1YEWA

Crystal structure of particulate methane monooxygenase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
382
structure length
382
Chain Sequence
b'HGEKSQAAFMRMRTIHWYDLSWSKEKVKINETVEIKGKFHVFEGWPETVDEPDVAFLNVGMPGPVFIRKESYIGGQLVPRSVRLEIGKTYDFRVVLKARRPGDWHVHTMMNVQGGGPIIGPGKWITVEGSMSEFRNPVTTLTGQTVDLENYNEGNTYFWHAFWFAIGVAWIGYWSRRPIFIPRLLMVDAGRADELVSATDRKVAMGFLAATILIVVMAMSSANSKYPITIPLQAGTMRGMKPLELPAPTVSVKVEDATYRVPGRAMRMKLTITNHGNSPIRLGEFYTASVRFLDSDVYKDTTGYPEDLLAEDGLSVSDNSPLAPGETRTVDVTASDAAWEVYRLSDIIYDPDSRFAGLLFFFDATGNRQVVQIDAPLIPSFM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords particulate methane monooxygenase, B subunit
publication title Crystal structure of a membrane-bound metalloenzyme that catalyses the biological oxidation of methane.
pubmed doi rcsb
source organism Methylococcus capsulatus
molecule tags Oxidoreductase, membrane protein
total genus 95
structure length 382
sequence length 382
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2004-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04744 Monooxygenase_B Monooxygenase subunit B protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1yewA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 1yewA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 1yewA01
4PHZA 4O65A 3RFRA 1YEWA 4PI0A 4PI2A 3CHXA 3RGBA
chains in the Genus database with same CATH superfamily
4RGMC 3RAJL 2DCJA 2XU9A 1ALYA 3FHAA 4ATTA 1KB5L 3KYKH 4UZUA 1JXJA 1ZSHA 1VA9A 5DS8A 4HOZA 3EH2A 5F9JB 2VC2B 2XPZA 1RJ8A 1RLWA 2QMKA 3GVMA 5EOTB 5KVFL 2PWFA 4U1IB 3X12B 1GGIH 1HEZB 3NIGE 5B3SB 4AVVA 2DRUA 1JFHA 4RISH 4PJEE 4NUMA 4UI2A 5ESAB 1DQ4A 1OUSA 1H4GA 2WNUB 1HWWA 4FQZA 1CDGA 3GTVA 2BNRD 3GK8L 2EDLA 3FU6A 4TN9A 3VD1A 3QUZC 4HZFA 4NHMA 1KJMB 4IHJA 2R042 1P5UA 5FECB 3ECVA 2YPKA 4AT6B 3P3RA 1TDQA 2R9HD 4JY6A 3L4YA 1PZUB 3KM1A 1B4TA 1JZFA 1PFOA 1YUHA 4P46A 1AGCB 4O02B 1ZHBA 4ODTL 4WO0A 4MTGA 3VACA 2E7AA 4HLZH 5HHMB 5IW1B 3F7RA 4UVAA 3O6KL 3QFJE 1PNFA 3BSZL 4I9WE 3P32A 5CSZA 1CPYA 3DHUA 4FXGB 5FZKA 4X4XA 43C9B 4JKPL 1WRFA 5F3EA 4Q4IA 4MJHA 4Z3HA 5SV4A 1Y9GA 3KXFD 2EEDA 5IROC 1SM3H 1X3DA 1LKNA 2R043 2IV8A 4LOUC 1JOBA 3RMXA 1KGXA 4NTXA 4KK6C 2VNCA 4PTUB 4JFVA 3WDJA 1RXGA 4WKXA 5DC0A 1EMTH 1ENXA 4NYKA 3LEYH 2FJFB 2FB5A 4OF3A 4DP1X 4JI3O 3T8VA 1A7RH 2X4OB 5BZWA 3Q7JA 3BPCB 4G9FB 5J56B 1VEPA 3VG9B 3T77B 5GZGA 3VYPA 1LU1A 4ZI8A 4OZGA 3PWNB 4BUHA 4ZUSB 4HJ0C 2A1XA 3UESA 4MB3A 4M62L 3H9HA 2OUHA 1HDMA 4JI1B 3K5RA 4RHV3 4OCLC 2QQKH 4WFFD 1H2KA 2H5UA 3I6GB 2VLLA 3DF0A 1LEMA 2EXYC 4BFFA 2IFFH 2QHLA 4KKBC 4X7EC 4XMWA 4KI1A 1ASJ2 1S2KA 2ZTNA 3P1VA 4MS8D 3VXUA 1QI3A 4S0HA 4W6XA 4AIXA 1JGLL 5DR5H 1NR7A 1K2DB 3MTRA 4QO1B 2IAMD 1VRH2 1ZVNA 4HEME 3PABA 1N18A 2VDPH 1KNOB 4O02H 3QH6A 1RFYA 4BA6A 5IVXA 3B7YA 4NPKA 5E8NB 2CK0H 5F1SA 4H8HA 2DQHH 2J8UF 5FP8A 2OYZA 2VXSH 3GXIA 5TE4H 5IQ7L 4EN3A 4XC9A 4FTSA 2FB4L 2OTPA 4UUJC 1W0WB 4WI5A 3RKDC 4Z7QB 1OOPA 4UZSA 3BUCA 5DGQA 4JS7A 1DK1A 1U97A 2NNAB 3EJSA 5A1FA 5BNOC 1S4CA 2P26A 1K5NB 3IDGA 4YE4H 4Q9QH 3H8UA 4I3PA 5MENA 2H6UA 3L5XL 1KTLA 3Q5YA 2VNVA 4ZJ9A 2HLAB 3R06A 3RZWA 1XH2A 4I30A 1T0PB 3M8OH 4G7YH 4YHHO 4WTXA 1INEH 1IFRA 1F6AA 3HNTL 1Z6JT 4A7KA 4OFYA 1KEML 3H0TB 4HXBH 4FZ1A 3PGDB 4OCXL 3ZO0A 1W15A 3EJPA 2VZ3A 2YJQA 3L6FB 3UDWC 1NXD1 2RDRA 3P4LA 4TSVA 1JZ7A 1NCIA 4LEXH 1HXYB 1RJZA 3U0WH 2ZGOA 5I0YA 3J7LA 3WTUA 3MZGB 4D0DB 1BYOA 4QX8A 2D97A 3I2OA 1ED3B 4XVTH 1DN2A 1TE1B 3SH5A 4LK7A 3ES4A 4Z3GA 5E0FA 2R23A 3LWCA 1FH5L 3HZVB 3W56A 3FX3A 4FGMA 2Q68A 3MUUA 4GY4A 1TMF2 3B5LB 2TNFA 2R2HB 3OWRA 3OGJA 1XILA 5EYPA 4EF3A 5FLIA 4Y2DD 2BH0A 5D7EA 4JLRB 3LPWA 1AR73 4HS8H 2GITB 1RUF1 3RVWD 1DJYA 2APSA 4NE9A 3FH7A 4FMKA 3HBQA 3QIWC 4HV8A 1MJ7H 1O3TA 3LFIA 1JPEA 1KGYE 4MTMA 3VI4F 1DJIA 4IBLT 4PV8B 4L9DA 5B3JF 5FYBA 4ONFH 2ADIA 2Q0OC 3WNIA 1Z0NA 3SKJE 4TQ8A 4LBEA 2YA1A 4O9HH 4B7EA 3QEUB 3UV9A 4TQEH 2Z5WA 3MZHA 3PVNA 1VFAB 1RUG1 5D9SA 5GQBA 2NSMA 1N1TA 5CLXA 1G9FA 4JO3H 4HHAA 3F6IA 3DROA 5EOQH 5ETUB 5FZGA 1UGKA 1A25A 4KK5C 4XF4A 1EJOH 2W1SA 1I94O 4HAMA 2NYYC 3MLVH 3O41A 1GZTA 1I4FA 2YN5A 2FYUH 1AR92 1XNKA 1QFOA 4YY3B 4XMLH 1JV2A 2ENQA 3P4MA 2R2EB 3L3OB 2BJML 4OF7A 2MSPA 3K2IA 3F7VA 4RMVA 3V52H 1LO0H 1SFYA 1T89A 3FSAA 4J9YB 1WT5C 3V4VL 1HJBC 1HXS1 1MCCA 1HL5A 2DH2A 3GWOA 2OZJA 3MLZH 4QXGH 2MHAA 4XCCL 3U75A 4EUPG 5IJKA 1SRDA 3OR7A 2YBPA 3X1BA 2WUCH 5AKRA 5IHBA 4U6YA 4WWKC 1FZJB 4HNAA 4KVNH 5MEPB 1V54B 3RYCB 3VWJA 1KYFA 4TWTA 2YYOA 5LBSL 1H8OA 2FZ3A 4MJIB 4V33A 4OV5B 5BXFB 3MQIA 2P9RA 3C60D 4L0ZA 1JYXA 3EYUL 3WF2A 4JGZA 4OZGE 4OJFH 1KULA 5B8CB 1M56C 4WTQA 3VTTA 4FP8L 3SE8H 3S2AA 5EJ3A 4ZUUA 1QABA 3CWGA 1WZKA 3CVHA 3GS4A 3U4EA 1CURA 2WSVA 4K8RB 5KOMC 4XUQA 1R0AH 5IBLC 4DH2A 4EQ2A 2WYHA 3VXUE 3MLUL 5EJZB 2DWEC 3QQ4B 3WS3A 1CO1A 1HH6A 4ZSOA 5CMAA 1OWRM 2D3VA 2X1XR 1G7QB 1P7KB 3VGIA 4KGQA 1RUD2 2Z8RA 4PS7A 2DWRA 12E8L 1J3PA 3ZE1B 5IVXE 4JRLA 1F4AA 4DT2A 1VADA 1LD9A 2ZE6A 4N1CA 4OF0A 4UM9A 5EA0L 1UADC 1UOLA 3S37X 3FWEA 1EV13 3HAEB 4WSKA 3TZVC 1PO13 4N87A 2Q3AA 4MXWA 2GAZB 2ZSWA 1GS8A 5C0RL 2Y3AA 2DQUH 3PL6D 1D9KD 4P2RB 3WFEH 1QBML 1E8ZA 2VXVH 4LWSA 3Q13A 3ZX7A 5F9DC 2WO3B 2UU8A 5B39A 3H9VA 5MENE 4N2GA 1RUC3 4AGRA 2QADB 4Z95H 4JE4B 4E9RA 1W59A 2BSEA 5DMIL 3P69A 1TKWA 3GFUA 4YHZH 1S7QA 4FEIA 1AGBB 5GGSA 3JSSA 1CK0L 5L0QC 2GMMA 3ZHLA 3QPQC 3O6FB 2PYFB 5C0IB 2ZCKH 1YNTF 3RWGA 1SDDB 1NX9A 4JQIL 1YMMA 3KPNB 3MJ9A 3RG0A 1A6VL 2YFNA 2FX9H 4E42A 5ACZA 4BFIA 5IMLB 2B20A 4ZS7L 3VWKD 2DJUA 3ZKUA 5G5DB 2P5OA 2OI9C 3NABH 3K8KA 3CRRA 4QWWD 3QG7L 3IF1A 4BGLA 5LEJA 3DKQA 3OZ9L 4FQIL 5LXGL 1OKQA 3LEKA 1RULH 3BPLB 3L9YA 2VDML 1UASA 2FT7A 2J8HA 3WKMH 4AKQA 4NT6B 2LM3A 4QXKA 4HC1A 4HK0A 3BAAA 1BEYH 1VQMV 4JDZA 4AL8C 1AZVA 2BVOA 4QMAA 3J80N 4HBNA 4N4YB 1MXGA 2R4RH 4JB9H 3DK0A 5FOJA 2Y69B 2Y2YA 1RIUH 4YDLC 3F64A 2VW1A 2MQ3A 3M07A 1GGUA 4MTOA 4OUOA 3JXSA 5F7EL 2WWJA 4ASKA 4U3HA 4JI5B 2HRGA 3ZT6A 4WM8A 1LR1A 1ZAUA 2YMXH 5EO1A 3ZZQA 1ULPA 4FQ1H 1MHHB 1E8XA 4RESB 1XH3A 1GQHA 1GA2A 1IAIM 2XNAA 1G7IB 3MUGA 5DHYB 1GZPA 2DN7A 3U2SA 3UP1A 4XC1H 2Q6WB 4Y88A 3IVKB 2Z65C 1UYPA 4PJDA 1IVSA 5CFDC 3KLHD 2YKLL 4JQVA 1XHHA 4QRPB 4Q4W1 3D4ZA 2Q4SA 3QJFA 2XKOA 4G6FB 5TQ2L 2ICEA 3SKJL 1EV2E 3VH8A 4EZHA 4JZOA 2AZ2A 5LWYH 1ORQC 1OTUD 5L8JB 5A3TA 1O75A 3HZMA 4LH7A 4RS5B 1U8JA 5DHDA 3IXAA 4YDZA 4DGVL 4Z7NB 5IFHH 2ADGA 2DQFA 4LF8O 1NGWA 3OKEB 4KO9A 4YSCA 1HB2A 2ALWA 4NXMO 1D5NA 1QBAA 2HFEA 1IQWH 1H5BC 2VABA 1RUKL 4JNXA 4NIAA 1T83A 4QKXB 2ITCB 3MN8A 4QRTA 3S34H 2XASA 1P5VB 2P8PB 3OOXA 1ILUA 4W81A 4XIKA 4DY5A 2VLJD 5L6YL 2D7PA 1EO8H 2BNMA 4JPIA 4DZBA 1FNLA 2WAMA 4PB9L 1OHFA 2XFGB 5FZAA 4AM0Q 1TJMA 4FJCC 1NBVL 3KWXA 1Q9LA 4I89A 4ICWA 4RWYH 5LNEA 1F42A 5I6XB 2C1PA 3LPOA 4XPBL 5CGYD 1NZ6A 3BW9A 3WCSA 1UUNA 5INCA 1B3JA 3Q05A 2EIJC 2C6SA 3NDYE 2ZF9A 4DV2B 2AJXL 4MLSA 5C0BD 1NFAA 1N0XH 1XSOA 1NZIA 1NLQA 3OXRA 5CKMA 1QJX3 4K3UA 1JVMA 1B0GB 3DXUA 1SGKA 4UT7L 5EN2A 2DMKA 4D9LH 5IM7A 1SDAB 1DEEB 3WDVA 2D73A 2ZWLT 4ADJA 3HRPA 1BEXA 1CYXA 1NCBL 3JYBA 3OKOB 4Q56A 1I53A 4JJOA 2Z7YA 4N6RA 3SDDD 3FU7B 1FNZA 1S2EA 5FPRA 1KB9K 1WZMA 2WWNA 3VGDA 3W82A 2BFUS 3VBUC 5SWSB 3IJ4A 5HPOA 1UOWA 3GMRA 5T50A 4DFSA 4OCYL 1JK8A 3GM8A 3H50A 4EI5B 1A1MB 4RR3C 4B4QA 2VITB 2V3DA 4D0CA 1NFDA 4I02A 1NDGB 1Z0MA 3FQTA 5KSUB 4IGPA 1A3KA 3AACA 1U3ZA 4R7XA 4EI6A 4YSOA 1ZLDA 4KKQA 1HQWA 1LXMA 3MRCA 4E9LA 4RFEA 2WOBA 3T6ZA 5AYTA 1P53A 2PR4H 5CG8A 4M8QA 3SHSA 4IV1B 4ZAKC 3WCRA 4MQ7A 4DUZB 3NPZB 4PCTA 1MFAH 1DBNA 3ILPA 2FYYB 4LCUA 4Y8DC 3MLWH 3L16A 2RMU2 3B8YA 3WFDH 2MHFA 5CA0B 2W6IG 3ARFA 2YBRA 3C6LC 4OD3L 5ILTH 5D72L 3L95A 1YMME 3BGMA 3HE6B 1AJ7L 5F5AA 4E4DX 3QHFL 4LVNB 4GQ9L 4N28A 4WFHA 4U1KB 4CDHA 1KN4L 3MUJA 3O11A 3SKNB 3ZSLA 4J3WA 1IIIA 2ERJC 2WW8A 3GBEA 3A4AA 5DZOA 1JZHA 2D5HA 4XRCB 2JEMA 4G2KA 2ZKNA 2VXQA 3OBZA 1DFBH 4MDIA 1L9QA 3LCYA 3GIVB 1L4IA 3MA7B 4PLJC 3V0AC 4N3TA 5IJDC 2CL2A 4XQDA 1B6UA 1YMHB 2PCPB 3UTTD 3V4UH 5AVAA 1BOGB 1QLRB 3DECA 1ZLZA 3EF7A 3QIBB 4Q0XL 5AVTB 6PAZA 1OGTA 5I1AA 4CZZA 2OTLV 4PJBF 1UEMA 4UFZA 5EZYB 1NINA 2V9QA 2X2IA 3VUAA 3WSQH 4E8CA 1R4XA 4JZJB 3V9EA 4FPKA 2PPDA 2E4TA 3QNXB 3W7XA 1UD3A 2QLVB 4JGSA 1PCXA 3RRQA 1XGZA 1PVC1 3E5UA 3PHMA 1HYSC 5A7PA 1EY2A 4D69A 5I0UA 4NQVB 1GCFA 1DL7H 3MGOB 2NZ9A 4XUTA 4P2QB 2MCAA 4G3YL 3UZQB 3ZMOA 1JK9A 1KTDA 4PJDE 3B2MA 1N5YH 3I9IA 3QDGA 1CF1A 4XPAL 4LARL 1CZSA 1U5IA 3RGVB 4AAXA 4QYOB 5CCKL 1PZ5B 1AR81 4PJHF 1WFTA 2F95B 3V0FA 4BZ1H 2B3RA 2BWIA 1GYUA 3QI9A 3CIAA 5CA3A 4B60A 1HZLA 2W38A 1JZDC 3FQRB 3ASOC 2APFA 2CGRH 4AHWA 4ZOEA 4H44B 3AK3A 2I69A 2OCCB 1F3JA 3GF8A 3KL3A 3SDCA 1WYJA 3GSUA 5KR7A 2AJ3A 3HG1A 1FFPA 3K6DA 4ODBD 4XAKE 1M7DA 5AYUH 1TVKB 3FH5A 4ZXBA 3SPHA 2EIEA 1U42A 2I5YL 4ISVA 4AYMC 4BWTA 3D4CA 3O3AB 4ZFOA 2OM5A 4XW3A 3FFDB 3C2UA 3GT6A 3BI9X 2C26A 4V1DD 1XB3A 4Y2OB 4Y9FA 4Q4V2 5FZ0A 1UWEH 2OSLA 1DBMH 5C0NC 2BTVC 1FO0A 3ATDA 3GWJA 1N36B 4J1UA 3UJJH 4OHXA 3QYMA 2V09A 1AHWB 4UT6A 5E5MB 4HQQL 3V65A 3EFOB 4UINL 2VDRL 2W65B 3QDJB 4EQ3A 2OT7A 5FXVA 4ZFGL 2PO6B 3ZYGA 2HJFB 3ZSMA 2VDNL 2ADJA 1KG0A 2VUOA 5LOVA 4N0YL 2EDXA 4NWUL 1WTLA 2CR0A 3SGDI 1EBOA 5FYLH 3OVUB 1EAJA 2H2SD 4FHKA 3AFLA 3BAIA 4KUZH 2SLIA 4KWJA 3KS0H 2BXYA 3EUUA 4PWGA 3L3KA 4PB0L 5EEVA 4GBXC 5L9VA 1CVNA 3P9WB 3O4OB 3CLPA 1FE8H 2YPLB 1I7UA 2OV0A 3QO8A 1EZSA 3U2IA 1OAZH 1RUG3 2X6CA 1R5VA 3ETSA 4MAUH 1LTEA 3HHRB 4ZY9A 2CPCA 4XVUD 4JPKL 2C4FU 4UFHA 5GGVL 5T3ZD 1VF7A 3CVHL 4LNVA 4Y16B 1VENA 3IGUA 3AZYA 4I0PC 1NAKL 4TLKA 3S3JA 2EABA 3MRPB 3C5SB 4WGKA 2JG8A 3UGFA 3K03A 2F68X 1BQLH 1JWSB 1NFDE 1S0JA 2JVDA 3FUNA 2WNVC 2PW1A 1BM3L 3C3TA 3HPLA 2HEPA 5C3IA 5F37A 1IMHC 3ZRXA 3FMGH 4KVCH 1HN0A 2P5ED 1OT2A 3GLDA 4LFAO 4MVTA 5JOFB 4EO5A 3UTQA 3ELQA 1HXS3 2L7UA 3UROR 5HYSA 2X7LA 1SA0B 5ID1B 4ODSL 4MXWL 1JDDA 4MGXA 2DQGL 3IJ9A 3V95A 1OAJA 5DD5H 2KD7A 5GGQH 3W0WB 5GLZA 5AW8B 4GW1A 1D4VB 3NA4A 3RAJH 1U8IB 2YS4A 1KB5H 2XETA 4ZMXA 4XMAA 4OR1A 4WFHE 1AJKA 3PWVA 2CUMA 4IKJA 2FSDA 5BRZA 4MAYC 5KVFH 1BS3A 5CZRA 1WZXA 3ZJZA 1U2YA 3O8XA 3CHOA 4CVZB 3WX5A 3ZK0A 3T0EA 2Y7OA 2V2XB 2H3NA 3MJ9L 1GH6A 4LBMA 1AI6A 4QHKJ 2PHLA 2LU5A 3E97A 4Y1AA 3GK8H 2LQTA 3V5HB 2V9TA 5IQMA 4TUKL 1YY8A 2HHHO 3LHPL 3VZLA 1NIEA 1Z9SA 1WHOA 5SX4H 3I56V 1ZDQA 4X6FA 4J11A 3L3GB 2Z4QB 2ICES 2PYJA 5IMKB 4ODTH 1VSCA 3BOPA 3O6KH 4HC1L 4D8PB 3BSZH 3BN9C 4AV0A 4G8GD 4NQCA 2OJ1A 4PJ9B 5C8CA 2FDGA 4JKPH 4NYLB 1WWBX 3RDTB 3K5NA 4V2VA 1BZWA 3NJLA 1LGCA 3LQCA 3P4OB 4OGZA 4KKRA 3K2MC 2ID5A 1VPOL 3QDGE 4LPTA 3O1OA 4LGPB 5E94A 4DUXA 2ZDIC 4JFDD 1O7DE 3QTCA 3ZN5A 3FT9A 3NK4A 4XH2A 1OVSA 1JXDA 2MOVA 1ZX5A 3H1YA 1L0XA 5HDOA 4CILA 5K9KB 1ES0A 2XWBA 2XDVA 3DC5A 4HKWA 2W5FA 4IS6B 4YN3A 4M62H 1US2A 1E5IA 4ELKA 2KG7A 2KQNA 4LVOB 5MERB 3UX9B 1ZGLA 1B35C 2KPWA 1H3WM 3TTSA 4ODXA 2HFTA 1K4DC 4YZFE 2A5UA 3HG2A 1RERA 2X5PA 3HG1E 5D4IA 5K1JA 2VULA 2EILC 3ZHRA 1PZ2A 3VBHB 2L04A 2W88A 4WI6A 2NDFA 4NN7C 4NUGL 5IB3A 5IVNA 4EB6B 1JGLH 4AIZB 2EYSB 1ENVA 4CUAA 1WZAA 1Y4WA 2BSBA 2ZP8A 4AYSA 4CSSA 4E9YA 3QUYA 2AGAA 1JRHL 1X44A 5JIMA 5CFHA 3DUHA 3WTXA 1PK6B 3GYRA 1USZA 3T2MA 3QDMA 2JDNA 2E74C 3HRZB 1AGFA 5TD4A 1GGTA 2CUAA 2DPKA 5AWNL 2QTSA 5IQ7H 1FSKB 2Q7NA 5H94A 3EF4A 3QCVL 2FB4H 3A22A 3VQMA 4CRQA 4XDOA 2GNMA 3F58L 3COOA 1FCCA 5E9AA 2DLHA 3FCGA 3O6LL 3F12A 4HW6A 1OTSD 4UF0B 4TQDA 3L5XH 2OTWA 2NY3B 2CDGB 2DKUA 3BXNB 4F7CB 1UOFA 1PKQB 1NLDL 4ZS6C 4M5TA 2B08A 2X7RB 3DURA 4B6ZA 4PI2A 4CSTA 3HNTH 3TIDA 5AL0A 3BX7C 3D25A 3ZJAA 3AKTA 1KEMH 4OCXH 5ENWB 4EZ4A 2RS32 4ANXA 4LCWA 4MDJB 1K85A 5HDWA 1RUI2 4Q4W3 1DANU 2K9PA 2WR9A 2GW5A 5HYQB 1DYZA 3C5ZB 4NN5B 4HS6B 4TNVF 1U92B 3I3EA 5FV1L 4B9FA 1KGCD 1NG0A 5B7MA 1Y7BA 3VN4A 2CTWA 2BXZA 3W7WA 2AP2A 2ZT9C 4U1LA 4ENED 2J1SA 1GKOA 2I24N 1TPXB 4FJ6A 1FH5H 4O9EA 3FC0A 2YBSA 2VQFB 3GB7A 3ZQWA 5AAWA 1OLQA 4CADA 1BQHG 1UD5A 4EN7B 4P9JA 3UGHA 2JQMA 2J1AA 4WCEV 3AT0A 5F7WC 1R3LB 3VXMD 1CAWA 1G0XA 5TGBA 1J5HA 2HFFA 5FW7A 3PTRB 2ZWYA 4U1JA 3HT1A 4KOBA 2CO2A 3KPQB 4KRNA 2GUZB 4ZBMA 2LTQC 3MTXA 5AL8A 1ENRA 2NPLX 1Z5YD 1TFPA 5CEHA 2DYRC 5L3FA 1MCDA 3QHTC 5HHOA 3KMHA 2WVTA 4X5PA 1UPGA 1ZBE1 5A3UA 4YW2A 3QULB 1YHFA 1MAKA 3LQMA 1WIPA 2AJYL 3QEHA 5I8EA 3R4DB 3APQA 1YQ8A 4RZCB 5BNXD 2OS7A 5K1XA 1AKJD 1BFTA 5BRZE 2JDAA 3ICXA 3UPRA 4MZ2A 5FUNA 2WKOF 1CTNA 2BZDA 1BV8A 2BHZA 3IMMA 2D0HA 3TM6A 4O4JA 3E2HC 3T0EE 4IEXA 1A9BA 2F17A 4N7IA 4OXSA 3UEZA 1Y43B 1UACL 2CO6B 4Y1AE 3EH1A 2ZINA 1W3VA 4B3MO 2ZYHA 4G42B 3IKCB 4LCIL 2ENSA 3E5XA 1WW5A 4WLCA 5FIEA 4N53C 4Y9BA 1I7TA 2W47A 4GWJA 1PPIA 4DPNA 3RNKA 3FQYA 5C0CB 3WDIA 1G7LA 5EUOA 2VOWA 2VXQL 2BJMH 4A7QA 2Q1ZB 2C3VA 1HHHB 4AEJA 4XNZB 4HK3N 1K4CA 1F11B 1L9OA 4Y19A 4NQCE 3V4VH 1XSKA 3MMEB 4R6UA 4YVUA 1VEOA 3O3EA 1S5HC 4P9OA 1NA8A 2Q30A 2IBZY 4XCCH 1YEFL 2IGLA 1IGJB 4LF3A 4TSCL 3PVOA 3OF6D 5E6ID 1AGDA 1ZJBA 4A6YB 3FFQA 1U30A 4KNTA 3W21A 1BPLB 1UZ8B 3I7DA 4TNEA 2J73A 1WA8B 1ZS8B 1NS1A 4DPRA 5LBSH 4KJQC 1CR7A 3C7OA 3MRDB 4N0UA 1G5GA 1ONQB 3MIGA 5IR1A 3EYUH 5D8AA 1ZYBA 4H5SA 2ESVD 3I2IA 1RM1C 4UQEA 4L99A 3PXHA 3AEIA 5CFCC 4AH2B 4FP8H 5KYWB 4PA4A 4G5AA 3ARGA 2FDJA 2WLZA 4UFKA 4X98B 3SGKC 3C5JB 4GRMB 4CXYA 3AREA 3NCBB 5KMGB 3IDNB 5AEAA 3BZEA 3T4YA 3VDDB 4YIPA 3D0VA 3KBFA 3MLUH 2BOCC 1ASOA 3WEXB 1ODNA 4RA0A 2FZ1A 2VDMB 3LRLA 2GYSA 2HFGL 4NQXA 4X5WA 1Z78A 3A4EA 3BYYA 1MI5A 4PREB 3B40A 2L9LA 3JBG7 12E8H 2WQRA 4HS3A 1AR1D 3QDME 4IHOB 2PF4E 3ZKSD 4NKDB 4LLVB 3D30A 4QCIA 5EA0H 4C58B 5C4WA 3NW4A 4Y5XC 3M7FB 4N2FA 2WBJC 3UYOD 1RJLB 5CN2A 4JGJA 3LRHA 4ICXA 1ZLSL 3WL9A 5C0RH 2B7YA 2X9YA 1CAUA 3QOPA 1WAAF 1QBMH 4X5RA 2Q2EB 3S98A 3X14A 3W7UA 3H4HA 4BHUA 4QHNB 4NFCA 5KSVA 1FO0L 2IZWA 3CNAA 4HVOA 1AE6L 2C8NA 4GH4B 1PVC3 1SG3A 3M6DA 4AI9A 4UT6L 5DMIH 2Z35A 3HEIA 3VBBA 3F8UB 2QPDB 1XJAA 4OLLA 1CK0H 4Y1YA 1JPSL 4NHCL 2WXOA 3NSJA 4JQIH 4LCWE 1VDGA 3QWNA 1A6VH 3ZHDA 4ZS7H 1AR83 4XQ4A 2QZ5A 4HHGA 4ADGA 1RK0B 2QV4A 1NC4D 1T7WA 4XE5B 3WENA 3SIKA 3QG7H 2H26A 3MPCA 3RP1A 3OZ9H 4FQIH 1TZHA 5LXGH 2LW3A 3GJFK 1VBB2 4QGLA 1OMIA 2WTRA 3STZA 3ES6B 3BY6A 2BRRL 3GMQA 2VDMH 2D3PA 3S6PA 2ZCZA 4NNXA 4A2FA 3A4UA 3WB1A 1CD8A 3O4LB 1KB3A 4X5XA 1QBLL 1MFNA 1NCRB 3MREB 4RGNE 4P5KB 4LSRL 2H45A 3OKDB 4M48L 1R9FA 3VTMA 2ORZA 3OGCB 3HC4L 5HHOE 1CQ9A 2WL1A 3EFFA 4DKDC 3JZYA 1W0OA 2ZR2A 3HI6L 1BGXL 4GRWF 5F7EH 1G6VK 2E6JA 5J2TA 2R1XB 4LOVA 3USSA 4P4KB 4N0CC 1DE4B 4XWOD 5HV0A 3EGSA 4KQ3L 4YE0A 3OPZA 3AS3A 2F2HA 1JAEA 5J5EA 1GY1A 2BSKB 3J7HA 5E6ZA 4YG0A 3BIKA 2HVJC 2E6QA 4CCDA 3H9SE 4LF4B 2YKLH 1YG9A 4GP5B 1PG7X 1ZBA2 5TE6L 2XXMB 3PPEA 3EBAA 2IWGA 2LFGA 3RS6A 3QUXA 4EFBA 1UCXA 5TQ2H 3SKJH 4WUUA 5JW4M 3TN0B 2YXWA 2WZEA 1RZKL 1HSAB 5KXEA 2JD4A 1CZVA 4NBYB 4CH5A 4HJGB 4DGVH 2CO1A 2JSFA 5EUOE 1XXDC 1DFQA 4RZKA 4UTCA 4RFNC 1RUKH 4C56B 4Y19E 1A4JB 4X9YA 4J8RA 3SC7X 4AI0A 2X10A 1Z5LA 2BNRA 3B3BA 5C09B 2P1BA 2ZYIA 5L6YH 2P6CA 2WJSA 3UTPE 1YIJV 2X5IB 2AW2A 3QXAB 1W8TA 5FZ9A 4PVBA 3X2QB 4JFPA 3CLEL 3ELNA 4CP9A 5I74B 4PB9H 1YJDL 1H3PL 1MZ6A 5EF2A 3UG4A 1PZ7A 1NBVH 1EN4A 4W50A 3D7PA 1RHHB 2D6KA 1KY6A 3VB9A 1U8KB 2EAAA 4XPBH 3WXVL 2V7HA 4N0UE 2VYRE 4F9PA 1WC7A 2VL5B 1NMCB 2AJXH 3O2DL 2EECA 4GAZA 2WXFA 2F7IA 3CFKB 3KXFA 1TZGL 3NCWA 4R3SB 4D7YA 5ERWB 1NVPD 2JKIS 3VNYA 4EN9B 1XGPB 4UT7H 1HB3A 1LNUB 2IWFA 1N1YA 4WTZA 3D12B 3OQRA 4KVPA 1M53A 4NCC1 1AI5A 4UV4L 1NCBH 4QR7A 4NRXB 5JHAA 3KHQA 2PA7A 1WJZA 2FEDC 4RBPH 2EP6A 2Q8AL 3KHCA 5FYYA 4AE0A 1I3GL 1IGFL 3S36X 3RZHA 3M1CA 1WFOA 4UFMA 2X2HA 3U36B 2E59A 2YQ2A 1MI5E 4ABVA 3FW6A 4MB5A 4Q0VA 5ISZD 4Y22B 4OCYH 2YGNA 4XBPB 2CSPA 4BK8A 1Q0XL 4WFFA 4J3UA 2A70A 1T5WA 2RTTA 2WO4A 1C08B 4OIAA 2YUEA 3A2FA 3HUJB 2VQAA 1TUBB 1XR8B 1HNWO 3D2UB 3PWPD 5F6KA 3U14A 2FX8L 2WSUA 3DOIA 2H6PB 2J5LC 4PIYA 4HUXB 2YD5A 5DLLA 2IAMA 3WY2A 5C3OA 1PYWB 3D07A 3MLTA 4I2XB 4Q6IC 2WYZA 4EZKA 3HLKA 1BF2A 1KD7A 4LKDA 5FYIA 3NIGF 4NXNB 4OD3H 1R3IL 3LEMA 1UUSA 5D72H 5DYOB 4PWIA 3ARDB 3TA3D 3DTDA 2FMDA 4F4LA 3B9AA 1AJ7H 2NXYD 4JTCB 2NSXA 3QHFH 3WJMB 4LK4A 4CN1A 4GQ9H 5I6MA 2GIMA 5A32A 2W9XA 1BIIB 5DVMA 1KN4H 5F6IC 5FLXN 3WS6A 4QF1A 1T1ZA 1A9VA 2XPJA 2GTSA 2YEVA 1FORL 1F2XK 4NFDA 1D0HA 5A2FA 3QJTB 1S9KC 1E2VA 1IPKA 3LMJL 3OB0K 5AOJA 3VFNB 2FECI 1AGEB 4HOXA 1QH6A 1QJFA 2UZXB 3IS0X 1ZXKA 3O5SA 2BRQA 1QOSA 4HSQA 3I9AA 3ZBHA 1GO3F 4PRPB 1DHKB 3BKYL 4HAKA 1HQLA 3CJIB 3M17B 4Q0XH 4BXSV 3CSYB 3Q8BA 3GSNA 2HWD1 3SBWA 1T7VA 2VDKB 2YAHA 4MXVA 2GBOA 4O2AA 1GMIA 2QT6A 1O4YA 5AKTA 1C8QA 2OMXB 1LU2A 1XMQO 3SYAA 1IJNA 1G7JA 1RL3A 4Y9EA 2WD0A 3FT4B 3GMNA 4UOW0 5FFGA 4E2SA 2VDNB 4BQXA 3KNBB 5KOVC 2P3JA 5AYQA 3BC9A 3GXUB 4Q4X1 4G3YH 4Y2DA 4PRAA 5DA4A 3DJTA 5CZXD 4XPAH 3I3DA 3MV8B 4JVWA 2XWJA 4LARH 1RUH1 1ULCA 3L3IA 2ITFA 5CCKH 4HKJB 4AQ2A 1LO5A 2EEAA 1CIWA 5L7OB 5C9JA 2GC0A 2P17A 3MCG1 4WUUE 3IJHA 4QRQB 4LIUA 1EXUB 4DUVA 4LR3A 2P1YA 1VESA 4K3DL 3VSQA 2MOQA 3SEPA 4Y4FD 2QTWB 3WQ0A 2BGPA 3NA9L 3IAPA 4YK4B 4QU2A 3O1RA 1KZYA 1TENA 3DRTB 3OR6B 4R97B 4AOCA 4AHCA 3JWOC 1WPXA 1P69B 2CO7A 2DZEA 1D5IL 4GCZA 3LB6C 3G5XA 1CPUA 4PJIF 5DJXA 5EH1A 1BFSA 1BVLB 2CR6A 2C9UA 2I5YH 3BP7B 1N0LB 2BNRE 3PU7A 2YXVA 1CFBA 1G7YA 1AR5A 4X7SL 3OAAG 4C0HA 1WPCA 1U3HB 1IBGL 4F8NA 3K5SA 3T4AA 3UYRL 4BD4A 2PMWB 3NIDE 2XH6A 4XUPA 2GTWA 2A1WL 3HE7B 3X1NA 4L23A 2K6WA 3DDFA 3RZCC 5JQIB 4HQQH 5KN5B 4Y9GA 4UINH 1W9XA 2VDRH 2HMID 3NCYS 4ZFGH 3ZYFA 2YUVA 3IB3A 2VDNH 1HESA 2ZXDA 3MYZA 4LLUB 2XQXA 5HV4A 4N0YH 1DBKL 2GALA 4QE9A 4NWUH 5AOMA 3KXFE 5F88B 4AYFB 2WB1A 1DCEA 2MPAL 4PB0H 2DF7A 2WN3A 4YBLC 5ISLA 4HLZG 2NY2D 1O0VA 3HLAB 1E6JL 3H9ZA 3FRPB 2NY6B 4LPLA 1M93A 2RDCA 4EJRA 4JPKH 2XN1A 4KZCA 3SQBB 3STBA 5GGVH 3K3QA 3CVHH 5IHUL 3QO0A 1DO6A 4XP1L 1OFSA 1ZS2A 1F2NA 1NAKH 4JR9L 1ND3A 1CFSB 3VFMB 4WFFE 5L4MA 4RWUA 1W72A 1XWVA 4K4KA 1WCBA 4K8FA 3AG7A 1J11A 2X9XA 3GI9L 4XFIA 4GUNA 2OMYA 4D7SA 1BM3H 2HJLA 3HFFA 3WJJC 4GO6B 4UW4A 3AK0A 3RYHB 2UZIL 3KG2A 2RHEA 3EGDA 4HU2A 3O65A 3WB0A 2VISA 3KMDA 1FPN1 4GMSL 5FPAA 4U0RC 2FQGA 1R3HB 1V6KA 4URTA 3WD5A 5FZFA 2W9LA 3HKCB 4IESA 4ODSH 4MXWH 4HF5L 1RGSA 3APOA 2DQGH 4FFKA 1BBDL 2Q2LA 4L3EB 2HB0A 1L7TL 1WA6X 3P2TA 5F8QC 4Y5VC 1J83A 5D2NB 3TNMA 4YW7A 2WCSA 1KCWA 4MMXA 4PIZA 2K0GA 3PL6A 1D9KA 2E4FA 1AY1L 1G6UA 1MCFA 5E00A 2RIKA 4U6TA 4AGLA 1V9U1 3TNQA 4FLZA 2QFRA 3VHRA 4XBGA 1PZ8A 4UU9A 3TYGL 3U7WL 3VTAA 4QPGB 2X89D 3MJ9H 1C1EL 4AE1A 2RVAA 3DTXB 5D1IA 3ZDXB 3V0JA 3F05A 3OXSA 3HPJB 1LUVA 1Q3EA 4ZAKB 2Q1EA 4TUKH 1FFXA 3IFPA 3QK0A 3BCCH 4XDKA 1HWHB 1OWWA 3LHPH 3MXWL 2EUVA 1QJU2 2LV4A 1IQDA 1LO2L 4LHUB 5C97A 1WFIA 5BQ7B 2V2TA 2BP8A 1VIWB 4EIZC 3GMMA 4MXVE 4YHYB 3RFZC 4UQ2A 5FA3A 1IAII 1Q9OB 2A4CA 1HEHC 1M7XA 1XCXA 2SEBA 3BYTA 3DUSA 4HC1H 4WW1B 3T3PF 4BKLA 5CD5D 1OCZB 1F45A 2R16A 4IGQA 2DU0A 5A7WA 2KZ1B 2A83A 5DQ9A 1IM3D 3MNMA 4N2LA 4N2HA 4OZGF 5FGBA 4BQWA 4DV4B 1VPOH 4META 2ZEWA 1AH1A 2K7PA 4Z7VA 2I9TB 2JRIA 2PNDA 5T52A 2OJEB 2YAFA 1M4UA 1YJ9V 4XXCC 5LGJB 1OH4A 2XV2A 5GGRA 2E0PA 1MCNA 4I0CC 1EIBA 2GJPA 3QYNA 3L2YA 1AS6A 2WWMD 3VXRB 3LV3A 3EBRA 2XUMA 1YN6B 1E4KA 1JPFB 4PYGA 1VQLV 2YROA 1OA2A 2NTSP 1BVKB 3Q2VA 1DGWA 2BCMA 5IVXF 3AG1C 5HDLA 4LPXA 5LP6A 5CF3A 4JAUA 3TA4D 5D1QC 2BE3A 1DO5A 4NUGH 2A7AA 2ZZQA 4XFGA 2QQLL 3LKSB 1MFMA 5IBTL 1HJGA 4X83A 2FWOB 1SLUA 3US1A 1G9EA 1JMUB 2WNEA 4YGCA 1JRHH 3KDMA 1OTTD 2VQEO 4CDQC 2A74C 1PLGL 2FUTA 1PDKA 5AWNH 1XB8A 4ZQKB 3RGHA 2KB1A 5BZXA 3BDBA 3CU7A 1FPTL 3HKEB 3QCVH 1QTSA 1AR91 1ZD6A 1OE1A 3F58H 3GEWB 5MEOA 4OD2A 3DMMD 3RTQC 3VG0L 2EE9A 2VLJA 3HR5A 3O6LH 1L0YA 3BTYA 3HC3L 1GOHA 3FUHA 5FB8A 5FPLA 5CB7A 2WLMA 4KK9C 1NLDH 2GSYA 1CG9B 3WAJA 4HCFA 2LVCA 1E9PB 4GRLD 5BUAA 4NP9A 3PJYA 2EDJA 4X42A 3GRWL 1E2ZA 2MTPA 4M5ZL 3T3ME 5DJ8A 2QLYA 3BO8A 5C0BA 4Y89A 3W11D 3JWNH 5LAXB 4PM1A 3NQIA 3WLWC 4ES9A 3HTLX 4BGDA 2X42A 1K5WA 4JQRA 3OTOO 3J7NA 1BQSA 5CCJA 1QKQA 5J3HD 1J3QA 5FUCC 3AY4C 1K5QA 4IKKA 4X64O 5FDYA 5FA4A 3VXTA 4F37K 1US3A 1YFUA 2A99A 4WHTB 1SETA 4L4TB 3SDDA 4KH9A 4COUA 5DJAA 1I3RB 1QRNB 3VBSB 4W68A 2EKSA 2UU9B 1V70A 3LCPA 1JFFA 2FLBT 2XOTA 2E6PA 1NM4A 5AAPA 4LO7A 1MG3C 2IOOA 4W4OC 1R75A 3VU1A 4Q9RL 3PQYB 4LR4A 5GZEA 4MJ6B 5G04L 4NKMB 4K7PY 3R8BB 1GYVA 1L8DA 3MRHA 4AQEA 2AJYH 2ZOLB 3IFNL 2EXKA 3FBYA 1FLRL 3RL2B 3HG4A 4G6JL 2YI8A 1BREA 1PG7W 5J4MA 2V9UA 3CO2A 2JGDA 4O4HB 5KX5B 4M56A 3RX5A 3U6RA 5L2JA 4HOMA 4GB31 2CTVA 2F8VA 1RVF2 3US0A 2GSIA 1UACH 2UUBO 2ZKOA 5J98B 3RPIA 2P7TC 5A3PA 2E51A 4LCIH 3SJAC 1CL7L 4S1DC 1Q0YL 1NFIA 4WQOA 3EUDA 4NIYE 1TTUA 2A5ZA 4WFED 1QI5A 2HUHA 5FMOS 4YWAA 3T0DA 4CUBA 4BQCA 3IJEA 3DLQR 2CH7B 5CMUA 1IBZA 3NVCA 1HT6A 1D7DA 2VXQH 3P3PA 2B9UA 2DUQA 3M2MA 4PDWC 4CEYA 1U8OA 5JORB 5D7JD 4Q20A 4JGUA 3TBYB 4PLNC 2EVHA 1AMYA 1ONAA 3BPOC 1JGUL 3KCXA 2X88A 2WZR2 3GSNL 1YEFH 4GKSA 4TSCH 5E4IA 5A6MA 4R8HA 5ANQA 5CR8A 5HYJD 3UTTA 3CF6E 1W6OB 3MRKA 4YDVA 3HS0C 1J7VR 2ZX5A 4OF5A 4UF7C 2WT1A 2VQ1A 2PWDA 1P0SE 1A1OB 3C08L 3LRSB 1UXMA 4Z7VE 4A2GA 2ZQKA 3MV7D 1QBZA 1V6IA 4APQC 3NWKA 3V4PA 5FEBA 4J1WA 5I0XA 2HTKC 4HJIA 2UY9A 3S96B 1FPOA 2IMNA 2ZAHA 1R73A 4GO9A 3QNEA 2QTVA 4NRYA 1VBE2 2EZPA 3CDGB 1MLBB 5E1AC 4HJTA 5I26A 5FMOL 3GJBA 1M6OB 4M4RA 3MRLB 1EZVY 4FADA 4DESA 4NQDA 5KSAB 2VBBA 2GIYA 2ZGQA 3MJ8B 4MXQC 3H2PA 1AROP 4PJ7A 4S2HA 5F2SA 1Z7JA 2AKRA 3BEWB 1FX5A 3ETGA 4ONHA 3UH8A 4UCSA 4KZEL 2LW8A 3ETPA 1KF9B 3FF8A 2AZUA 3LKQA 3FQ4A 4BZ2A 5J9PA 2HFGH 1JHJA 4HG4J 1F41A 4YGVB 5D1ZD 3AG3B 1UZGA 1J5CA 3IRZA 1VBE3 2ZM6O 2RA1A 3JAKB 2APTA 3DX1A 4IJ3B 3WSOA 1TQBB 2XJVA 3U79A 4YNYB 3G6AB 1S7XA 3V0IA 2FRGP 3WF3A 2CDEB 2FR4A 2A06H 4LU5L 3FUQA 4L97A 3P4NA 5FZIA 2HWD3 4AVIA 5KBKA 1FJGB 5HY9A 2LW7A 5H35B 1ZLSH 3DV8A 3DTUB 3MXVL 3IDEA 4HMCA 3NNJA 3H9YA 3UT0A 3VBFB 3L9DA 2VLJE 3MRQB 4V1DA 1J5OL 1FO0H 5ID0A 1AE6H 4ZUTB 3SDAD 3WJLC 2AK4B 2LTNA 4JRXD 4FQXD 4UT6H 3I2GA 1KCKA 5C0GA 3LF7A 3RQ0A 4HVQA 5HYIA 5C0FA 1O5UA 1UOJA 1OB0A 4KKAD 4YLQT 1JPSH 3HB3C 4JM0A 4RFOL 4Q4X3 4NHCH 1FGNL 3Q4HA 2P67A 3TCLB 2PF6A 3Q5TA 5CJ5A 2DEWX 1A78A 2JK5B 2EAEA 2WS91 2A4EA 4U3CA 4WV1A 4XZUA 3WTTA 5C0BE 5IB1A 4IKNA 3SCHA 3QZWB 2E5EA 1ETZB 4Y20A 2ZX0A 5JSOA 2CZNA 2ROXA 4P5TB 2WZR3 5DUPL 4UT9L 1G9DA 4H7VA 4DP8X 5IY5C 1XGTA 2GK0A 2BRRH 5CU9A 5DJYB 5F21B 1WTGT 4MA1B 4JDNA 1I8MB 3AQZA 1QBLH 3REWA 2NTFA 5F0MB 4UV8A 2EACA 1W72L 2GJZA 4XX5A 3EO0B 4YFEA 1STMA 4LSRH 5A43C 2GBUA 4M48H 3H9AA 3ZL4L 4CGTA 3OUJA 3QD6A 3PGCA 3T1HO 3HC4H 1I1AD 3AM8C 4YGDA 4QGMA 5GISL 1Z9OA 3HI6H 1BGXH 3K2KA 2ATKC 2Q5ZA 1JTPA 1UGNA 5FP4A 3PV7A 5IB2B 3NQHA 3CXHF 1ZWIB 4YVNA 4KQ3H 1FZOB 2P5EA 3WD5L 4DFHA 5FDBA 3RZGA 3VLBB 4PLMA 3ZDZE 3FBQA 2BHUA 3WLBA 4FAHA 4YW3A 1VARA 1PO22 4AFMA 1LGNA 5TE6H 2QTEA 4DERA 4E9KA 1XCQB 2JV6A 1NIFA 3ZIMA 1QO3B 4WBNA 4M6NL 5HBAA 1MF2L 1S7UB 5AG9A 5F9WC 3BTZA 1RZKH 1PMYA 1JNHA 3EYVA 1IKOP 4BINA 3VRLE 5FRAA 4BFRA 1ZT1A 1SC5B 4F24A 1IZKA 1TQ5A 3LKPB 2UURA 1V0AA 5FBJA 3FUJA 3KT7A 2MIZA 4AEDC 1CXEA 5M0TA 2KUTA 4IIQA 3DGEA 5E79Z 5KA5A 1A7QL 4OGAC 4RMWA 4B96A 3JD71 3OJDA 5EC2C 1YEHL 1SJEB 1C12A 1GZWA 4K7FA 1R6NA 3UTTE 3CLEH 4OKVA 1UTDA 1WWCA 1YJDH 1H3PH 5EEXA 4AEHL 1PGL1 4DO5A 1RSOB 1FPN3 1TQCB 1TZIB 4Q6YA 3UTOA 3LDBA 2BCKB 2P3KA 5HHQA 3WXVH 4QKNA 1XIWD 4LNRA 3PN1A 4XP4L 1Q82W 2OMNA 1VRSA 1GSKA 4G8GA 3G6BA 3O2DH 4L3AA 2PHWA 3QARA 1ZZ9A 4DXZA 5IFTA 2ZCLL 2Y5QA 3F01A 3RWCA 1H8LA 1P5UC 1U8LA 1TZGH 3SJVB 4XTMA 4F8AA 1IGYA 1SBEA 1XQ4A 4NQDE 5L4IA 4DR5O 4BHPA 4O2EB 4P46C 4PJ7E 1QQP1 1X4YA 3O9WB 4UV4H 1ZSDB 3L4ZA 1BZ7A 4JFDA 2EDNA 4HMDA 3VDCA 3FXIC 4LO8A 1OCWL 3VMPA 4WDIA 3BP4A 4JFOB 2Q8AH 5K9QI 5FF6B 1I3GH 1NFDF 1IGFH 1OE3A 3G5VA 4JY4B 4FFVC 3FOMA 3D3VD 1ZHLA 3IDJA 3V2AR 1B09A 3SCGA 3THML 1HI6B 5CKNA 1CD0A 4PGCA 3DPRA 3ARBD 4F33A 3Q1SL 4OUUA 1CX1A 1Q81W 2Y6GA 1Q0XH 1AI7A 2YGQA 1Y7VA 4H7MA 1ZDSA 3D0SA 1K8DA 4CDXB 5H2BB 3KQRA 3M3QA 1E6OL 5LW9A 3L17A 3CJXA 4FOVA 2IJHA 1EJ8A 5FY8A 4TV9A 2FX8H 1W91A 3B1UA 1HHIA 4V1DE 1Z9MA 3FUMA 3KYMA 1FGVL 4E5XB 1C5DB 2EUXA 2DVAA 4A68A 4D2NA 2Q5TA 1AQ8A 4ELMB 4IEUA 1JS9A 4FABL 2P34A 3E22A 1Z5VA 4F6RA 2VR7A 3JV6A 3CG8A 1BA9A 4GQRA 1SOKA 1J48A 4MQXD 5LMNO 3BQVA 2XWTB 4Z78A 4X6CF 1R3IH 4L9BA 4YFWA 2YGVA 3OBRA 5I1JL 4XMIA 1DVUA 4IRJB 5LMUB 1NBYB 2F7PA 4G8EB 4D9RD 1IB5A 5HBBA 4ATFA 4XI5D 2EUWA 4N2KA 2JB6B 1MLCA 3Q9QA 2BQPA 4UW5A 2YXYA 3N85L 1FKAO 2Y24A 4NROA 3C8DA 4COVA 4DIXA 1FORH 2RMKB 2RM22 2WXLA 3LMJH 5DMKA 1A0QL 3I2JA 2CGNA 3IKWA 2CV6A 4EN3C 1J0YA 1KIQA 4YZ3A 5AVPA 1E8WA 1IARB 2R29A 5ESVA 4FP3A 2OX5B 1VF6A 2VSDA 1OOPC 3JBG1 1HQRA 2ZOUA 3C2SA 2IIJA 2UUDK 1XGUB 1E43A 1J5EO 3H56A 3BKYH 3IKKA 4JQXA 4LKCA 4PJHB 5DMGD 3EO9L 1MCKA 4XHJC 1O9GA 5T3ZE 5CFCA 4JYBA 1I8LA 4BWWA 2OXHB 1HOCB 4KJPD 5IHZB 5KXCA 2GHYA 2DOSA 2EDDA 3WKYA 2Q8BL 5EYYA 4PP2B 5ICYA 2RM23 3X13B 2HH0L 1I9RA 4I0AA 3IMVA 4IBUA 3TBVB 5B4NA 5BXXA 1U8NB 1LK2A 4KRPC 4ZUVB 3T6QC 2NR6D 4W9KC 1MHEA 3TF7C 1SY6A 5L8KB 2P5EE 3TURA 1FAIL 1ZK5A 3GRGA 3VXMA 3RTLA 1T22A 4DO2A 2WXPA 3X11B 4HKXB 1SHMA 3GZUC 3R0NA 1UIJA 3DX9A 1KTKE 2G3ZA 3ZFFA 1IBKO 1XNQB 3HHSB 2XJQA 4N5UA 1W90A 1S77D 3EJYD 5JHBA 2VERN 4FPGA 5I1LA 2AJSL 3P9MB 5EU6B 4K3DH 3SYQA 3CVCA 1CICB 3Q2CA 3U9UB 2C3XA 3ROOB 1AKJA 3NA9H 1R5IA 4PS4L 4DAGL 4ZQTA 3RIAF 2J1RA 3UTSB 4E41B 1OFNA 3WE6B 1D5IH 2WLIB 4GT0A 1SQ4A 5D6DA 1HHKA 1KCRL 2O6CA 5J57B 3ZMUA 4XMXA 3VB8A 4KI5M 1VERA 3FT3A 3QSKB 2KXLA 3MODL 2IU0A 4X7SH 5EU4B 1NGZB 1IILE 1KCUL 4LLWB 2LU4A 3TYFB 2Y2WA 4HKLA 1IBGH 3ATGA 2VS0A 1WVZA 4LBEC 3UYRH 3MLPA 5JCOA 2FH6A 5INDA 1FIGL 2A1WH 3EYFA 4LORA 4X66O 5DUBA 5KW9H 4U05A 4AFAA 5FYKE 3AMQA 4EV0A 1GYCA 4R52A 7CGTA 3HWJA 4G8GE 4Y4KA 5CJQL 3LD8A 2OT5A 5DRXB 1JGVL 1V8HA 4J8QA 1DBKH 4IBWA 4PJGA 4EN8B 1XREA 1O3SA 4PF5A 4LKXA 3RUGB 4CW1B 5CBAA 2Z0UA 5E6IA 4LHNA 3CCVV 1N4XL 4OY9A 2MPAH 3KCPA 4BKTC 3L2HA 2QKIA 3SGJA 3UMTA 3VFGL 2BNQA 2OPCA 5D93B 4JFDE 5JO5A 1AYM1 1TSHA 4QPEA 3F7VC 4PG9B 4GB33 2XBZA 1T89C 4MCYB 4JASA 1E6JH 1MH5A 5DZPA 1AZRA 1O5PA 2R4SH 5T5FH 3SCMB 2J1EA 1EH9A 3GSOB 2NZ1A 2YXHA 2E3VA 4JFQA 5E8PA 5IHUH 2PUSA 2ESVA 1S1AA 3S5YA 4XP1H 5IJKC 4FMFA 3OR7C 3F04A 3JCIA 2G5UA 1YN7B 2EDTA 4JR9H 1SYVA 2D7NA 3K6FA 4YDJB 3VFOB 3ZMRA 3MW2A 4H13B 5B1BC 1SUJA 5ECGA 4U3JB 3GI9H 1PVHA 4BZ2L 4DRXB 1N32B 3QORD 3VWJC 1BVZA 1RUJ1 3IDUA 3MRNB 3MLSL 4L29A 3V56A 5T1MB 3MHSC 3WG1A 2UZIH 3K6OA 2FL4A 1P1VA 2HYMA 2VZ1A 4JCWA 4JAMB 4RMTA 5KANG 5CN0A 4GMSH 2H0FA 1RY7B 2HA1A 2XXGA 1GZQA 2EIBA 3OG4B 3HBZA 2JDHA 3ARSA 3OMNB 1CFQB 3R65A 4HF5H 1JH5A 1DQ1A 1HVXA 1BBDH 3U4KA 3EJJX 1L7TH 3T1YO 4KGLA 2AF2A 3V9FA 4JYAB 1I5PA 4C0BA 2KZKA 5LYJB 1Z7S1 3ALQA 5FPXA 1F1DA 2R69L 3QXDB 5E2VL 3E89A 3AROA 1AY1H 1TVGA 5BNPA 4POYA 5FYJD 1AXKA 3MICA 5JOWA 1PGW1 4OD1L 1JZIA 2UXDB 3VCLA 1S9YB 2HG5B 2RS51 1KLUB 4QJ3B 2NY1B 3TYGH 3U7WH 3M3OA 3S7EA 1CGVA 2BVQA 1S0EA 3IDAA 1C1EH 2LROA 3KF5A 2W0FA 3S97C 1XFPA 1NCJA 1KCSL 2K7QA 4JO2L 1UY1A 5IESH 5D6CA 3L7EB 3OM3B 3PY9A 4WO4B 3MXWH 3NFNB 1URLA 1LO2H 3AL5A 2XI9A 4ZX4A 2BWQA 5EUKB 2FJGA 2DQCL 5EU3A 2RS31 1NC4A 1VIBA 3WZ1A 1O9VA 1YIPA 4LMQI 4L5FE 3TH4T 4D94A 3APCA 2PXJA 4F3FA 2Y0OA 4BV1A 4IYIA 4FQHB 1UH2A 5T3ZL 5I8KL 2BSRB 2BUKA 1DQJB 2VN6A 5IHWA 3GBFA 4IOIA 3VXME 5CWSA 5FGSA 1YQCA 3BLPX 1KELL 3ILRA 2BY0A 2R0FA 4P9PA 3PUUA 4FRWA 3KPLA 3PAYA 1NAEA 3JAWB 2YPDA 4WSJA 2XG4B 5D2LA 2RJKA 1KKDA 5AW5B 5GSRA 4R4ND 4K15A 5H4YA 5J13C 3QFGA 4UNTA 4H7LA 1X5LA 4XBFA 3AMHA 1QFHA 1CGYA 1N3PA 1W3XA 3B43A 3RYIB 1IGML 3FCUB 4YSPA 4X4YB 5I6NA 2WS93 3ILQC 3PLQA 5C8JB 2B5IB 1BZQK 1U8PA 2RH0A 2V0AA 4B9KC 2XXFA 4D3WA 1NEZB 3ERXA 4M1GL 4QY8B 3ZDYF 3SO3B 4Q4Y2 2AJZB 3PAZA 3TOJA 2O0OA 3PHQA 1JYWA 3GJFA 2QQLH 2XFXB 5IBTH 4KUCD 1P7HL 4JRFA 1ROWA 1OB1A 2L7JA 1MVQA 2JXAA 2V33A 1XMOB 2XVKA 4CBPA 2ZX9A 5F1NB 2AVFA 3WUWG 4QIWF 5I18L 3JALA 3M1BB 4XCFL 4Y1UA 1PLGH 4EKXA 1F3RB 4TUUA 3AK2A 2EXWC 3LQZB 4JQVC 2HN7B 2O14A 1FPTH 5IWAB 2W91A 2IBZX 2YSUB 4BH7A 1G9HA 2JG9B 2ICEC 2XZQL 4EEQA 3GSXA 3MHHC 4DR7O 1SFNA 1IIKA 1NH2D 3VG0H 4PJGE 3J7MA 3S0MA 1UXXX 1CTMA 3IMSA 1T5KA 2DWSA 3TO2A 3HC3H 4MAZA 3FQNB 3VXQA 1N34B 4ABMA 3MR9A 4G6ML 1NGYB 1LE5A 1X50A 3VQWA 2BNQE 3MGUA 5LASA 1KYOK 5DO2D 2HFEC 1ODUA 2IGFL 1R082 1J1OL 3GRWH 2R56L 1YZZA 3RYPA 4CYDA 1UC6A 3CDCA 5TDNB 1RFDL 4M5ZH 3K71B 3CVBA 2ESVE 4OQTA 2FIKB 5GS3A 3IETB 2LFEA 1ZPLA 4ASUG 5KHGA 4FPHA 1CJYA 3KHOA 4J27A 3K0GA 3T1MA 3HS8A 1LDSA 5J11B 5FXCH 5DVPA 3QVNA 3SSGA 3CNKA 1R083 1W6MA 2FK9A 1NT0A 1GYAA 1UX7A 1T66C 4Z3IA 4QUOA 3JD73 2HYXA 2UWEF 3K0YA 5HVGB 1M42A 4IM8A 4Y2NA 1A6TB 3CFJA 3D85D 4FDWA 5FCSH 5L7XL 1XL6A 4Q9RH 4B7KA 3V0VA 4QHMB 3LKRA 2FTKA 3WIHL 4Q0PA 2HJDA 1XF3B 3P3NA 1R5WB 2OW6A 3L3DA 2NNUA 2X70B 4JM2B 4JV4A 2GABA 3UCRA 3DVGA 3T0VA 5KEZA 3IFNH 3PWPA 4PJ5B 5HHMD 2AEZA 1FLRH 1W16A 5DJ0B 3POHA 4G6JH 1J05A 5DAXA 1SBDA 4DUYB 4GKXA 5C8YB 4MNHB 1XYOA 3CPLA 1UA7A 1WEJL 4UDUA 2EXHA 5AVXB 2BIQA 3WLUA 5EUOF 3LVEA 3KPTA 3SE9L 1UU6A 2D6PA 2F6BA 4XODA 5I8YA 1NIAA 1SZBA 5H4ZA 1KGJA 4P5SA 4Q8LA 1QQP3 1M9SA 1CL7H 4WM7B 1Q0YH 4LHQB 4Z77B 5LQBL 3NSTA 2ZMLA 1ZTMA 2BNNA 1PNLA 1FNYA 5BVJA 4G9FD 3D6EA 3JD4A 4FLWA 4JI2B 1S0FA 4MKTA 4W9LC 1L5GB 5FK8A 2D6NA 1VQOV 3T1CA 2GT9B 4KJYB 1XD1A 4RRPA 4K5NA 2V4DA 3NP3A 1TTGA 2QSAA 4LCUC 5HJ3A 1EAH2 3ARFC 4G1MB 1MHCB 1DBAL 5GKAC 4ATEA 2YGLA 4JYCA 2SODB 4AVAA 4B7LA 3CH1A 1JGUH 4PS8A 1WA0X 1QVOB 1R64A 3GSNH 1PZAA 3DKWA 1VBB1 3BTAA 2ATPA 2NY4C 4KK8D 2IDUA 4X20A 1OI6A 3NRPA 3KWWB 3ML9A 4ANKA 1I9RL 1ENQA 2B59A 5LGNA 1CUOA 1NCCL 2YUWA 3C08H 3V5KA 2P4EA 4LITA 4QNPE 2GSGA 4NPYA 5BS0B 1OVPA 3DA0A 3I49A 1SY6L 2IH1A 4XMKL 1VFBB 1FNEB 3GMLA 3R05A 5J2UA 3P0YL 5FWQA 4JI6B 2HJKB 3BRGC 5IAXA 2WINB 1U8MB 4HIXL 4ABUA 1MCJA 1W8UA 2UY7A 1O9HA 4AFBA 1JQ0A 1LO3L 5GIRA 2QBXA 4LBNA 3EXUA 3W59A 4JFEB 2X4UA 1X5YA 1UN1A 4KZEH 5CAZA 5DEFA 1XF4B 3ZXKA 3C60B 1QTPA 2QWRB 1E7VA 3K1KC 3ZTEA 5JMOC 4YOKA 1D2SA 2G19A 1S8DA 1B3QA 1H1MA 1RK1A 5EBMB 1BMGA 2EIZA 4DR6B 2NZ9C 3NFPB 4YO0A 1MZZA 3QFDA 4Y4FA 4A1RA 4Z7OF 4DRVA 2OL3B 1E3FA 3JBG3 1UJTA 4AI8A 1U58A 2FO4A 4M6AA 5D1XB 4X65O 2XBDA 3S35X 3OKKA 4Z7WA 4BCYA 4OGQB 1AVAA 4LU5H 3NRUA 1O7DC 4DZGA 1N59A 1AQDA 3GPSA 1XGQB 4NN6B 1LEKA 4J28A 1ZCRA 3K6NA 2ADFL 3MXVH 3NNFA 5IAVA 1LE9A 3QI9C 4ZYKA 5B1AC 4IMKA 3CCLV 1EEZB 1FZKB 4U0QB 5DZVA 3T0BA 1J5OH 3UO2A 4DR4O 3T30A 3PJLA 3N27A 4OW6A 3SDCC 4UZGA 2BTQB 2HWC2 2QPSA 4M29A 2Z3YA 1KJ2A 4OFKA 3LEVL 1MNGA 1MCLA 2EYRA 4RFOH 4Q9CA 3K2OA 2GP5A 1DVFB 1FGNH 1JNLL 2VJ8A 4KTDL 4ZXBC 4P3DA 1Y74A 5E03A 3RY6A 1JFQL 4PMEA 4MD4B 1C16B 3UT5A 1UQSB 2VRAA 3RNSA 4KKCD 3SKOB 3VXPA 2O4EA 4OV6F 1PZDA 2FE0A 3QXVA 1YI9A 3IC7A 4GXLA 1R1CA 1NLRA 4XAWL 3ULSB 5DUPH 4UT9H 5E8EB 2OW7A 3EGXB 3Q6FB 2R072 5A2LH 5EEUA 2XKPA 3POJA 4UAHA 4PCRA 4BQ8A 4F93B 1ACCA 3GMOA 1AZNA 1MN4A 3QR0A 4IOFC 3MFGB 4X5LA 3U4AA 2WABA 3I59A 5F3CA 1PNCA 4F57L 4JJ5B 2WC7A 2PZSA 1N5AB 3ZMTA 1IGTB 1JPGA 1W72H 3BZDA 1AHKA 3ARPA 4PFEA 1FHGA 1XTMA 2XYBA 5DVKA 5ISZE 1HK6A 2C9KA 3HC0A 3ZL4H 3VFTB 1MCWW 3IYLW 2ZUYA 5I76B 4P23B 1JXKA 5EMYA 2J22A 2VDQL 4PV9B 1I9JL 5GISH 3A67L 5HGBB 43CAA 1F4MA 2Z64C 4AXWB 4ZTOL 1ERNA 3OGRA 4MQSB 4LLYB 2P45B 3OKLA 1DLCA 3PWPE 3BD5A 3WD5H 1N3NB 5I30L 5HDQL 3KBHE 2YIBD 4ZU7A 1SJVA 2GV9A 1YY9C 1B04A 1SUHA 3BU7A 3ZGHA 5KHKA 1UZZA 4HSLA 2J72A 4U6XA 4JGMA 1CDBA 3HJEA 4WI8A 4LQFL 1EXHA 1JOJA 1MR5A 2O6FA 2JG8C 2FTAA 4MVRA 5L3BA 3KJ4C 3OX8B 5F1OB 2LALA 1XSJA 1O91A 4M6NH 4EZLA 1MF2H 4CP2A 2W08A 3HPLC 3STLB 3GSRA 1AYM3 4KY2A 2VMHA 4H8UA 4XOBA 4ZT1A 3UAJD 4ES8A 3O12A 1BJQA 4MJID 1PMIA 3ARUA 1G9ML 4YZWA 3BKZA 4ILDA 4JDVB 5FHBL 2WVUA 1V55C 2CLRB 2I85A 5DI8A 5IF0B 3U25A 2K46A 4QXTB 2VC9A 5FYCA 3ZPYA 2X89A 4FFWD 4ANUA 1CAXA 2IH3B 2PQQA 3N2KA 1G87A 1A7QH 1Z3RA 3WG7B 2RFXB 3MRRA 4G71B 2WO7A 4K8RD 2E86A 4UFLA 1YEHH 3PWJA 2H8PA 5I5MA 2E7TA 1TU2B 2LABA 1RUJ3 1VBA2 1POV0 3QNZB 2CM5A 4Z18A 3PDQA 2IJIA 2A79B 5IJ0B 2YAMA 4NDMA 2QJDA 1IAKA 3NCXA 1RZKC 4IBSA 4AEHH 5LA6A 1V6MA 4UB6Z 3O8XC 1WGOA 5CP3H 5FM8A 1JUFB 4FG0A 2G9GA 3ILFA 3T0EC 1OALA 4UI9L 3DGGB 1NANI 4HKZB 5H6QA 4XP4H 5JH7B 2Y7MA 1QNMA 3U2JA 1NGXB 2VZRA 2B9BA 1HL9A 1KC8W 2YHJA 5FZ6A 2ZCLH 4HPYL 5I93A 3BFQG 1SPPA 2ZWSA 1BSMA 3OD3A 5A1LA 1IM3A 1QUNA 4P2OB 4P2RD 3AXDA 3ZFEA 4FNLL 4OFPA 5A2AA 1ZLWK 4CTEA 1EZUA 2QADD 2EIGA 1YJDC 1OCWH 32C2A 3DVFA 1W2AX 3QRGL 2RS53 1FYTB 3RYKA 5C8CC 2AH2A 3ECWA 1HAWA 5I2IA 1QDCA 3HN1A 4JZGA 1SF9A 3O6FD 3MEPA 3THMH 4XDPA 1F23A 3Q1SH 3WNJA 5JPNA 1XVSA 4KGJA 1AANA 2H2PC 1GWKA 3GCWA 5ANMB 4J3XA 4Z7WE 4IBQA 5D7SL 4HLEA 2JGUA 1E6OH 2EICA 5J1XA 3E80A 3QQ3B 2XLLA 3LSOB 2OFQA 4LOEA 3B9KB 3WIFB 3G7TA 5IESL 5IW0A 4PF1A 1QWUA 4MWFB 2TEPA 1FGVH 1SS3A 3GSWB 4PY7A 1J9CT 1Z5WA 4K8XA 1WGVA 4PV1B 4OCTA 2QGDA 3FC8A 2J5WA 4FABH 2HLEB 4B3SO 3TF4A 4MYPA 4FA7B 3IFXA 4TVSa 2P8MA 4RGOL 1MJJA 1SNRA 1OBNA 1U0AA 1OSEA 1N6UA 1KJVA 1MRDL 1US6A 2OCJA 3AMLA 5I1JH 4UYPA 3K4AA 2IVJA 2AV1A 2ARJA 1XHXA 5JW5A 3VFVB 3H55A 2JI3A 1NQJA 3DETD 3N85H 3S48A 5GSVB 3QUYC 1ZT4B 2UXBB 5DJ2B 4LPWA 4IIJA 2ITEA 2IXJA 4HGWB 1T1XA 1IS4A 3FU8A 4IUGA 4Y3OA 2WNGA 1KPRB 2BP3A 4CU8A 4MVMA 1A0QH 4A3XA 3TO4A 1RZJL 4MXVF 5C2BL 3ALPA 4DEWA 5JZ7C 2EJRA 4OQTL 4NKOB 4TYSA 3O3DA 4BK5A 4QRPD 4GLRH 3WHXA 5IEKA 1QEWB 2WIMA 1R3IC 3OSDA 1QUPA 4G6FD 3SKUD 3B9CA 5FK9A 3EO9H 1NQBA 1UW8A 1D7PM 3VV1A 1X7QB 4X6DB 4JI7B 4NKIL 4Q74A 2Q8BH 4OPAA 1P4IL 2HH0H 3P0VL 3P30L 2JB4A 2X0UA 1RB8G 4JDEB 5DF0A 2VZSA 1NUFA 4PR5B 5DK2A 4PJIB 1SLLA 1IBFA 1FAIH 3BVNA 4LHJB 2OSXA 2AGJL 15C8L 4MHHI 4QJFB 1O9ZA 4LLDB 1HNXB 3B7UX 3HIZA 4QX1A 1TQWA 3LH8A 4IIZA 4MD5B 5D2AA 1JGDB 4UQBA 3P5BA 5AVSB 5FJHA 3S3PA 1V6OA 3PHOA 3GB7C 4TQIA 5AAWC 3HKBB 4UBHA 2AJSH 2GB2A 4IMLB 1LHOA 4I4TB 4DSYA 4N7UA 5ANNA 3RWKX 2Z69A 1EHLL 3TJEL 3Q44A 4JKNA 1KIPA 1CXKA 1T5XB 2R1WB 2VIRB 1P4LB 4PS4H 4RGNC 1WUNT 5CHNB 4DAGH 3ESVF 3AP4A 3M8LA 4YZ2A 1TITA 1U8CB 2FEEI 2WCGA 1OF2A 1HV1A 5EO0A 3RWEA 4JGYA 4G28B 1YFYA 4FEMA 1YQVL 1KFAL 1KCRH 1A4KA 1JD7A 3MODH 4R4FL 5EBWB 3LTVA 5B39G 5TF1L 1KCUH 1C1LA 2EVGA 1A2YA 3BFRA 4GUQA 4WFEA 3OC5A 2PHDA 1AR61 4JZNB 5FBZA 3I6LD 4NHLA 3K3WA 1FIGH 1HRV1 2FQPA 4X5QA 3BRDA 5SWSD 1NCDL 1ZL8A 1TTAA 1WQVT 4PI0A 4XOAA 5IV2A 1KPVA 1QFWM 5JOXA 4PRDB 1NAML 2YEQA 4EI5D 1FL6B 4QTFA 4J12A 3VYNA 2UUCO 5CJQH 1WKYA 4I2OA 1JGVH 5E2JA 4HIIA 4O58L 4PJCA 3RWDB 3J27A 4FQQA 4JFTA 4M7KL 2X4NB 1DYPA 3T3MF 5HYJA 1K3IA 1ZUQA 4KMQA 1N4XH 5JPMA 3TBBA 4ZUWA 3VFGH 2YFOA 4D8MA 3GJEB 2WNWA 3BEVA 3U46A 3MV7A 2GJ6B 2PPFA 5DS8B 7FABL 4Y5TA 1K4CC 1MEC2 4LE4A 5E5LA 4AQYB 1CGSL 2X9WA 3CX2A 2F7QA 3N91A 5EDXA 2PTMA 1QMJA 2VN7A 4QQLA 2O61A 4KG0A 1F90L 1X9TA 5BYNA 4LL4A 3HE6D 3DUIA 4PGBA 2V4VA 2CDYA 1VKXA 5E70A 1EVTC 2Y26A 4BZ2H 4XJWA 3K8LA 4GD4A 5GHWL 4OIFA 3FUOA 3MLSH 2FMYA 4U3SB 3VVWA 2V2WA 3U82B 1JWMA 4NQUA 4F1ZA 5F72S 4MGSA 5D8AC 1NKDA 2RR11 4PQ9A 3RMYA 5D1ZA 4YG3A 3I97A 4QXWA 3B4SA 3OUSA 4GW5A 3ARGC 5IQOA 3PIQA 5JZGA 4WVVA 3W2DL 3H3PL 2MH4A 4J25A 1QLFB 2VTFA 3QIBD 3VH8G 3AREC 2A7BA 2VR6A 3O0WA 1LCLA 4CKQA 2DM3A 1U4FA 3JV4B 3WMSA 1PD3A 4AV5A 1BMFG 4RA0C 4WNQA 2ADYA 4HJ1A 2R69H 2R0LL 5E2VH 2WAOA 4PJAF 1MY7A 2HVKB 4NQSA 3T3PB 4O9GA 3POWA 4X9QA 3T65B 1F4WL 4OD1H 5CAYB 3SDAA 4JRXA 3AXLA 4FQXA 1OSZB 1AIFA 4D7PA 2CLZA 4JREB 4WU5A 1OQEA 3MLLA 4ZKTB 4P2QD 1P2CA 4OZ4A 4R0LA 5FYLD 4GZ9A 4UYBA 5C4WC 3OEEG 1KCSH 3QCTL 1TLKA 4JO2H 4O5LL 3WUZA 1OC1A 2ISDA 1AX1A 3B3IB 1CGPA 5AW0B 1P84K 2JJVA 1WD9A 2DQCH 2GCYB 3ZTNL 4AAPA 1AX0A 3I4IA 4DN3L 4HH9A 3WMQA 3DIFA 5GRUL 4FLXA 1UHVA 2BIPA 4Z7VF 3WQ7A 4JCKA 5T3ZH 5I8KH 3CCJV 3M1OA 5DAWA 3ABKB 2Z93A 4WW2F 5IT9N 3JWNG 3MDJA 1A4BA 1KELH 4KZ0A 4LVHC 3UZVA 5ITFA 3LA3A 4TLGA 2WZAA 4A2DA 1JR9A 5GALA 3BH9B 1L0QA 2OXGB 5J36A 3N3EA 4K7PX 5ESQB 1WW6A 4TQPA 2F8XC 2VXRA 2B1OA 1I1AA 3JXAA 4P3WA 5HVHB 3QE5A 2JKBA 2J44A 3STZC 1W80A 4DV1B 1MFCL 1WLWA 3FRUB 3R06B 1LEDA 3FB8A 3REVB 2X4PB 5BV6A 1DN0A 4EIUA 1W2UA 2PO6D 1IGMH 3DV4B 3QNYA 4SBVA 3E9TA 4UDTB 1D4M1 1S7RB 1EAPB 3APMA 4LHSA 1WCDJ 4FLHA 5EYXA 4M1GH 3VGHA 2G2RB 4M5SA 1QKZL 2AQ2A 4NUPA 3VI3B 4I4WB 4AIEA 3FHQA 1KXTB 4M93C 2YPLD 1JJ2U 5L2KB 1I8KA 4UFIA 1RVF1 1M9NA 2V7NB 5KJ4A 3S4SB 4WFEE 4M6OL 4PGDB 5BPPA 3U10A 1AQHA 5I18H 2JWPA 4HT1T 3F5WA 4XCFH 4ZS3A 4ZO7A 5FO7A 4L2NA 1DQIA 4TNWF 3BD3A 3P9LB 4RQQA 4XPHL 2KERA 4A7GF 3CCSV 2NY0C 2P4KA 1GGBL 4FQJL 3CFDA 3QUXC 5DMJB 1N19A 2XZQH 1QOOA 1BQPA 4PJCE 2JDZA 3ZYPA 2WBKA 1KEGL 1XOUA 1QLNA 4HV8B 2BC4A 3HPNA 5HYJE 4AI2A 1HOEA 3BVDB 1RPKA 5GLUA 4G6MH 1KTBA 4HUNB 5FWRA 4Z7UF 1J87A 4GAJL 4V2BA 3ULVF 1HCYA 3F85A 2HKOA 1N8ZA 2IGFH 2AERT 2X2JA 2P6JA 1BCIA 2AV7A 1J1OH 3MV7E 2R56H 3DV6B 5DFVD 4HGKC 1G8WA 4IE7A 4OCNC 1TR7A 4OGYL 1RFDH 4E4ZA 5J6HB 3V79C 3CDZA 1JF1A 4YM0A 1Z3GL 1NPUA 3HBGA 4HOWA 2ZE8A 5H9CA 1HILB 1QNZL 2R9HC 5DZAA 3UEQA 4CN4A 1K5MB 4MVSA 2WWWA 5E88A 3QJZA 4YZ4A 2K1EA 1WZLA 1NTZH 2UXVA 4LLQA 4PLKD 1WFUA 5D5MB 1O3QA 2N1TE 2IMMA 2BPBA 2TUNA 2CDFA 1UH4A 4F9PC 4GWNA 3B2UD 4DV0O 3GSVB 5DRWA 2CIKA 3AG4C 3FPYA 4BRJA 3HMYA 3MRIA 3D3VA 2W81C 2Z92B 4PP1D 4R9DA 2AQ1A 1W6NA 3E3QE 5K1NA 4AENA 2AJVL 1OLZA 3F7YA 3ZDZF 5L7XH 1W8HA 3TEZA 3BWZA 3WIHH 3L4UA 5KBMA 4NXKA 3ZDWA 3EDJA 3X3FL 2VERA 1MW3A 4IBYA 1O7VA 5JQGA 2ICCA 4ZOLA 1YEEL 3N1PC 4QRFA 4YAQA 3BISA 4IRZA 3LKOA 4LEOA 1ET8A 4PJ9D 2XNDG 1WEJH 4JRXE 4I50B 3VRLF 4M0HA 4G8FB 1P1ZB 2X4SB 4G6AD 4PWKA 4UQAA 1H2GA 1RJCA 1IAOB 3BUQA 1EEUA 3I75A 3OLDA 4QXUL 4JAAA 3VVVA 3SE9H 5C7ZA 3UP6A 5FR3A 4M3CA 4P9WA 2YR3A 3S5LA 2RJMA 5LZ6A 5H37A 4MS8C 5LQBH 3BAJA 5FYMA 4N53B 1CWPA 1JYNA 3F95A 2IAMC 2WXQA 3I02A 3MA9L 5TFSL 3RJ2X 3JATB 4QGTA 5BVPL 5DUUA 4K40A 1S0VA 3QRLA 3WYRA 1YYML 2W0LA 4ZSOB 3LEGA 5AD0A 4RR3A 2P42B 3LPFA 1DBAH 3PJSB 5HGDB 2R7EA 2HZHA 4MS2A 4E2LA 3AAZA 3QO1B 4R2GB 1FZMB 3QJRB 3T2PA 4F91B 3ZXAC 1OF3A 3DX7A 1NA1A 1FVEB 2GTZA 3KPRB 4HD9A 8FABA 1IPJA 3WS6C 1OKOA 1I9RH 5L88L 4MW3A 1NCCH 1WS7A 2Z8WC 5I75C 1H8TA 2V4AA 3BMWA 3BB6A 3GUFA 1SY6H 4PJ7F 4RAHA 5JDSB 2WZPA 2IGTA 4XMKH 5EBLB 2LS6A 1BZ9B 2N59A 1KBWA 2EEFA 3P0YH 1FAYA 1N3OA 1TKWB 2NR6A 4GI6A 3DXRB 1S7QB 4NTYA 3T2NL 1HNZB 2YUAA 3ME0B 5BOPA 4HIXH 3O7OA 5FCUL 4FPPA 1JZEA 3CAFA 1ZVHA 2FNWA 2OQ7A 1G6RL 1LO3H 4U1MA 2YMZA 1L0NH 2AXHA 3CBKB 1ZLVK 1YHQV 1EZLA 3SBWC 4YHIB 2XA3A 3D9AL 5FUZL 1Q8IA 2NY3D 3BA8A 1FV2A 1YPZA 4RDBA 2PTTB 4TQHA 1KBGL 3JVFC 3K72A 3MCKB 4PTTB 1BZ8A 1E9QB 1FL5B 1YJNV 2M1KA 5HYSG 2KSDA 3DSFL 4LDLB 2XV0A 1O6UA 2WRAA 4AM0A 2VLME 4Y2DC 4CMHC 3KT4A 2YD1A 1KGWA 4K9EL 4QHPA 2YRLA 3M86A 2JELL 3PJNA 5DEGB 3RVWC 2P90A 2HBUA 4YGEA 2C9RA 5AFBA 2QTOA 1X5AA 5G4NA 1AXSA 1CGUA 4WI0B 4PY8J 2VDQB 5DDHA 2Y64A 5K4LA 1SQXH 4NO2B 1F1GA 2ADFH 4YXKL 1G1OA 2Y0SA 1VCAA 3D52A 1S9VB 4F15B 1JF6A 1R1A1 1AR1B 3BKCL 3SDXB 4IETA 1S0GA 3VKMA 4XR8C 3O0VA 1KB9J 3FULA 3ZSJA 2YUXA 3LEVH 2FJSA 4RAVA 1XZ0A 4CXXA 2A6IB 4KTDH 2QWNB 1JNLH 2NQ3A 4YR6A 4XZPA 1T4WA 2SBAA 1GWMA 1JFQH 4LP4A 3PNWA 3VFWA 3EZJB 4K23L 1VAMA 1MFDL 1AYRA 3T4AC 1LEIB 1E5UI 1L7IL 2P52A 4K0KB 4OLYL 4WJKB 1H4HA 2ICEB 5FV3A 1RZGB 4XAWH 4J6RL 4QKFA 4U1NB 3DPDA 4Y4YA 4PVNA 2YD3A 4ACPA 2CIIB 4D8OA 1ULGA 2QGEA 4ZXEA 1LEGA 1F5JA 5FDWB 4F57H 5IOPB 3K6SB 1W05A 2YAEA 1GAXA 1RI8A 1YTFB 2DBLL 3D3VE 2M26A 1JVOA 4L9LB 4DUWA 3GIZL 1VRBA 2DM2A 3MX0A 4UIMB 4QRTB 4O00A 5FHAL 4HCRL 2XZCL 3DKHA 5GJSL 4BJLA 1SEBA 2NNRA 2DQEL 2VDQH 3E35A 1I9JH 2EQDA 3A67H 4K3HA 4ZTOH 4I1NB 1FN4A 3E6HB 3QORA 4BWUA 4Z3JA 4H37A 5C0CD 1HRV3 5FOBA 2OMWA 3T1FA 1E79G 4A63A 2G9KA 5GGVY 5I30H 5HDQH 5C0DB 1H6XA 2AAAA 1RZ8B 4IGBB 3C6SA 4DR2O 2EX3A 5E1IA 3EJQA 4LQFH 2AXJA 1ND3C 3H0OA 1F8TL 4XUOA 2OQJB 3QUMB 3CD6V 3BDXA 1RHI2 4M3CE 2G0KA 3GCXA 2XT1B 4N43C 4UM8B 3HCVB 2NXZC 5EEWA 5AFAA 4O61A 1QXJA 4ASLA 4DKEL 4UNUA 1YJKA 2M7WA 1YEGL 2O5YL 2HLFD 5IM7B 3TVMB 3FQXA 4D9RE 1G9MH 4XP9L 3SPVB 2R8SL 5FZOB 1E4HA 2B4CL 4QLRA 5FHBH 2P3IA 1CFVL 4RMQA 2GTQA 4IGOA 4OUMA 5JI7A 2YDEA 4G8IB 2EINB 3GNEA 5GTIZ 5DWPA 1YIFA 5C0AB 3CJHB 2W60A 4RX4D 1OKEA 1Y3TA 4HCIA 5IROD 4MMXC 1TLMA 1ZA3A 3PL6C 1D9KC 5GS2D 4KK6D 5DJCA 3U4SA 2R39A 4N23A 3A6BL 3PU3A 3CCRV 2IDQA 2ZNXA 2I9LB 3RVTD 2ZX7A 2RR13 2L8AA 5AW1B 3H01A 2VUCA 4C1WA 3Q48A 4LF7O 1VQ9V 3D8MA 4FXKB 2FL5B 2QM8A 1FI8C 2O8OA 2C9QA 5E8OA 4F7MA 4XBEL 3AP7A 4YHML 3VD5A 3UJIL 1X9QA 4HPYH 4ZOCA 4XB3A 5G4MA 4JBSA 2BYVE 3EJKA 3K51A 4CEWC 1B0IA 2FECL 1CE6A 1RJ7A 4L8SA 1MVUA 3UO3A 3VWKC 1IQDC 2NN8A 4QQHA 2CDPA 5BV7L 4CDWA 2EXYD 3UADA 4FNLH 3D0JA 4QWWC 2FUQA 4AE2A 5FREA 4HYOA 1GV9A 3MRBB 3QRGH 4HD5A 4E4SA 3KWTA 1VMHA 1ETB1 4E5XG 3WU1A 4JGZB 4QHUA 4YXHL 2Z6FA 3OKNA 1FMD1 4X6CB 1HCZA 4PMFA 4JGYB 2WO1A 2IXCA 2JENA 2WXJA 3RYMA 3R4UA 3FAVB 5FGBC 1EP0A 3EMRA 1BMV2 1CYGA 2V1DA 2JIGA 1JUHA 1UYXA 3PGFL 4WJ5B 5D7SH 4FI8A 3VFSA 1J3RA 3RKDD 2HWE3 3R4RA 3AS2A 1AP5A 4FMVA 3OKMA 4PD4F 4LFCB 5FGCB 1TZOA 4U1GC 2Q6AA 3ROLA 4FAGA 2OYLA 4N86A 3BCDA 1INQA 3O4LD 1M7IB 4R4BA 1E4KC 1GU3A 5JVVA 5JA9A 4BQ6A 4HIEB 1P7QD 1W2KT 2A73B 4RGOH 3LFMA 5FNVA 4R5XA 3POFA 1MRDH 5LP6C 2DIBA 1KGUA 1QASA 3BT2L 4HFWA 4YFLF 4NXSA 3GQFA 4PRBB 3RL1B 1VQ8V 1ENSA 3HKDA 5HDBF 4F27A 1OTUC 1V27A 2G0LA 2NZIA 5E2WL 3NMBA 1YFWA 3WT3A 4O4LB 3R0MA 1ULOA 3D4GA 4P4KD 4WVMA 5FO8B 2EADA 2J1YA 4JZ2A 3FT2A 2EDQA 3M99B 2W9EL 2Q7YA 2V5SA 1FL3A 3HNBM 2Q76B 4YWGL 2PXYB 1RZJH 3DX4A 3NPSB 5C2BH 1D4M3 3VU2A 4DZ8B 4G83A 2ZCWA 4OQTH 3KHBA 4WJG3 3MF9A 5H5NA 3CC1A 2C7FA 4AEIL 1DDTA 4GQQA 2EC9T 4BZ4A 5E95B 5EV7A 3LQAL 5DZJA 2XKNA 4HUUA 4G59C 4NKIH 3MNDA 1BXHA 4ZFOB 3C75A 3SGDH 4S2GA 3LSUA 1P4IH 2DTSA 2IDCA 2NLJB 1I7ZB 3BH4A 3INOA 3P0VH 3P30H 5F9JA 4GFXA 5EOTA 4A7UA 4Q1PA 5LY2A 3VD4A 5CGYC 1NAMB 4U1IA 3X12A 3ZKXC 1HEZA 4YFDB 3RVUD 4UNVA 4CJ1A 2QQKA 4GQ7A 5ESAA 4C56D 1TQSA 4LRNL 1G43A 2AGJH 2WNUA 3ARRA 2Z8VC 15C8H 3PWUB 2X29A 2GNBA 3OTTA 2J21A 5C09D 3CE2A 5CEZD 5DDJ2 1XUQA 4FS0A 1QLEC 1KJMA 1QR4A 4MJJA 1IVTA 2JDIG 5FECA 4AT6A 1ZZCA 1C28A 3KLSA 1BE3H 1ZKAA 3MVSA 2X6MA 5AVYB 1QR9A 4IRZL 4JCLA 2CA4A 1AGCA 4O02A 3SDDC 4MMZB 1E65A 1KS4A 1ZA4A 1EHLH 3TJEH 5IW1A 2ZPXA 1ITCA 1TNRA 2BLFA 5DZFA 3ECBB 5FYJE 4FXGA 1EGJL 2G2NA 1IDSA 1PV0A 1TEFA