1YEWA

Crystal structure of particulate methane monooxygenase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
382
structure length
382
Chain Sequence
HGEKSQAAFMRMRTIHWYDLSWSKEKVKINETVEIKGKFHVFEGWPETVDEPDVAFLNVGMPGPVFIRKESYIGGQLVPRSVRLEIGKTYDFRVVLKARRPGDWHVHTMMNVQGGGPIIGPGKWITVEGSMSEFRNPVTTLTGQTVDLENYNEGNTYFWHAFWFAIGVAWIGYWSRRPIFIPRLLMVDAGRADELVSATDRKVAMGFLAATILIVVMAMSSANSKYPITIPLQAGTMRGMKPLELPAPTVSVKVEDATYRVPGRAMRMKLTITNHGNSPIRLGEFYTASVRFLDSDVYKDTTGYPEDLLAEDGLSVSDNSPLAPGETRTVDVTASDAAWEVYRLSDIIYDPDSRFAGLLFFFDATGNRQVVQIDAPLIPSFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a membrane-bound metalloenzyme that catalyses the biological oxidation of methane.
pubmed doi rcsb
source organism Methylococcus capsulatus
molecule tags Oxidoreductase, membrane protein
molecule keywords particulate methane monooxygenase, B subunit
total genus 95
structure length 382
sequence length 382
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2004-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04744 Monooxygenase_B Monooxygenase subunit B protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1yewA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 1yewA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 1yewA01
4O65A 3RFRA 1YEWA 4PI2A 3RGBA 4PHZA 3CHXA 4PI0A
chains in the Genus database with same CATH superfamily
4X6FA 4F9LA 1VGEH 1ZTXE 4RGGA 4Z3GA 3MV11 1WUNT 3LDBC 3SCHA 1BFSA 4RGND 1W72H 2H9GA 3OUSA 5D1ZA 2OQ7A 3KF3A 4YZ5A 4KKZA 3LNDA 5JXHA 1WFUA 1THCA 4G8GD 4K3AA 4PA3A 3ET9F 2BFVH 4MB5A 2JKLA 4WFEE 5KVGL 3ZN0A 2J12B 2QQKL 4YM1A 1AUYA 2NYZA 1ACZA 1UMZA 1RUH2 2ZM6B 1FJ1A 1B4TA 1TJHL 4PJAE 2MKWA 2PHLA 3JASA 5EPMA 4HULB 2WDBA 4HJ0C 2PCFA 5G55A 4V1DD 4RWYH 1W9FA 4PVBA 5FPIA 2CYFA 4P04A 2RNBA 5FCUH 1PZBA 2ZNJA 4LBEC 5I1CL 3VH8B 5A33A 3RYPA 4I1NB 1OHHG 1MHEA 5GJSH 4B9JA 3ZIXA 3V0DA 1IHMA 1M57B 2GSGB 3PDGA 4JB9H 1U6AH 4MAYD 4M03A 1KIPB 4O51A 2QHLA 1INDL 3AXHA 1MHHA 3ELAT 4RS5A 5FCSH 4P59H 1GNZA 2CJSA 3JBG2 3ABKC 1Y07A 2BNUB 4LE3A 4UWDA 1X7TA 4LOEA 1K85A 1PAZA 1KENH 2DW4A 3CCJV 3HB3C 1JX9A 1SN2A 3EFOA 3LN9A 4NZJA 3T2QA 5C7GA 3CC4V 5E6IB 4U33A 4M93B 4BKSC 2W68A 2O8QA 5FKCA 3BVWA 3ZBMA 3L48A 1B0IA 5ACZB 1G6RA 1YEWA 4JY4A 5DC4B 3EYOA 4GWJA 4S2GA 1CPYA 1SFDA 3SBPA 3W2DL 4ZSOB 2DWEC 1ODAA 4PA6A 5B7EA 1DIWA 4JZOA 3BP4B 4FA7B 3ZRXA 4XN8A 3P9LB 1Y43B 1DBKH 3BPCB 1Y9QA 4PRHE 2YBKA 4PJEB 3H9HA 4U3SA 2NY6D 1PVC2 2UYBA 5K9QI 5I1AA 5FYKU 3DURB 5DK2A 3VFSB 5GLTA 1FA4A 4LAQH 5FW6A 5KVDL 4OZFG 1XF3B 3G6EV 1U5YA 4HU8A 1G0YR 2B14A 3FUHA 5FZ3A 4Y1AD 2HN7B 4M7KL 5CJXA 3K5SA 1CN4A 3DI3B 1R1A3 2GMEA 4YQXH 2JB5H 4L5FH 2V5RA 2R69L 5CS7A 3RTQB 5DD5L 4B50A 5FTTC 2HWZH 2AC1A 3CC7V 3BWAA 4LHQB 2F1MA 4PJXE 3TF7C 4OJEH 5GJSL 4M56A 1UM4H 3ARBC 3KPSA 3P3RA 4Y4KB 5GTHZ 4IESA 5A16B 3W0WA 2HJFB 5FCUL 1D6EA 4JPSA 3FTYA 3HPJA 2YXYA 4XMKH 1B35A 4WZCA 4X9GA 7FABH 1WBLA 5JW4M 4Z76B 5SWSA 3CXHK 3U46B 3KPRD 3RI9A 4JI8B 4XPFH 3FUMA 4HKJA 3KXFB 2QZ5A 1FYHB 3MACH 1EVUA 2E9WA 3H2WA 1PO23 5FZGA 3IMVA 7PAZA 4JI7O 2BC4B 1S0FA 4G1MB 3S5LB 2QSQA 2MRYA 3IFXA 2NNFA 4WV1C 3MIEA 1INEH 2R0HA 4AG4L 5H9RA 2H1LM 1S7TA 4G59C 1TXKA 2YAPA 1YVLA 4L9LC 3VX0A 1MKFA 5D7JB 1OZUA 2XKUA 3WGVB 3CIQA 3L5IA 1PVXA 2WT0A 3R66A 3MBEB 5DUBA 1VCAA 4Z7OE 4XP6H 4P9YA 3MV01 2VLKA 2BMKA 1SGKA 4PLOB 1X59A 2AQPA 2F1AA 1SS3A 1YIJV 4AT6B 5I66A 4G6KL 5B39G 3V6ZA 5FMOS 3ZE2E 3RURA 1A9BA 3P0VL 3PP4H 2AXWA 2GMMA 1FVCA 2HWF2 4Q4W3 2DF7A 1SZXA 1E28A 3RNKB 1V3LA 4P9WA 1JTPA 1OGAE 4IYKA 2JKSA 4JDVB 1MPXA 4GMSH 1ASJ3 3A4EA 4IKJA 4WUUE 2XT1B 3BSZL 4ZW7A 3FO1B 1RUG3 1BSMA 3FT4B 2OM5A 2HFFB 1MAJA 3W7XA 3GMRA 4KZDH 4IK7A 1ENRA 4H55A 5E2VL 1H6EA 4OCXH 2F15A 4JDTL 4NHUA 2OQJA 3S3PA 5FM5O 2XAQA 3TXQA 3VXQB 5J11B 4LH6A 4UT9H 3LNIA 2Z5WA 2RN9A 5IEKB 1CZ8H 3FN0L 3A47A 2C4XA 4AUYA 4OQ9A 4EI0A 1FT9A 1TO4A 2NLJA 1XMOB 1PKXA 3B77A 4PELA 4PJBB 4JI2B 1S0VA 3G6JA 5LGHH 4P5MB 3WSQL 2O0OA 4RBPH 1XBFA 4O58H 1ITBB 3ES6A 1MJJB 2CBMA 4HU2A 4P9XA 4N2NA 4PJDB 5FOJB 4FLTA 1UD8A 1PZCA 5J3UA 2PCXA 3ISRA 1R1A2 2Q1MA 5FYKD 1T7WA 1YQVH 3TT1L 1YJDL 3HE7B 4FQJH 5HV4A 5FHAL 2UZYA 3AADB 3PAUA 1LXMA 3MFAA 4XH2B 4FOWA 4AEJA 3FUFA 4YDKH 4OFGA 3FX7A 3ARRA 1JCHA 5FDWA 3C3SA 4XAWL 2EF6A 5HHMD 3BAAA 2ICES 2XN9E 3JWNC 4AVKA 3I59B 2WGNB 1BQHB 5INDA 1OARH 3WF4A 2Z7WA 1Q9OB 1UUNA 3JVFC 4WTZG 2X0UA 5FP7A 3M07A 3GINA 4S2SB 3L9RB 3VSUA 3GHEH 3GZKA 2WIIB 2ZOLB 4ZUVA 4I85A 3ARUA 3UBHA 3QO0B 4I0PC 2P6CA 1MJ7H 2VTFA 4Z7NE 3GHBH 2I85A 4J8QA 1R3KA 5B1BB 1TETL 1RIHL 3SYCA 1UCBH 2YHGA 3J7HA 3P40A 2ZHLA 3APBA 3KYKH 4NO2B 1DJZA 4HIHB 3MNZA 5DRXA 1X9QA 4XN7A 3RJOA 2R8SH 3MQIA 1RK0A 4DR5O 4M1DL 2KG7A 3ATEA 4RGNB 5FOJA 2R0LL 3BFWA 2X70A 4YZ3A 2CKBL 2BVTA 3PVEA 3TGXA 5AD0A 1KYOF 2B4CH 3CZJA 4PJ9A 5H35A 2E7QA 4MHUA 4PIXA 5FZIA 3QCVL 1JWUA 4DRVA 4V2CB 1UWFA 1W0VA 1I53A 4TV3A 3UYRL 3W0WE 3BCDA 3GMMB 4R4FH 4YHIB 1ZK5A 2XJSA 4JHBA 3NGBB 3IJ4A 1WMEA 1JS9A 2CQVA 2JNZA 1OE3A 3D3VA 1WK0A 3CFDA 4ZX3A 4MA3A 3O8XB 4WW1B 4XP5L 1UYPA 3J9SA 1JOPA 4S1RL 3KVBA 2NRDA 1BQLH 2A74C 3WDVA 1IS4A 4HK3N 3BESR 5ELIA 3VDDC 1PVC1 4H0GA 3NFNB 3C8KA 4S2FA 4QHOA 3TB0A 1K4CB 1IURA 1CVSC 2G9ZA 2JEMA 5IT6A 4X66O 3I6GA 1ORQC 3H6AA 3DMMB 5IVBA 5ERWB 2AEOA 5E8OA 4X7FC 4IRSC 4JYBA 3TJEH 3VQ1C 5GM0A 3MUHL 3POCA 1L9SA 3LPPA 3RWFA 4AGPA 5C2UB 1WPXA 3HUJB 4TYSA 3RYCB 1BVLB 5FS5A 1G43A 1E27B 1M42A 3LKOA 3GDCA 3L2NA 3LVEA 5DQJB 1L0YA 4U1KA 2CH7B 4X65O 4QTHA 5DN2A 3OKEB 1SJMA 3FBKA 4S11A 1RUOA 4W65A 1KIRA 1KPRA 3ZM8A 4MRCA 1DDLA 3INAA 3RU8L 3MICA 5IBLD 4LP5A 3AREC 4FVVA 4NC1C 4Q4X1 4EN7B 4JGYA 3D8MA 1Q1JH 3F2ZA 2XWTB 3PJSK 2IANA 5EZIH 5EF0A 1W3XA 4EQ3A 4DK6A 32C2B 1QXJA 5DPNA 1HU8A 1XNRO 2GW5A 2R1DA 2G2RB 5DLMH 2DQGL 3KL0A 1GZTA 4X8JB 2V09A 5JIPA 2HKXA 4JFQA 3GBFA 1HTYA 5DN6G 1J5IA 5BRZB 4HVRA 4A41A 5BZBA 3HJ0A 1VBA1 1NVPD 4KMLB 2ATKB 2YEQA 1SOKA 4J11A 2BK8A 4GIPD 1GM9A 5DUWA 4V2BA 4XBGA 3HG1D 4PRNB 3HZMB 4XOAA 1IC4H 3BT0A 1YLBB 4FG0A 3MV7D 2CLRA 3HE7A 2D03H 5LMNB 2YD2A 4QWWD 4CDQC 3VI4E 3JUYA 4HWEL 2ICCA 1ZTEA 2JS3A 2CIKB 4WTZA 4X99A 3JWNE 2GJ6E 2X4QA 1A21A 2IBGA 2XZCH 4AVJA 3DURA 3L7FB 2VISB 1N4CA 1XBDA 3HHSB 2VDLB 4NT6A 3FSVA 3L9DA 2QVMA 1NAMB 2X2HA 3MRGA 4PJ8B 2Y26A 3PVNA 1TYRA 2ZUQC 4NWUL 3JAMN 5GRWA 4NTWA 4WK2B 1LOFC 1A6UH 1XQ8A 3RVTC 1IAOB 3CSXA 2XQXA 5CHNB 1O6VA 1AXTH 1EBOA 1C5DA 1DFQA 3QUZA 1RCYA 3IDYC 1KBWA 4JHUA 1J5EB 5C07E 3UAJA 3V4UL 2E75C 3B5HA 5CWSB 1H8TB 4Q8KA 2FX9H 3L08A 1M05B 1JDDA 1AR83 1T1XA 1SLUA 3T0EC 2JRIA 1MCPH 1GJWA 3HNVL 3I75A 1R24A 5DT1L 5B1JA 1OOPC 2WT1A 3LNNA 2EXYD 4JRYE 5FYJL 3W1ZA 1JGLH 5I1GL 2ZNWA 4LNUB 3V0IA 4YGBA 2AF2A 5D8AB 4EE2A 1XH0A 1MF2H 2IZWA 3GYDA 3LPWA 5AOMA 4WIQA 5E70A 5JLZB 4FM1A 4PJCF 3H3UA 5F9AC 4Q4X2 1I4FB 3E22A 3GRGA 2OI9B 5K39B 5JQIB 1QJY3 1EA9C 1SPPB 1UN1A 3GB7C 3W5MA 2IBZX 4XP4H 3O1TA 3MNWB 2DUOA 5AG9A 4NVPA 1OK0A 1XHXA 3WY1A 2BS9A 2F43G 2YD4A 1HDJA 3CIAA 4N2KA 4P0DA 2AR6A 4YE4H 1NCBL 2PHFA 1A3LH 1FNAA 1X8MA 2A6KB 2N01B 4FOYA 5GZOA 4DEQA 4IIZA 4XCBA 1YHPA 5DECA 3U4XA 1UY2A 4LIQH 2FBRA 4QTIL 2X4NB 3SEPA 1IC4L 2A5UA 3V64A 4MA3B 4NLAA 1WGPA 3NOIA 4F8AA 1NWPA 3T5WA 3CFDB 3BPNC 2EE9A 2R69A 1MY7A 3BUYB 3C5JA 3Q1EA 4L8DB 3LOWA 4LVNB 2RQEA 4YBLC 2J88L 3MRMA 5CJBA 4YNYA 3RWJA 3DXAB 3O81A 4JDZB 5GJ6A 1ZXQA 1NBYB 1TTAA 4FI7A 1P6FA 5A16A 3CVBA 3EGDA 5L9RA 2JH2A 2VTXJ 2GHWB 2WWUA 1R5IA 2DD8H 3VBHC 2C9QA 3O3EA 5HGDA 4HUKB 1YHFA 2HVJA 5I6MA 1GWMA 5JHLH 1BT8A 1RAMA 1QJX3 4PDRA 4UM9B 3OYWB 2W95A 4YDJA 4QWNA 5JJNB 3MBXH 3V0JA 5IROD 4OI4A 4ARXA 1NAMH 4DXWA 1H8EG 1XT5A 2XZAH 4G5ZL 4XJAA 3FFQA 3H1HH 4R96A 3SBWA 1I7RB 3S30A 1G1OA 1QSFB 3UJJL 2WO4A 4YHYB 1EEYA 4UCVA 4XHJD 4LLDB 2ZEYA 8FABA 4L05A 4KK5D 3FLPA 2VRZA 5DJ8B 2WO7A 4TOYH 4HONA 3M8OH 4Q4W1 2F1BA 5IB1B 4TXVB 3GTTA 4R7DA 5E8PA 2YJQA 1DGLA 4AXWB 2FIKB 2ZNXA 1J0HA 3PIQA 5DCCA 4AEFA 1FNGB 1SC5B 5JR2A 3O1UA 2R1YA 3B00A 5FKBA 3EYSH 1HK6A 1QATA 3HRZA 3FCUB 4B9KC 1UCXA 4FE9A 3FS9A 3G6DH 2BXYA 2H6CA 2BOJA 1VBB2 3CMOH 5KVDE 1JQ0A 4LTAA 3LRLA 4ASMB 4IHJA 4WI0A 1SZBA 1I08A 1H38A 5HHVH 1HHGA 4LT7A 4U05A 3CH8A 5C0DB 1D4M1 4OKVB 4JV5O 1YY8B 3BI9X 1PLCA 3DA0A 4NRYB 3S97C 1L0NH 3BKMH 4UF7C 4PIZA 5EEWA 2J6EL 1WCUA 1DHKB 4FJYA 4CCDA 3UJIH 1WB8A 2QE3A 1OCZB 3M17B 3QJRB 5ACMA 3RL2A 4PJGB 3FHIB 3RMYA 4I13B 2Z9TA 4HALA 1QKQA 4HPKA 4OFIA 5BNNC 3RWCA 4OGAD 4LFHD 1Z32X 2VDOH 1AGCB 3FHEA 5DRZB 3S2AA 5JA9A 1EEYB 1XTLA 5GGSY 1F0LA 2AJXL 1G8WA 4NE9A 4FQCH 2SEBB 5HCBA 1NGYB 3AAZB 3LZLA 3M3CA 4E42A 4Q1RA 4PJHE 1LL1A 1N6VA 1OD9A 3THTA 2CGYA 1ZWIC 1B9KA 2FK9A 1U5ZA 1L0QA 2VRKA 1X8EA 5DUBB 2XBZA 5J9PC 2NUPA 3JCUZ 3JD4A 4WI5A 4FTSA 1Q9KB 3BWSA 4OBRA 4YIQB 4M6OH 1H0BA 3I74A 4LXLA 4I0KA 4YL4A 5FFOA 1Z3RA 3KGRA 2XX1A 4NPLA 1MW2A 1PD0A 4MQ7A 2F7IA 3T2NH 2DM4A 3EXJA 3FFDB 1OT5A 5JZGA 2D7QA 1UD3A 4RDQG 2JJ1G 2VNOA 2GKIA 3K8KA 5BUVA 3VI3B 1WCBA 1I94O 1BPVA 1W59A 1Z9SA 4OD3H 5E88A 3UIYA 1YNTF 4P06A 1O4TA 5L3GA 2BVBA 5FO7B 3VVVA 4LHUG 4X7SL 3BEVB 1B3JA 4LGSB 4OFYA 4YJ3B 4HLZH 3L3GB 2FJSA 4JFOB 1B35B 5A3WA 4NC0B 3COOA 3P0YL 1Z0HA 4MFHA 2OKMA 2QQLA 3P4MA 2OXHB 3RZCD 5DJCA 2ZOUA 1ZGLM 3STLC 4UW3A 4M6AA 4AI9A 3IF1A 2ITDA 4HEME 3ZL2A 1XAUA 2QT6A 5JWPA 4IW4C 2CBQA 5T1LB 1T21A 2AK4D 5LK5A 1QJU3 1DQ2A 3E22B 4DV2B 3HNSL 2ZWYA 4MX7A 5TGBA 3WNMA 5K9JL 1E4KA 5LBFA 3RZMA 4MJ2A 4DMIA 2XLLA 4L3CA 1GGCL 4R7NB 3RJQB 4FTVE 1G9FA 5LHGA 5JXGA 3UV9A 1IAIH 4JZRA 4GFTB 1DZ0A 1KBVA 1NWOA 4Q9RH 1A02N 2XGXA 3IYLW 1ZLWK 3I9IA 3TM6A 5C9AB 2BJMH 2C1PA 4KZCA 3IMWA 2M2DA 3V5DA 2HJKB 5I1DA 4FQXC 5F88B 3PMSA 1ZD6A 1FNHA 4PAZA 5LCVL 4Y9EA 2IUWA 4PGCA 4ESKA 1NEZA 4YW2A 1RD6A 3P02A 3MROB 1T3FB 4HLJA 3VZNA 1LOAA 3JAWB 2ZKOA 3LNGA 3O2DA 5EORL 5GS3A 5BV7C 5IMOB 3S36L 3LAGA 2NR6A 1NAMA 2D7TL 1WUVA 5CILH 5GGTH 1HKLH 1ZBE3 5FF6B 5DI8B 3HN1A 2WAMA 3X3GH 1V54C 3U9UA 1G7HA 1KELL 5HHOA 3E6DA 4IV1A 3RZHA 1LEKB 1D2PA 5EULV 4ZMTA 3TZVA 3ZE1B 1RUD2 3ACIA 1BBDL 2WJSA 1WFMA 2PO6A 3Q2WA 5EZYB 4ENED 3C2AH 4F7ZA 2PF4E 3KT7A 5EU6D 2VN6A 5SV8A 2NLJC 5F7DA 2K6YA 4QOKB 1MZFA 3LXAA 1YUDA 3CEIA 3D3VD 5CSBA 4OVEA 4GUQA 1TQBB 3ZFFC 4NIGA 3OX8A 4JG1L 4XTRD 1MFBH 2EDYA 2IPTL 4XXWA 2J1SA 1I8KB 3I02B 2ENJA 2DQUL 2RM23 4RUFA 2DQMA 1L7QA 5CEXA 4IDZA 4XFGA 1WISA 1XNRB 4L1SA 1J1XH 1GRWA 3QEQD 4PIBA 2OL3A 5DO8A 1WD4A 3PUHA 2EYSB 4ZUWA 1LMKA 1Y6NR 1P5VB 2QR0B 3MREB 4X7EC 1W0JG 1MSPA 2DBLH 1SQVH 3BQUB 1CAWA 3S48A 1VRSA 4Y9BA 1T1WB 2FIRT 2PYEA 3LIUA 5TDOA 4X5XA 1XNQB 1EERB 4YHLH 3CWBH 1IEBB 1PX8A 4OCRL 1JYVA 1QNYA 4JFFA 1AXKA 2HKFH 5I0VA 2CCVA 2Q8BL 1UY3A 3UC0L 1NMAL 3OXSA 4L3EE 1LO5B 4QXUL 4PSRA 2HWE1 4L4TD 4AVAA 2LFSA 1BM3L 2VLMD 2F7QA 3JD3A 4I2XA 5CZKA 5AOJA 3S5LG 3T0BA 1BG9A 3V5KB 1CL7H 3VBBA 1HNYA 1VFUA 2VDNB 1K45A 2XTJD 2ARBA 1OQXA 2BVOB 2BOLA 1M06G 3L3IA 4U0RB 2P37A 5D71H 3CSPA 3WT3A 1L8DA 2LU4A 4JFWA 4YHMH 2E6VA 2B1AL 3FQXA 1POV1 3AP9A 1OSZA 4J6RH 4TQFA 3J26N 2Y0OA 1BFOA 2VLLB 5EN2A 4G28B 3U11A 1VPOL 2QQNL 5EBGA 4L23A 3HS8A 5EBWB 1U8JB 4APXB 5HYJA 4TSBL 3PHOB 3LGRA 1HZHH 1K2DA 5I91A 1INDH 3OGGA 2EDBA 1HILB 1W2BU 2IH1A 3WEOA 4NIAA 4NJ9H 1OMIA 2YIBA 1QW9A 3U4KA 3ZEDA 5JMOC 2OFQA 2W1WA 2PKDA 2RMNA 4F5CA 2ERJC 4ZMYA 3WO4B 1O5LA 1AD0B 2V5YA 4WGWB 1Q8SA 3VDDA 5D70L 2GIXA 3WD5L 3OC5A 5IVZA 5D1IA 1TZ8A 4ODUA 1SXZA 4YSOA 2R2CA 3UTTB 4AK2A 5D5PA 4JHWL 1OGAA 1M4KA 1KSRA 1T22B 3DHPA 2AQ3A 3LKQA 3HZVA 3CJJA 1RP3B 3J8F7 2QQKH 4ETYA 3U07A 3MI6A 1B6DA 2FCTA 1H9DA 1NZRA 4URAA 4LLFA 2I24N 5GQBA 1FYTB 1CI5A 1JNNL 2ZR3A 1E42A 1P7BA 1MRFH 1SXNA 2TSAA 3ISYA 5H94B 4CP0A 2ODMA 4A7VA 2XTJC 4GZRB 2Z65C 4ASKA 3MCKA 4X6BA 3VN4A 2TAAA 1D9KC 4G8EB 3ZDYB 3THML 1A7BA 2A5ZA 1Y6XA 1NGPL 5FL7G 1ZV9A 1MCCA 1RZ8B 1S9YB 5L3CA 1L7RA 1CX1A 2AABH 2APVA 1JMUB 3GI9H 5EOCJ 1ZVNA 1QW8A 3B8SA 5GS0C 2RGSA 4JPWL 1AR81 3JV5A 3H9VA 2YR3A 3PWLB 3G6AB 5C9JA 3SLIA 1IJ9A 4JAMA 2B1HL 2BCCH 3T0XA 2OUJA 1I7UA 1TF4A 3MXWL 2JEXA 5L4IA 3TEYA 3L3OA 3ERXA 3L95B 3QPXL 4M48H 5IBUG 1HEZA 3STLA 1JH5A 3QO8A 4HGWA 2GAZA 2FMDA 5A3OA 1NGZA 1WZMA 1ID5I 3CC1A 4O00A 5I1IL 2GMPA 3P32A 2QVFB 2YEZA 4L3EB 1GWKA 1W8WA 3DROA 4H13B 3OB0H 1NCRA 1FRGL 2D3NA 2WXJA 3AG1B 3NEXA 5IEKA 3USUB 4WM7C 5CR1A 4F20A 3GXMA 3N0AA 4IV3A 1OQ1A 2JLPA 1JXFA 2IQ9L 3HBPA 4HZAA 4GMP0 3CFKA 3CXFA 2WZPA 2CGRH 4OSUH 3VI4B 4F3FB 2G5BB 2XQYG 1JVMA 1SHXA 5F7LB 2AKRA 4K3DH 1BIIA 3TBBA 1OZTG 2WWKT 1FAIL 3IDNB 4WO4B 5CXPA 5TDPB 4ABVA 5DDJ2 4IRJC 4DZGA 3HG4A 2WR9A 4U7SA 3BVOA 2A9AA 1YMMB 5EDXA 3SDDA 5JI9A 4FTBA 4COUA 4HNAB 3NA9H 4ZDHA 3MBEA 4TUOA 2WVSA 3RVUD 4MS8D 2Y4SA 3FO2A 3BH9B 2IGTA 4KRPD 4ZOEA 3UO8B 2C4FU 4RZCB 3RP1A 2CUHA 4PWKA 4J1WA 4GB33 3ZIAG 1PJ9A 1OAKL 3BVTA 5JQ6L 3H3PL 4IU3A 5FA3B 1CLZH 2BC4A 4GLRH 3D4CA 1P49A 3D0SA 3WY6A 1MCEA 5BRQA 5A7SA 2HP8A 2ZNIA 3QEQA 2JELH 4P4RB 1YYNA 3SPJA 2O61A 3P54A 3IXTA 4MXVE 1CYWA 1W05A 2DYCA 4IE5A 5IHZB 5FAXA 1HNZO 2JK5B 3HNTL 4LBNA 4UCFA 4FMKA 3NIGB 4Q6IB 3F3HA 3R4UA 4I09A 1WJ3A 1N1VA 3VFGL 3P3PA 4FCAA 1NBQA 4FM2A 1RUKL 4Y4KA 3AJYA 4O9EA 1YSCA 4D8MA 3KPMA 5CEYA 4MNQE 2F8VA 4PJ9B 5H35B 4Y2DA 4MHHI 1PKQB 1F97A 1QBBA 4KXDA 3VD2A 4ARYA 3KEDA 4QLRA 3VG0H 1A14H 5GGRA 5CEZH 2Z0BA 4C56D 4RGKA 1AYN1 1TFPA 1RUI1 2JXMB 2R2EA 5A7BA 5ADOL 3Q4HB 1CLCA 3QCUL 5KOVC 4AWJC 2UX7A 4Y20B 3JALB 3IK2A 4X6CF 3RBSA 3CLFH 4DW1A 4CRPA 3WHUA 2CK0H 2LO1A 2QDWA 2VUJA 3PUCA 1UKRA 3V6FB 1TZGL 2X4PB 5CLXA 2BZ7A 2V2WB 1FV2A 4AYMC 3A4UA 4Y2NA 4YDNA 1IGIH 1K5NA 3FQUA 1FMD1 4TN7A 2HVJC 1YDXA 5SWZD 1EN6A 1MSWD 2EXSA 4RAUA 2WJ7A 5JHDE 2VG9A 1ND0A 2AZ0A 1A6TB 2ZGQA 4NM4H 5LQBL 3I59A 2D31A 2NY1D 3VXRD 4XN1A 2VR6A 2IVIB 5C0RH 1NFIB 2Y60A 4BH8B 1GR7A 2PP7A 3ST7A 4EEEA 3PG2A 2DU0A 4ZFZB 1H4GA 2GTSA 4DV3O 5EF2A 4MDIA 1KCRL 3RWIB 1IKOP 5IFJA 4KX7A 2ZUVA 4MAYB 4FZ8H 4HXAL 1SQGA 4UQIM 1Q0XL 1I3HA 1JF5A 2HBUA 4BQ1A 2OPCA 4GAAA 5DUML 5T1DH 3F05A 3TNNB 1QQDA 4KVPA 1BEV2 2FZ2A 4IS6A 4DUVA 3POWA 1UNBA 2DJVA 2C7UA 2P46B 5E94A 3FYEB 1CFNA 3NJNA 3QHZH 1WIOA 4HG4J 1IPJA 1KJVB 4PUBL 5CAZA 3G5YB 2XAFA 1UOWA 3TJPA 1OOAA 5ICZB 2YOCA 1BCXA 1UF2C 4NTXA 1N32O 2JENA 4UBDD 1VA9A 1WIPA 4CCJA 4EN8B 5HGAB 3L70H 4GB9A 4NQVA 2DB8A 5KN5A 2IAAC 4XC3H 1EJOL 2PLV2 1F58L 4UYPA 1U8MB 4ZYKA 1R64A 3VFNB 4ISQA 4OUMA 3SMHA 5J56B 1R081 5CA1B 2IQAB 3CIHA 3L9JT 5H5NA 1Q1PA 4MXWL 2VPVA 2ICWI 5GSVB 3V8CA 3I55V 1HRI3 5G05L 3WY3A 4YVWC 4HAMA 1T0NB 4K5OA 5T1DL 3K72A 4GXVH 3RG1C 1GZWB 2V37A 2DPKA 3I9GH 2VLJD 4PHXA 3HKDA 2ZX5A 3BD4A 1Q0XH 4Q4Y3 5D2AA 2FAUA 5JQGB 2FO4B 3ARGB 1UMIA 4RAIA 3ZRSA 3BP7A 5D7JA 2GQHA 1ZHKA 3NAAL 1VACB 1F4WL 5KYXB 4HOWA 3VWJC 1X7NA 3NA4A 4A6YB 2O1QA 2H3OA 4XJ8A 3MRPA 4IMLB 1L4IA 1ASQA 4RX4A 3TBYB 4GAGL 4LE4A 5C0RL 1X4TA 4ZMXA 3AK2A 1WT5C 2AXFB 2J6WA 4I50A 5LY1A 5CO1A 4DPCX 3VBHB 1IGTA 3L16A 5DEGA 1KGXA 5T1KB 3OAYK 2NX5A 2WM0A 4ELME 1AR63 3T3PB 3TO4A 1BV8A 2AV1A 3GSNH 4HXBL 5G04L 2CO3A 3OHMB 4XJZA 1ASOA 4BQ4A 5IVXF 4NIYE 1COWG 5TISZ 1I82A 3JV0A 4YFDB 3EYVB 4JFEA 3MCLH 1A78A 2QCSB 3FRUA 2IJJA 3P3TA 2KR2A 1ADQA 2PYFA 4L29B 1RK7A 3SKMA 4QT6A 4UZSA 1U8HB 2VSKB 1N36B 2LLGA 2PXYB 3BSZA 2QWOB 1ESOA 2VOXA 2VXRA 5LWYH 5AG2A 2YOAA 4NO4A 2ZWKA 4QJFB 5MEQB 3VBSB 3GJFK 4FPCA 1NICA 2YPLD 3OKKA 4OCYL 2ZUXA 1S0EA 1ZBE1 5I23A 4WNJA 4BWUA 2I5YH 4MNGB 4OZIE 2WZPP 5EJ3A 3RAJH 3QG6B 4R4NC 4PMFA 3FB6C 2LOEA 5I8TA 2IVJA 3MRDB 1GOHA 4ODHH 3SJVA 2DS4A 1JZ5A 1R3LB 3L73H 1OAXL 1KXQE 1HL5A 4HUVA 4DV5O 3H9HB 4URKA 1GZ9A 4B9ZA 1FL3B 3NIFF 1BWMA 2H6OA 1N10A 5FYJU 1SEBB 5F1NB 2Y6GA 4U6YA 3ZO0B 3QIBA 3R06B 3MUGA 5IIEB 5FO9B 4GRWF 3FJSA 1EZVH 3WXWL 5HGBB 1K7DA 1JPGA 1AX1A 1GP5A 1FJGO 5KVEH 3FC8A 1SMAA 4XI5D 1B0GB 3DUUB 1R1BA 3VKOA 3O12A 1H9WA 2A77H 3BO8B 1AJKA 4BXSV 4IEVA 2A6YA 4NJAL 4QRRD 1SYSA 3U7YL 3ZO9A 5JMCA 2WLNA 4D9QD 3K71A 1YZZA 2J1XA 5ACA2 4ZTEA 3T4VA 1OF4A 3NNLA 4C56A 4FXGC 4GYBA 1K5NB 3ZZLA 3FZ3A 1N4XL 2WXQA 3GMPA 5KANG 2YAMA 4CKVX 1VBD3 4URTA 1Z5LA 5FYCA 3MRDA 4YH6A 3EDJA 4ILDA 5AL0A 2HG5B 2FX8L 1S5LZ 5D55A 1YNKH 3CNKA 3AZVA 2PPAA 3OV6A 1UZGA 1FFQA 2VZSA 4EI5C 1HQ4B 3UYJA 4OHXA 2WVVA 4ZS6D 3E35A 1L9MA 5D1QB 5FPZA 2EUVA 4TUKH 3H7YA 1SN0A 5LYJA 5HYJD 3DX8B 4PWJA 1HIXA 1P8JA 4FT8A 2WNOA 1JWSB 2DDQH 4ONUA 4FJZA 3BRDA 3ECWA 4R3SB 3VFUA 5HCAA 1FV1B 3QRFM 1CICC 4LSRH 4DQOL 5FW8A 4E9SA 5B4XA 4AQOA 1WZ1H 4KOCA 3A0OA 4XDLA 3BKJL 3D2UD 4U31A 4XHJC 2BSKB 5CINL 2HG5C 5I18L 4PJ7A 5EH1A 4Y33A 4X64O 1J5EO 3RBZA 4MSWB 4OQTH 5FOBB 2Q3XA 4ZAKC 4BE5A 1OGAD 2FGWL 4FXGB 3SKNA 1BBT3 3NQHA 4QB6A 4RFRB 1L0XA 2K9ZA 1XNDA 5EZLB 1MH5B 2CRYA 4RR3B 1LILA 3WG2A 1P4BH 5LDUA 3ZMVA 4E5XB 2JEUA 1IXBA 3AS0A 3OPZH 4OF0A 4YO0B 2WD0A 5GISH 5IT9N 1QOTA 4MD4A 4TNWF 4LCCC 3RJDA 3WFBH 2VQFB 2Y64A 4Y4YA 2CWMA 2FDFA 4JDOA 1T0NA 3U4EB 4Q5OA 4XETA 4FFYL 1QJZA 1PK6B 2PLV3 4Y89A 1KDJA 2YSSB 1Q6UA 5GSRA 4WI8A 2N05A 4H88L 4LKXB 4QRSA 1CFSA 3RVWC 3STZA 1S9WB 3T3PE 3VFVB 4AOFA 2WFF2 2KS0A 2YMXL 4NP9A 3LA2A 1UAIA 3N9NA 4ZS3A 3PNWA 3OWEA 4AH2B 1G7YA 2Z93B 3MNVB 3HI1B 3QFDB 4EI5D 4GX1A 4XVJL 3C6EA 1IVSA 3J8F3 3ZKUA 4OGAC 5EP9A 4AIEA 3F6LA 3FH5A 5IP4A 2QEXV 2B3RA 4MVOA 3ZU8A 4V11A 4E41B 6CGTA 1XRUA 3F12A 3JUZA 3U6XA 4GQQA 4DH2A 2AYHA 1XCXA 1L5GB 2PLV1 3V0GA 1JERA 2V5MA 3L4WA 4RX4D 4N6QA 1JI6A 3NAPA 3GSVA 3U6RB 1V3KA 4ZPVB 4LIQE 1UHVA 3FQRB 2YZ4A 2PXYC 2Y7NA 4I5BA 2FLRT 2GJRA 3C8DA 3QGVA 3MFFB 5LN8A 2BM3A 3GO1L 5IBTH 5TK4A 1IX2A 1PKQE 4JFYB 4MAYA 4LFAB 1IAII 3BXNB 2UZIL 3MLRL 3O41B 4Y1ZA 3AKQA 1F8VA 5T3ZH 4GO9A 5GRJH 5F9OL 1CE6A 1YDPB 3ZXFA 2YAEA 5C8YB 5LP6A 2UZXB 3ALXA 2QKIC 3EGSA 4PP2B 4CAGA 2ED7A 2NY5C 1SA0B 4IHBA 5ECGA 4K23L 4NQCA 4CGTA 5PCYA 3WV0A 1XGUB 1W04A 1HJCA 4COWA 3F7RA 1S7WB 4BSWB 3QCWA 1BBT2 4RQQA 2EZ0D 4EIZC 3QAQA 4A67A 2VJ8A 1QJX1 3VWJB 1C3HA 2IAMB 1DQ4A 2JWYA 2HT4C 1I3RA 4HJIA 4W9KC 3UROR 4KNUA 3TFBA 4DR1O 2BHZA 4JM4L 1Z2GA 2NCMA 4M6ML 5C8JB 4F7TA 3MZGB 7CGTA 4Y20A 4K9EL 1QY4A 1KIUB 3FB8B 2B39A 4XNDA 3FQRA 1U58B 4LLWA 1GP4A 3WS6A 2RFXB 3Q5YA 1YUHA 1JUHA 1MXDA 4K2UH 2FD8A 1GOGA 4OF8A 1ZLVH 1AXZA 3PYCA 1PP9H 4PWGA 1U3HA 4G6FB 4XCEA 1GKBA 4N7IA 3QJQB 1YQ8A 3QH3A 1HNWO 1YITV 4W6XA 2J1KA 2Z3FA 1DGRN 4IEWA 1NUKA 1BJMA 5D5MA 5D7IF 3HI1A 3QFDA 5IFHH 3C90A 2DW5A 1AXSB 4JG1H 5KSVB 3KHCA 1DSWA 4WI6A 4JFDE 4KTYA 3MO4A 5AW5B 2NDFA 2PR4H 1I1YB 4YPJA 1RP9A 5IQNA 4FPPA 2NZIA 4JFUA 3CLPA 3WDTA 3O2DH 3WUCA 1K33A 3ZFEC 1ZV2A 2WXFA 4JQIH 4B4RA 1ZDSA 1BZ9A 1MI5E 2X4SA 4OXSA 2BS8A 4LESA 1IE5A 4PGEB 4ZZ5A 4U1JA 5GZCA 1FGNL 1JBJA 2JMRA 2IAND 1CPUA 1PIGA 4KG0A 3VHOA 3BFRA 2NY0B 4JPRA 4GW1A 4M29A 5EUOE 1NZ6A 3BALA 2MOQA 1YXWA 4QMAA 3PP3K 1VBC3 1AYN3 1W9YA 2XJLA 5GIRB 4R97B 1NE6A 2GDSA 4RR3A 2J21A 4NQDE 4AMKH 4EZJA 1PZ7A 4DXTA 4YW3A 3IFNL 3DIFA 4GBXA 5J1AB 1K5MC 2A6IB 2P45B 4KRPB 4D0CB 3ZDZE 2KM2A 3FUOA 1MWOA 3GSQA 4GRLD 3FQTB 5CLYA 5JCTA 1QFUH 4ZMZA 3BPOB 1PHMA 3RDIA 3CFKB 3T0AA 5F2VO 3M7OA 3MRRB 4M1CD 3GJFB 4N5EC 1FDLH 1MEC3 4ZPIA 4IV3B 4COVA 1CCZA 3SH4A 3QZOA 2Y69C 4IDJH 4MQTB 2XWBB 4GKXA 3HN5A 5T3XE 1JK8A 1HXYB 3SGEI 4JC1A 2YEZB 4MXQD 3OTFA 2OR8A 2VXQH 3LXCA 3EOTL 1KYFA 4HZ3A 2D3LA 3MV8D 5HDOA 4A2LA 4BQ8A 2B1GA 3NNGA 1BQZA 2BERA 4QHNB 1TVBA 1YMME 1ZCRA 2FATH 2Y33A 2D7FA 3QACA 1IE4A 4Z7UA 3EJUA 2VR7A 1TME2 4WU7B 4P9JA 2Q7YB 3P0YH 5F7DB 4Y5VC 1RUJ1 3VRIA 4MVTA 5IUCA 1F3DJ 1M6OB 1QBLL 4KHPO 5EG6C 5A80A 4Q6IC 4PD4K 4D9LL 2JK5C 5EF3A 4I0XA 1XHZA 4O02B 2XJTA 4LOTA 4ONHB 4WVMB 4FNLL 1JK8B 2LS6A 4Y1UA 1UB6A 2BP3A 3INOA 4PLKD 1FGNH 4FQXD 1HKDA 3UCQA 3IGUA 4X20A 3LKPB 2XJRA 3ZFGB 2Y36L 4U49A 5HI3D 1UYXA 2QQIA 5EV7A 3BN9D 4UANA 3JAWA 1HJBC 1GZCA 1SVZA 1EVTC 5SWQB 5DXDA 1W2NA 4QXHA 3Q2NA 1IAKB 4M43H 4PV1B 1DJXA 4CP2A 2JKNA 3ZMEA 2ZKWA 4PW3A 5F5CA 3B3IA 1Y74A 3P2BA 1AS6A 1ZNPA 2W9EL 4PDVA 3NTCH 5TH2B 4ZFOA 4JGZB 1ZRRA 3TJHD 3NABL 3LCYA 1J9CT 4I0BA 2CG9X 3AG2B 3WTXA 2HUEA 4JFVA 2P6HA 1T4WA 1ZSPA 3ULUL 1LE9B 1V3MA 1R3LA 4X9IA 4UT7H 3BTYA 5GRUL 1KCLA 1MW3A 2R83A 4LXFA 1N1TA 1C12A 4TWKA 1FFRA 3QUKA 2ZP8A 3KW8A 3AYAA 1YEDB 3CUPB 3O4OB 1GC1L 3T4DA 1G6UA 3EYQC 4NQXA 1ZVFA 3TBDA 4CCNA 1ZZBA 1BECA 2BE3A 4TQ8A 4WM7B 1SEQH 2BTOA 4Y5XB 1HOCB 3DSNB 3I9AA 1GKFA 1T2QL 2ZAIA 1DTOA 3G08B 4H13C 3UTTD 1I5ZA 1O7VA 2UUAO 2PYFB 4L29A 2EABA 3VI3E 3IJSB 3S35X 3VW3L 4WWKB 3F62A 1UXLA 5HPMA 2CTPA 2EDNA 1HJFA 3MYZA 1XYOA 3C2SA 5DJDB 2A3QA 3QORD 5F3HB 5FY0A 3BCCH 3AB0A 3IM1A 1TME3 2QSVA 3AACA 3G9AB 1ZLVK 4E5XA 4KFZC 2C24A 2YG0A 1OLZA 1QNIA 2ZS6B 1LDSA 3MDJA 1CGVA 5IYYA 1F2XK 1TFHA 1IKNC 1FXKA 5CBHA 1BLNA 1S3KH 2NY3D 1FAYA 1I1AB 3V5KA 5J7MA 4EYUA 1LOEA 1TMQA 4B41A 1CF1A 3QZBA 5IV2A 3I9PA 4KUCD 4W6YA 3ETDA 1SLTA 3AZUA 4M8QA 1F4YL 3B9KB 1MQTB 3D3VE 1QABA 3VXPA 3RFZB 1QVOA 2RS13 1DSFL 5I1HL 4AUUA 4QO1B 4NKMB 4JYAO 2JV6A 4V1DE 5J48A 3D12B 4OF3A 2UXDB 4EV0A 5C08D 2HEPA 3B9KC 2VUAA 4XQ4A 1C08A 1RM1C 5LBSL 4DO6A 1TUPA 2XTJB 2AEWA 3LKSB 4J8RB 2CLZB 4NQSA 2F95B 2YQBA 1I1AC 1RZKL 4X98B 3PQYE 4LSPL 1X7QA 4FRWA 1FXZA 3T0EE 3HC4H 4OB5H 2ZOTA 2DTYA 2WVTA 4Q6YA 1AGCA 4ZYKB 2DCTA 4HGMA 3CXDL 2W1UA 1K4DA 1J8HB 1U5IA 4JO3H 1IBMO 2QSCH 2E76B 4H88H 3ZDXF 4M0NA 2WLIA 3L5HA 5LUMA 2Y23A 1IPSA 1CQYA 1SMDA 3KVQA 4X1KB 4WWKC 1EPWA 3LYRA 1RUD3 2B9BA 4GQ9L 4PJGA 4IQPA 4XIOA 3WJJC 4I9XA 3R05A 5MENA 2QADB 4QIRA 2COQA 4KROD 5JDSA 2P52A 3WO4C 4E5XG 1Q56A 5FK9A 2VKWA 4Y5XC 3VFWA 5CIPB 1QHDA 3E2HB 5F5IA 1COV3 5EBWC 4DERA 4D7PA 4FM0A 3O4OC 2YWYA 5AOKA 1PLGH 4LK4A 3W11C 3D08A 3UTSD 3EBRA 4CMMA 1RUF1 1H6FA 2NY6C 4JPVH 1RUD1 4OVVA 1N34B 5EU6B 4Q97A 1E5SA 1X6LA 5C92A 3WMQA 4B97A 4JKNA 1FNYA 2C7FA 4RMSA 4AXWA 5CJ5A 2BY2A 4R7DB 2JDIG 4KI5M 3FTUA 4FFFA 5EZOH 2YSSA 3U82B 4I18A 1OCOB 4UV8A 3IJ9A 1TYJA 3IJYA 4PV1C 1IM3B 4MB3A 1Y7BA 4AQSA 2IPUG 3OKYA 1RPKA 1RMU2 2VSMB 5FUIA 5A7QA 5C1MB 1SDYA 5F1RA 2EDMA 3TTYA 4YEEA 1O6SB 1CVNA 1BWWA 1HNXO 4EUPB 3JU9A 1PZDA 4NRXA 3ZFGC 4JI6O 1FO0L 4QQPA 2NPIA 5JZ7D 4TNWK 4X4ZA 2BH0A 1I8IA 2EVJA 5G2NA 3ZHKA 3BAWA 1Y3TA 3BQUC 2ZGSA 1KTLA 3CZUA 5C07A 1OEZW 2ADJA 1DR9A 4AENA 5ID0B 3TFKD 1F4MA 5DD3H 4GB31 3VHPA 4ZMQA 1KCUH 1JCKA 2VN4A 4LF4B 3IETA 3N2JA 2HLEA 5BNQA 2J22A 4KUCF 1N4XH 3T4YA 2J20A 5D1ZD 2JDPA 1AJ7H 4HDIB 4PBPA 3RWEA 1XGQB 1WEJH 4PG9B 1KJ2L 4OIIH 4K5NA 4NB5A 3BAEL 2RV9A 1DVFD 3DX7A 5FYUA 4WFBV 4Y0GA 1AHMA 2BOBB 1VF6C 1OCCB 4X7TB 2AK4B 3TBVB 3U10A 5KMGB 2JLLA 4DFHA 3QIWD 5LVEA 1XXDC 3KKYA 1YG9A 4OQTA 1QG3A 4XGZA 3EFDL 3ZKMC 5JPMA 4M8RA 1VRH3 3KT4A 1KZYA 2Y69B 2RS51 2ICEC 5IB5A 3KJ4B 3MLYL 3CBNA 3BKCH 3W81A 3AXDA 3P9WB 4JO4L 5AAWA 3VBOB 4A1RA 3WDHA 1R33A 1ULVA 5KHGA 3D8CA 2NTFA 3LEGA 4RDQF 3DVFA 2VO8A 4J3OF 4YHKH 5AYTA 3FF8A 5KYXA 2ZHKA 1TJXA 4Z7IA 1X9RA 4XMAA 3WB1A 3H7BA 4OLZL 4DHLA 1HB4A 3WQ0A 2XG5A 2A7WA 1JF6A 3KYNA 5BV7B 2XQYK 3IMUA 5J06A 4UT7L 4RESB 4GG6F 3K72B 2GUZA 1EQWA 4DV0B 4KI5D 4LL4A 4ODVL 4Q9BA 2K8MA 3LKNB 1XR8B 1JNNH 1NGYA 1BJ1H 4BWOA 3D5OF 1UJ3A 2A83A 4EKXA 4YW5A 4JEGB 1TZHA 2H2SC 1UU4A 1YN6A 3AUVA 4I7ZC 3BO8A 1KCBA 1SRYA 1RUJ3 4UOW0 5DD1L 8CGTA 3WX5A 4FZEL 4NC1E 1K9MW 1T6GC 3GCWA 3CX2A 1WP7A 4RSYA 3V0WH 4LFBO 1IBHA 3DK0A 5DMJB 5CEZD 5GLUA 3H42H 5C0JB 3D5OA 4S1QH 5C4WA 1NPUA 2R062 1N3QA 2VE6A 4PRID 3ZFEB 4O2CB 3D6EA 2O6PA 3D25A 2R0ZH 5J36A 2Z7UA 3LXUX 1KXQA 3UT5B 1D6VL 1JRHL 2VMDA 2Y1AA 3CHQA 4MCYB 5CIPA 3AZYA 4RZKA 4OHZA 2A1XA 2GAZB 4BIOA 3L2LA 2J42A 1DQQB 1RFDH 4NHCH 4YGEA 3B2DC 2D6NA 3ZRVA 5L3BA 1U3HD 3SJVB 3Q1SL 5FLIA 1JZIA 1B06A 4M3HA 1DYZA 3V0FA 2XN9D 1XF5B 4QPGA 1XCTA 1DJGA 2OA9A 4GAGH 1H2GA 4Y1AA 2A3WA 4BA8A 1MSDA 4ZNEA 2JKRM 3OKKB 4GJTB 1L0PA 4JE0A 1RUQH 1FNGA 5I5RA 1NFIA 3MOAL 2FIKA 1LOGA 1TJGH 5F39A 2QWRB 3NG5A 4AZ8B 1FSKB 1JJUA 3NSDA 2N1TE 4JREC 5IB1A 3MXVH 5E8EB 3V9CA 1AY1L 4F91B 4MVBC 4QM9A 3HR6A 3KDMB 2Q69A 5I15H 5I0ZA 5BRZA 2OMWB 5E79Z 1ZPUA 1SHWA 4NN6B 2VBDA 4PJIB 5CADA 5KBFA 4NO0B 3VXME 2X4PA 4CW1B 4QEGA 35C8L 3CCLV 3MEPA 1NZCA 5AKRA 2ENSA 1PVHA 2A7BA 4BWAA 3SZKC 5J6HB 4YE0A 5JTWA 1WAPA 4AEHH 4JANA 1AR71 4X9HA 5KWRA 3BAYA 2XYBA 2ZWZA 2M1KA 1UIJA 1PQZA 3K79A 3F65A 1I3GH 2OZ4H 2W9LA 5IB4A 3KPOA 4R8HA 4GQPH 5DMGD 5AFEA 3T09A 1KIRB 2AANA 2YLHA 3ATFA 3OKEA 2R15A 3RX5A 3ZPYA 1VQ6V 2AK1L 4RAVB 2I9LA 5ABAA 3RUGE 3V0VA 4HWZA 1ZHKB 5CBAA 2J1RA 2YQ3A 3GJEA 3PGCA 3VX1A 5KSBB 2EVGA 3VD5A 1F5WA 1KULA 1E9QA 4AK3A 2G9FA 1QHTA 3TNQA 2HVBA 3DECA 3ASNC 1DSYA 2HVKA 2J1WA 3R4SA 1L6PA 2QVIA 2CBPA 2C1OA 4UM9D 4QU2A 3BJ91 1MFAH 5IFTA 1RJZA 5CLZA 4YARA 3UGGA 4G6ML 2C3GA 1AP5A 4KI5F 5EBLB 3C9NA 4DT2A 3B7MA 1JXKA 2WLLB 4XPHL 2DCZA 2VITA 3QXWA 2OT7A 3K6SB 1OA3A 1CPNA 2WNUA 4L2NA 3UL2A 4UV7L 3W39A 2XLAA 3JV6A 1SESA 1ZAGA 1MVFA 3PWPE 5LQBH 1MABG 1KELH 1CDYA 3ZT5A 4COYA 2Y0PA 2LVCA 3QQ9C 4JN2A 5SV4A 3VFPB 5JXEC 4PJHF 4YHNA 1YNLH 5FQ0A 5E2TL 5G5DA 1QFWM 2YN3A 2CY6A 5B1OA 2QM7A 1VIBA 1C5CH 3B5TA 1M7IB 4C8DA 1MFUA 1HL8A 1NIBA 3GMMA 1JWMA 5AAMA 4YZ4A 1PK6C 4B9CA 1DQIA 3U2SA 2VDQH 4PRIE 3DXAE 3K0DA 4RNRA 5F7FA 3JATB 1RL3A 5E2VH 4LU5H 4ONFL 3RN4A 4MMZC 4LCCB 2R9HC 2ZSWA 1JW6A 1QFWI 2ID4A 4NM8L 1HRV1 2UVEA 5I1EL 5IGXL 5DRXB 5C8CA 1G87A 4YHYC 5IVNA 4RR3C 2O5XH 4XC1L 5HFLA 5K59F 1W6MB 4Q9QL 3LH8A 4ZOLA 2MK3A 5FJKA 3TIDA 1JNHA 1F00I 1N0XL 4M6NH 2ZGPA 4N2IA 3FNKA 1AY1H 4BRJA 1K5MA 1R3IC 3MGAA 4Y2OB 2JKBA 4RAUB 3FKSG 1NYWA 4GG6B 4KQ3H 3GS0A 5JIDA 1IGOA 2EYRA 4JI5B 3VI3F 4PRHD 4YDIL 1X9PA 5KHIA 4QXBA 2ATFA 4ZK8A 2LLLA 5CGBA 3LPGA 1C8M3 2P1YA 2PCYA 2VDRB 5EOCH 3S34L 3O3DB 5K0UA 4Y1VA 1A6CA 1INEL 3VGHA 2B8MA 3FCTB 4IE7A 4XH2A 1FCGA 3KLDA 5IBTL 1J8KA 1ENQA 1S0BA 1VB2A 3WE1A 2VZ1A 1AE6H 1HXMA 1PG7H 4W4LA 2Y06H 3TZVB 2NR6D 3BPNB 4Z7QB 4DXRA 3V6OC 4HKZB 4GAYB 3B83A 3KH3A 4GFXA 2OR9L 4OD3L 3ROOB 3UTSE 4EI5B 2AENA 3OMNB 4PD4F 4LLYA 4ADGA 5JORB 3OUHA 5FF6A 5I6LA 2F8XC 2XKNB 4JPKH 5B5EZ 3HJEA 4TUUA 2P4EA 1RJLA 3TZVD 1EP0A 4R9AA 4JHAH 1GA2A 1L9QA 2EXYC 3EH5B 3ACFA 4J1XA 2E7MA 3SDAC 2R2BA 1CU4H 2XTSA 3BC9A 4NUQA 4W70A 5KBLA 1SYVA 5IWAO 2BRQA 2OI9C 4RO2A 2OZNA 5IWAB 2PP8A 2ZYHA 4JRYD 5HHNB 3V5DB 4ISVA 5L3FA 3FSOA 4PWFA 3K5LA 5LMUO 1U8QA 3KM5A 4HLEA 2Z6FA 4P9HL 4XNXL 5FY7A 4DQAA 5I6PA 1JD9A 2YPKA 2ED8A 3MOBH 1QO3B 5GGQH 1DVTA 3ZRWA 2W6JG 1UD2A 5HBAA 3FL7A 2I69A 1DLBA 2DLEA 4AZZA 3RVXD 5BXFB 5FYIA 3LNHA 2CRIA 4UU9A 1JYIA 1WGOA 4CDWB 3K48A 1JUFB 4MQSB 2FEDD 1KCSL 4U4BA 1JGUL 2PWEA 1AGFB 2RS11 4HUWB 3SR2C 1R3LC 4QHMA 1IBYA 1XYNA 1UL9A 3T2MA 3FB6B 1PMIA 3CMAV 4K94C 4M01A 5GTIZ 5BR8O 5KXDA 3VRJB 4H8UA 2BP0B 3EDEA 1EH9A 1A3KA 1AR93 4HD9A 4K3JL 5FYHA 4QJ4B 4HCRL 3VBSC 1Z78A 4JX0A 1J5CA 2XN9B 1T89C 3G6DL 3I8TA 1TVDA 1VLXA 2Q76A 1XCQB 3ZE2F 3JXSA 1CC3A 2EILB 3US9A 3FQNA 1DLHA 4OM1L 5FM5M 4MAUL 1LE9A 4HKOA 2Z64C 1RIVL 1GGIL 5DUXA 4FMTA 5K1NA 4JGZA 4TULL 1MACA 2HWF1 5D96B 1A4JB 1LMIA 1VFAA 2OR9H 3E8UH 3M8OL 4PRIB 3IKCB 2IXQB 1A7OH 4JFFB 2XA3A 1K72A 3PGDA 1GUIA 3SQOH 4TSAL 3OHXC 2ZABA 4XBMA 3RBGA 1RUPL 1E8ZA 4QRUB 3ZTDC 4P2OD 1I7ZA 3DTXA 4I0PA 1LK2A 1VGKA 3KG5A 4PY7B 5D7SH 4Z1VA 4YXKH 1SN5A 3UTQA 1S0DA 2N7GA 3WHTA 4UMGA 5I5MA 3H42B 1NAML 1VMFA 3H6JA 2IBZY 1XZWA 4XCFH 4LEXH 1M71B 1U92B 2JJTA 2VMFA 1K3IA 2WIIA 3L75H 1SA0A 1K6QH 5DRZA 5FGSA 4EWDA 2O57A 3AREB 1QJX2 4N2OA 4P23C 4IBQA 3MMEA 3N7MA 4M02A 4GB32 2LABA 2WBJC 1REDA 2VZQA 3ECQA 4UB8Z 1LEIA 1NFKA 4N21A 1BQHA 1HT6A 2F5BH 1JSYA 4PN6A 5ECJE 2K9PA 4YVWB 4HHAB 1INQB 1B4LA 2RQ8A 4QOKA 4XVSL 3GZAA 5I6OA 3NL1A 2Q6AA 1KQRA 5DO2C 4QHNA 5E6UB 1LOBA 2EYRB 2PWGA 2VXUH 4XR8C 3WKMH 1JMXA 3IU4H 4KITB 2OMXA 4IRSB 5J1TC 2WWWA 3DMMC 1CESA 1SY6L 4HQQH 4N2DA 5JAXA 1K4CC 1NI8A 3T1CA 2YBRB 2XVGA 2WT2A 1LTXA 1DZTA 4IYIA 3IDGA 5IVXB 1A3LL 1W6MA 5K1VA 3JTTA 2FT8A 3JWOH 2A74B 4QAWA 2J5WA 5DUVA 4LLQB 2R1YB 1A0QL 4XHQA 3OQ3B 1J88A 2LAGB 3P6BA 2E27H 2HKFL 2WUCL 1YF2A 5BPXA 4XP4L 5C0BE 1URIA 1KIPA 3VXOA 1A22B 5FPXA 1WN7A 2HJIA 5IJ9B 1U3NA 3QFJB 4EEQA 1HWGB 4G3YL 4X2UA 2D3RA 1DBJH 2YI9A 2HFFA 1BYPA 3CFTA 4E2LA 1BGXL 8FABB 1PNGA 4JFZH 4Y4HB 2MTAA 1IIIA 2LT9A 3N42B 2DVGA 3KGTA 4RQFA 2KKQA 2FHFA 5EIQA 4RGNC 1OUSA 1Q8OA 1S7XB 2XDHA 2IG2L 2WFF1 2NX5D 1K34A 1LRHA 1M7DB 2SLIA 5I28A 4E9XA 4FQHB 1MCBA 1JG9A 4OZIA 4G43B 4FFVD 4X89A 1S4IA 2D7NA 3V4UH 1JOBA 2VLRE 5B1BC 1IZ3A 1AXTL 1S3KL 1QBAA 3L2MA 4XVTL 4F7KA 1NEUA 1O59A 1S7TB 1C8QA 1KXHA 4M4RB 4A2MA 4WNSA 5T5NF 4JR9H 3MBWB 3B3BA 3P4MB 5CB7A 3ZFFA 1TVKA 4HBNA 1UKGA 3JQWA 4META 5LBBA 4UIKH 2YPLA 2CAKA 4XO9A 1VIWA 3H8NA 4NJAH 1I3VA 4PJHB 5FLVA 4BIUA 3WL9B 1D5ZA 2CR3A 1QKZH 2GP5A 4P2YA 4QPIA 2JTYA 3ARFD 1TQ5A 4TVUA 2DICA 3HE7C 4TKWA 3CVHL 3OZ9L 3MLTA 4B9IA 4ZHQB 1URFA 3WHE0 3RY6C 4KK9D 4XQWA 2XL9A 5GGUA 5F0LB 1G9NL 2XR4A 3BTXA 3QIBD 2VDML 2AW9A 3QI9A 3AFLA 5FUZH 2E26A 5LXVA 2CXKA 4POYA 1G9CA 1WLEA 4LIUA 4MVUA 4HSLA 1QUNB 4XTRC 3WFZA 5BW7A 3S88H 2OX5A 4KRMB 3RY4A 3RRDA 5IB3B 3FONB 3HKBA 4J9YB 2EVXA 5L7XL 4Y4KD 2VY0A 2CALA 1Y0LA 3ZZQA 5C09E 7PCYA 5HHXH 5AC91 1IU1A 3QXTA 5F2FA 3WNPA 1YAIA 3L3KA 3CN3A 4F7MA 5KS9E 3ETEA 2KUTA 2RR11 1L9NA 5CWSA 2R32A 4JY5H 4R6UA 4IRJB 3LE0A 3FFOA 1DANT 2APFA 3BDXA 1DTUA 4WO4C 1TQUA 3V7MA 4ENEC 1YC61 2EIKC 1ZHLA 5DDHB 1QDCA 5DD6B 3OAYH 1M90W 4PBWD 4M5ZH 3ILQD 1XHHA 5F3EA 4L9LB 3CFEB 4GG6E 4JI0O 1RIRA 3AX4A 5L6YH 3KLLA 3EFOB 3TJHC 5AB0A 5AW3B 3E7JA 1NUGA 4Q14A 3AG1C 1DL7H 1DVZA 2F8IA 4LGRB 5E95B 1JZEA 3E3QC 1FG2B 4X6CE 2IH3A 1UEMA 3EMRA 4PJEE 1P7QA 3CX5F 3JYCA 4FQPA 4PB9L 4NRPA 1EIBA 2P8PB 2Y07L 6PCYA 3J4UH 4RS5B 1HB1A 4QY8A 2ZMLA 4P3CL 3VFVA 3G67A 2PXYA 3ZE1F 2RJKA 4YHKL 3STZB 3FBMA 1G9NH 3OMAB 3NJKA 1WBYA 3AT8A 3D33A 3LIGA 1BEXA 4PB0L 5FGCB 3TEUA 1XR8A 3EXLA 2HJFC 2EDDA 1DQKA 4QYOB 4YUEH 4MASA 3OZ9H 3OHXA 1KY7A 3HIFA 2Y7QB 1HR0B 3B9CA 2FUQA 2NW3A 4LLMA 4NXNB 1ASPA 3BWUC 1G9MH 3GI8H 3IMMA 2QADD 3DUIA 3PVOA 4N85A 1SNRA 2XSKA 3K0YA 1QLFA 4PLJC 1D2QA 2XKPA 4PCRA 5GZFA 4LMQI 1ET7A 4B1MA 2UXCO 3OAWA 1UUSA 1IBLO 2MWCA 3C08H 2ZDIC 3U1SL 2BVPB 2MNUA 4G7QB 2DWDA 2FQDA 3PWPB 4NQEA 2YC0A 5ESVB 3H1YA 1HYSC 5I8OL 1D9KB 3QH7A 4TV9B 1DDTA 3R7QA 5DHYB 3JZ7A 4WSGA 4Y26A 3WNXA 1QOKA 1I9IH 5FJHA 3OG4B 1PY0A 3GHEL 2R2HB 1QZNA 4I8DA 1Q81W 1SLXA 4N23A 5LG1A 3RYCA 5CBEB 4G43A 3RWJB 3UM7A 1M3IA 4L8DA 3UEQA 1WEJL 4IKNA 2NZ9A 4HDIA 3JB8A 4EUPG 2BSTB 1V55B 1WA6X 2SEBA 5LDSA 1P0SE 1N3OA 3FQ1A 3S8FB 1EWHA 2CGNA 3NXSA 3BP5B 4YW1A 3GHNA 3HMYA 1BGXH 1RURH 2YXVA 1AXIB 3NIFE 4JQVC 4K3GA 5AVXB 5IMMA 2RM22 1OF3A 4HJUA 2HFEA 1QJY1 2C9KA 4UVBA 1UM5L 3QHFL 4PEEA 5AZ2H 3VGDA 1FFNA 1W2TA 3ZK0A 3GK8H 2AEIT 1GHFH 5AOZA 3BB6A 1S7RB 1OCWH 1EBAA 1FORL 3LDCA 3K81A 1B04A 1HV1A 1KYDA 2OW4A 4CUGA 3RUGF 3DJZA 3B4NA 1MOFA 4MT8A 3AEIA 4KJWC 4BQ2A 1CZ8L 4E9WA 3K5MA 3LRMA 3BA8A 4MNHA 4JTDB 2V8MA 4GKZB 4OKVA 2VQEO 3RL1A 3WHE1 3BE1L 1F4XL 3P3YA 3PWVA 2QHRL 1K5QA 5JIHA 2C9XA 2LFEA 2G3MA 2ODIA 1EMTL 4P5TA 1KNOA 2ZOKB 4GKNA 4N8VA 4F2MA 4EZ4A 5KYWB 1X9LA 3I75B 1VSCA 2EULA 4ZXBA 2IXLA 2AP2A 1M1KW 3VA6A 1H6UA 2WP3T 4FYTA 4KTDL 1BVZA 1GXEA 3WKPA 5AAMC 3N35A 1UH3A 2KLSA 4JVWA 4U6TA 1OANA 4HIIB 3H3KA 4IKKA 4GQZA 4NDMA 3ZMNA 1F1AA 1QR8A 3DSQA 4YVWA 3FFCD 3ZO0A 4GULA 2AJ3B 3DO4A 3QWNA 5E5MB 2HT3C 5D1XE 2Y34A 2CDFA 3MMEB 2VCOA 2DQDH 3V4VH 5C6TH 1CAVB 2XAHA 1EM1A 4CDXA 2O6EA 3DPDA 3LRSA 3MRNB 3NSJA 4AG4H 1BDYA 4W4KA 1CLZL 4LKDA 3PJYA 3EZJB 2GBOA 2WKOA 1D5IH 3X13B 4N2AA 1L9OA 5DZJA 4Q4IA 4JO3L 2PUQT 1FYJA 2HWE2 3BSHA 3KL3A 3HCVA 4I9QA 3TO4C 3TYGL 3L81A 3DOHA 2Q6WB 3C6LB 4AYFB 5J13B 3ALQA 3OMIB 1CWPA 2F08A 4WFFE 2K70A 1LWJA 3KPNA 2GFBB 2IWFA 4XMKL 1P84J 3NMBA 2X53S 1A8JH 2BJSA 5CCKH 3BRCA 4KH2A 2G1MA 3WE6A 3OEEG 2NLJB 2DLIA 2X7RB 1IG0A 2YRLA 3B9IA 1PDKA 2O4EA 3LFMA 1GR3A 3EGXB 2ISDA 3QI9C 2HWZL 5IFPA 3BUYA 2TRYA 1NOLA 4XPAH 4M8UA 5EIYB 1AIZA 4H26A 3DJSA 4FL4C 4LGPB 4LHUA 4NHUB 2R9IA 1ZVSA 5C0BB 2K46A 2DJUA 4M8QB 1V54B 1VZIA 1GY1A 4GMTH 4XNQA 2EACA 1RUAL 4IU3B 5FA3A 5LASA 2XJUA 2FH8A 4K8RL 4TL5A 4N2LA 1P69B 1FXKB 1BLNB 1JPTL 3MJ9A 3TL5A 5IT2H 1JN2P 1Z5HA 5CKMA 4CPBD 2W0KA 4LF8O 5H9PA 3MJ8A 5M0TA 4MYEA 3SGKC 2YIBD 1QWUA 2IAMD 1LEGB 3K9AA 1YO8A 1P4RA 3ESVF 4U6XA 3N1GC 3ZW3A 4UOJA 1OY3B 4I4TB 2WO3A 3HPLB 3TXSA 5C9AC 3P4LA 4ZI7B 1MNUH 3ULSA 2VAAA 4ETQA 4MNQA 1DUZA 2ZYSA 3RUGB 3VTAA 3QG5A 3FOLA 4G9FA 5DYOB 2XXFA 1BIIB 1ADQL 3ZE1E 1R091 5ITZB 5BZWA 4IRSD 3WUWB 1MELA 3BRFA 5I2IA 1QZ1A 4HHWA 1UY1A 1WA0X 3P1IA 2AJZB 1AI7A 1QLRA 4YHLL 1XIWA 1S5HC 4TQDA 2VW2A 5JSOA 2JVDA 2I45A 2Z7ZA 4LHUB 1YEDA 4IV1C 3CN1A 4TTGA 3USUA 5H2FZ 1S7UB 5SWSB 1FNSL 4GT1A 1WV7T 2X12A 1EN5A 1RJYA 5GGQL 1X5FA 2C7UB 3P3NA 1NBVL 2VMEA 5KLVH 1KB9F 4NQED 4ACTA 2IGFL 5L88H 4AGRA 2OJEB 4H1LB 3EO0B 5INCA 3RYRA 1U6AL 4CCKA 3WEAA 2VYRE 1JBCA 4NI3A 4ZFOB 1CLOH 5JORA 2X5PA 4FTDA 1SFPA 1H3PL 2HCZX 3CFJA 3PHMA 3OJVC 1RZ7H 4LCWD 3VXSE 2KG7B 4UV9A 4L4VA 4Z92B 1MPAH 1W9SA 1OF0A 4E2GA 4MCZB 1CFVL 3JWDC 4CEWB 3D39B 1U3ZA 2XLGA 4K8FA 1CD1B 4KXAA 1P9MC 1DBBL 1A1NA 3Q8BA 4G27B 1YJ9V 4NXMO 1R3JA 3KBPA 5D2NE 5JW4Q 1CICA 1CZSA 5IWLA 4JAAA 5DM6V 4OAWB 1S9YA 4APQD 3L72H 3RIKA 3CFQA 2Y6FA 3OPZA 4PR5A 2ZMKA 3D50A 4NP4H 1TU2A 4JFQB 1UWGH 4N26A 4X6BB 3U1XA 3QDGB 3M3IA 3RGVB 3LDBA 3UIZA 1V10A 2B0SL 2WQSA 2EDJA 3CXCU 5GGTA 5I0XA 1BK1A 4LOUC 1UZYA 3MRKA 4JY4B 5EOCL 3S34H 3U25A 1OLQA 2H4EA 4G8IA 3LCPA 4INDA 1BHAA 1MREL 4P46A 3EUUA 3DGDA 1O5UA 5D71L 5EEXA 1ULEA 1DFBL 1O75A 1MREH 5GPRA 2XHKA 4B4QA 5C9KA 1PKQA 2OMBA 2ZX8A 2XWBA 4AQ1A 5IF0B 2OMZB 3QQ9D 4NO5B 2VJ0A 3SOTA 4CNIB 3M8LA 3IFNH 3EO0A 4OGQB 3TN0C 2W8CA 2G75B 1OCZC 3QCVH 5JHDD 4B1LA 2I5YL 2B42B 5LATA 4F3JA 1QRND 2ILLA 3UABA 4DO0A 4HOMA 5JSRA 2E6PA 3CFNA 4L2YA 2G9HA 4L0YA 1W15A 2ARXA 2JWPA 4ALAL 3BT2L 3VXQA 5LWYL 4BUHA 4OX9O 5HHPB 1BAFL 3AG3B 3GMLB 4MG2A 1DBML 2BS71 3UOAB 1KP3A 1UYYA 3KYOB 1HSAA 4KXCA 5K9OB 3B56A 3VH8A 1LGBA 5FZOB 3APDA 3EJZC 4GT0A 4ET7A 5KG9B 1TAEA 2PPCA 4FEIA 4GG8B 3MIHA 3A0HZ 4JZGA 3RPKA 3DDGA 5K4LA 1RJZB 1X5IA 5CLTA 2F5AH 2QFPA 1X50A 3W57A 2Y2WA 2A1WH 4AT6A 2EO7A 4JDEB 2LRPA 3EO6A 4PJGE 3KCCA 5I1JH 1AACA 4CCEA 1E9QB 2GY5A 3K3OA 2VDLH 1F90H 2W3JA 5D5ME 3OGRA 1JFQH 2D4DA 3ZTNH 4A2HA 4AGLA 4RAVA 1H6XA 1QSVA 5A3LA 4KPHH 4HEMA 3UZQA 4YNIA 1E2VA 4DP2X 2G5BA 2EH8H 1XX9C 3O2WL 2AZUA 1RK0B 2X0LA 2V0AA 2Y7OA 1J58A 3O3AB 1SQFA 5GZNA 3AYEA 4HSJA 3ZMOA 4FSJA 1AXSA 1MJ8L 4K7FB 4TQIA 5GGVY 4I0WB 3JYBA 5DJAA 3U9PH 4W9ZA 2A71A 3MRHA 1H15B 3I56V 4GINA 2LUWA 3V9EA 4PV8B 2GPZA 4XMIA 5F7UA 1U91B 2JQAA 4AYDC 1AGBA 2AJXH 3OB0K 4PRHB 4DW0A 4AL8L 2A70A 2D3PA 4F93B 3E6HA 2BOIA 3MVSA 2WS92 3HQRA 4UTBL 5KTEH 2D0HA 4QYOA 2X9XA 3KDMA 4PJFF 3MLJA 3F7YA 3NCFB 4CPBA 3EIFA 4IOSA 1G0DA 4LVNC 3B9VA 4M6MH 4NUMA 4AEHL 1OTTD 4XW3A 2WYHA 4UT9A 3E8HA 5LLIC 2XOMA 3GPSA 1JR9A 3MLPA 4XUNA 2Y5TA 5I8EB 4EPSA 2GI0A 5KXEA 2VECA 3PP4L 3W3BA 2HTKC 2VQTA 4MNQD 3Q1SH 1MCNA 1E40A 1C5BH 4XMXA 2B0SH 2Y1VA 3ES6B 5KVFH 2V9RA 5DUMH 3VFMA 3ZHLA 3KV4A 1PU0A 3WXPA 5D1QD 4ORGA 1S2KA 3CH1B 4PTUA 5I8KH 1CFQA 5JIIA 3M1CA 2QGCA 3H9SA 4YSPA 4FZ0A 4GXUM 4X8XA 3RDTD 4K7PL 2D5FA 3D0AA 4N9IA 1JHKL 4OZFH 1LODA 5BZDB 2WPDG 4LA2A 3ZY7A 3APCA 4B3TO 1J9QA 2YPLE 3F7LA 5FUCC 1AMXA 2D2CC 4KWUA 3V0WL 3IPVA 4GKKO 4KY2A 4RDBA 3S3JA 5ALBH 4Y1TA 4JNXA 1AR61 3GGLA 3NFSL 1OOPB 4TOYL 1UQXA 1I8LA 1W9WA 1LD9A 4PJ8D 4U1HA 4JKWA 2DM3A 2Q1ZB 1T5XA 2Y38A 2UX6A 3T0EB 5FY9A 4ODWA 4U1IA 3WMPA 4BLIA 2E75B 2VZUA 1H8TC 3CBKB 2PQQA 3IN0A 5J8OA 3L5XH 5IYCO 3ABMC 1BLIA 3X29B 1HHHA 3T1YO 2BMKB 2ETEA 3AG3C 2H1PH 2OJZH 2ZUQB 4IGBA 1MHHB 4G8AC 2V2TA 3H7BB 4G80B 1COV1 1M56B 1HDMA 1OAUL 1GMIA 4L9BA 2H7WA 2ET7A 2B3IA 1U95B 2VLRB 2LTQC 1XR9B 1KZQA 4BV1A 2HFEB 5CKGA 1ND3B 2ZCWA 1XF4A 1LO4H 4PJIE 1Z7S3 2R1WB 5ANNA 2BNNA 3WFHA 2FGWH 4L87A 3EJYD 3O9WA 2WS93 3MGOB 1QH6A 5E8NB 3SDAD 2ARJA 1U0QA 3ZJAA 4AM0B 2YC4A 4HK9A 5KSUA 1QYGL 1JZ2A 1MZZA 5IJVA 1LGCA 4QD2A 3RY5A 3NK4A 4PLMA 3J7AU 1ERNA 5ES4B 3TEXA 2YPLB 1BX2A 3KVPA 3T4AB 2HWF3 3TWCH 1F3DH 1P6AB 4EZKA 3ZKNC 4J3OC 1FH5L 1QR4A 5DHEA 1OLMA 1WPCA 3N2GB 4MMXC 4OI7A 3TBSB 3W20A 2YXSA 3MDSA 1ROCA 1DJSA 3MHSC 3C2UA 1KTLB 1SERA 3SYQA 1J1OL 3THDA 2WW8A 3HG3A 1ND2A 4PGDB 2HYKA 3LZOA 5DS8B 4CILA 2ZDIA 3CMOL 2VMHA 1Q82W 2OPKA 3MJ7B 5I24A 1O6SA 4ZUWB 3EXAA 2CIIB 1FOD3 1MZ5A 1TEYA 1RUI2 1SF9A 1SQ2N 4PYGA 3QDMA 4CEWC 3ZXKA 4H37A 5HDRA 4FLQA 2WZ8A 3WU2Z 5FZ1A 3E6CC 1UD5A 3T3ME 4ZU4A 2I7SA 4Z3EA 3WVJA 1K3EA 2CTWA 2IADA 2V7HB 3OX8B 4WTWA 1LQBC 1J1OH 2VAUA 4JFPB 1VRH1 4HMCA 5EYPA 4CEYA 4JGMA 4ANUA 2F4PA 1P7QB 1ORQB 3L2YA 1A6UL 2VW1A 2WKOF 1FH5H 3A0NA 3FAVB 1MCFA 4J80A 3HZYA 4J25A 2XZAL 2FECI 4WFGD 4R0LA 1WBZA 4DCQA 4OI1A 2ZSVB 4L8BA 4YHHO 3MXWH 5LAXA 4Z7AA 5K59E 5B4MD 3TWIA 4ONGL 4QRRE 1WDAA 1XSIA 3NGBC 4KBZA 3CCHB 3JCIA 4HZFA 1BYOA 4LPXA 4FFVC 1K5WA 2DFCA 1IVLA 2VVFA 5SWSD 4L99A 4CEYB 1KCWA 4O51B 3LV3A 5JUVA 5B3SC 2ETWA 3EJCA 3HPLC 4KWLA 4XC1H 4XB8A 3D6GA 1G8MA 2WLIB 5IE9A 1H5BA 2HG0A 1T83C 2YICA 3JWDH 1S76D 1HCFX 1UX6A 2EUZA 1WAAF 3CH1A 4PJXB 4XPVA 3MA7B 4LB8A 2Y07H 4NYLA 1RUC2 2OJZL 5AW0B 3MUUA 4FFGA 5FZ0A 4ZS7L 4QTIH 2BVQA 4XE0A 4MJ4A 1SBDA 2ATPB 2F2HA 4K0OA 2WMPB 4ODHL 5HDQH 3RIAK 3QG6A 2N0KA 3SJVE 4XP1H 1SHSA 2Y5TB 5I8EA 1AR72 3S0MA 2BVYA 2AJSH 3GRWH 4XOBA 2JJVA 2V3DA 2VZ3A 3RPIA 4FL4B 1ML0A 4CU8A 5B39A 4MJ6B 3LA3A 2XVBA 4E4HA 1U3JA 3ILNA 3H8OA 4OZGE 1H1IA 1KLUA 4C4KT 4HYTB 4YRDA 4NQTA 3Q2VA 3T8XA 2Y6SC 1V0AA 3SDXA 3KAAA 4K8XA 12E8L 5L9DL 1EN4A 3V4LA 2Z91A 2COVD 5CJOL 5LBVA 3NRPA 4X1IA 4OFVA 1HNGA 3D07A 4LF6B 1R1CA 3L13A 5FZAA 3C6LC 1CPMA 5J13C 5I8KL 3RWKX 2V4AA 3HB3D 3MRHB 4O4YL 2V17L 3CPWU 4TQEL 4N2MA 3RW0A 4JGUA 3RKPA 1W8UA 2A2QT 2QQVA 2PCPA 3I54A 5FHBH 1IEAB 2A9MH 2WNVB 1U95A 3X1BA 3G3LA 4OI0A 3AJ7A 5EN3A 2BRRH 1UX7A 5D9SA 2H0PA 3KM2A 4FEMA 5JQGA 2FO4A 3SE9L 1EEZB 3PWUA 2YFOA 3RPIB 2X42A 4DR7B 2VLJA 1VKXA 3WG1A 2YXMA 5F7WC 4AWDA 3F84A 1VFBB 3PHQA 4R4BA 4OCWH 5AVYB 4W6WB 3IU3B 3U36B 4Z7QE 4XFFA 1ZHBA 4FHKA 4N6RB 3PAZA 2XUEA 3BGFC 1J87A 1AGDB 3IS1X 3TTSA 2YPKB 4OCWL 3WFCH 1GNHA 1I8LC 4Y2LA 1MCIA 4UUJA 1JI2A 1CI3M 4P9HC 5GLZA 1ZJBA 2BSEA 5EBMB 3ZR5A 1NXD1 3M3EA 3TA3C 3BKYL 3QXDB 5CG9A 3MBEC 3WFDH 1GMMA 2RG4A 3FZUD 3TZVC 3O3UN 1UKTA 4JRXD 2DURA 2LQTA 2H41A 1TZOA 1B0RB 2UZPA 3MLVH 4WV1B 4QXWA 4Z6AT 1HHGB 5L6YL 1FNEA 1WD3A 2A9NH 1U21A 1Z2KA 4DCQB 4G3YC 1ZEAL 4U7OA 2TEPA 4LZKA 2J71A 1EZJA 1BJ8A 1XGYL 3HBZA 4IQHA 5I17B 3WDUA 2CDGB 1JPEA 5C0CA 2ZX2A 3L1OL 5DG2A 4DIQA 1G7IA 3PIQB 3HT1A 4WU7A 4U2YA 4Y4KC 1XGPA 4OZFB 5I0WA 4GXFA 4QRBA 3S9DB 1K5JA 1QACA 1W8EA 1PL4A 2ZG3A 1V5JA 2J73A 6PAZA 5JZ7C 1V6IA 2EALA 2LGQA 4P5SA 4N3UA 4R90L 1RVF1 4LIVA 2VXQL 1YN7B 2AI0H 2FWLB 1SJXA 2WY3B 4QGTA 3RTQC 4J3OG 3K03A 2WLMA 1U2CA 3UL4A 4O4HA 4E9TA 2H26A 2QLVB 4U1LB 2P1BA 2IV8A 1AR73 4UQ3A 4M1GL 1V7NH 4YGDA 4JI3O 2OS2A 1OSPL 5FQ0B 1HSBA 1X5MA 5JDJA 3PGFH 4WK4B 4BQ5A 4BJ0A 3TT3H 1NGQH 2R27A 2LLNA 2OTWA 5GZEA 2XZQL 4JGYB 3NJMA 1VBA3 4ODXA 4FQIH 2C0ZA 3OD0A 2L7QA 1ZV5A 4EZLA 1G9DA 4LBLA 3G71V 3GXIA 2A6IA 6FABL 1UIKA 4FFWD 3CP1A 1D9KD 1C57A 1JZ8A 1IBDA 2QQMA 2HYMA 3ULUF 3RYHA 5IK7A 1G7QA 2HPTA 1NBYA 4G6KH 3VFGH 3DV8A 5CA0B 4B3RO 3DXAA 2HKHL 3HUJA 5DJYB 3ZYJB 3STZC 4QF1B 2TBVA 3NEEA 2Q76B 3HNSH 3IWUA 1UOLA 2ESVB 1KPUB 5ISZA 4R50A 4RS5C 1D4VB 2KHAA 5DQ0A 3FOMA 4AKOA 5FECB 4KDVA 5E6IC 4PQ9A 2EXWD 4K3EL 4XCYA 1OGPA 3UADA 3RYIA 3JZVA 3WFHB 4D8PB 1KJRA 4V1PA 1WBXA 4MCMA 2ADFH 1KN2H 3L1GA 4G8FB 4V1DB 2ZAGA 5JOWA 4X7SH 1RPUA 5JJEB 3WUWG 3D3VB 4P5KB 4XPGH 4Y88A 2F17A 5K39A 3W37A 2GC4C 1X5HA 1E3ZA 2AJYH 4QF1A 3QDHA 5FBJA 2R23A 2DLFH 4LMFA 1YMMA 1RHI1 1ZZ7A 2Y8KA 2RR3A 5BO1L 4GUOA 1NBVH 5L88L 1C4RA 4JYYA 2KKWA 1XDTT 2I9LB 3BGFB 3UO1H 3B9KD 3T2NL 1BF2A 4JZNA 4FTVD 5MI0B 1OT4A 4UBGA 1BMFG 1R24B 2IM9A 1SRDA 4L0PA 4UFJA 4RWUA 4QIWF 3UTTE 1D7BA 2QJVA 3LHPH 2H3NB 4TRPL 4JQRA 4JL1A 2P5EE 5T5FH 1AR1C 5T5LA 5HHNA 3HMXH 1HSBB 2Z7YA 5E5LA 2P3JA 1OPOA 3E86A 5EYXA 3AWGA 1OVPA 2PZSA 4MQXD 2ZJSL 3RWHB 5D21A 3ZXLA 2WNVC 4N9GA 1CDGA 1IAOA 3LDBB 3RGVA 4OFYD 2HPOA 2OCJA 2UWEE 3SGDI 2WTRA 4PBDA 1AC6A 1QHOA 2E32A 4YIPA 2P6JA 2GH2A 4PJ8A 1HQNA 3USSA 1M4UA 2ZGLA 3V4PB 4BKLB 3WFEL 1JMZA 4K9EH 3W59A 5JZGC 4WCYL 4F57H 3OKLB 3O14A 2Q4PA 3NJXA 3W21A 3S4SG 1I7UB 5EIVA 2PTTB 4A39A 4J6GA 1H0DA 3ZL1A 5BJTB 1NCQA 5T55A 3QNZA 2UZYB 5F9TA 4QXTB 4WFGE 4U6VL 1ONQA 3QWOB 1ULDA 2MFNA 3X13A 3S8GB 2P8LB 3MV9A 3UO3A 5T1LD 4D7BA 4JRFA 3RY6A 2P3YA 1MI5B 3A0BZ 1G9NC 3WNIA 1CDJA 1RJCA 2ATKA 1G7PA 4Z7QF 5HVGB 3LDDA 1Z0NA 1J95A 3EDFA 3UBXA 4PJBA 4JI4B 3I6SA 3IJHB 5KA6A 1NGPH 5DMGC 2YUAA 4ZRGA 5ICXA 3U48A 4OB5L 3KWTA 1GGBH 2DI7A 5DWPA 1KYOJ 4Y2OA 2XVKA 5F1OB 3VU2A 5D1XA 3OM3B 1V6OA 2D6LX 4UNTA 1RZKH 3CSGA 2G38A 4HIIA 3RIFF 5CP3H 5IW3A 2WRAA 5CKNA 4KKRA 1X3DA 4K7FA 3AWEA 3LH2H 1LQSR 2AW2A 4QTFA 4QHLA 5KYWA 1MVYA 1U93A 1S9WA 3ARSA 2BCKA 3FPXA 4XX1G 3RLSA 1VCBC 1D5IL 4OIAA 3H85A 4NWVA 4Y4HC 4WF7A 4LOVA 3IJ7A 1A6VL 2XT9A 3CMGA 4J6RL 5D70H 3UTSA 1MHCA 2UXXA 1JHKH 3ETQA 2GUZB 4YEFA 1XXNA 3LN4B 2GV9A 5F9WB 1RP8A 3PWUB 2NNCA 1S9KC 3ROUA 4NXSA 4C47A 3D18B 1P4LA 4MD4B 3UC2A 1N6QL 3M6DA 1E6OH 2ZX6A 3N0PB 4YQXL 3WJLC 4J5VA 1FPN1 4NHLA 3NWKA 4R5XA 4HVOA 4AI1A 4KH9A 5FKAB 1BFOB 1MCDA 3ALWA 1ZX3A 5EN2B 5EZLA 3IMSA 2BUKA 3GJAA 3I3DA 5FZCA 4D8PA 2EVFA 1HSAB 4WI4A 3DETC 1E9OB 5KYYA 3LNFA 4ZJ9A 5DJZB 5KJ7E 4WM8A 3O8XA 3FOMB 4H40A 5C3TA 1OH4A 3IJ8A 3KR3H 2D0GA 4N28A 1EV2E 3D4ZA 1HN0A 3ABUA 5HD8C 2IXIA 5K9KB 1YEGL 4DN3H 5DVNA 1NJIW 1GC1H 4PJ6A 5HDBE 4XBPB 1CD3G 3ISWA 4UIMA 4ZW3A 4AQ2A 5C08E 3AABA 5JOPD 2OMZA 1RZFL 4LP4A 4NO5A 2LGNA 4CNIA 2VQ1A 1Q94A 4GAZA 3IETB 5D7LB 3MRLA 1GMGA 2WBJB 1G1XB 3I84A 2ZJSH 4R83A 3WCYA 4A3XA 4P23B 3UDWA 5L2KE 3MGTA 3V6OA 3EG9B 3X11A 1FZKA 1GKEA 1KBGL 3O6LL 1UPSA 1YNKL 2Z0AA 3EH4B 2HBTA 4P9IA 2EYTB 5T8IA 2FDKA 2NY5H 3QQ4B 1P5VA 2ED9A 2QR0A 5E08L 1A4AA 3RWNA 2E8ZA 1BJ1J 1F3RB 4PJFB 2BGPA 3QO0A 2Y4UA 3LIZH 3NESA 3VFSA 4MMXB 1N47A 4YM2A 4CDXB 1UMHA 1HESA 3OHXB 2KYIA 1Q9OA 5IREA 4WAFA 3T4AC 3R8QA 4FPJA 1YYLH 4ZOBA 5DQDH 2EDOA 1D5BB 5D96C 4DJMA 1BW8A 3VZLA 2OT5A 1CXIA 1CGUA 4MKTA 1QSFD 1OAZL 5GONA 1N18A 1CXFA 2QQLH 3WDJA 3GXUA 5FYLD 4FLXA 4EDXA 1FZOB 4RMQA 4BGDA 3VXNB 1AKJD 1QOOA 5CR8A 4WWID 2IDTA 1FNFA 2B9VA 2EILC 1GC1C 1P7QD 1ZA6A 4CEWA 1SQQH 1ZVYA 2JIXB 1M3JA 2WABA 1XF5A 5FAAA 1BE3H