X12A 3BCCH 1OMIA 4K3UA 1KJ2L 3F00A 5I0TA 3EF7A 3O0RH 5KZCD 1T6BX 1W39A 2JG9A 3RRDA 2O0OA 1WAEA 5HHXL 4BQ5A 4X6EB 2HLFC 3C6SA 2R043 4N23A 1H5BA 4HIEB 1DE4B 2OP4L 2GU9A 5B3SB 1N33B 4OF8A 4FNUA 3FX3A 3KGRA 3WXVL 3MLVH 4YVWB 4D69A 3ARBA 4O9GA 2VE6B 1KTLA 2AXTZ 4JO1H 5EZLA 5BW7A 3MRLB 5FYKH 2WNOA 1QVGU 1SY6L 2DQCL 2H0PA 3JB4C 4AM0B 3ZBHA 1EHXA 2DM7A 3LN9A 2E5LO 1SUHA 1EAH1 3B9KC 4M7JH 1T2QL 2A7WA 1L3JA 5A2AA 4N53A 4FLSA 1BEV2 3LA2A 3N1GC 2CTWA 4WWID 4PBXA 3WB1A 1KENH 3DBSA 4LRNH 5H94B 3QJZA 1ITCA 4R9HA 5INDA 3IMWA 1D9KD 4P3DB 5EIBC 2HLEB 5D7LD 3HQRA 3VXNA 5BV6A 5IB5A 4TWKA 5JYMA 3MRNB 1GMIA 4OVEA 3A6OA 1SQFA 2VITA 3U6XA 4PB0L 2WBXA 4YN3A 4BH7A 1K4CB 3QQ4A 4WEEA 1PNFA 1N64L 2YS8A 2Q8EA 3ITQA 1XH1A 1LU2A 1DO6A 1FP5A 3NCMA 5E6YA 4Y3OA 2YXSA 4XPGL 1BD2B 2FJGA 3I3DA 2WZ0A 4Z7WA 2R0FA 2EUWA 1OLRA 2R062 2WYSA 3QH6A 3HVNA 4XMTA 2E5LB 4F3JA 1ZA3B 3QYCA 3VWJD 3ZT6A 3FW6A 4A63A 3VCLB 1XFPA 1LMKA 2UXGA 4P49A 4U1HB 1FC1A 3ETPA 5HGHB 3L54A 3CK0H 5B1BB 2FBRA 2DM4A 3MNWB 2BUKA 2XLAA 3PWPD 3OSVA 4MDJA 4FFGA 2UWCA 4JI3O 3MX0A 3BAYA 4N3TA 3T3MB 5KS9F 1X44A 4CU7A 3LQMA 2E47A 2VLKD 1S9XA 3H7BB 3OFNG 2AXFA 4LSVL 5I19H 3FS9A 2D73A 5JNYA 3ME2A 2D7MA 1X9LA 3ZUCA 2VDRB 1LENA 1WE5A 4XC9A 4LLVA 1HHGA 4PJ5A 5C8CB 5IFJB 1FZMB 3K6FA 4L1SA 2CDYA 1FGNH 5GGSB 2CJUH 3FT2A 5ABZA 2PTUA 3FQ2A 2DLGA 3GK8H 5LDUA 4YXHH 2HRLA 1AD0A 1IC5H 4OCRL 2QQLL 2XGXA 2P4EA 2VH9A 5BNXD 3T1HO 1DQ0A 1LP9B 4YDZA 2IXQA 1GS7A 2MOGA 2Y1VA 3NSDA 4IERA 4IEOA 4Y5TA 5EPMB 2DCKA 4MJ2A 4MQTB 1WZXA 5D1QB 3QIWC 3L5WA 2NN8A 3QNZA 1MQKH 2EJRA 4NPYA 1DFQA 3LEIA 1OD9A 3AVEA 2ALWA 2EAAA 3B9KD 1XF5A 4I77L 1A6UL 1F4XH 2HEPA 3I02A 3LQAC 4Y4KB 4ZFZA 4YQXL 1JWSB 5FEBA 4IU3B 3ILEA 5EIBD 3MLTA 4N9GB 1DBKH 1ZLSL 2HWD2 3PWJB 5JSPA 1X59A 1NCUA 2MEV1 3QNXB 1OGSA 1EVUA 4G8EB 4QAWA 4UUJB 4OJCA 4L0ZA 4DJMA 2YFZA 2KB1A 1EPFA 3NCJH 1TSRA 5C0BE 4I2OA 1KULA 1U3HD 3E35A 3T1HB 2QDNA 1HE8A 1HLCA 4LOTA 2VLRA 2XWEA 4QHUA 4ZIBA 4DP9X 5KJ4A 3LPPA 4MVSA 4LVEA 3UBXG 4KZEL 1IGFL 4MD4B 4PJBA 1LR5A 1S0DA 4FCHA 4K5MA 3WLWD 1UKRA 4PRPE 4Y88A 5I71C 5IR1A 5JW4M 4NXNB 1R091 4HVRA 3USUB 1CLZL 3UG5A 4AYFB 2J55A 4X7SL 1RMFL 1QBLH 2YC2A 1KJ2B 2JS5A 1WAZA 3IKCA 4I9XA 4CILA 2ZMKA 2NY7H 3GMRB 2PQQA 4FM1A 1Y66A 1WLCA 4WVZA 4G8GA 1RZPA 3MRFA 2AJVL 4A45A 1GFF2 3AXLB 4ZHQA 5D7HA 1ZOXA 2JCCF 4LLMA 4Y16B 5BS0D 2B4CH 4U1IA 3G5YA 4M5TA 5I6KA 2A9AA 3CSBA 2OQJB 2QJVA 1FYHB 3L8QA 2DBJA 2WVTA 4Q6KA 4OHVA 1OPGH 4YDKL 1ZCRA 4KV5F 2QWPB 5K59F 1PTZA 2XUEA 5T5LA 1PZ3A 1Q9KB 1RPKA 3X14B 4TTGA 1AQMA 3ZFGA 5KBMA 1OWRM 5JZGA 4F3FB 2PP7A 1QBMH 4GMSL 1V5JA 2DI9A 4Z8FH 5F5AA 2QZ5A 2YFNA 4E41D 2AXGA 4Q4X2 3VDDA 2R30A 1CGXA 1L3NA 5ITZB 3FX7A 2WL1A 3POIA 3AT0A 3WD5A 5JQHC 1K8DA 2ZCHH 1CE1H 1ETJA 3MFFA 2RS32 3UBXI 4AEKA 2YXWA 1T89C 1WCUA 5KHKA 2GDFA 4CPBD 1X5GA 2GAZB 2O5ZH 1EXGA 1U8KA 2J4WL 3QIWD 4CC4C 5LHDA 3EMRA 2YD1A 4CVXB 3US1A 2VUAA 5C0IB 2FECI 1R5VA 1X6NA 3QEQB 2KQMA 4Q74A 5LBFA 3QCWA 4NUGL 4DYLA 4F15B 3UTSD 4AI8A 3M4FA 5CZVL 1SLCA 3OB0K 3LZLA 4JFYA 2NLJC 4R26H 3WGUB 1XZ0A 3QJXA 4L29A 1RUQH 5B38G 2XXZA 4IGBD 4Y4FD 2VDKB 4LVOC 3F6LA 2AACA 3C7OA 1FV2A 2EE9A 2YAHA 1E6JL 3FO2A 3GMOB 3N42B 2LGQA 2N7SA 1VBE2 4EV0A 2R2EA 3JT0A 4N8CL 4LHUB 5GS1B 3S8FB 3NJMA 3CFDA 2FQPA 1YMMA 1NE4A 1T0MA 3NMEA 1V55C 2HKHL 4ZTOH 3VI3E 3ULVE 2J8OA 2J88L 2Q5BA 4HK0B 2MCMA 1FAYA 2F19L 2VERN 4DP8X 3GDBA 2G5RA 3TTYA 4JYAB 2XPJA 2CU5A 4K7PH 4A7UA 3EOYG 1NGQH 1I3RA 3QXDB 4HCFA 1EP0A 3QJHB 4HJGA 4P14A 2P8MA 4PY8I 4ZK8A 3RY6A 1MJ8H 3WEXA 3VG9C 3BWZA 2EEFA 4TUOA 3IPVA 3D0JA 3A0BZ 4XP1H 4JZNB 4ZMNA 5FO8A 5A3LA 2B1HH 1JQ0A 3NJVA 5D1XA 2YR3A 3VSTA 4KQ0A 3NJYA 3NQIA 2HJIA 2YPVA 3S5LG 5CEZL 2X6AA 1AI4A 5LQBH 5JR2A 4ZW8A 4ZBJA 3VFGL 3S3CB 3K6OA 1AR2A 4O4YH 2D7OA 4UOW1 4KC3B 3WJMB 3MYXA 2FYYB 1FG2A 1OA4A 2FMYA 1QTSA 4PJ0Z 5HHVL 3LSDA 2IBGA 1US6A 1OLLA 2HFEB 2QV4A 2UWEB 3D2UB 4Z2WA 1LJMA 3HFML 5DLLA 1K3EA 3FRUA 3I2IA 3V0AA 2C9AA 2JECA 2F53E 5ICYB 1ADQH 3U0WL 1D7PM 4CZZA 3F3HA 1IL1A 5EBGA 2WNEA 4HIIB 3KWVA 4YH6A 1Y74A 4X1KA 4ORGB 3P4OB 2WNKA 4JI0O 3SZ6A 1YYCA 2KT6A 4UV9A 4B3TO 2EXHA 1I1AC 4D8PA 5CM1A 2V5RA 5HGBB 1U5YA 3GEWB 3B93A 2BHZA 4X99A 3V6FA 3AEIA 1F51A 2ZKOA 4AQYO 1HQRB 1SXAA 3T0WA 5A70A 4FNPA 5IB4B 1A6ZA 2V4LA 4FPHA 1O59A 4LMQI 4JE4B 1AANA 2EIZA 2D4DA 4ZQTA 5T3ZD 1AL0G 4Q9CA 2RFXA 3ZDSA 3N4MA 1L7IL 4PT6A 3FLRA 3GWKC 1AJNA 1JPGB 4HWZB 5F1KC 1H1AA 5FTTC 2ITDB 4P2RD 5JORA 5FZ6A 3TJHD 4QTFA 3UH8A 4N28A 2J1KA 1ASJ2 1GPOH 1VJSA 4OT1H 43CAB 4BQCA 2V5MA 1KUQA 3VHPA 4JI0B 2IAMD 1NCQA 3VKMA 4WBBA 3CN2A 3FFCA 3N9GH 2JDZA 3DV4B 2V8MA 3ZGHA 1U8MA 1CK0L 1KGYA 1RUI3 5KOMC 1ND2C 1JDAA 4YM1A 3ZJZA 1OSPH 1RJLB 5FKAB 4AQYB 4GQ9H 1NZCA 2J1TA 3C6LC 3FB6B 1B2YA 3I9GH 1HB1A 1ZUQA 1A8DA 3VZNA 1YDXA 3G08A 5LA6A 3MFGB 4FGMA 2QKDA 1S0GA 3QQNA 4JO8A 1OB1A 3CC5B 3M6DA 3GO1H 5D4HA 2OW4A 5FZHA 5SWZE 3JYCA 2YV8A 1TQCC 2J6EL 3RUGF 3IPFA 3RFRA 1XCTB 4FFFA 2OULB 5IFPA 3WNXA 5F96L 3ARDA 3LNDA 4X20A 1M05A 2X0LA 3JU9A 3KGTA 5IW3A 4LPCA 3GGWA 2VT0A 1MQ8A 2W60B 4YJ2A 3MAQA 4KQ3L 5HCBA 1XDCA 1OP3K 1K7DA 3T2PA 1U8HB 4PJXF 4JFZH 4WFGA 5IQ7L 3X1NA 2H4EA 1GLHA 3DUIA 3CFCH 4G83A 3FQYA 1HILA 1ZTXL 4GAGH 1FT9A 1SQXH 4LVHC 1E1QG 1BYNA 5BNNC 1F4YH 5H4ZA 3CL1A 5JIAA 3B40A 3GQFA 3TM6A 3A21A 4HGWA 4DTGL 3BPNB 3H0TB 4DRXA 4IHBA 2AW9A 1ZHNA 2F15A 2NQ3A 3NIDE 4ZODA 1YNTB 3TEYA 1WC7B 2H7WA 1RUF3 1NFDF 1RERA 1FH5L 5DRZB 3V7MA 2XX1A 2NY5C 1U8PB 1EAJA 3U7AA 4KU8A 1MIEH 3ETQA 3DGGA 4LCYB 1MIML 1TXKA 4IIJA 5I15H 4H37A 2Q10A 1TYJA 1PG7X 4UV7L 4FTEA 3MODH 3JD3A 1H3PL 4X6QB 4F7KA 3OPZH 5D70H 4CBCA 3LEXA 4LHSA 1UZ6E 2EYRB 2GW5A 1X7QA 1JN6A 1PO21 3E9UA 2B4KA 2V33A 3S5LA 3DVNB 2C9RA 4XF9A 5DAQA 5DC2A 4X98A 3QUZB 1ZREA 4X7CC 1ACYL 3IGAB 4U0QB 5HHOA 1NMCC 3FUJA 3B3IB 4UV8A 3MA9L 4S2GA 1WFMA 4IOFD 3IN9A 5BNQA 3WY4A 3JBG1 1TFHA 5HJDA 1U4FA 4BZ2H 5KW9L 3VFUB 2F7OA 2XWXA 2KMWA 5L8JB 1HDMB 2ZABA 3UTZA 5FPUA 1UY4A 1VPHA 4ZRGA 2E5EA 2EC9T 1BQ5A 5KVEL 2QTSA 5AAWA 1QGLA 4RAVB 3FQRA 2XBO1 2Y5EA 2W0FC 4XAEA 3EGDB 1JXNA 2NMNA 4ZU4A 3RJDA 3COOA 3UYPA 1MHCA 2BHFA 1ULCA 1VIWB 3CPUA 1PIGA 1OCOB 1MLBA 2LABA 1M7IA 3MLRH 4NJ9L 3EJRA 4PJDE 3JD73 1MHEB 2Q8BL 4NZUL 2ZG3A 3VXTA 3ZMSA 1C3HA 5AKSA 1ZAGA 4FEMA 4GP5B 4MXWH 2X4RA 4X7FC 4JPKH 3C8KA 4ABUA 5J89A 4N9OB 4HANA 2V2XA 3AG1B 3OZ9L 3H7LA 3OX8B 4GSDL 1DUYB 4KY1L 3S34H 4AKQA 2PAEA 4LIUA 4U4BA 3S3BB 4CS2A 4HWUA 3B9CA 3O3AA 1E8XA 1G1YA 3GMQB 4ALAC 4F27A 2YUVA 1ILSA 5AUMA 5GGQL 4PYGA 2E9QA 1QZ1A 4M7LL 2CKNA 4KI1A 3AITA 1FKAO 2KDYA 4KAQH 3IWZA 4PCYA 4M1GL 4P46C 1I8KA 1N8RW 4N25A 1S7QB 2QJ1A 3JTTB 4IGPA 3SJVD 1URLA 5E1RA 2TRYA 5HDQL 1D9KA 2IANB 3TGUH 5D7LA 1R3LC 3B7UX 4HLTA 1JHTA 4KXAA 5CD5C 4KK6C 1OF4A 2D6PA 1T4KB 4GWMA 1BVOA 1A21A 1JODA 4F8NA 5DQJB 5LGTA 4LLUB 4PCKA 5B1BC 1RPRA 4NB5A 1MJJB 1DJYA 1T6GC 4N2CA 2RMU3 4I0AA 3LE0A 1YPZF 1UKSA 1XCQA 4L5FL 5LGNA 3BA8A 4OGQB 3WXWH 1QQP2 3BAEL 4L05A 4W9HC 4FA6A 3JV0A 4LCWB 3RBZA 5E56A 1PFCA 5GS0L 2GSMB 4HF5L 3OKEB 3T0DA 5BR8O 4AFBA 1OE1A 2AKRA 2APTA 4HOXA 1QOTA 3ZYGA 2DWXA 4UINL 4UTBH 3PWPA 5FP8A 4Y1AD 4BLJA 1JYIA 5JOWA 1I3HA 5CMUA 5A6YA 2JG9B 4BFIA 1NUKA 4GB31 1ANUA 5EO0A 1Z3RA 2QPSA 2VLKA 3C6SB 4PEEA 1H5BB 1A4KA 4FLOA 4HDIB 4MCMA 4R90H 5DZVA 3VGEA 1J5EO 1TYEB 4ONGH 5FY1A 3T0AA 3DL3A 1R6TA 4RSUA 1AR71 1DFXA 2VOVA 3HC2A 3K3WA 2CIKA 4XOEA 1SMVA 2VW6A 1DQLH 1HNYA 1KTLB 1EDQA 3V0VA 3VFPA 1BZOA 4FP8L 5EZLB 1TIUA 1WT5C 5KXDA 1INQB 5MI0B 3LJ3A 5D5PA 5CN0A 3HE7A 2ZWSA 1W6QB 3C9NA 4CDXA 3N7LA 2F74A 2PF6A 4N53B 5BR8B 2W08A 1FOD2 5HDLA 4YJ3A 1NJ9B 5INDB 3CFTA 5DJXA 3MUZ1 4U31A 1OAKH 4R4FH 5I73C 5FUOL 2Z7UA 3SGEI 1EEQA 3VXNB 2XJQA 3LSOA 3EXUA 5IB5B 5F3BA 3VQVA 4AEMA 4OMCA 2F93B 1NXMA 3UADA 4F57H 3Q5YA 4L11A 4BIFA 4TV8A 1J5EB 1QFWM 2Z91B 3S48A 2BNMA 1W6PB 4BH7B 2DTMH 1BK1A 3X3FL 5DFAA 5T3XH 1E6OH 1MAMH 4DESA 3Q8EA 2QWOB 1QU0A 2DQJH 4LO6B 5H37G 3ZKSD 4Z7WB 1JZ4A 4RNRA 2MPVA 1YEDB 4XCFL 4Y4HC 4DN3L 4RESB 4Q20A 4FM2A 4PQXA 3VD2A 1VGEL 2QSQA 2WXQA 1PKQA 2HTLC 3QARA 3V7AG 2QTEA 2EUVA 3SBWC 1U3HA 1HV1A 1B2WL 1HQ4A 1MCRA 4PLKD 4OCLC 5KBPA 2PYJA 4R6ZA 2CDEB 1AILA 2GMPA 4MDJB 4LBMA 3D8CA 2OK0H 2QHRL 5BUAA 4Y16C 3MX0B 4FP3A 3GBDA 5HVGB 3RDIA 4NM4L 3E5XA 3QCTL 4CVZB 1G9MH 1NCWH 2AXFB 1G0YR 2ESVA 4DEVA 4YSSA 3V9FA 5BV7L 3Q2CA 3MHHC 1KIRB 1NBYA 4CKQA 3R4DA 1TKWB 4LLVB 4PJ5B 3I4IA 3NA9L 3PDDA 3IS1X 3WCYA 2DCTA 4J11A 4RR3A 5BS0A 3FT2B 5IQMA 4PJHE 1POQA 3D87B 1OARH 2X1QA 3POHA 3JAWB 5IJ9A 4P5TC 2COQA 4ZPVA 1V9PA 2I25N 3TH2T 4Z7OE 2IMNA 4HZ1A 3ZDXF 2DVFA 2HYKA 1C1EH 3JCIA 2DZEA 2G9HA 4FQQB 4KZDL 2YPVL 3CJJA 4XB8A 3P11H 4HEME 4GY4A 2V5DA 1H6EA 2EDHA 4ODTH 4IW3A 4G42A 4XTRD 3NV2A 1TVBB 2IOIA 1SERA 1DLHA 3L5WB 3QNZB 4JV5O 1Y6MR 2XWZA 2VB5A 2R042 4BMEA 1MFMA 3DJ9A 4JLRA 4E41A 5CN3A 2IVJA 4JO4L 4NPYB 3VFNA 3QIUC 3MRDA 5FXZA 3H1YA 5FP9A 1XF5B 2NX5A 3A0KA 4XF0A 1D3CA 3K1DA 2VZQA 4MQXD 3WG7B 4ZFZB 3E0GA 3I02B 2DKMA 4KRNA 4TQHA 1MCOL 5FZIA 4CPBA 1JPEA 3QIWA 3MLTB 1UVQA 1E9PA 2D8KA 3IFNH 1A7PH 4ZQKA 3LPFA 3B2VH 3CFMA 1NWOA 1SF3A 2BHUA 3X11A 5GGSY 1PGL2 4B7LA 3UTSA 4I89A 4N0YL 1SDDB 3AWEA 1RUAH 3SGJA 1H9WA 4Z6AT 4UVBA 1X9UA 2FH8A 2EH8L 3ETGA 4OGYH 2BNQB 4IGBA 4Y4FA 4C0HA 4HWNA 5BNPB 2P8LB 4JV5B 3HN1A 4OPAA 1EA9C 4TTDC 5ICZA 5IR1B 5EQUA 3U37A 5TF1L 5EC1C 4QXBA 2VXQA 1BQ0A 4GZ9A 1EJOL 2DOCA 3IKCB 2AZAA 3NSXA 4FNLH 4TS6A 5CSBA 2IIJA 2OT5A 2O30A 2WAOA 1G7LA 4G5ZL 4G8GB 5EBLA 1K5JA 4B9PA 3H9SE 3UAEA 4WW2F 4LLMB 2YZ1A 4CUAA 4U1IB 3G5YB 1RL1A 1X5HA 2YAFA 2YHGA 4EKWA 1X7TA 1QF3A 2EUXA 3GSNA 1I7UA 4F91B 3QZBA 4XBEL 1MQTA 5C09D 2RR13 3TLRA 2XFXA 1B4JL 1RUG3 2GIMA 4OZFB 3QR2A 1PZAA 3LDKA 1LHZA 3ZFGB 5JZGB 1AE6H 2Q6WB 3HKZA 4JY5H 1QPPA 2GNBA 4P5TD 5ECJE 4EO5A 2AXGB 3VDDB 4RGNC 4Y8DC 4WK4B 4YBLB 3LEVL 4GX5A 1KDMA 1X9PA 2AV1A 2ZUVA 2D0FA 3ESMA 5GRVL 1K8DB 5G2NA 2VJ0A 1UT2A 1R33A 4XNQA 3VSQA 4GX1A 3WHXB 1W8UA 1INDL 5ID0B 4XCYA 3HN8A 2JEXA 3C60B 5EMYA 1R5VB 1H0DB 4BHPA 2AQ3A 2VKWA 3QIUD 5HHNA 4ZAKC 3K79A 5H37A 2ES3A 1KIPA 1UJTA 5FLIA 5LY1A 3KL3A 4LQRA 3S2AA 4D9QE 1N34O 4Y2DC 3W7WA 3CRCA 1LJ7A 2D3NA 4JFYB 4Z0BH 3ULUE 4MTOA 1XZ0B 3EDJA 3K46A 4L29B 3FU8A 3O3EA 4YHOH 1Q0EA 3HG3A 1DQQA 1E4KC 4XXDA 4ZW5A 4PIYA 2EALA 2J8UE 3K2KA 3NJKA 2ZCWA 3VBBA 1F4AA 4A7TA 2R2EB 2WC7A 3DK2A 4GI8A 5SX5H 2DW4A 2RCVA 4ZBMA 3CFDB 1O5UA 1YMMB 1CDUA 3O6MH 5IWFA 1US3A 1T0MB 1PIV1 1XMOO 1G1KA 3CUPA 1A9VA 2DH3A 3AY4A 3OXSA 1OAUL 3MRCB 4UCOA 4KI5F 3UZQA 5BV7B 3PJYA 1NXD1 3L3KA 5IEHA 4HBCH 4TTDD 4PVLA 5E00A 2DURA 1NCRA 3H9VA 1CI3M 1T5WB 3G5XA 3M7OA 3QCVL 3C3SA 4JFXA 5AWNL 4HJGB 4P2RA 4AJYV 4C55A 2P8MB 4OB5L 1N34B 3WEXB 4XMPH 4TUOB 3OXRA 1CQ9A 3IPVB 3KHCA 1KCUH 5FO8B 3KPPB 3KPLB 4WU5B 1JNHA 3HG4A 4PJAA 1T7VA 4GZRB 2IAMA 3RYCA 5L7XL 1P9MC 2AVFA 4X8CA 5D1XB 3ZM8A 4I0XA 3T6ZA 5B8CA 2HBTA 4BIUA 4K0KO 5JO5A 2YK1H 4MA1B 5FYLD 1BGYH 1JTOA 1XMOB 3FN9A 3ZTNH 1BVKA 3I2DA 3W11C 3TJEL 3E5QA 2VAAA 2YARA 1LNSA 5E6HA 5JIUA 1FG2B 4PGEB 4AIXA 1DBNA 4PJCE 1XF4A 3U9PL 4RGND 3VI4A 3FRUB 3SCMD 3OF1A 1S5HC 1RU9L 5T50A 2BOLA 1Q1JL 1TO5A 5AOJA 4META 2FKXA 1EJ8A 3FO1A 3K5SA 3RX8A 4ICGA 4PBPA 5LK5A 1IL1B 5L8LB 1Y9GA 4WGWB 1SHMA 5D7KD 3WNIA 4CBPA 3TNQA 1Y74B 1EAPB 3BPNC 4OLYH 3BKZA 4TLFA 3LXAA 1IFGA 4O2CA 3VWKD 5IKCA 4QPKA 1B04A 3PABB 1KKCA 3HJ0A 5I18H 4K0KB 4D8PB 1HN0A 3ELAT 1G9EA 5CP3A 3I7DA 4X99B 3V6FB 1IG0A 4Y2DD 1MFAL 2R071 2IDQA 1J7VR 3JZVA 1QQDA 4D7YA 4ZUUB 1A6ZB 5AZEL 3NQHA 4WI7A 1W9SA 3CP1A 2YA2A 1ZRUA 1FI8C 2EIZB 1WMDA 4OQTH 3S36H 1U5ZA 1YYNA 2RFXB 4L9LA 3U36A 5FP7A 1DJIA 4JV4A 4RWYH 2R1BA 4NHKA 2LFSA 1A22B 1KCVH 1PZSA 1KJMA 1XQ4A 1GRWA 2CMRH 4MV2A 4JMXA 2Z3YA 3TBBA 5GJTH 4IL6Z 1RZFH 1L0YA 1P4LA 2H94A 2FB4L 2HJKA 2X4QB 4PW3A 3V0WH 4ZMYA 4ZTPL 1M2OA 4JRXE 4INDA 2BVPB 3GC3A 4U3FH 4AE1A 1HDKA 2PGGA 1NCQB 4FQXC 3FFCB 5D6DA 3CLWA 4L2LA 1CTNA 4F9PA 1EXHA 1OLME 5K1NA 3SE9L 1NCBL 5JHDE 2Q7GA 3WMQA 1D2PA 5DQDH 4XP4H 4E36A 2ODIA 1L0QA 4XRCA 4L37A 3P9LA 3TT3H 1UQSA 1UQXA 5FYYA 1FNFA 2NZ9C 1XD1A 4M48H 4ODSL 1KPRB 1NEZB 3DVFA 3VOUA 3VW3H 3G08B 5LA6B 3HS9A 3H9HA 2X2UA 2HLDG 1HQLA 2EQDA 1OB1B 2JI1A 3HPLB 4BQ8A 2HVJA 1KWGA 4C57C 2FNWA 4FA8A 1G1OA 2EAEA 1LUVA 5DK3A 1LU1A 1TETH 5JR7B 4X9QA 4QKXB 5H9SA 3O0WA 4WTWA 5F7DA 1ZY9A 3ZKMC 1M05B 4YM0A 4O2BA 2W95A 3LB9A 5LEJA 4YJ2B 2OTWA 2JIXD 2KQNA 5CO1A 1AXTH 1SFNA 1Z9OA 3OHXA 5DUBA 3AT8A 1JPST 2A71A 5JH7A 1NAMA 1WAPA 4Q89A 5C0EB 3M8AA 1AS8A 1HILB 3PWVA 4DQAA 1BJ1J 4I4TA 2DYRB 1IBHA 1TZIA 2YEZA 3VQLA 2WZR3 3BI9X 3D4YA 4HGWB 1BQKA 3ZL4H 1I9EA 4QJFB 2WWKT 2C1FA 4DRXB 3MGTA 1TMCB 3KVQA 1QYGH 5IYBO 1N0LB 2FL5A 3EO9L 4NERA 4BQ4A 5ADPH 4OI4A 3FN0L 2FUQA 2P22C 2EBOA 5F7KC 1RVF3 2A1XA 4OMDA 5DEZA 1MVEA 1J9TA 2GFBB 2R70A 2AVGA 3DGGB 1PK6C 1A14H 4PB9H 3WB0A 4BSVB 1FNEB 2ATKC 2CXGA 4E8DA 2D43A 3P73B 4H44C 1UOLA 1RULL 4PRBA 3LEXB 4UAOB 2VY0A 3E6DA 4ASMB 4W9EC 3OG4B 5IE9A 1NUGA 1X7QB 3IDXH 3OC8A 5CEYA 3SJVA 3UTPE 4AIOA 1C8M1 4X98B 1W72L 1CX4A 3Q01A 5D2LE 1U5XA 1BM3L 4I8DA 2WZ8A 4AF9A 4LGSB 2OJEB 1YEKH 4I5BB 3T3PE 4FQXD 4CDHA 3I2HA 4JM2C 1XNQO 1J0IA 4XJAA 2NUTA 5FV2A 5IVYA 4K0OA 4OFIA 4LK6A 3WP6A 2EC8A 2NZ1A 4BFKA 4BWUA 3O4OB 4DGYH 4OV5A 4LE3A 4F33A 4FLTA 1BVLB 2LFEA 1IX9A 4WCEV 5IVVA 3HI6L 3GS7A 4LR3A 2NZ9D 3NNFA 1KCSH 4IEPA 5A7PA 4HWBA 2XPZA 1I82A 5T1KB 1QD0A 2B5HA 4XVOA 1RUI2 2HKFH 2V7HA 4NN7B 4YDIH 5KOVC 1TUBA 4YRDA 3UYPB 1MHCB 1P6FA 2IBZX 4K8FA 5FYVA 1MLBB 1M7IB 4Y1AA 5FM5O 1IGJB 1SVBA 3D39E 1DJHA 3ZKMD 3BJ91 4DCQA 1LE5A 4BUQA 2X4RB 2ARXA 1W80A 5JOZA 2R69H 2W0FA 4AK2A 2V2XB 3ZDYB 1XNQB 4BK8A 5DC9B 4LCUC 2VDNL 1ETA1 1FL5B 1KELH 5KVFH 2XIBA 1R5IA 1U30A 3V5HB 1IGMH 2DWEA 5I28A 4XETA 4I18C 4FVMA 3O3AB 1HIMH 2OSLA 4FM0A 4UILH 1NQJA 5EJZB 5AUMB 3GB7A 1UZVA 2DQGH 4HEPG 1AAJA 3D33A 1TF4A 3KCXA 1ORSA 4QXGH 1GNHA 1ZHLA 2N05A 5CIPH 4NP4L 1JZJA 1AR4A 5K93A 5KVDE 4N2KA 4WZFA 2IW5A 2IUWA 1A34A 1D9KB 3OGOE 1M93A 5D7LB 1R3HA 4DP4X 1H8TA 3ABLC 2EIDA 4OFDA 5DZJA 4YEEA 5ESVA 1IO4C 1JHTB 1AYN3 4YE4H 5D9SB 3ALXA 4MW8A 1JI6A 5DGQA 1RUF2 4MS8C 4EN7B 3QUYC 3GXDA 3PLQA 2WSDA 1G4YB 2V17H 1OJHA 2VXUH 5CGYC 4YLZA 1TZHA 3GTVA 3K5NA 3B2MA 3AROA 5FUZH 3SE6A 1A7RH 2E7BA 1YTFB 3ES6A 2R0LL 1RJYA 1XCQB 3IEAA 3K8LA 4NFBA 5I8CB 1AP5A 3I75A 1A9BA 1T80A 3FJTA 3I5DA 4IIQA 4JQXC 4D7BA 5KYWA 1DSYA 4JM2D 4PG2A 2K0GA 4PJFE 5H9RA 1I7TA 4TF4A 1OC1A 4OTXL 1X5XA 4XPFH 3KMDA 3BUCA 1K5WA 2AKRB 3IE4A 3USSA 1F00I 1WBZB 2VXQL 2BXZA 5KAIZ 3PWPB 3R18A 1BEV1 2VVFA 3ABKC 4OZGF 5EIVA 3RWFA 3VA6A 2W1WA 4XJWA 4YZ4A 2WN2A 2WAQA 1WW4A 5EO0B 1PSKL 1A3ZA 4GG8A 3KQ4B 2VLKB 3CDCA 2ZCEA 1YIPA 5C08D 3BUYA 3SCHA 4F2EA 1K85A 3K75B 2ZT9C 5F7AA 1YC61 2QQKA 1B09A 3NO8A 2CIKB 4PTTA 2X4PA 3V65A 1DQKA 3Q05A 3O1RA 3VHNA 5A3MA 1XHXA 2UX6A 4OUOA 3Q9QA 2VQ0A 1AACA 4GG6F 3AL5A 3HE7B 3PYCA 5DLML 4FLYA 2P5EE 3OEBA 1JGIA 1CPUA 1BZKA 3C9NB 2R061 2VUJA 4CDXB 1FL6A 2QNKA 1V7ML 3PDOB 1NBVL 5FKPB 4OGAC 2A83A 4LH7A 3BDYH 4ODWA 4ANVA 5FYMA 2K6ZA 3JD72 3AQZA 3MV8E 4PMEA 4HAKA 4JFUA 3HQXA 4TL4A 5DJXB 3PNRB 4P9XA 4Y5Z0 4IYHA 5L4IA 3B4SA 5TF0A 3VI4F 3CIHA 1RZKC 5C2BL 4WBNA 2DBNA 1XNRO 3FL7A 5F3BB 4EWAA 1MCPL 5GJ6A 3G4SV 2NCMA 4TV8B 1W72B 2P48B 3IJ9A 4NNXA 4U6XA 5JOEA 2PHFA 3S6CA 3EDFA 3FBKA 3RDTC 4DOHE 1WSST 1D6EA 3K6SA 1JRHL 2RS53 2Q86A 1AHSA 5E8OB 3CO2A 1PMYA 2Q2EB 3VRJA 4PJ7E 4UT9A 2WYFA 4RHV1 4G7YH 4RNRB 3I3BA 4NQDD 4UQCA 1CZSA 4A66A 2WO1A 4FX5A 1PKQB 5J1TC 3W5MA 1U3HB 2WHVA 3GBML 3VBFB 3TU6A 2AEPL 1AHMA 4GRWF 4UBHA 4Z07A 2BNUB 3B01A 3T4HB 4CA4A 2MNJB 4WHDA 3HLAA 1MEC1 4FFYA 4XVSL 3G6EV 2ZF8A 4KHTH 4UIKL 4FMVA 3JQXA 4RFT0 3MHZA 1XNRB 2VDQL 5IT6A 2ESVB 5DTFA 2EIJB 4HJJL 3U4BH 4LIQE 3T3YA 5T3ZL 2XXFA 1NBYB 4DXTA 2ZPKH 3R4DB 4OD2B 5A80A 5FK7A 3QWRD 1NC4D 2YXLA 4RFOL 2RMU2 3ES4A 1N47A 3OBRA 5HXVA 4XP9H 4ZW6A 2WZEA 3M3CA 4MVUA 4Q4W3 4RR3B 5BS0B 5D72L 5IFTA 4Q0SA 3QP3A 1H2MA 3WKYA 2VDNB 1S1AA 3VBHA 5I74C 1POV3 5FA4A 5FX3A 1JU3A 3V0GA 1YJDL 2YGMA 3QORC 4HMDA 4P4RB 2G9HB 4Y9CA 3S37X 1A7OH 4UFIA 4HEPA 5C09A 4MQ7A 1MHHA 3TNMA 4Y7OC 1WLTA 3BKCH 1KD7A 2Y2TA 4G42B 1ADWA 3ECUA 5I6NA 1MF2H 3NRQA 1NUDA 5BO0D 3UCSC 1H6UA 4XMKL 1DLHB 3T77A 1Z2GA 4TLTA 4B9JA 3J7MA 1FAIH 1A7NL 4P5TA 4E41B 4JLRB 3AP5A 3VFNB 3HE6D 2DJ4A 1R1ZA 3MRDB 1FATA 2ZKHH 2R8SL 1OKOA 2CO2A 2NX5B 4Z7UF 4OGAD 4NKOA 2WLHA 4ZOBA 1W59A 2RJZA 1QJY3 5F1SA 3QCUL 1UMHA 3OGRA 4TNGA 4ZS2A 1MZYA 4NAQA 3JAMN 2Z1PA 3CZFA 4ZQKB 4PG9A 4TOYH 4QT5A 3SDYL 2O8QA 1H9PA 5A3IC 3QIUA 3X11B 1QKZL 4XXCC 3UTSB 3ABMB 1WW6A 5TE4L 3D25A 4JHAL 2XV6B 5DHVH 2OMZB 4QHNA 3RDTD 1H4GA 2RQ8A 4LKFA 4DUVA 2AHYA 4X66O 4KKPA 4IGBB 4Y4FB 1W90A 1JPFA 2UXNA 3RL1A 1B0WA 3RZGA 4H8WL 5ICZB 4GRWH 1P2CA 1RUJ1 1BOGA 4HONA 4Q4X1 4L3EE 2VWJA 1CT8B 3Q2VA 1NOAA 2A79B 4U3HA 1O7DE 1PVC3 5C1MB 2ZHLA 1I9RL 3M8OL 3EJZC 3IAYA 4G7QB 1DLCA 2RS31 4HCIA 4PS8A 1G7LB 2C6SA 3CJIA 3NFPA 4XQ4A 2GBTA 4Z2AA 2UZXA 2GJ6D 5BUPA 3QBTB 3SOBH 4D0CB 4YBQC 4JJ5A 2JS3A 5JVDB 1I7UB 2BSTA 1AFVH 3B9EA 5EYYA 1MQTB 3ZSJA 1VCBC 2XFXB 4X66B 1UCTA 4I7ZB 1D2QA 4HUWA 4AYEC 4E9TA 4TN9A 1RJ7A 1DZTA 2OXHB 3KPSE 3E6FA 2IXIA 1R75A 3GJBA 1VBE1 1UYWH 1BZ9A 2AV1B 2BSRA 3MRPA 2PYFA 3G5ZA 4POZC 2QLVB 3II2A 2ZUQB 3MCLL 1NOVA 4IEXA 3Q3GB 1F90H 4XNQB 1S77D 3SE8L 4CSSA 2VL5A 5IT2L 1RI8A 5LBSH 2NMOA 1S3JA 4XCYB 1JGUL 5LGHH 1UASA 4GO6B 4U0RC 3SCMA 5D21A 5DS8B 4OXSA 3V0DA 2LGWA 5CJ8A 4J3VA 3WJLC 4UOW0 4BZ1H 1EO8H 1NAML 5BZBA 1HNGA 3K72A 1WMEA 3CTTA 3O3EB 3QQDA 3DYMA 5ES4B 4J3TA 4XXDB 3VWKA 5C07D 4PBOA 3QVNA 5A3ID 1JPSH 3DX1A 3RL2A 1MCLA 4K9JA 2CH7B 3PTRB 1RD6A 5AKRA 4Y2DA 3ZLQC 1QLFA 3CUPB 4QU1A 2OCJA 2VDQB 4HK8A 3OXSB 3PAVA 3ZU8A 4DERA 3GJAA 2XWTA 4XOGA 5FAXA 3CMOL 4IE7A 3C5XA 3L3KB 5IEHB 1Y4WA 5EZWA 1MA1A 1YY9C 5H6RA 2C9XA 5E00B 5ITFA 3R4UA 3BRCA 1N0XL 4M1CC 1H4HA 3BZFA 1NCRB 2JDYA 3UCRA 4P2RB 3E6HA 3QHZL 2MWCA 2VN4A 2HKXA 3EJZD 4YWGH 3OD4A 3AZUA 4K73A 3O11A 1JNHB 1QTYT 1P7BA 2P8PA 4PJAB 2IAMB 3RYCB 4AJWA 4XURA 5FKBA 1MH5B 1M7XA 1G9DA 3L3HB 1TQWA 4AZ8A 3KDPB 5HDOA 4A2DA 3LQZA 1UA6L 5B8CB 1MXDA 2NSMA 3HPLC 1J8HD 3STLC 2XIIA 5JO5B 3BRGC 3B02A 3ZIYA 1OOAA 5KA5A 2WQXA 1OAXL 1YECL 4B4PA 4KK8D 1KN2H 2XASA 4A1RA 4GUQA 1EWHA 1HSBA 5G55A 3LZFL 2NY6B 2VAAB 4FLZA 5BMFL 2FWSA 5J13B 5KSBE 2WC2A 2LFRA 3N7JA 1VP6A 1VB2A 2Q69A 1SHWB 2DB8A 2X6MA 1XF4B 2BFVL 3AMKA 4BHUA 1IXBA 3LDCA 3ULSA 2EJ1A 2K9UA 1RL3A 3KYAA 2FX8H 4XPAH 2X1WL 4HWBL 1MZFA 3WG2A 4C1WA 2A73A 5A2LH 4H1LA 1QPKA 3BQUD 4POZD 3FO1B 1XBDA 3SYOA 1RUG2 3K2OA 1FO0L 2W80C 4PRID 1H9VA 1OIOA 3WIIL 1KJ3L 1FNHA 3DKHA 1F9KA 1E8WA 1ASJ1 2PYED 3EYVA 2JIXA 4O2CB 3TASA 3X13A 5IKCB 1N70A 1R3JC 2KC0A 3WG4A 2MTAA 2IH3A 1EGJA 4Z7VE 3U0TA 5FBJA 1NPJA 1YN6A 4Q52A 2H5UA 2DTYA 4BFGA 3CZSA 3FH5A 3N50A 1G7IA 1SEQH 2JD4A 1LE9B 5IIEA 3ROUA 4YBHA 4LLAA 1G6UA 1DEDA 4I9WA 1DBML 1B90A 3T1WA 5DDJ3 4UTAH 2DVAA 1A6PA 3FMGH 1UWXH 2MNWA 1SOSA 3WY3A 5JQGA 4L9LB 3C2SA 3U36B 4CEYB 4FSJA 2WBKA 3BSZH 4XO3A 3VXSD 2FCTA 3SHRA 1KJMB 1LEIA 4YZ3A 2V3FA 3ESNA 4NRMA 5LRRA 4MNHA 2LUWA 4AXOA 2AGJL 1KYAA 3L13A 2HJKB 3DUUB 4EN2A 2J42A 1U8QA 3UO1H 4P9HH 5DA4A 2FX7H 4LSSL 4ODUA 1O9ZA 3GM8A 4M1CD 5EC2C 1CWPA 3O4OC 3BP7B 4KMLB 3KHBA 5APAA 4FBFA 3ARFD 2VUCA 3RYRA 2VRKA 4XRCB 4L37B 2KBGA 1NZIA 1UQSB 4CRPA 3DX4A 2DQIL 3CVIH 3D06A 4PA6A 5CZXC 5SWSE 3UJIL 5JLVA 2AEWA 3H9HB 3O7OA 4ZMXA 5DG1A 1VQKV 2QV2A 1U91B 3DJTA 2HVJB 4XOAA 3FRPG 1YQ8A 4OZHA 4KNQA 4E9VA 4GPVA 2ETEA 3L5JA 3CLEL 1ENRA 3FN3A 5F7DB 4UOJA 4O2BB 5DXDA 4DV5O 4KJWC 5I0YA 1Z32X 4NGHH 5F89B 3LS4H 3OHXB 1VQ8V 5DUBB 4E42A 4F5CA 5IESH 2R063 3O0XA 5FC9A 5JH7B 1NAMB 1B6DA 1WA2X 1E40A 2OVUA 3PWVB 2VDRH 1TZGL 5KMGA 1K3IA 2JJSC 4JN2A 25C8L 4I4TB 1TZIB 2YEZB 4OBRA 2J1RA 1R5WA 5KUMA 2F54E 4OIIL 3NFNA 4HGKC 4WFHE 1LOFC 5BPXA 4F6RA 2QQKL 2XUMA 3ZKNC 3JSNA 1X5AA 4NQCE 1AB3A 2FL5B 4FRWA 4JDZB 1FPN3 1UXZA 1UG9A 1QAWA 2F68X 1DG6A 1YEEH 3UYRH 4P9GA 1LO3H 4F8AA 5C97A 4JL2A 1IAKB 3IJ8A 5CBEB 2DQEH 4JQVA 4ZYKA 1IM9D 1ZTMA 2YU2A 4JVPA 5FYKE 4AWDA 4PCSA 4DV5B 5FMOS 2A7BA 2ID5A 3AP4A 4ZOAA 3FU3A 1NIBA 2NNFA 3BE1H 4PRBB 1QA9A 3NJLA 5IB2A 1F2NA 1H6FA 4K8RL 5CEYB 4QHBA 3KMHA 1J0JA 3SJVB 4ZNCD 1QWRA 2BRRH 3R4RA 3RAJH 4PJ9A 5I1JH 2HEWF 4GAZA 4OJEH 3RNQA 2AC1A 5D7SH 5L3CA 4KBPA 3UXFA 4IYKA 5F88B 4QO1A 3I54A 1XOYA 1ZS2A 1DFBH 1I1YB 2XZAL 4UDUA 1CR9L 3L08A 4HKBA 4XN8A 3ZTJH 4CH4A 2NUTB 2WXPA 3O4LA 4BPZA 4R7XA 1M9SA 1FXKA 1GMEA 1EN6A 3AFGA 5JDJA 4L97A 3LDEA 4F33B 3CU1A 1OM3H 1J5IA 4F1SA 2A2QT 5FO7A 1ZBE3 3T4AA 4TLSA 3GMMA 5A16B 1LNUA 5IVXF 3BH8A 4JJHA 5CZXD 1SBEA 1W28A 4JM2A 4ZUVB 4BA8A 5B1OA 3B9DA 1E5YA 2IMMA 3CWBH 1WBXA 2FEEI 1FO0B 2ATPA 2PETA 2Q20A 2V7HB 3B7TA 3F58L 5ESQA 1EY2A 4GWJA 3MHSC 1KJ2H 4B9YA 1BMGA 1V6NA 5JQ6L 3S3XA 1DVTA 4Y1AB 4IDLA 5E1GA 4Q7DA 3N9PA 1L8DA 3BD3A 4DCQB 4HMZA 1FRGH 1N8OE 2OP4H 5F8QC 5KJRL 1LE5B 2HG5B 1KITA 2VTXA 2BOCB 3WXVH 3VFRA 1ZDSA 5C08A 5EYPB 1Z9SA 4M1DL 2R0WL 5KSUB 1KS5A 1G7JA 3HC0A 4HJ0D 2DWEB 2EIKC 1SY6H 2DQCH 4UB0L 2MCAA 4OF0A 1DLLA 4WTQA 3H01A 2OSLB 3K58A 2B15A 5IBLC 5A40E 3GB7B 1T2QH 3AG2B 1Z2KA 4K9EC 3ZKND 3RX9A 1IG3A 5D7IA 1ORSB 3O65A 4M6AA 4BQ6A 3V64A 3CCMV 1RUH1 3NGBC 1W9YA 2WZR2 1IE4A 4NRYA 1W06A 3E86A 1R3HB 4FFVD 1QTPA 1H8TB 2OYQA 2OZ4L 3SBQA 4A2EA 4AGRA 4MADA 1TT6A 4PB0H 4NBXB 3H3LA 2LLLA 4ABMA 5CCGE 4OFGA 3U4KA 5I30L 4D2NA 1SBDA 1RZGA 2OZJA 2AQSA 4TLGA 1TZHB 1RVF2 1W8ZA 4XPGH 4S0HA 4X7TA 1GZTA 3FRPA 1SCRA 2JKIS 5F2SA 3B3BA 1LWHA 1OW0A 1DVYA 1RJYB 3TEXA 3A7QA 2AK4E 4HSAC 2YA1A 1A9BB 4H2AA 2GC4C 4NQDA 4IIQB 5KYWB 2OFQA 2J1SA 1WCBA 4FFHA 1IAOA 1I7TB 5DO2C 3IKWA 1Q8PA 1PEZA 1BBJB 1RUE1 4ZT1A 2OCFD 5IVEA 1UGNA 1ZX5A 3IYLW 1BZEA 3VQ2C 1WNSA 4ABQA 5IHUL 2BWDA 2RN9A 1AX2A 2BGPA 3UGFA 4AAXA 3O6FC 3WV0A 2R9RB 4Y89A 3Q1SL 4QOKE 3RWFB 3N91A 4LSVH 4GG8B 3F5WA 2LALA 1D5XA 1SPPA 2ZKWA 3BUYB 4QDSA 1X4ZA 1CN4A 1PGW2 4HMEA 2I9LB 2O4EA 3QWRA 4LF4B 1CGUA 1E65A 1NC4A 2Z34A 4PTTB 3CFKA 4IESA 4MHUA 4XFCA 5KYUA 2C9SA 2HPOA 3CDGB 4KVCL 2NXZC 3GBWA 5HV0A 1X5ZA 4OCRH 2A6JA 1QR8A 3DBXB 3DX6A 1RPQA 2I2SA 3LDBA 1FL6B 5H6QA 4GIOA 2K3HA 5T52A 3WG1A 2B3IA 1UH4A 2A83B 4IK6A 4QNHB 4CCJA 3TNPB 1T6VN 3IDJA 5E6ZA 4AQ1A 3JD2A 2DH2A 3CC2V 4ZMVA 3IDIA 4Q2ZA 5I26A 3VYOA 3T0EE 2J71A 2ET7A 5IBLD 4XQDA 4WBNB 3P4MA 4K8RB 5DA0B 1IV8A 1GP6A 3HE6A 1ZVFA 4PI0A 1MI5E 3BN9C 4I77H 1N5AA 1A6UH 1S7XB 4FG6C 4YQXH 3CBNA 2N56A 4U6XB 4NNXB 1G7QA 2GABA 5IROA 1ONAA 5CU9A 3DROA 5EU6B 4N43A 5J96B 1D6EB 3K6SB 3R1GL 4CGUB 1ZLSH 4GT7A 4E2QA 2Q86B 2Y5TA 4ACPA 4PWGA 2G9ZA 1UOFA 3PWUA 3GZKA 3VRJB 2B1GA 2IPKA 4HPYL 5IMOA 2V5YA 3CCRV 5L9RA 2YD7A 4Z7NE 5DHXB 1WZAA 3UGXA 1LM8V 3B6SA 2ICWJ 4NKMB 4YGVA 1F5FA 1DF5A 32C2A 3GLDA 4XI5D 2DYSC 1IS4A 2FL4A 1J0KA 1CZ8H 1I53A 1IGFH 4PWHA 4ZNEA 3RWHB 1IKNC 1SUJA 4KZEH 3PNAA 5DAWA 1AH1A 5I6LA 4J7KA 1OE2A 1YNTF 2FIKA 3HLAB 2CJSA 4JQIA 1L4IA 3ZHRA 1C16B 1CLZH 1F56A 1QASA 1U9KA 4X7SH 1RMFH 5JPNA 4RS5B 3JAKA 4JM4L 1P1VA 1YI9A 2R041 5GLZA 3VBRC 5DTFB 4DQOL 4WGVB 3LIZL 1D4VB 1AO7A 1RUD3 2L6LA 2Z9TA 1AHWC 3GMLA 3NABL 1FLRL 4PW9A 2AJVH 5LN4A 1VR3A 3CSFA 3RIAK 3STZC 3VBOC 1OTTD 5BUGA 1OL0A 2F1BA 3VBHB 1U95B 2EINB 4AE2A 2VD7A 3T0BA 4PRNA 3ZRXA 2CIIB 1Q6IA 4XACA 1PGL1 5FMCA 3T2OA 4APQD 1WFNA 3LZZA 2FLRT 5C09B 1SF9A 1MHHB 4MQ7B 4RDQG 4DK5A 5JW4R 2RDSA 4GMSH 4A7SA 3FUKA 4N0FA 4ZX5A 1D7CA 2NXZD 4C4KO 3T77B 4NPRA 5JI9A 1MRDL 3TS8A 5C3IA 1SLTA 4C91A 5CKNA 4CDUA 2D2CB 3MOBL 4Z7AA 2DMXA 3D4GA 3FUDA 1EBAA 3DPBA 2YUXA 1GZHA 3S98A 5JW5A 1ZMYA 2J4WH 5E1HB 3VU2A 1ZTEA 4DR2O 1Q86W 1GH7A 1A8ZA 1EMTL 1TLMA 3C5ZC 4U7MA 5F3EA 3EYUL 2Y69C 3CZFB 4NUGH 4MXVA 4QT5B 3ULVC 2C3VB 4QGMA 3UYJA 3FTUA 5CZVH 3DKWA 2OQ6A 3OUHA 5IK8A 1H3XA 3CC7V 4PRPD 4L87A 1NCJA 1ZSHA 3DC0A 1R19A 4QHNB 3WCRA 3CPWU 4LSTL 2IEPA 1IUZA 2WWOA 1E6JH 1A66A 3KJ4B 4N8CH 2JTDA 2W0LA 2FZ1A 5C07A 2A4EA 1NPNA 1GM8A 5TPWL 4PJGA 2HKHH 5C0DA 4JB9L 4YSPA 1PNKA 2PN5A 2J88H 4MJID 4DZ8B 4NKGB 4P2YA 3KWXA 2F19H 2RS52 3QZLA 3FTSA 3CJIB 2OR9L 5I1DA 2Q1MA 1MW2A 1G86A 2UZXB 2E3VA 2YKLL 4F37F 4WEUD 1XUQA 4HSQA 5L3FA 4QUOA 1SHSA 5H4YA 3EHBB 1J9CT 3MTXA 4JJ5B 3K6NA 3RKPA 4NHLA 1AGDA 2BSTB 4OR1A 5CFCC 2R1WA 2WQ8A 3F7KA 4W68A 2DQFA 3WV6A 2ITCB 2TUNA 2VH5L 1GMMA 2NY2C 5CEZH 2CGZA 4HUWB 5ISZD 1BYHA 3O9OA 3PAZA 3E6FB 3VFGH 4AHXA 1BS3A 4PGDA 1O9WA 3BAAA 1J8HA 1WFTA 5KBDA 2JJ2G 5D4IA 1BECA 4X9IA 1K3ZA 1YI2V 2BSRB 3MRPB 3NK4A 4MMZC 1QEXA 3V5DA 2PYFB 3G5ZB 5ICXA 3FWEA 5G04L 3KPRD 2WWUA 4PA9A 1KYDA 3KH3A 4Q4W2 5HHVH 4YZ5A 2VL5B 1FD9A 1LGBA 4DV7O 2CNZA 3D85D 3HFMH 3CSPA 2EZPA 4NYKA 4BKLA 2GNMA 2CNYA 4XHXA 5FGCB 3WGVB 1EK3A 3SCMB 1YSOA 3U0WH 3FSAA 3TXQA 2A74C 3BQUA 3DX3A 5LGJA 3MGOA 3PIQB 1ZGLM 3SXWA 5KTEL 1TNNA 5L36A 5L6YL 2FJHB 5DD6A 2Z0AA 4GX2A 4R9CA 4LLOA 2ZOKA 3K72B 1PJ9A 3QQDB 5C8JB 2PYEA 3VWKB 3TF7C 3O1OA 4LF9O 3ULVD 4PD4K 2JH2A 5D5MF 3SDXA 4V1DE 2B8OT 3PG2A 2VR3A 3PFUA 2XNDG 3RL2B 4YIOA 3V0FA 3NVQA 1FYTD 2QBXA 1QJY2 1HL9A 4MHHG 1HNFA 5BZZA 1XL4A 3SH3A 4ZG1A 1LGVA 5D7IF 4DV7B 1L7IH 5D96B 3IMMA 1QFWI 4M6ML 1R34A 2WWNA 5I5IA 4WJ5A 5L7OC 4TUKL 2WR9A 4J6RL 1BQZA 3WFBL 3VXSA 1T0NA 3U9UA 2DN7A 3B7YA 1HHHA 4CN1A 4MVZA 3BZFB 3TBYA 5FZKA 3PWNB 3BGMA 3Q2NA 5C86A 1L7LA 4XGZB 3SD5A 1PY9A 1Z5YD 1A8JH 5C0NC 5T33L 4CA9A 4OIAA 3RYKA 1VMGA 4ONOA 2P8PB 3FPYA 1S9WB 4LF9B 1V3KA 4LF6O 1CK0H 1COWG 2OS2A 5AVRB 2QADD 4AZ8B 3LQZB 4A67A 4QNPE 5C3RA 1PVC2 4XPVA 3HBZA 4WK0B 4LE4A 2NDGA 2UU9O 3SPJA 5EH1A 3ARFA 4S1SH 4Z3FA 1HKFA 3NL1A 2E46A 1HSBB 5IOKA 5CZRA 5DUPL 5FXWA 2AHIA 2EXSA 1PNMA 2F53D 2NY2D 1FL3B 2B77A 3DETD 5E4EC 3P3RA 2Y6KA 4JPSA 2BIHA 2ED8A 4GSQA 2J6EH 3ULSB 2ZMLA 3G9AB 3O3BB 3VXOB 4PRDA 2ETWA 5J12B 2VJ8A 2A73B 2YDEA 5ERWB 2EVXA 4H1LB 3D9AL 5F96H 2C1PA 1YSCA 2Q1ZB 4RIRA 4KQ3H 3RJQB 1LXMA 4GKJB 2I85A 4FFWD 4J4PC 1CJYA 4AV0A 5IQ7H 3EYVB 4LZKA 4LF6B 2JIXB 3PURA 2BWIA 2X3BA 4MA8L 4IBSA 1LGNA 2DF7A 3S5AA 4O51B 1M2VA 1ZTXH 2ICEC 2IH3B 3U0TB 4ZFQA 2ZIMA 5CP7B 5JIHA 4N24A 4OI1A 5F7LB 1RSYA 3H85A 2ICWB 2UU9B 3N41F 3T5WA 1NFKA 1G7IB 4MYEA 3TYGL 4DTGH 5C3SA 4DV4O 2VLJE 3D05A 3PJNA 5IIEB 2WABA 2D3OW 5I9QC 2P06A 4JFEE 3WVJA 1HB2A 1CF8L 1NM9A 3LKRA 4OVUA 4AENA 4JRXB 3LNMB 3JCUZ 1FH5H 4JDTH 1K12A 3RI5K 4GIQA 5LP6C 5F7BA 5F5CA 5FPAA 1KTBA 3AKQA 3I2KA 3BAJA 4MNHB 3W1ZA 4A44A 1XIWD 4WNSA 1QNZL 1YY8A 2FGWL 1MIMH 3ZL2A 5I0WA 4FPCA 4QX1A 3QXUA 4CUBA 1IM9A 1AR1B 1U8QB 5A1AA 5JHDB 4WLCA 1TJGL 1H3PH 5BRZE 1NOFA 3N04A 2Z69A 3W0WD 3S3WA 1QXRA 2NSQA 3ASNB 3HPJB 4IKJA 4IEWA 1YA5A 4DV4B 4LLWA 4YK4B 5A32A 1ACYH 2ZNJA 2JJTA 5SWZD 2OIGA 3MA9H 4DFHA 2A6ZA 3WF1A 5GIRA 3WHE1 2K78A 1MZ5A 2UY7A 4QJ5B 2WKOA 5KW9H 2JQZA 1QBBA 4LHKA 4HZLA 5E5LA 3OW2U 4OZHB 1XI1A 3WFCL 4H8QA 4MD5B 5KVEH 3VRLF 3NIGE 5IYZB 4CDWA 1EERB 1SDAB 1BT8A 5CWSA 4JTCB 3L7EB 3LPOA 1W0PA 3ZN0A 3BEHA 4XN1A 4CP1A 1R73A 2EADA 4NJ9H 1AKPA 4IL7A 4QXCA 3UO8B 2ZHNA 3CXHK 2MOVA 2Q8BH 3ZGIA 4NZUH 2G75B 5KMGB 4JN2B 1N1TA 1CQKA 2CSGA 1HNWO 1MLCB 2P67A 1HC1A 1GC1L 1ODUA 4JI5O 1R5WB 1XZWA 5E6ID 1UZ0A 5EO1A 3RMYA 4F6RB 3IBOA 5FXCH 5HI3D 3OZ9H 5HSFA 3WU2Z 1IPSA 1HW5A 1ESOA 3FFZA 3BJLA 5IK7A 4GSDH 4GLRH 4KY1H 1JW6A 4NN5B 3WN5C 1GV9A 1F4NA 2K3TA 4QX2A 5FJHA 3UNPA 4YW5A 1GSLA 3G9VA 5JHAA 4W93A 5E2VL 4ZZ8A 2AQTA 1LOFA 1T22A 5GGQH 4ZYKB 4M7LH 3T4ZA 1UGKA 4GKZA 4TSBL 5IQLA 3MBXL 4M1GH 2AQ2A 2NY1D 1KP3A 5ALBL 1MCHA 3DYOA 4QJ3B 2HSIA 1QA9B 5IB2B 5K0UC 2BDRA 1JUIA 1TQTA 5HDQH 2Z93B 3MZHA 5L2KD 5IMKA 3SZKC 1N67A 3VUOA 3JD1A 1HNWB 4PJ9B 3UABA 5KEZA 4JI5B 1RJCA 3RNQB 1NGWA 2MSPA 5EBWC 4KDTC 5LG6A 5DDJ2 4O4JA 4G2AA 4NT6A 3UPAA 2HHHO 3ELQA 1URIA 2ADIA 4UDUB 3ZMRA 4HKBB 5ETUA 4XCEA 4C4BA 1UN1A 3CDYA 3O4LB 4OU3A 4BAYA 3WP3A 1FXKB 1NI8A 1JX9A 1DUZA 2EYSA 3DK0A 4B3NA 4L5FH 1FFTB 2MQCA 1NDMA 3S37L 3PS6A 3BAEH 4OKVA 4W4OA 1EN5A 5FO7B 3QG5A 3T4AB 3GMMB 4JKKA 3RLSA 5AVYB 3BH8B 5A2QN 2V0AA 5GS0H 2LP7A 5TISZ 2ICES 3CHQA 4HF5H 4DV1O 1GCYA 3DC5A 3FTGA 3PQYE 4NO2A 2GV9A 4DR7O 1WBXB 3BDBA 2WSUA 3ACFA 3TZVA 5LZ6A 1R1BA 4IYIA 3U10A 4UINH 3O9WC 3B5LB 3RYMA 3HOBA 1KB3A 3DX8A 4M56A 3G6JE 2Q67A 3T6VA 3ZE1E 3U1QA 1ZXQA 2B5IC 2VRAA 1UM5L 2CAUA 5CA6A 1CEZA 4WSJA 1I6XA 1ZA4A 5K39A 3CZUA 2HHHB 1B06A 3VFRB 5C08B 5JA8B 3UG3A 2QQMA 2BIIA 6FABL 1RUF1 1G7JB 2D6OX 5E8NA 4G28B 4FP8H 5CJ5A 4OX9O 3K8MA 4UW6A 3I50L 3APOA 2E6QA 4OZFH 3P4LA 2VC9A 1JGLL 4BK5A 4DW1A 4DV1B 5ILTL 4FYRA 3AK1A 4DR7B 4M00A 3TB0A 5JYLA 5AVPA 1MPXA 1QACA 5FUOH 3QNYA 1GYVA 1RZJL 3LNFA 2BSSB 1MREL 5GSRA 1SOKA 2Q0AA 1SNRA 2B45X 1U4EA 4HUXA 3GJFA 3X3FH 1FPN2 2BRTA 2WLKA 4NXKA 3TF4A 4IV1C 2GC0A 4COYA 2V4DA 3GSQB 2QKCA 4GOSA 4OX9B 4AVHA 4X7TB 1K42A 1FN4B 4XCFH 3P2BA 4DN3H 1HOEA 2G9KA 3A4EA 3FTVA 1VGEH 3SDAA 3VFMA 2PAKA 4P4KB 3WDJA 4RS5C 5DAVA 1WCBB 1B2WH 1IAOB 1QLEL 1JVMA 1UTDA 4BOWA 3NIFF 1XPWA 4Q6IC 2VO8A 5GGVL 2BY1A 4O2EA 3CIAA 2CDGA 1Q8SA 1XHZA 2QHRH 3DTXA 4YW7A 5ERLA 4NM4H 1AXIB 3QCTH 4M4RB 1W8FA 2AK1L 5EORL 3AAZA 3GSWA 4YDVA 5CADA 2X6BA 5BV7H 2HZHA 1CD0A 2FNBA 2V7NA 3F5WB 3FUEA 1PQZA 2XC8A 4XBPA 1D5XB 1OQ1A 1SPPB 1C5BL 1NLBL 3RDJA 3AFKA 3NA9H 3ZK0A 5FWEA 1MCWW 3IKKA 3ZOIA 4Z78A 3FLTA 2WT2A 1NC4B 2Y6TE 1TG8A 1TQUA 1XH2A 1N12A 3CFKB 3LRKA 4RDQF 3S2CA 5GZEA 1ZBE2 4LASL 5DRXA 1AJQA 1CLOL 2XQRA 2IDSA 3MRIB 5KYUB 4WF9V 2F23A 5FW8A 2A6JB 4V2CB 4YY3O 5E2WL 3DX6B 3LDBB 4P2ZA 4KZDH 3I84A 2YFUA 3VBUB 4YW4A 4APQA 1YCIA 4XF3A 4P5KA 5TD4A 3P1IA 3ZFEC 3SGKC 4MSWB 1E4XL 3IDJB 1NTKH 4AQ1B 5J1SC 4JGZC 4ILDA 4OAWA 2YJLA 3IDIB 2NYKA 4Q2ZB 3GHNA 2DWTA 1WF5A 3S5QA 1JHLL 4JO4H 3VRIA 5IJKA 3T65A 4C56D 5FZDA 3P4MB 3LSEA 1S7UA 4TVPD 1CFBA 4JGYC 4RQPC 3HE6B 4X64O 4FEIA 5J2UB 4IBTA 3VZMA 1WHOA 3QJOA 3QI9C 1MCOH 1G7QB 4N43B 1I85A 4N5UA 5DVNA 5C71A 3MRKA 1GANA 3NACL 1A3QA 5FM4A 3MNDA 1UM4L 1W6LA 2IPKB 3GNEA 2WXFA 3IMTA 4FABL 4YY3B 4IKKA 5CB4A 1TU2A 3EZJB 3DO7A 3FUOA 1ULGA 3B6SB 2WXNA 3CDFA 3MLUL 4LF7O 32C2B 4PRPA 4F20A 2EH8H 1M7DA 5J09A 4DN4L 3D34A 4ZX4A 5HDBB 2E32A 4NUMA 4U1KB 4IMKC 2PPDA 2YIAA 2FIKB 1JF6A 3L95A 4GKOA 4E8CA 5TF1H 2C26A 4PJIA 2VNGA 1BAFL 1LO2L 5JPNB 1G9HA 1S8DA 2IJKA 4X64B 1EJOH 1KCLA 1SXSA 5KXCA 4LOUC 5F6HI 1HNXO 1AO7B 4WFFE 2Y6GA 5HJ3A 2ENRA 4G5ZH 4MJIA 5L4FA 4R52A 3RTQD 3AFLA 1PIFA 1UA7A 1TOXA 3MV9E 4WTZG 3MMEA 3O41A 3TX4A 3UROR 3ZKUA 1DJWA 1QBAA 3FCSA 3FSOA 1OH4A 1A4JA 1U8NB 1OSYA 3UZVB 3UAJC 3JT2A 2D7TL 4BXSV 4PRNB 1GA2A 1W8EA 4P2OD 5DJ2B 4XBEH 1QSFE 2NR6C 4LF7B 3QXAB 4OJDH 5JUEL 1B4JH 1PAZA 4Y22A 4M5YL 4HP5A 4LBEA 1RHHA 1YHPA 2Y0OA 2B0SL 2DL9A 3OKLA 4W65A 1FXZA 2BBVA 2IGFL 1YJWV 2X4SA 4N0FB 5DVLA 5ISZA 3WLBA 4NRQA 3LEVH 1GJWA 4KGGA 4FJZA 3ULUC 5B39G 1HCZA 1G87A 1E57A 3ZKXC 2J56A 5C5UA 4CDUB 5LBCA 4LCVA 2AXHA 4JHUA 5JW5B 3GGLA 1INDH 3KPRA 4XO5A 4YXLL 3NKGA 1NLQA 4AV5A 3KEDA 3OF6D 3VE0A 4Z7QE 1WZKA 1ET8A 3RU8L 3D85A 2PY5A 4Z92B 1JYVA 3HG0A 1TZ8A 4B7KA 3IAPA 3F7YA 4BUGA 2VDML 2FHRA 3OE7G 3C7HA 5ADOL 2YEQA 1NR1A 4I55A 3TO4D 5B2GB 3KG5A 3BLKA 3QI9D 4FKEA 2NW3A 2HX9A 2LLNA 2YBPA 3FAVA 4K35A 1UL9A 3R65A 1QLEB 4FQJL 1VMJA 2V2WA 5C07B 3FFQA 2X1OA 1TENA 1UEYA 4G7VL 3EYFA 3GS4A 3R7QA 4H13B 3GI8L 4XCCL 1S46A 3DMMC 3T1YB 1FYTA 1KEGL 5C0DB 1WD3A 4QX3A 2OYKA 2GMMA 4CCNA 3H2PA 1OAUH 3ENRA 2XICA 3C8XA 5EWSA 4AI2A 5GTIZ 4KDVA 3D69A 3F7LA 1W9TA 3KW7A 2BVOA 3QFJA 1E3FA 4H0LC 4I48A 2XAHA 5I1DB 2XA8L 4OI8A 2R2HB 2Q7NA 2ZAIA 1CL7L 3HG1E 2YSSA 5AWNH 1Q8VA 2PHWA 4MAUL 5TH2A 3PL6B 4OB5H 1UXXX 4JFWA 5J1XA 1TMF3 2C5DC 2EVHA 2Y5QA 4KI5E 2A70A 3MLZL 2L04A 1FZJA 4YHNA 5L7XH 2OL3A 1U8CB 2DQFB 5B4XA 1A1OA 4NFDA 2EILB 5IHRA 4AFAA 2BOBC 3QQ3A 4TNVF 3UG4A 5IWLC 2MK3A 1SA0B 2ZG2A 1J8HB 3CFIC 3QE5A 4JFFE 4OH2A 4PGDB 2NR6D 1RUD2 3ZZ1A 4L99A 4LT5A 2LAAA 3ZLIA 3MJ8A 2DI8A 3TJEH 3V5DB 3SYPA 2WIIB 3OAZH 4PLJC 4TNEA 5ICXB 3T04D 5A7SA 1X7SA 3QNEA 4ZXEA 4C8DA 1K6QL 4TSFG 3POBA 4E0RA 5BMVA 4ABVA 2V9UA 3MBWA 4AK1A 3U9PH 1H8LA 1SDYA 5BVPL 5CA3A 3ISYA 1F2XK 2WLIA 4W4KA 2Q76A 3H54A 1RU9H 4FTDA 2AQRA 4NPJA 1Q1JH 4Y5YC 2C24A 1NEPA 2GEQA 3L9RA 5CHNA 2K7PA 4DFIA 4L4TE 1Y6NR 1OGAE 1GZCA 5FZAA 4Q8LA 1KTDA 3VGBA 3FU7A 2JKWA 1H8OA 5FO9A 1GY2A 5DD6B 3OM3B 3ZYIA 1GS6X 3IWVA 2RQ6A 1N36O 5FWRA 4PS4L 1IS3A 4YDNA 3X17A 4L8DA 1JNLL 2W91A 5IJVA 2A0LC 4NHXA 4FOWA 3BSGA 3SDXB 2OSXA 1UZWA 3IMNA 1MFAH 2PR9A 4AX3A 3NSTA 2XN9A 4MJ6A 1UKTA 2OZNA 5AZEH 4ATFA 4PBDA 5I6XC 1AR1C 4DFSA 4X9BA 1C5HA 4LP8A 2I7SA 1HAWA 2UUDK 3GI9L 4NBZB 3Q06A 4QGNA 1ODMA 1GZPA 2ZX4A 3LDRA 3ZDVA 1BQRA 2FBJL 4CN4A 4KJQD 1T0NB 3TYFA 1F15A 2FB4H 1HHHB 1A7BA 4L8JA 3DMMD 3M86A 4Y2OA 3TBYB 4ZTPH 3BGMB 1XIWA 2C9KA 1ZT1A 4ZOEA 3ES1A 4BRJA 4LHQB 2B7DT 2HH0L 2ENPA 5HHMD 2ETNA 5FV1L 4DKFL 1RUG1 4JDMA 4HX1A 1N36B 1G7HA 5FPOA 3VSVA 2OPKA 5L7OA 3MV7A 3SE9H 3A22A 3W0WA 1NCBH 5FREA 3ZE0B 4RLDA 4XZ4A