1YFHA

Wt human o6-alkylguanine-dna alkyltransferase bound to dna containing an alkylated cytosine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
175
structure length
165
Chain Sequence
b'CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*TP*GP*GP*AP*TP*GP*(XCY)P*GP*TP*GP*TP*AP*GP*GP*T)-3'
molecule tags Transferase/dna
source organism Homo sapiens
publication title The structure of the human AGT protein bound to DNA and its implications for damage detection.
pubmed doi rcsb
total genus 41
structure length 165
sequence length 175
chains with identical sequence B, C
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1yfhA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1yfhA01
5DEQA 5ILVA 2XKPA 4I2OA 2CGPA 3J81Z 5DCMA 1XCVA 1SFXA 3K2ZA 3DXJF 1D5VA 4M73A 1KU9A 4EJOA 3F23A 1STZA 1W7PA 1FZPB 2HOEA 1D3YA 3JSOA 1Y0UA 5J8FA 5DYMA 1Z6RA 2V6CA 3RIRA 2MH2A 1J0RA 2UXXA 1SFEA 4LJZF 4R1HA 2FSWA 2QUFA 4RS8A 1XGOA 4I98B 1YQAA 3EETA 2STTA 1BOAA 1TNTA 1R00A 2ESHA 1YLFA 5LRSA 4LD5A 3W6JB 3H92A 2CSOA 3T8TA 5D5VB 4G6DA 3HRTA 2YPRA 2DT5A 2IPQX 4D0PA 5D6EA 4LLNA 3GXOA 4WXHA 1MJBA 4R79A 1XMAA 1ODDA 1MJAA 2WTEA 2A5YB 3N97A 4L18B 3ABTA 3V8LA 3WE2A 1GXPA 4RGXA 3M9AA 3ZQ7A 3R60A 1YW9A 1O3QA 1I27A 3N4MA 3R6SA 5KVRA 2GQQA 1FBUA 3ULQB 4A0XA 5JI6A 1UCRA 2J5OA 4M74A 2JPBA 2HTSA 5L3DA 2XIGA 1QPMA 1L0OC 3TO7A 1SMTA 3LA2A 1BI2A 5CVVA 1IW7F 1ON2A 3MWMA 5DUIA 3T5XA 4CXFA 3TGNA 1XN7A 2M45A 2L01A 2LF8A 4M9ZA 3F8BA 5HDKA 4OIRF 2XKOA 2ZMEB 1DUXC 1ZAOA 2DAOA 2M30A 3DEUA 3V8KA 3F8FA 3BY6A 4K2EA 4XSXF 2VOOA 3GW2A 2XVCA 3VB2A 3JTHA 2VONA 5HS9A 1B4AA 3F8MA 3WTWC 2V1UA 2WWYA 2H09A 2RQPA 2PQ8A 5BPIA 4G7HF 1D8KA 4EMSA 2JPCA 1HKTA 3QAHA 4B8XA 2HQNA 2MBFA 4EGZA 2JT1A 3HHHA 3FXQA 3RYPA 2EFQA 3WU1B 3KFWX 4BNCA 3FMQA 3FX3A 2DI3A 2F5DA 2OZUA 2MLGA 4MQVA 1LEBA 1BM9A 3DV8A 3MQ0A 3W6KB 1TQMA 2RKHA 2GA1A 4HDUA 3DF8A 3I5UA 5LEKA 2BV6A 3J80K 2O6GE 4I0AA 1U5TC 4XLNF 5L3BA 1ZGAA 3I53A 2ZXJA 4N0BA 1U3EM 3ZMUA 2DFIA 5FFZA 4G8XA 1PP7U 1S7AA 4P96A 4KYWA 1LDDA 4BHCA 2MA3A 5K5QA 2MH9A 4L5IA 5IT9K 3JAMZ 5DCMB 2FF4A 3HYIA 3Q9VA 2QQAA 2VBYA 5CLSA 2DW4A 3D0SA 3IKVA 2KJBA 5FLXZ 2ELHA 3GF2A 1HXDA 1UHWA 3GVAA 1W5TA 4LK1F 2KKOA 1FP1D 3CO6C 4M9SA 4DQ2A 2L02A 5CVUA 3IRRA 4ESJA 3IC7A 4OMZA 1TNSA 2NS0A 2XRNA 4OOIA 4KICA 2VT3A 3FXUA 2LF7A 2PMHA 2ZJ2A 3J7AO 2FXAA 3IWFA 1HQCA 2H6CA 5D4RA 4HQMA 1DP7P 3BJAA 4ZH4F 3I64A 3BDDA 1ZG5A 4Q48A 1XMKA 3NRVA 5F6FA 2FMLA 3U2RA 2IRFG 2VC0A 1QNTA 4RGUA 3TDZC 2R3SA 3M1EA 2F5FA 1R7JA 4A12A 4RB2C 4ZYDA 3F72A 1REPC 2FEZA 2P5VA 1G3TA 5JR3A 2Y48A 4FX4A 4HQEA 3ELKA 3JAMK 2HYFA 5BS6A 3ISPA 1ONVA 4XBFA 3O3KA 3GYHX 1IN8A 3WE3A 4O6JA 1FY7A 3TQNA 2W24A 1FT9A 2L3DA 2M87A 1R1TA 2QQBA 3IKTA 2IT0A 5ERIA 2XV4S 3I4PA 2CO5A 3SZPA 2G7HA 1ZN2A 1Z1DA 2F5CA 4ZYEA 1TQIA 5LBQA 2ZCWA 1KA8A 4Y17A 2H27A 3CO7C 1QQIA 1YYVA 4NHJA 1ZG3A 1B1BA 1KU3A 4QLCU 5FD5A 5HVQC 1BN5A 2P4WA 3RPQA 3ABUA 3E5QA 4L9JA 3FF5A 2EV0A 3D5LA 1UFMA 3P7NA 4L9TA 4KN4X 1ZLKA 1V4RA 2XROA 2G7UA 4AIKA 3RTRA 2R7FA 4LLGF 4CYDA 5F64A 3OV8A 4HV5A 1LDKB 3B73A 2Z9OA 2VC1A 4HA8A 2JSCA 1L3LA 1YFHA 1J7KA 3CUQA 1XSXA 4OMYA 3F6VA 2CG4A 4RB0A 1IZ1A 2XAJA 5E20A 5LGTA 1LDJA 4ZZLA 4GXOA 3LA7A 1F1ZA 2VN2A 5CJ9A 5HS7A 4A6DA 2ESNA 1IN4A 1YTYA 2A3SA 3LFKA 5IT9Z 2EV6A 1BI0A 1G4DA 2GIVA 4I7HA 2VT2A 3TKYA 3ZPLA 3I71A 2O61A 3CUQB 5HDGA 2PMUA 1EH6A 3QPHA 4I09A 5HDNA 1BI1A 5LHIA 5DD8A 2W25A 2F5EA 3F8NA 1KQ0A 1O3TA 4M6YA 4G6QA 2LDUA 5FFXA 3V7CA 3RKWA 1B59A 1LEAA 3EDPA 3R61A 1SD4A 3FM3A 1GHCA 4HX7A 1K78B 2RC4A 3IL2A 3BOQA 2K27A 4WWCA 4HDVA 1Z05A 1I1GA 2O8XA 3KP7A 3EUHA 3HUGA 2W84A 4UV8A 4EJUA 2D1HA 3E97A 5H20A 2HEOA 4BHPA 3VEPA 1USSA 3AAFA 3EYYA 2OZ6A 3MZHA 1Z6TA 2IW5A 2GXBA 2D45A 3KETA 2D1VA 3F3XA 3QPTA 5AONA 1JHFA 4MGRA 1OKRA 4HOBA 3JTGA 3C1DA 3ERED 3GLXA 2XASA 3GEZA 5IT3A 1RNLA 3ZMVA 1RI7A 3PQJA 2IA2A 2BBYA 1BIAA 4IXAA 4EVIA 2ISYA 1ZYRF 5LEJA 3KLNA 4IRGA 5ICFA 1P2FA 1XB4A 1TBXA 4IF4A 5ICEA 1HKQA 4L0ZB 3I59B 5ICCA 1Q1HA 1ULYA 1KQ8A 4U88A 3J80Z 1IAWA 4ASNA 1R1VA 3F6OA 3DP7A 2F2EA 2QWWA 2P5KA 3HIFA 1KYWA 2VE9A 3E6CC 3QOPA 5EEHA 2EK5A 4CGZA 3DPLC 2Z5UA 4HF0A 1TTYA 3MZYA 2DK8A 2RGVA 2XUBA 3P9KA 3KP6A 1SAXA 5LLQA 5F1RA 5ED4A 3BZ6A 2FOKA 5DV5A 1PP8F 5D6FA 3H3UA 1V3FA 3BWGA 1J59A 4MEXF 4LLLA 1O7FA 4KIGA 3MAJA 2GAUA 4PDKA 4N9HA 1R5GA 3DFGA 1USTA 2OQRA 5AIQA 3R0AA 1X3UA 3ECOA 2XAQA 4CO8A 5FGMA 4O3MA 3KLOA 5HLGA 4KFCA 1U8RA 1Z7UA 1G3SA 5TJJA 4JBAA 3T1BA 4HBLA 1P4WA 2M8EA 2ZO4A 1MD0A 2XAGA 1F4KA 2HR3A 1D8JA 4UNOA 4ETSA 1ZH5A 1B6AA 4YIFA 4PGGA 5HLHA 4Q47A 2VOPA 2BEOA 3L7WA 4HX4A 3K9TA 1IF1A 4AVPA 4HW0A 3SQNA 4GGGA 1OYYA 2L54A 1FP2A 1S29A 4TV7A 3L2CA 3GFJA 5EEGA 1HSJA 3CDHA 1FPQA 4WF2A 4I02A 1OPCA 1TW3A 1YS6A 1ZREA 1BI3A 5D8LB 1PUEE 1SFUA 3MFKA 2QVOA 5ILSA 3R0JA 2Y0MA 2EFPA 1BC8C 1WRJA 3FMRA 1DDNA 2LSOA 2IA1A 4I01A 1JXSA 3ZMZA 3EYIA 3WU0A 4ENNA 2FNPA 4GO1A 3I59A 4LB6B 1C0WA 1W4MA 4OINF 3B02A 4UVBA 1NHAA 4FHTA 3HSRA 1ZG1A 1XGSA 2BE5F 3TOBA 1R5HA 2QM3A 3ZMDA 2HFHA 1JE8A 5D5UB 3ZN0A 1U2WA 1FNNA 3RDIA 5E18F 4BH9A 1SD5A 5L3GA 4RGRA 3WODF 1H9GA 3HTUA 1ZGJA 2OBPA 1IXRC 1QBJA 4FX0A 2L4AA 4ZYHA 2QYOA 4G94A 2RVCA 2ZFWA 3HSEA 4WX9A 5H6QA 1SD7A 2COMA 2EB7A 2O3FA 1K79A 1DPUA 1H0MA 1GXQA 2OU2A 1FLIA 1XCBA 2MD5A 3GWZA 4PZJA 2VE8A 4CZZA 2OAZA 2DQLA 4UVCA 4Z2YA 4G9YA 5E8GA 1W5SA 3PFIA 4LK0F 2ZKZA 4JK1X 3WTYC 1O7LA 4KMFA 3COAC 1IN5A 3ZP5A 3QRFF 2R7DA 3TO9A 1H9TA 1Z91A 5J6XA 3EQLF 2FRHA 4KMUX 4MEYF 4L9NA 1TW2A 4ENMA 4M71A 3KZZA 2TDXA 1IN6A 3IHUA 5BMZA 3C18A 2X0LA 4P55A 2DK5A 4EJTA 1F5TA 3K69A 1DPRA 2V79A 5DDGA 2ETHA 2NNYA 3ZN1A 2C6YA 5BQTA 1AWCA 1KGSA 2A07F 6PAXA 1XDSA 1O57A 2VBXA 4UV9A 3WTSC 2UWMA 3WGHA 2EFOA 3V8JA 1T0FA 4KNYA 3HOSA 1XDUA 4WK8F 4A2UA 4KIFA 5LGNA 4EM1A 2K02A 1S3JA 4XSZF 5L3FA 2JTVA 1JGSA 3DKWA 1KU2A 5D8KB 2HTJA 4IRHA 1ON1A 4JQFA 5CVRA 3BJOA 4M6XA 3E5UA 3CLOA 3BPXA 2DU9A 4HV6A 3KP2A 2D2WA 1R1UA 1MZBA 1U5TA 4RGSA 4LB5A 1JHHA 2FU4A 4CHUA 3RJPA 5HOOA 4MHGA 2ISZA 2ZNYA 3BJ6A 3WTZA 1HW2A 2YU3A 2YSRA 4L5JA 1YO5C 2PN6A 5D5XB 1HKSA 1U5TB 3KCCA 1OMIA 4A5NA 1HW1A 2GXGA 3ZMSA 3LQRA 3GFIA 1KQ9A 4XRFA 3QU6A 3SHFA 1ZRFA 3WGIA 1ZRCA 3HHGA 1R22A 2QBYB 1YW8A 1T38A 2WV0A 4Q4ZF 4MTEA 3VODA 3E6BA 4P9FA 3I0TA 5JVTA 4UHTA 2J5PA 4YFXF 1T2KA 3K1PA 4OIOF 4S05A 3HOTA 1LJ9A 1I6XA 1FOKA 2FBIA 3E6MA 1T98A 5K5RA 3NQOA 3WTVC 4FT8A 2FE3A 3Q5FA 1FYMA 2MC3A 3IWZA 4RAZA 1RZ4A 2EWNA 4OIPF 5E1ZB 1ZHFA 4IHSA 4UVAA 3WTTC 1QZYA 3F21A 4DNCA 3GUDA 2STWA 3FZVA 1P4XA 2YX4A 1LB2A 4U7DA 1SMYF 2KIMA 4YFKF 3FWEA 3LWFA 4NQWA 3E5XA 2P8TA 1T6SA 2FBKA 1AOYA 1FSEA 2Q8KA 3E6DA 2PG4A 3ML6A 2OA4A 4CDGA 1E17A 3CTAA 2CW0F 3FMSA 2E1NA 1R36A 4OU0A 1J75A 2PEXA 3HRUA 4EJWA 1CF7B 4O5VA 4R8HA 3V4GA 2VODA 5E17F 2A6EF 3P9IA 3I54A 1MGTA 3V7RA 1FYLA 2YX7A 2Q0OA 3GO5A 3SXYA 2P6TA 1WWXA 2X4HA 3RPUA 3QP5A 3ZMTA 1YIOA 1G3YA 1KU7A 4KT5C 5A2QK 2Z33A 3OOPA 1EV7A 1WSUA 2P7VB 2EFNA 2GZWA 2HWVA 5K5OA 1IN7A 2GWRA 2CWEA 4HYEA 1TLHB 2UXNA 3NEUA 4CICA 2ZNZA 4RAYA 2Q2EA 4H0EA 3ROUA 5JHUA 4AIHA 1FSHA 1IXCA 3KZYA 1P4AA 5CVJA 5D5WB 5HLIA 4BHBA 1MJ9A 1UB9A 1IRFA 4AIJA 4IJAA 4BXUA 4BQAA 1RUOA 2ACJA 3IRQA 5HS8A 2K4JA 4A0ZA 3L9FA 1KYZA 4UUVA 3BROA 3Q9SA 2HKOA 4KDPA 2PI0A 4WXDA 1J5YA 1ZLJA 3U1DA 4EM0B 4G7ZF 1BJAA 4RB1A 5LRRA 1QZZA 1R58A 1VTNC 1R23A 2CYYA 1I1SA 2DPUA 4U0VA 2A6HF 3E3VA 5L3CA 4IPAA 2FBHA 4BYYA 2ZMEA 2RDPA 2HGCA 4HAMA 3J81K 1YW7A 1CGPA 2XAHA 1WKMA 1IXSB 3O6BB 2QBYA 3C7JA 1G6NA 2HKXA 2UZKA 5A2QZ 4GYIA 2IVMA 2ZBKA 3QP6A 5LHHA 4A6EA 3KP4A 1FC3A 3G3ZA 3MCZA 4QWQA 3WTUC 2P5LC 1YS7A 4A5MA 1B9MA 1P6RA 1XGMA 2G9WA 3M8FA 2EA2A 5BPDA 4U0WA 1FWZA 1J9IA 2RNJA 2RV8A 3M7GA 3HRSA 2PJPA 1XSVA 3KEOA 2LNBA 5DD4A 1K78A 3TO6A 4XLPF 5JFRA 5DCFA 4HZFA 4LG0B 1YG2A 1FBQA 1OYWA 2NNNA 4HX8A 4NB5A 2QENA 5H6RA 3L09A 1K6OA 4IRIA 5TRDA 2VBWA 3GX4X 2FNAA 3WGGA 5FD6A 4E70A 4ESBA 3R4KA 4IVNA 2OD5A 2W85A 1B9NA 2EA4A 1K7AA 3SZTA 2BGCA 3O2PE 4WXCA 4KUMA 1T39A 3RYRA 4L9VA 4LGWA 5K1YA 3PQKA 4LG0A 3LSTA 2GA2A 4EV0A 5D4SA 4HF1A 2CQKA 3KP3A 3SFZA 1A04A 3LA3A 3KP5A 1EH7A 3CUOA 1F9NA 2E7WA 4I0BA 4L0YB 2HS5A 1XSDA 1UHMA 5AIPA 3JSPA 4LMYA 2XAFA 1I5ZA 3CUQC 4YFNF 5LHGA 2P7CB 4ENJA 4EJVA 1ZRDA 4HLXA 2QLZA 2Y75A 4F7ZA 3K1NA 2E1CA 3T0YA 4Y15A 2HYGD 4A0YA 4AWXB 5FLXK 2B0LA 2O03A 5LGUA 3JW4A 2PBIA 3TDUC 4KIBA 1WI9A 4AD9A 2EFWA 1QGPA 2V9VA 2K86A 2PFBA 1IUYA 4P9UA 4MTDA 2AXLA 2QQ9A 2KIUA 4ESFA 3F8CA 2V1XA 1TQPA 2JRTA 4ZZDA 1LVAA 2V1DA 4M9XA 2DPDA 1MKMA 3P9CA 3RKXA 3LQQA 5L3EA 4ENKA 3KE2A 4HF2A 4UXNA 3ECHA 1G3WA 1J2XA 4ON0A 3K1MA 1LQ1A 2IJLA 1XGNA 1WQ2A 2M5WA 2H94A 4WCGA 2DO7A 5BOXA 1ZARA 4GCVA 3HSFA 1FBSA 1SD6A 3WTXC 1PDNC 1GVJA 3T8RA 1FYKA 4ZYGA 5ILUA 4BAYA 3DPTA 1CF7A 4IHTA 5E1WA 3G73A 4G7OF 3GZ5A 2XGXA 4PCQA 5FO5A 2WC2A 3HRMA 4MNUA 3GFLA 3C3WA 2MLKA 3MEXA 2FMYA 2JZYA 4OIQF 3BP8A 1OR7A 2HZTA 4U7BA 2IA0A 3CJNA 4MQ9F 1RIOH 3KEQA 5E1XA 1HSTA 3L00A 1HBXG 4M72A 4P5OA 5KK1A 4EM2A 2K7LA 2PLYA 2NRAC 4GYGA 1BIBA 2NAZA 2VXZA 3FHZA 2P6SA 2KRFA 1U78A 2FQ3A 4U0YA 2A68F 2H6BA 4YG2F 2W57A 2OQGA 1O3RA 3S2WA 2IP2A 2FA5A 2CFXA 1E2XA 2DBBA 2NYXA 4RB3C 2BYVE 2DTRA 1EH8A 1S8NA 2KJCA 3M8EA 1FX7A 2A69F 1QO0D 1RUNA 1MDMA 3U9GA 3I58A 2Z3YA 3HTSB 4Q5SF 3LAPA 1IRGA 4EGYA 2VBZA 1BC7C 2L4MA 2AS5F 4YIIA 3VFZA 5CVIA 2RN7A 5E8IA 2DLLA 3WG9A 3FXRA 5FB2A 2QZ8A 4KN7X 2EJRA 3DQVC 5J8CA 2Z99A 2HDCA 1MDMB 1OYIA 2O0YA 3F22A 3VOEA 4PGHA 1BBYA 4Y13A 1XD7A 2ADUA 3V7SA 4B09A 3K0LA 2DQRA 5DUKA 4S04A 4EQQA 1S6LA 3GFMA 4HLYA 3H3ZA 2YR2A 2LKPA 1S7OA 1U6GA 1Z9CA 3RKYA 2A61A 3RI4A 3FM5A 2XHKA 3BPVA 2HQRA 4KA4A 1W7PD 3TOAA 2E7XA 2K4BA 1HW5A 4N9IA 3QU3A 1LNWA 3REOA 4LFUA 5CYVA 2M1BA 1W7PB 2EV5A 1P92A 2KIFA 5ICGA 1O3SA 3LAJA 3GZ6A
chains in the Genus database with same CATH superfamily
3LSJA 2ZC2A 5DEQA 5ILVA 2XKPA 4I2OA 2CGPA 1X6HA 2EZLA 3J81Z 2X1DA 3CZ6A 5DCMA 1XCVA 2HQ5A 2JVHA 1UG2A 1SFXA 2VKDA 3WHCA 4BY7J 3K2ZA 3BF2A 4RH8A 3DXJF 2HVRA 2EL4A 2JA7J 2FTXB 1D5VA 4M73A 1KU9A 2UUAE 1GQEA 1SVOA 4A3MJ 4NHRA 4EJOA 3F23A 1STZA 1Y1VJ 1W7PA 3VHTB 1FZPB 2HOEA 2EN8A 1D3YA 2K9LA 3JSOA 1Y0UA 4IOAF 5J8FA 3S1MJ 3OS0A 1E0EA 3ADJA 2RTXA 2M34A 1D0YA 5DYMA 1Z6RA 2KL4A 2VJIA 2G0EA 2HVQA 2V6CA 3I56I 2DA3A 4XM3A 4F2JC 3S93A 3HOZJ 3GTJJ 3RIRA 2DODA 2MH2A 1J0RA 2EJ4A 1X1CA 4BE1A 2UXXA 4LG3A 2RAEA 3OS1A 1SFEA 2GHFA 3HPHA 4LJZF 3JRFA 2Y9ZA 5IYDJ 4R1HA 4LF4E 2FSWA 2QUFA 4RS8A 2XB0X 4C3JJ 1FIAA 2E2IJ 1XGOA 2YTFA 1M1EB 4I98B 1YQAA 3EETA 1EKEA 2STTA 4BEHA 2KRCA 2M7BA 4XLEA 3THOB 1BOAA 1TNTA 1R00A 2ESHA 1FOWA 3HPZA 1TWHJ 3BG3A 1BR2A 1YLFA 2PMZA 1ZR2A 1W0TA 5LRSA 2V6EA 4WPYA 1Z3XA 2KP6A 3ONQA 4LD5A 3W6JB 4LF7E 1TF3A 3H92A 1LE8B 2CSOA 3T8TA 3K6GA 2LD5A 5D5VB 4G6DA 2UXCE 3HRTA 2YPRA 3LSHA 5GPAA 2ID6A 2CH0A 2DT5A 2IPQX 2L9RA 3BQZA 1A1JA 2L2NA 2Q8UA 4D0PA 5D6EA 4LLNA 3GXOA 5A6BA 2H1LA 4WXHA 1B72A 3PNTA 1MJBA 4R79A 1XMAA 1POGA 3P5JA 1GV5A 4B1RA 1UN6B 1N33E 1ODDA 2I9IA 1MJAA 1XS9A 2WTEA 1ETKA 2A5YB 2WA0A 3N97A 4L18B 4DV5E 1WJEA 4A3IJ 1D1CA 2ME0A 3ABTA 3MHHC 2JWTA 3V8LA 1DGCA 3WE2A 1GXPA 4RGXA 2K9QA 3M9AA 1P7JA 3ZQ7A 3R60A 2FV4B 1YW9A 2CU7A 2YTJA 1O3QA 4DV0E 3IWBA 1I27A 4G12A 3N4MA 1LPQA 3R6SA 4CCNA 3RQIA 5KVRA 2E1MB 2KHXA 4P78A 4HPQA 2LRSA 2GQQA 1A35A 1FBUA 3I9V2 3ULQB 4A0XA 4JI6E 5JI6A 1UCRA 2J5OA 4RMNA 4M74A 4II3A 4BU2A 2JPBA 3B6CA 3K2AA 3GTPJ 2HTSA 2KQRA 5L3DA 2WV1A 4F92B 2XIGA 1QPMA 3LSGA 3L1PA 1L0OC 3LOCA 3TO7A 1SMTA 2DMTA 2KHMA 2UV1A 2LYCA 3LA2A 3JTZA 1A1FA 1BI2A 5CVVA 1E3PA 2JVAA 3F9KA 1HF0A 2VUMJ 1IW7F 2F6CA 1ON2A 1XPXA 3MWMA 4BCAA 5DUIA 3T5XA 2JK3A 4DW6A 3FHNA 4CXFA 3TGNA 1XN7A 3OIQA 1DQ3A 2M45A 4IS1C 2L01A 5C4XJ 2LF8A 2TCTA 3U1KA 3SJMA 4M9ZA 3F8BA 5F08A 2NS8A 2EMWA 2OC6A 4HG2A 5HDKA 4BJ5C 1IO2A 2VB6A 4OIRF 4I6ZA 2N3HA 4R8OA 3MSWA 4FE4A 4F3QA 2XKOA 2ZMEB 1DUXC 3HGYA 4XN0A 4RAFA 3NAUA 1ZAOA 1KONA 4QSHA 3H09A 3DKYA 2DAOA 4AYBN 2M30A 4BACA 2R0QC 1WHNA 3DEUA 3V8KA 3F8FA 4GZNC 3BY6A 2P0WA 4K2EA 1MH3A 1KZHA 5E3OA 4XSXF 4YIRX 3VSLA 2HOSA 2VOOA 9ANTA 2EPNA 3GW2A 2XVCA 4JP0A 4WYQB 4GKKE 3VB2A 1YYOA 2EMHA 3JTHA 2EOZA 2VONA 4XLFA 1B4AA 5HS9A 3F8MA 3LSPA 4R2EA 3WTWC 1QZEA 2V1UA 3HM5A 3KYDB 4RHBB 4JI8E 2QF7A 2IS4A 2WWYA 2H09A 2RQPA 1X4PA 2PQ8A 2E35A 5BPIA 1AKHA 4G7HF 2XGCA 4CCOA 1D8KA 4EMSA 2RQLA 2JPCA 1HKTA 2DRPA 2IS1A 2EMGA 3QAHA 2MC4A 4B8XA 2HQNA 1HLVA 2KMUA 2X85A 2R5YB 2MBFA 2EMAA 3BTLA 4EGZA 2JT1A 1WPKA 4CCJA 3HHHA 1H89C 2WY8Q 3ZR8X 4LF5E 1XMXA 3H3VK 4LOCA 3OYEA 4LF6E 3H9JA 3FXQA 3RYPA 2EFQA 2E5LE 3WU1B 3KFWX 5F1JA 4HNVA 4BNCA 2KOUA 4CZCA 4ZTJA 3FMQA 3HZJA 1PDAA 2EP3A 3FX3A 2DI3A 2QGUA 2F5DA 1A6IA 1UHZA 4N4NB 5IP9J 2OZUA 1JJ6C 4J01A 1BW5A 4WSPA 2MLGA 4MQVA 3HL2A 2K9MA 2X48A 2WBMA 3BZCA 5F04A 4R2RA 1LEBA 2MFZA 1XTAA 1XNRE 2EMFA 1BM9A 3DV8A 3MQ0A 2LP0A 1D1AA 2XF6A 3U21A 3W6KB 2VE7C 2KONA 4JI2E 1TQMA 2RKHA 3ABKH 2GA1A 4HDUA 3K70D 3DF8A 3I5UA 1FMWA 5H2FC 4N4OB 5LEKA 2XGEA 2BV6A 2LRDA 3J80K 2O6GE 3JAMC 3CESA 1ZAAC 4I0AA 1U5TC 4AVZA 4V2FA 2QQ8A 1J26A 1X5WA 3TP0A 2E34A 4GKJE 1PJRA 2WAQA 3PSFA 4XLNF 1UELB 3K4KA 3LL7A 2DLQA 2EPCA 5L3BA 2HHHE 1ZGAA 3WHBA 1BR1A 2EPLX 3GBGA 3I53A 3L2RA 2ZXJA 5DS9A 4N0BA 2IBDA 1U3EM 5LL6R 3ZMUA 2DFIA 5FFZA 2BHZA 2JA5J 4G8XA 4NC7A 4JI1E 2RPCA 1PP7U 1JTXA 1S7AA 3C2BA 4P96A 3IWDA 4L5EA 4KYWA 1LDDA 2YU8A 4BHCA 3DLAA 2MA3A 4XRSA 3KEYA 1BBGA 4R2DA 3AV0A 4H4KC 1LFBA 3K4NA 4O43A 4AM3A 3GMEA 2M4IA 1XMQE 4A93J 5K5QA 2MH9A 2R7QA 1Y8QB 4L5IA 5IT9K 3JAMZ 5DCMB 2FF4A 5JVGF 2ELJA 3OSFA 1PJQA 3L2WA 3HYIA 2KT0A 5T6JA 4CYCB 3N05A 3Q9VA 2QQAA 2VBYA 5CLSA 1R49A 2DW4A 3D0SA 3IKVA 2KJBA 4OAZA 5FLXZ 2XDVA 2ODRD 2ELHA 3GF2A 4IKFA 2X6OA 1HXDA 2EN2A 1UHWA 4UUTA 3GVAA 1W5TA 2IS2A 1P9QC 4LK1F 2KKOA 1FP1D 2X1EA 4M9SA 3CO6C 3PNYA 3J7Yp 2LY1A 1WJFA 2VQLA 4DQ2A 2FQ4A 2L02A 5CVUA 5J1RA 3OY9A 3IRRA 2LVSA 4IX7A 4DR1E 1WI3A 4ESJA 3IC7A 1X3WB 4OMZA 3CMMA 2DT7B 1TNSA 2NS0A 5F0HA 3UK3C 2E71A 2EM8A 1TT5B 1YRNB 2XRNA 4DYCA 1NG6A 2CUZA 4OOIA 3EPKA 5J47A 1MEYC 2CUFA 4KICA 1NK3P 4M3DA 2VT3A 2HGHA 3FXUA 2LF7A 1OCPA 2PMHA 3ZQLA 2ZJ2A 3J7AO 3G4SI 2FXAA 4PK4A 3HOUJ 5F0CA 5KL7A 1TF6A 3IWFA 1HQCA 2H6CA 2YS9A 4JOMA 4MO7A 5D4RA 4HQMA 4IL6C 1DP7P 3BJAA 2JA2A 4ZH4F 1SVLA 3I64A 1ETWA 1O4XA 1N75A 5HNHA 1A31A 4DR7E 3BDDA 1ZG5A 4Q48A 2F4MB 1PUFA 1XMKA 3NRVA 2X6XA 1N3GA 4YEJA 5FKMA 5F6FA 2FMLA 1FJLA 1HDDC 2YTIA 2ECBA 5CPRB 2MKDA 3JRHA 3U2RA 1X48A 4M9VC 2IRFG 3LLHA 4IEJA 1YYWA 2B3TB 3P1XA 2VC0A 3J81C 1QNTA 4RGUA 1K83J 2ME6A 3S3NA 3HGGA 3CC7I 4FTHA 3TDZC 2R3SA 3RKQA 3M1EA 1J09A 2F5FA 1R7JA 3L2QA 2BBGA 4A12A 3LSIA 4RB2C 1IG7A 4ZYDA 3F72A 2ZSIB 1REPC 2FEZA 1MSEC 4C2UA 3M8JA 1Z1BA 2P5VA 2V4JC 1G3TA 3NWSA 5JR3A 3PIPF 2Y48A 3BR5A 4FX4A 1ZR4A 4HQEA 2KDOA 2CSHA 2KZGA 3ELKA 4PJNA 3JAMK 4IHWA 4LFCE 3ZQFA 2HYFA 3HOVJ 5BS6A 2EOEA 3ISPA 4RAGA 2BVLA 4J8ZA 1ZBTA 1ONVA 4XBFA 1WJAA 3O3KA 3GYHX 2DA7A 5JLWA 1IN8A 2A5WA 2K3FA 2MSYA 4C3HJ 3WE3A 3C6MA 4O6JA 4XQFA 3OYGA 4XR6A 1FY7A 3TQNA 2LKXA 1APLC 3GTOJ 2EOMA 3VPRA 2W24A 1FT9A 3SDGA 2L3DA 3BR2A 2M87A 3F0CA 2CV0A 3FKIJ 1N32E 2EORA 3BR0A 4RLFA 1ZR9A 4LFAE 1R1TA 3H5AA 2QQBA 5CQGA 1N25A 3IKTA 2EOIA 2IT0A 5ERIA 2XV4S 3S1QJ 3I4PA 2CO5A 2LY9A 3SZPA 2UUCE 4XOTA 2G7HA 1IBLE 1ZN2A 2RSMA 2PX9A 1Z1DA 2MGQA 2F5CA 2M1SA 4ZYEA 2NXNB 5M5YJ 1H88C 1TQIA 5LBQA 3CCEI 2DB2A 2ZCWA 1KA8A 2M4KA 4Y17A 4KITB 4RBOA 1A1GA 2EPMX 1BL0A 1OLTA 2VPLA 1WHUA 1X58A 3H5NA 2H27A 3CO7C 1QQIA 4XIDA 2CT1A 1YYVA 5A6BD 3ECRA 3H1CA 4NHJA 1ZG3A 1B1BA 2HDWA 2LOOA 1ITYA 1KU3A 1RQ0A 4R2CA 4QLCU 2EM4A 3ZQCA 5FD5A 2IGNA 5HVQC 1BN5A 2P4WA 3RPQA 3ABUA 3E5QA 4L9JA 1IMUA 3FF5A 3LFUA 2EV0A 2B7EA 3ZOBA 3D5LA 1WH7A 5KCMA 1YJ9I 1UFMA 3P7NA 4L9TA 4BQQA 3KWRA 1I39A 3AG3H 4KN4X 4CCLA 1V4RA 5C44J 1ZLKA 2M9AA 5E3LA 3BC8A 1Z67A 3SDBA 2DA2A 4PSWA 1AKHB 2YWQA 4KWYA 2XROA 3CCSI 1MMNA 2G7UA 1R6RA 4R03A 2L6MA 4AIKA 2V89A 1IBME 4ABZA 3J7AY 2V26A 3RTRA 2R7FA 4LLGF 4CYDA 4F6MA 5F64A 5EG0B 2JPAA 3OV8A 2IHR1 1RR7A 3A2KA 4HV5A 4KZSA 1LDKB 2AQFA 3B73A 1IBKE 2Z9OA 2ECCA 3CP2A 3H0GJ 5AASA 1LVKA 4Q35B 2DTZA 3Q3SA 2KIQA 2AHQA 1XG1A 2VC1A 1AH5A 5FKLA 4HA8A 4BBYA 1DGWY 2JSCA 2LY2A 1L3LA 4N4RB 1UBDC 2EOJA 1YFHA 1J7KA 4Y7NJ 2ZFUA 3CUQA 2ZJRF 2OTLI 1YUIA 2HYJA 1XSXA 3PFYA 4OMYA 3F6VA 2CG4A 4RB0A 2LH9A 2DLKA 2EMYA 1IZ1A 2XAJA 2ICWG 2DA1A 2E1MA 2NABA 5E20A 2DOFA 5LGTA 2DIXA 4DR5E 1S5LC 1LDJA 4J00A 3DTEA 4ZZLA 4GXOA 3LA7A 1F1ZA 2EMIA 3H5RA 4BJTA 4TUGA 2VN2A 1G2DC 2Z1DA 5CJ9A 4D9JA 3JR9A 5HS7A 1QHHD 4QPOA 1QVUA 1S9HA 1BA5A 4LU9A 5J1UA 4A6DA 2W4SA 1R4MB 1W1WE 2BHYA 5GP9A 2FD5A 2ESNA 3JRIA 3ZCOA 5M3MJ 5FRMA 1IN4A 1YTYA 2WAEA 2K4VA 1VQOI 2A3SA 4M3EA 1X1BA 3LFKA 5IOYA 5GPCA 3S15J 2HI3A 5KHDA 1ETQA 3JRCA 5IT9Z 2EV6A 1BI0A 2M0CA 2X6YA 2GIVA 4I7HA 1G4DA 2LBSB 2VT2A 2EIMH 3QYBA 3TKYA 3ZPLA 1UMQA 3I71A 4DYQA 2O61A 1NH3A 2YZTA 4XORA 3CUQB 5HDGA 3OYIA 4ZYAA 3A0HC 2PMUA 1EH6A 2DMIA 1WXRA 2VQHA 4DV4E 3QPHA 2NUEA 4I09A 5HDNA 4DR2E 1BI1A 5LHIA 3KYCB 5DD8A 2W25A 3CF2A 3C4BA 1VQ4I 2F5EA 3F8NA 1KQ0A 2XF7A 3HPGA 1O3TA 4M6YA 4G6QA 3W2AA 4DKKA 2WB1N 2LDUA 5FFXA 3V7CA 5F27A 3J7YJ 2ID3A 3RKWA 2QSFX 4AC0A 3VYSB 3K4CA 1B59A 1GUUA 1LEAA 2EILH 1RR8C 3EDPA 3R61A 1IV6A 2VQEE 1SD4A 3FM3A 1GHCA 1KJKA 4HX7A 4BE0A 1U8BA 1K78B 1LE8A 2RC4A 2R7TA 3ERMA 3IL2A 3HOYJ 3BOQA 1LKXA 2K27A 4WWCA 4HDVA 1Z05A 2H36X 1BJZA 1I1GA 2O8XA 3KP7A 3EUHA 2BB8A 4E7KA 2LTPA 3HUGA 1TWGJ 1VFCA 1JUSA 2W84A 2EOFA 4UV8A 2VJ5A 4LFBE 3FBNB 2A6TA 2UU9E 2CV2A 5B5EC 2JYAA 4EJUA 2DMYA 3JCUC 2D1HA 2DYRH 3E97A 4DUZE 5H20A 2HEOA 4BHPA 2KISA 3VEPA 1USSA 3AAFA 5A6KA 3EYYA 2OV7A 2OZ6A 3MZHA 1FEXA 1Z6TA 2IW5A 2GXBA 2BY3A 2D45A 3KETA 2M7QA 2D1VA 3F3XA 3QYEA 3QPTA 1Y0NA 4XKVA 2V85A 5AONA 1JHFA 2LG4A 4MGRA 1U0JA 1OKRA 2M2EA 4HOBA 4RM3A 4Z6YA 4HNUA 3JTGA 2EPAA 1LFPA 1FTZA 3C1DA 3ERED 3GLXA 3OYMA 2XASA 3GEZA 4E7LA 3DJWA 2CMPA 2HPIA 5IT3A 1RNLA 3ZMVA 1B69A 1VNDA 4A3KJ 1RI7A 2IAIA 2MYSA 3PQJA 2IA2A 4MLOA 5AE2A 5FROA 2PMZN 5JHFA 3ASOH 4BBRJ 3MKWB 2HVSA 3HEFA 4IHYA 1MMSA 2W7NA 4XKCA 4PFPA 2BBYA 4DOZA 1BIAA 4IXAA 4M3BA 2ISYA 2VJ4A 4EVIA 4B48A 2DMPA 1ZYRF 4W97A 2AQEA 5LEJA 3KLNA 5GAGJ 4IRGA 2LR8A 5ICFA 1P2FA 1XB4A 2VLAA 4JYAE 4NC8A 1NTCA 1TBXA 2R7OA 4IF4A 1PVEA 2CQ7A 3QQAA 4X62E 1SR9A 3TQMA 5ICEA 1MBGA 5EGOB 1VQ6I 1HKQA 3DTKA 2MC6A 2P81A 4L0ZB 4HTGA 3I59B 1LUJB 5ICCA 1Q1HA 2K3PA 1ULYA 1KQ8A 4U88A 3J80Z 3AL0C 1ETOA 1LLMC 1IAWA 1QHGA 4ASNA 1R1VA 3F6OA 1K61A 3DP7A 1AA7A 1Z21A 1U9NA 2F2EA 2QWWA 1X2MA 2P5KA 3HIFA 1KYWA 4DZJA 2V88A 2VE9A 5J1YA 3MD2A 3E6CC 2GPIA 3QOPA 5EEHA 2ENHA 2EK5A 3BG5A 5EYRA 4CGZA 3DPLC 2Z5UA 4HF0A 1QA6A 4XICA 4GEQB 3Q0WA 1TTYA 3MZYA 3EPZA 2DK8A 3THNA 2BY1A 3GLLA 2RGVA 2XUBA 3P9KA 3KP6A 1SAXA 2BXZA 5LLQA 4IZZA 2RS7A 4DR3E 5F1RA 5IY5H 1GDTA 5ED4A 2EZKA 3BZ6A 2FOKA 2NVXJ 5DV5A 1PP8F 1AAYA 4C2TA 1SVMA 2MD0A 1JJ8C 5D6FA 2DCEA 3H3UA 1V3FA 2W82A 5B66C 3BWGA 1J59A 2V86A 1I94E 1DQUA 1T08B 4MEXF 4PJ0C 3I55I 4LLLA 3OYDA 1O7FA 2K5CA 3A01A 3C6KA 4KIGA 4P7DA 2EPRA 3MAJA 4OOGC 2E60A 2ELKA 2GAUA 2W00A 3UKGA 4PDKA 1S72I 4N9HA 1R5GA 2COBA 2L0KA 3A4CA 3AG1H 4E6KG 3DLLF 3CCVI 3S2HJ 1O0WA 2VF1A 3DFGA 5LMNE 4II2A 1FOYA 1USTA 2CUJA 2OQRA 2WADA 5AIQA 3R0AA 3ZGKA 1X3UA 1UHSA 1MNMC 2IGMA 3ECOA 2XAQA 3H35A 4CO8A 1NCSA 5IV8B 2ZB9A 1SC7A 1XX5A 5FGMA 2WB1A 4O3MA 5IT9C 3KLOA 4CA0A 5HLGA 4F91B 2ENCA 4DV6E 3RCOA 4KFCA 1U8RA 1Z7UA 2CRGA 2LV2A 1V5FA 1G3SA 5TJJA 2KDZA 2EPUA 4JBAA 3T1BA 4O5GA 4HBLA 4LITA 1P4WA 2M8EA 5LFAA 3D1NI 4C3IJ 2Q2EB 2N8XA 2ZO4A 4IQJA 1MD0A 2XAGA 5DNYA 4PJMA 1F4KA 2HR3A 2Y0SN 1D8JA 3OYLA 3DCFA 4ETSA 1UZCA 2KPMA 1B6AA 4AU7A 4YIFA 4PGGA 5HLHA 4UNOA 1IDZA 1D1BA 4ITVA 4Q47A 5KL4A 2VOPA 2BEOA 2BXYA 3L7WA 3S1RJ 2YU9J 1IQOA 4AQYE 2N3GA 2YUSA 4HX4A 3K9TA 3BG6A 2XC7A 3VYXA 1Y6IA 4DYRA 2R1FA 4RDUA 1IF1A 4E7HA 1RETA 2K40A 2Y0SA 2DMQA 4AVPA 4HW0A 2YRMA 5GAEJ 3VYYA 2BVMA 3SQNA 4E7JA 4LF9E 1X1AA 4GGGA 1OYYA 4DUYE 2L54A 1FP2A 2EN3A 1WH5A 3CCJI 1S29A 4TV7A 5J4VA 4HRIA 3GFJA 3L2CA 1OJLA 5EEGA 3K70C 2L7ZA 2R76A 1HSJA 3OIPA 3OR1C 3CDHA 5C4JJ 3MHSC 2EL6A 2EBIA 3Q0UA 1FPQA 3VDXA 2EMLA 1MMDA 4BMJA 4X1EA 2BZTA 3VYTB 4WF2A 2F48A 4M3FA 4A3LJ 4I02A 1OPCA 1TW3A 1YS6A 2BW3A 4FQGA 3GCMA 1ZREA 1VQ7I 1BI3A 2VKHA 5D8LB 1PUEE 1SFUA 3MFKA 2QVOA 5ILSA 1X1PA 5IP6A 2EMCA 5IXMB 3R0JA 2Y0MA 2EFPA 3TW7A 2DGCA 1BC8C 1WRJA 3AL0B 3FMRA 3GTGJ 2O7OA 4BJ6C 2EM3A 2LCEA 1DDNA 4JI0E 4XN3A 2LSOA 2IA1A 2WAQN 4I01A 1JXSA 1XMOE 2JRMA 3ZMZA 2ZXIA 3DBRB 4B3ME 1Z3YA 4B44A 3HOXJ 2LFBA 3EYIA 3PO3J 2EINH 3WU0A 3UNGC 2VRDA 1OCZH 2FNPA 4ENNA 4BE2A 4GO1A 3I59A 2R93J 4LB6B 1C0WA 1W4MA 3OMYA 4OINF 3B02A 4UVBA 1NHAA 2CW8A 2ZMEC 4FHTA 3HSRA 3M3YJ 5E3NA 4XONA 1TWFJ 2MDRA 1IGNA 1ZG1A 1J5EE 2HU9A 3S1NJ 1XGSA 3W2WA 2BE5F 3TOBA 1R5HA 1FKAE 2QM3A 2HZDA 3PJRA 3ZMDA 2HFHA 1JE8A 5D5UB 3EPLA 3ZN0A 2V1NA 5IPAA 1JK1A 1U2WA 1FNNA 3RDIA 4FE7A 5E18F 2NVUB 3EPHA 2EMKA 1F2IG 4BH9A 1JT0A 2GXAA 3BCBA 1SD5A 2IGOA 1V55H 5L3GA 1MBJA 1ZH5A 4F6NA 4RGRA 1YITI 3WODF 2LT7A 5HODA 1H9GA 3HTUA 2CJJA 3W3CA 1R71A 1YHQI 3HBLA 1ZGJA 2UUBE 5M3FJ 2OBPA 2JOBA 2L7KA 1JUMA 3VYRB 1DU6A 1PUFB 3IAM2 3RZOJ 1IXRC 3BQYA 4FX0A 2L4AA 5KAIC 4ZYHA 1QBJA 3ZOQB 2OJED 1ETXA 4V2GA 2MC5A 2QYOA 5K7HA 2F4OB 2HPMA 4G94A 2RVCA 3FXJA 2ZFWA 2M9HA 3A01B 3HSEA 4WX9A 4EATA 5H6QA 1SD7A 4U87A 2COMA 2EB7A 2O3FA 1K79A 4BXFA 1DPUA 2EPKX 1RKTA 1SEUA 1H0MA 2XAUA 5F0FA 1GXQA 1SAUA 2OU2A 1ENHA 2DA5A 1FLIA 3KPHA 3CCYA 4O24A 1OCCH 1XCBA 1R5ID 4WSGA 2LKSA 2E5NA 3UR3C 3TEDA 5KAFC 4F52A 2PJRB 2MD5A 2L7FP 3GWZA 4PZJA 2VE8A 2V7FA 5JLXA 4CZZA 2YRKA 2OAZA 4NNJA 2EM6A 2DQLA 1ZTRA 4UVCA 4Z2YA 4BL0B 2QKMB 4G9YA 1T95A 5B1BH 1X6FA 2HJJA 5E8GA 1G59A 3T1HE 1W5SA 3PFIA 4LK0F 2XSDC 4ZC3A 4M6VA 1RKWA 4UB8C 2ZKZA 2ELYA 2GOMA 4JK1X 4NBQA 5DM7F 1O7LA 3WTYC 4KMFA 3COAC 1IN5A 3ZP5A 4WFTA 3A03A 3ZQGA 4BY1J 3QRFF 2R7DA 3TO9A 1H9TA 4XNFA 2LO3A 1Z91A 1I6HJ 5J6XA 2FUG2 2V87A 5IYBJ 3EQ1A 1YX3A 2DYSH 2EIJH 2X1CA 5EZHA 2LUQA 3K4BA 1YOVB 4B3RE 3EQLF 2FRHA 4KMUX 2VASA 2EE8A 2O8KA 4JV5E 1BOBA 4MEYF 3S2DJ 4NZVA 1GV2A 4L9NA 1V5EA 4JI7E 4Y52J 1IRZA 1TW2A 1MSFC 4DJAA 4ENMA 3EPJA 3DBLB 4M71A 2FOWA 2K9SA 3KZZA 5FKKA 2MKNA 2LC2A 3B6AA 3SFIA 1UG0A 3ADLA 3BTJA 2TDXA 2R7UA 2JUCA 1IN6A 3IHUA 3PUFA 5BMZA 3CC4I 1IRXA 2VQFE 3C18A 2X0LA 4P55A 2IS6A 2DK5A 3DBHB 3LMMA 1HNWE 4LF8E 1MNEA 4EJTA 3C4TA 1F5TA 2HNHA 4Y3OA 2FGGA 2BW3B 4MFEA 3PO2J 3DEWA 2YSPA 2DN0A 3K69A 1DPRA 1Y1WJ 2NUGA 2V79A 5DDGA 2XSJC 2ETHA 1H8AC 2NNYA 3ZN1A 2C6YA 5BQTA 1AWCA 3OYFA 3FXLA 4LIVA 1KGSA 2A07F 2E19A 4UUSB 6PAXA 2K7IA 4B3XA 1XDSA 4A3BJ 2DFFA 4F54A 1O57A 1MMGA 2NOJB 2L8TA 1V54H 3IH2A 3S32A 2VBXA 4UV9A 2WBTA 1U9OA 3HTXA 3PUBA 3WTSC 3AG2H 1MW7A 2HC5A 2UWMA 2ZXHA 2EFOA 3WGHA 2EN6A 1W36C 3V8JA 1D0XA 1YI2I 1T0FA 2DDBA 1TT0A 4FASD 3QOEA 4KNYA 1E3HA 4OX9E 3RQ4A 3HOSA 1B8IA 2CS3A 4NC6A 1TC3C 1XDUA 4WK8F 1DI2A 4A2UA 4KIFA 2Q1ZB 5LGNA 2DMUA 4EM1A 2K02A 1S3JA 4HSRA 4XSZF 2L2OA 1JKOC 5L3FA 2JTVA 2TRTA 4E7SA 1JGSA 3CJTB 3DKWA 4XMYA 2VQCA 5FRNA 3OTOE 2IEKA 1KU2A 2EMBA 2UXDE 5D8KB 3M4OJ 2HTJA 3AG4H 4IRHA 1ON1A 4JQFA 5CVRA 3BGHA 1MBEA 2Y2ZA 3BJOA 4M6XA 3E5UA 3JRDA 1G2HA 3CLOA 4FCYA 2DJIA 2OCEA 2V9PA 3BPXA 2DU9A 1DU0A 4HV6A 1BB8A 3KP2A 3T1YE 2D2WA 1R1UA 3M1CA 3OL3A 2X6WA 3SZGA 1EKZA 3H36A 4BQNA 3EUAA 1MZBA 5EEAA 1U5TA 5DM6F 2X9DA 1B8IB 2NOGA 1NEIA 5K7ZA 4RGSA 2E1OA 4LB5A 3W2VA 1JHHA 1A1LA 2R7XA 1BW6A 2FU4A 4BUPA 2M8GX 4CHUA 1GZ6A 2LJUA 3RJPA 5HOOA 1VZ0A 3D5RC 1X19A 4MHGA 2BY0A 2ISZA 2ZNYA 3BJ6A 2YTGA 2VKEA 3BCAA 4BGDA 3WTZA 1HW2A 4I76A 4GFBA 2DDAA 2EZIA 3CD6I 2YU3A 2YSRA 3FKJA 4L5JA 3GTQJ 1YO5C 2PN6A 2Y31A 5D5XB 1HKSA 3RZDJ 2EOQA 1U5TB 3KCCA 4RA2A 1OMIA 4A5NA 3VWBA 4X8WA 3J80C 2DXIA 2R7ZJ 3HJEA 3PM1A 1HW1A 2GXGA 3ZMSA 1ZBQA 3LQRA 1FTTA 1ZK8A 4AUXA 3GFIA 3S3OA 3LNQA 1Y39A 1KQ9A 2E36A 4XRFA 3QU6A 3O8GA 3SHFA 3L2UA 1ZRFA 3WGIA 4PJJA 1XC5A 1ZRCA 2O9LA 3HHGA 1R22A 2R4GA 3BTIA 2ZM6E 2L5QA 1WFXA 4BBSJ 4X64E 3G1LA 2QBYB 2YTNA 4M30A 3IH4A 1YW8A 4CYCA 3BG7A 5HNFA 3MKYB 1T38A 2WV0A 4XRMA 4Q4ZF 4ZDOA 3HQ1A 2BOLA 4MTEA 3E6BA 4P9FA 3VODA 4MLQA 3I0TA 3FK6A 5JVTA 2JR1A 4UHTA 4X0GA 4LTYA 2J5PA 4YFXF 1T2KA 3K1PA 4FETA 3AFHA 4OIOF 3OR2C 4UB6C 3OYCA 4OWRB 1YSAC 4S05A 1WJCA 3HOTA 4PJLA 1L4SA 1RESA 1LJ9A 3JRAA 1I6XA 2CW7A 1FOKA 2FBIA 3E6MA 3S8PA 1T98A 1ETVA 5K5RA 3NQOA 4OAYA 3ZQIA 3WTVC 4BDYA 4FT8A 4AIDA 1BR4A 2FE3A 2XB5A 3TBIA 2R5YA 3Q5FA 4B4CA 2EOYA 2HQAA 1FYMA 1Z7LA 2GIZA 2DFEA 3BTCA 5BR8E 2EOOA 4I99C 2MC3A 3IH3A 2JA6J 2DA6A 1I3QJ 3IWZA 2EPXA 2L2MA 3ASNH 4RAZA 2GBYA 3PIOF 5AE3A 1RZ4A 3QWLA 2I5UA 2EWNA 4OIPF 5E1ZB 2GM4A 1UAAA 1ZHFA 3BR3A 2Z16A 3JRBA 5LD2C 1PYVA 4IHSA 4DGWB 3BBGA 4CCMA 2V9KA 4UVAA 3WTTC 4JX6A 5GTHC 1JK2A 1QZYA 3F21A 4DNCA 2A25A 3HKZA 3GUDA 1VQKI 1YPNA 3CJRB 2STWA 3FZVA 1ZKGA 4A3JJ 2QEXI 2ENAA 2GLIA 1P4XA 5A2QC 2YX4A 1LB2A 4U7DA 1SMYF 2L3JA 3S16J 3TL4X 2LTRA 3ADGA 4DR4E 3IV5A 2KIMA 1GVDA 1TL8A 3FDYA 1ETYA 4YFKF 3FWEA 5AE1A 3ADIA 3LWFA 2OCCH 2DOAA 2LK2A 2I10A 4P1WA 5FLMJ 1X4OA 4A3DJ 3OYHA 1IC8A 3OOUA 4NQWA 3E5XA 1R9TJ 2P8TA 5GTIC 1T6SA 2M0MA 3OYAA 2FBKA 3AUZA 2PRTA 1AOYA 2VQGA 1FSEA 4DV1E 1UJ8A 1T8IA 4I8OA 1JTYA 2Q8KA 3E6DA 3OYNA 2PG4A 2OPTA 3ABLH 3ML6A 2OA4A 4CDGA 3RMPA 1E17A 3CTAA 4DV3E 2CW0F 3FMSA 2AO9A 2E1NA 1PJTA 4G6TB 3H0DA 1R36A 2IGKA 2YRHA 4ZDPA 2EOXA 4OU0A 2YSOA 2PEXA 1J75A 4RLQA 4F55A 3HRUA 1VQPI 1EA3A 4EJWA 3VK6A 1YJWI 1T4OA 5M5WJ 1JKQC 4NDLA 4O5VA 1IDYA 4R8HA 1CF7B 1QU3A 1TZLA 3V4GA 2DMNA 2VODA 3IWCA 5E17F 2LJHA 3OIOA 1QPIA 3K6QA 4ZDLA 2A6EF 3P9IA 1X1DA 2OUMA 2RQQA 3I54A 5FKOA 1MGTA 4BDZA 3BT9A 1XNQE 1OCTC 2F4VE 3V7RA 4D7NA 3FISA 1FYLA 2ADRA 4PSXA 2YX7A 3BZKA 2Q0OA 4YELA 3GO5A 3O8HA 3SXYA 2R5ZB 2P6TA 2EPOA 4NXME 1WWXA 2X4HA 2WY7Q 1P47A 3RPUA 4AYBA 3QP5A 4CCKA 3ZMTA 3ABMH 1YIOA 1G3YA 1KU7A 2EOSA 4KT5C 2R92J 5A2QK 1WHQA 2Z33A 5EF6A 3OOPA 4GDFA 1EV7A 2EZ6A 1OFCX 2LREA 3G1MA 1WSUA 2P7VB 2EFNA 1ZU1A 2GZWA 2HWVA 2EQRA 2QSGX 5K5OA 4JYKA 3FBIB 1IN7A 2GWRA 3MKZA 1VQ8I 4L5NC 2CWEA 1NK2P 4HYEA 1TLHB 2UXNA 3NEUA 4CICA 2ZNZA 4RAYA 3A0BC 2Q2EA 2AXTC 4H0EA 3ROUA 5JHUA 3CDIA 5IP7J 1WGXA 2CV1A 4AIHA 1FSHA 1IXCA 3KZYA 3QODA 1YE9A 1P4AA 5CVJA 2LMZA 3I4MJ 5AC5A 2EMZA 1SFOJ 1EF4A 5D5WB 1YJNI 5HLIA 2MDGA 4Q28A 4BHBA 4KJZA 1MJ9A 1UB9A 1EJ9A 1JGGA 4S0HB 1IRFA 1VQMI 3F6HA 1T4NA 5CQEA 4QPQA 3RSNA 2ODRC 4AIJA 1TN9A 2L33A 2PJRA 4IJAA 2QCOA 1PKPA 4BXUA 4BQAA 2F4IA 4C2MJ 3HXLA 1RUOA 2ACJA 5IWAE 3JREA 3IRQA 2EN4A 5KL6A 1MMAA 5HS8A 1ZELA 2K4JA 2EPFA 4A0ZA 3EUHC 5BNGA 4ZJZA 5J4YA 5LMUE 3K4LA 4XK4A 5CFFE 1YUJA 4HNTA 2L7MP 1KYZA 3L9FA 1VF9A 2CQXA 5FLXC 3WG7H 1FJGE 4UUVA 4Y33A 3BROA 4R2PA 1V5GA 2DT6A 4J19A 3Q9SA 2HKOA 4KDPA 2NVQJ 1T0FC 2PI0A 4WXDA 1J5YA 2JMWA 1ZLJA 3FK7A 3U1DA 4PUSA 4EM0B 3J7ZI 2Z2SB 2OTJI 1T56A 1WJPA 2K9NA 4G7ZF 5E79C 1BJAA 4RB1A 1A1HA 4QIWN 2Y30A 3KZIC 2DOEA 2CUEA 5LRRA 1QZZA 1R58A 5FJ8J 1VTNC 1R23A 2CYYA 1I1SA 4NXNE 1YZ9A 4K0KE 3D5SC 3KIOA 4XLHA 2DPUA 2YTEA 1GT0C 1UILA 3LSMA 4BC9A 2HOTA 1OISA 4U0VA 5KNLA 3W6VA 2A6HF 1AU7A 1JI8A 2NVYJ 4D7MA 3CCUI 4BEHB 3DU6A 3E3VA 5L3CA 5GADJ 4IPAA 2QA4I 2FBHA 4BYYA 4DV7E 2WZOA 2ZMEA 3IP4B 1SANA 1ORKA 1FIPA 3CQZJ 4FK5C 3K4MA 4YHHE 2RDPA 2HGCA 3C2HA 4HAMA 3CMEI 3J81K 1YW7A 1CGPA 2XAHA 1WKMA 1IXSB 4XL9A 2EQ0A 3O6BB 4HEA2 1VI0A 3C7JA 1G6NA 2QBYA 2CTDA 2HKXA 2O5RA 4CUGA 5A2QZ 2UZKA 2BY2A 4NUBA 4GYIA 1BBOA 2IVMA 2ZBKA 3QP6A 1VQNI 2M3AA 5LHHA 4A6EA 3KP4A 1FC3A 3SEQA 1X2NA 3CCRI 3G3ZA 3MCZA 4QWQA 4A3FJ 1Z0XA 4CSWA 4IO9F 3WTUC 2R7VA 5FKNA 2P5LC 1YS7A 2XGDA 4XKWA 3TP3A 4A5MA 1B9MA 4D1QA 1I3AA 1P6RA 1XGMA 2G9WA 2H8RA 2EQ1A 3DWLE 3HDDA 1WJ5A 3NARA 4PFOA 3OWTA 2JVGA 3M8FA 2EA2A 2VPRA 5BPDA 4U0WA 1MH4A 1FWZA 1J9IA 2RNJA 3OYJA 2RV8A 2E5ZA 2OF7A 3M7GA 1RC9A 1TWAJ 3L2VA 1RPWA 1HA8A 3HRSA 2PJPA 1QU6A 1XSVA 3KEOA 2R5ZA 2LNBA 5DD4A 3S17J 4A69C 2L92A 1K78A 3TO6A 4XLPF 5JFRA 2RS6A 3DKXA 3E0JB 3CC2I 3X2QH 1HDPA 5DCFA 4HZFA 4LG0B 5EG0A 1YG2A 2B63J 3C2GA 2B9SA 4C30A 1FBQA 3FXKA 1OYWA 1X3CA 2NNNA 4HX8A 4DZPA 1STUA 3KX2A 1N34E 4NB5A 2YT4A 3TW6A 4R2QA 4F9BB 3CJQB 2ZJQF 1W0UA 2QENA 1OR7C 2CQNA 2E2JJ 2B7TA 3M07A 5M5XJ 5H6RA 1ACIA 2CFOA 2LBFB 1YIJI 1F43A 3L09A 2FX0A 5TGTA 4A3GJ 1P7IA 1K6OA 4IRIA 1MIJA 2JUGA 5TRDA 2VBWA 3GX4X 1ZQ3P 1Y8RB 2FNAA 3MN2A 1K4SA 5AC4A 3WGGA 2H1KA 2EMXA 5A69A 5FD6A 4E70A 4ESBA 3CMAI 3DPUA 4XLAA 1VQLI 3R4KA 3K4JA 2OD5A 4IVNA 4QTRA 2W85A 1IQSA 4O4KA 3BG9A 5E3MA 1B9NA 2EA4A 1K7AA 3SZTA 1N36E 3CMYA 2BGCA 2EH3A 3O2PE 4WXCA 4KUMA 4XLCA 5EZGA 3CF5F 1T39A 3RYRA 4L9VA 4LGWA 5K1YA 3PQKA 4D5CA 2JQ7A 1KYQA 4LG0A 2EN7A 4B3AA 3QPSA 3LSTA 2GA2A 2LMDA 4EV0A 5F3WA 5IYCJ 4BC7A 5D4SA 2CQKA 4HF1A 4BS9A 3KP3A 4BXXJ 1A6QA 2DA4A 3SFZA 3DF6A 1A04A 4JX5A 3LA3A 3KP5A 1EH7A 2KFDA 3CUOA 4XRSG 3RPUD 3KYLA 3PNVA 2LVHA 1X49A 1F9NA 2EM9A 2EZHA 2LBFA 1HC8A 2E7WA 4I0BA 1W36D 4L0YB 2HS5A 2HOAA 1XSDA 3G6EI 4UY8I 5ADZA 4E7IA 1UHMA 5AIPA 2KRHA 2VJJA 3PSIA 4LMYA 3JSPA 2XAFA 1I5ZA 3CUQC 4YFNF 1B72B 5LHGA 4NQWB 2EOHA 4RM2A 1RMDA 2WBUA 2P7CB 5EGOA 1PJSA 4ENJA 4EJVA 3E7LA 3Q0VA 4HLXA 1ZRDA 2LLKA 4FISA 3A1YA 4ZTFA 3IUOA 1QVTA 3FXOA 2QLZA 2Y75A 4F7ZA 5TISC 2R7SA 3K1NA 2YTQA 4DIQA 4LIUA 2E1CA 5IOZA 2EM5A 3CCLI 5A6AA 3IAS2 1Y56A 2HYGD 4Y15A 3T0YA 4A0YA 2EM2A 2WCC3 4JI3E 2J7JA 2WBSA 4AWXB 1TP4A 4CH7A 2JXPA 2K85A 5FLXK 1YYKA 1F36A 2L9SA 3G2BA 4DV2E 3CP8A 3QPLA 3BR1A 2B0LA 2ZXWH 2ZJPF 4JI5E 4DR6E 2O03A 3NWTA 5LGUA 3JW4A 2PBIA 4HEIA 3TDUC 2HXIA 1RRJA 5KL3A 4X66E 4KIBA 1WI9A 2NUFA 4AD9A 2V8QB 2EFWA 1QGPA 2V9VA 3ZXSA 2QSHX 2K86A 2PFBA 2ELZA 3WU2C 5J3LA 1IUYA 4P9UA 4X9JA 3DTIA 2R7WA 1E3OC 1MNDA 5TSEA 4MTDA 1WCMJ 2AXLA 2EPZA 2QQ9A 2KIUA 3TMOA 4ESFA 1A36A 1T4LB 2YTDA 2UUZA 1HR0E 2CQQA 2FJ1A 2KZVA 1TQPA 2V1XA 2W1OA 2JRTA 3F8CA 4ZZDA 3DU5A 1LVAA 2JN6A 2V1DA 2DFHA 4X65E 1FOXA 1N77A 4M9XA 3M99B 4XOPA 1MKMA 2DPDA 3P9CA 2W48A 3RKXA 1QRYA 3LQQA 2JY9A 2XRLA 5L3EA 4ENKA 4YY3E 1S7EA 2VXDA 3PL8A 3LSRA 4Y4RA 3S14J 2D9HA 3KE2A 4HF2A 1JT6A 3I4NJ 4UXNA 4F93B 2YU5A 2MABA 3BR6A 3ECHA 2CPNA 1D0ZA 2DJNA 1G3WA 4ANJA 1J2XA 4JI4E 3QG5C 4IHVA 4ON0A 2EQ3A 4R2SA 1DP3A 3K1MA 3OYKA 1LQ1A 4B47A 3GTKJ 2IJLA 1XGNA 2RREA 1WQ2A 2M5WA 4UUSA 2H94A 2H8WA 3E1SA 5CKTA 4WCGA 3HB9A 2DO7A 3F6GA 5BOXA 1ZARA 4GCVA 3HSFA 1ZGWA 1N78A 3GZNB 3FIWA 4V19K 1YRNA 2Y69H 3A02A 1FBSA 1SD6A 1TWCJ 3WTXC 1PDNC 3AKZA 4B3SE 1GVJA 3T8RA 4ZYGA 5ILUA 3H9QA 4BAYA 1FYKA 3DPTA 4F9CB 4B3TE 4XKBA 1CF7A 2N8GA 2LUPB 3OL4A 5E1WA 3G73A 1Q1VA 4IHTA 4G7OF 3GZ5A 3LMLA 2JP9A 2YPNA 4DMIA 2XGXA 3CCQI 4KISA 4PCQA 5FO5A 2WC2A 3HRMA 4E7ZA 4MNUA 3GFLA 3ZRGA 3C3WA 2MLKA 4D5FA 3I3LA 3MEXA 2FMYA 2JZYA 4OIQF 3BP8A 3ZQQA 4M2ZA 1OR7A 4M3GA 2HDDA 2A05A 2HZTA 3MMYB 4U7BA 2R7RA 4C9YA 2IA0A 3CJNA 3OSGA 4MQ9F 1RIOH 1NG7A 4F9AB 4B43A 2JJ7A 1OCRH 3KEQA 1SFKA 5E1XA 1AHDP 1HSTA 2KLOA 2JWOA 5HLTA 3L00A 3G1OA 3MZ8A 1HBXG 4M72A 4P5OA 2EM7A 5KK1A 1A1IA 1Z77A 4EM2A 2K7LA 3OYBA 1WZ2A 3JU0A 5B3SH 2PLYA 3BIDA 2NRAC 4GYGA 1BIBA 4IJDA 1WVRA 2NAZA 2VXZA 5DTDA 3FHZA 2P6SA 2V83A 2MW8A 1X6EA 2KRFA 1U78A 2L9VA 3G71I 1WJDA 2YTOA 2M7AA 3S3MA 2FQ3A 4U0YA 4MLVA 2A68F 2H6BA 4YG2F 2F5VA 2W57A 1G2FC 4W1UA 2OQGA 2WAFA 3S2WA 1O3RA 2IP2A 2CFXA 2FA5A 3MKLA 1HNZE 4GRIA 1E2XA 2DBBA 2NYXA 2IXSA 3VSKA 5J40A 3VYUB 4RB3C 3CLQA 1D5YA 2BYVE 2DTRA 1EH8A 3J7AG 1S8NA 2KJCA 3JRGA 3ZQHA 1GTKA 2JSPA 2UXBE 5C3EJ 1OCOH 2HXOA 1JKPC 1R4NB 3M8EA 1FX7A 3CDLA 5EJCA 1MBHA 2A69F 5GAHJ 1LFUP 1W5CC 1JUPA 1QO0D 1IV8A 2Y9YA 1RUNA 2JOXA 2M4GA 1MDMA 3U9GA 3ESWB 3I58A 2Z3YA 3CCMI 2L2KB 3HTSB 4Q5SF 2XPUA 3LAPA 5KL5A 1IRGA 3HPSA 3OMLA 2ZSHB 5B1AH 4EGYA 2VBZA 4IOCF 1BC7C 2L4MA 2B7VA 5FLVA 2AS5F 2YTPA 4DBQA 4YIIA 2EPPA 2NS7A 3V42A 4KT6A 5CVIA 2RN7A 2VIXA 3VFZA 5E8IA 3GTMJ 2DLLA 3WG9A 1RC7A 4KHPE 3FXRA 5FB2A 1K6YA 2QZ8A 5EDNA 4KN7X 2EJRA 2I8DA 4DBRA 3DQVC 4E4HA 2Z99A 5J8CA 2HDCA 4BQOA 1IJWC 1MBKA 4HSTA 1MDMB 1OYIA 3SYTA 2EIKH 4JX4A 4BKXA 2EWLA 2O0YA 1A5JA 2LE2A 2VI6A 3LSKA 3F22A 1HOMA 3VOEA 2E72A 2E2HJ 4PGHA 1BBYA 4Y13A 4L8NA 1XD7A 1CQTA 1GLNA 2ADUA 4R2AA 2I13A 3V7SA 1DGRM 4B09A 3K0LA 2DQRA 5DUKA 4S04A 1T33A 1VQ5I 3K7AJ 3BLYA 4EQQA 1S6LA 2XF5A 3GFMA 4HLYA 4X6AJ 2GLOA 4MFDA 3OS2A 1HCRA 3H3ZA 3K10A 1JKRC 2YR2A 2LKPA 2L3CA 1S7OA 1U6GA 1Z9CA 3RKYA 2JA8J 1G8XA 3HC7A 2LTSA 2A61A 4A3CJ 2XPVA 1I50J 3DEEA 2B9DA 3HKZN 3RI4A 3FM5A 3FXMA 1MBFA 2XHKA 3BPVA 1FMVA 2HQRA 4KA4A 1IUFA 2RSIA 1W7PD 3SEZA 4M0VA 3TOAA 2F8BA 2E7XA 2MG4A 2RNGA 2DSYA 1X3ZB 3FIGA 2K4BA 3HOWJ 1X47A 1HW5A 4N9IA 3H9GA 3QU3A 1LNWA 3REOA 4EEFG 5K7FA 1K4TA 3MVPA 3HG9A 2EM0A 1VQ9I 3QYFA 4IHXA 2L9NA 2EN1A 4LFUA 4A3EJ 5CYVA 2M1BA 3GTLJ 2EL5A 2VL8A 1W7PB 4MIMA 1YX5A 2EV5A 1P92A 1HNXE 4IQ4A 5KL2A 3EUKL 1A1KA 2KIFA 2X51A 2GOXB 4YRVA 2D5VA 5ICGA 2VKVA 1O3SA 5A6JA 3LAJA 2XPWA 2NVTJ 2E1MC 1OQYA 3GZ6A 3HUGB 2QKLB 2NA2A 4TUIA 1WJBA 1ERDA
chains in the Genus database with same CATH topology
5DEQA 5ILVA 2XKPA 4I2OA 2CGPA 3J81Z 5DCMA 1XCVA 1SFXA 3K2ZA 3DXJF 1D5VA 4M73A 1KU9A 4EJOA 3F23A 1STZA 1W7PA 1FZPB 2HOEA 1D3YA 3JSOA 1Y0UA 5J8FA 5DYMA 1Z6RA 2V6CA 3RIRA 2MH2A 1J0RA 2UXXA 1SFEA 4LJZF 4R1HA 2FSWA 2QUFA 4RS8A 1XGOA 4I98B 1YQAA 3EETA 2STTA 1BOAA 1TNTA 1R00A 2ESHA 1YLFA 5LRSA 4LD5A 3W6JB 3H92A 2CSOA 3T8TA 5D5VB 4G6DA 3HRTA 2YPRA 2DT5A 2IPQX 4D0PA 5D6EA 4LLNA 3GXOA 4WXHA 1MJBA 4R79A 1XMAA 1ODDA 1MJAA 2WTEA 2A5YB 3N97A 4L18B 3ABTA 3V8LA 3WE2A 1GXPA 4RGXA 3M9AA 3ZQ7A 3R60A 1YW9A 1O3QA 1I27A 3N4MA 3R6SA 5KVRA 2GQQA 1FBUA 3ULQB 4A0XA 5JI6A 1UCRA 2J5OA 4M74A 2JPBA 2HTSA 5L3DA 2XIGA 1QPMA 1L0OC 3TO7A 1SMTA 3LA2A 1BI2A 5CVVA 1IW7F 1ON2A 3MWMA 5DUIA 3T5XA 4CXFA 3TGNA 1XN7A 2M45A 2L01A 2LF8A 4M9ZA 3F8BA 5HDKA 4OIRF 2XKOA 2ZMEB 1DUXC 1ZAOA 2DAOA 2M30A 3DEUA 3V8KA 3F8FA 3BY6A 4K2EA 4XSXF 2VOOA 3GW2A 2XVCA 3VB2A 3JTHA 2VONA 5HS9A 1B4AA 3F8MA 3WTWC 2V1UA 2WWYA 2H09A 2RQPA 2PQ8A 5BPIA 4G7HF 1D8KA 4EMSA 2JPCA 1HKTA 3QAHA 4B8XA 2HQNA 2MBFA 4EGZA 2JT1A 3HHHA 3FXQA 3RYPA 2EFQA 3WU1B 3KFWX 4BNCA 3FMQA 3FX3A 2DI3A 2F5DA 2OZUA 2MLGA 4MQVA 1LEBA 1BM9A 3DV8A 3MQ0A 3W6KB 1TQMA 2RKHA 2GA1A 4HDUA 3DF8A 3I5UA 5LEKA 2BV6A 3J80K 2O6GE 4I0AA 1U5TC 4XLNF 5L3BA 1ZGAA 3I53A 2ZXJA 4N0BA 1U3EM 3ZMUA 2DFIA 5FFZA 4G8XA 1PP7U 1S7AA 4P96A 4KYWA 1LDDA 4BHCA 2MA3A 5K5QA 2MH9A 4L5IA 5IT9K 3JAMZ 5DCMB 2FF4A 3HYIA 3Q9VA 2QQAA 2VBYA 5CLSA 2DW4A 3D0SA 3IKVA 2KJBA 5FLXZ 2ELHA 3GF2A 1HXDA 1UHWA 3GVAA 1W5TA 4LK1F 2KKOA 1FP1D 3CO6C 4M9SA 4DQ2A 2L02A 5CVUA 3IRRA 4ESJA 3IC7A 4OMZA 1TNSA 2NS0A 2XRNA 4OOIA 4KICA 2VT3A 3FXUA 2LF7A 2PMHA 2ZJ2A 3J7AO 2FXAA 3IWFA 1HQCA 2H6CA 5D4RA 4HQMA 1DP7P 3BJAA 4ZH4F 3I64A 3BDDA 1ZG5A 4Q48A 1XMKA 3NRVA 5F6FA 2FMLA 3U2RA 2IRFG 2VC0A 1QNTA 4RGUA 3TDZC 2R3SA 3M1EA 2F5FA 1R7JA 4A12A 4RB2C 4ZYDA 3F72A 1REPC 2FEZA 2P5VA 1G3TA 5JR3A 2Y48A 4FX4A 4HQEA 3ELKA 3JAMK 2HYFA 5BS6A 3ISPA 1ONVA 4XBFA 3O3KA 3GYHX 1IN8A 3WE3A 4O6JA 1FY7A 3TQNA 2W24A 1FT9A 2L3DA 2M87A 1R1TA 2QQBA 3IKTA 2IT0A 5ERIA 2XV4S 3I4PA 2CO5A 3SZPA 2G7HA 1ZN2A 1Z1DA 2F5CA 4ZYEA 1TQIA 5LBQA 2ZCWA 1KA8A 4Y17A 2H27A 3CO7C 1QQIA 1YYVA 4NHJA 1ZG3A 1B1BA 1KU3A 4QLCU 5FD5A 5HVQC 1BN5A 2P4WA 3RPQA 3ABUA 3E5QA 4L9JA 3FF5A 2EV0A 3D5LA 1UFMA 3P7NA 4L9TA 4KN4X 1ZLKA 1V4RA 2XROA 2G7UA 4AIKA 3RTRA 2R7FA 4LLGF 4CYDA 5F64A 3OV8A 4HV5A 1LDKB 3B73A 2Z9OA 2VC1A 4HA8A 2JSCA 1L3LA 1YFHA 1J7KA 3CUQA 1XSXA 4OMYA 3F6VA 2CG4A 4RB0A 1IZ1A 2XAJA 5E20A 5LGTA 1LDJA 4ZZLA 4GXOA 3LA7A 1F1ZA 2VN2A 5CJ9A 5HS7A 4A6DA 2ESNA 1IN4A 1YTYA 2A3SA 3LFKA 5IT9Z 2EV6A 1BI0A 1G4DA 2GIVA 4I7HA 2VT2A 3TKYA 3ZPLA 3I71A 2O61A 3CUQB 5HDGA 2PMUA 1EH6A 3QPHA 4I09A 5HDNA 1BI1A 5LHIA 5DD8A 2W25A 2F5EA 3F8NA 1KQ0A 1O3TA 4M6YA 4G6QA 2LDUA 5FFXA 3V7CA 3RKWA 1B59A 1LEAA 3EDPA 3R61A 1SD4A 3FM3A 1GHCA 4HX7A 1K78B 2RC4A 3IL2A 3BOQA 2K27A 4WWCA 4HDVA 1Z05A 1I1GA 2O8XA 3KP7A 3EUHA 3HUGA 2W84A 4UV8A 4EJUA 2D1HA 3E97A 5H20A 2HEOA 4BHPA 3VEPA 1USSA 3AAFA 3EYYA 2OZ6A 3MZHA 1Z6TA 2IW5A 2GXBA 2D45A 3KETA 2D1VA 3F3XA 3QPTA 5AONA 1JHFA 4MGRA 1OKRA 4HOBA 3JTGA 3C1DA 3ERED 3GLXA 2XASA 3GEZA 5IT3A 1RNLA 3ZMVA 1RI7A 3PQJA 2IA2A 2BBYA 1BIAA 4IXAA 4EVIA 2ISYA 1ZYRF 5LEJA 3KLNA 4IRGA 5ICFA 1P2FA 1XB4A 1TBXA 4IF4A 5ICEA 1HKQA 4L0ZB 3I59B 5ICCA 1Q1HA 1ULYA 1KQ8A 4U88A 3J80Z 1IAWA 4ASNA 1R1VA 3F6OA 3DP7A 2F2EA 2QWWA 2P5KA 3HIFA 1KYWA 2VE9A 3E6CC 3QOPA 5EEHA 2EK5A 4CGZA 3DPLC 2Z5UA 4HF0A 1TTYA 3MZYA 2DK8A 2RGVA 2XUBA 3P9KA 3KP6A 1SAXA 5LLQA 5F1RA 5ED4A 3BZ6A 2FOKA 5DV5A 1PP8F 5D6FA 3H3UA 1V3FA 3BWGA 1J59A 4MEXF 4LLLA 1O7FA 4KIGA 3MAJA 2GAUA 4PDKA 4N9HA 1R5GA 3DFGA 1USTA 2OQRA 5AIQA 3R0AA 1X3UA 3ECOA 2XAQA 4CO8A 5FGMA 4O3MA 3KLOA 5HLGA 4KFCA 1U8RA 1Z7UA 1G3SA 5TJJA 4JBAA 3T1BA 4HBLA 1P4WA 2M8EA 2ZO4A 1MD0A 2XAGA 1F4KA 2HR3A 1D8JA 4UNOA 4ETSA 1ZH5A 1B6AA 4YIFA 4PGGA 5HLHA 4Q47A 2VOPA 2BEOA 3L7WA 4HX4A 3K9TA 1IF1A 4AVPA 4HW0A 3SQNA 4GGGA 1OYYA 2L54A 1FP2A 1S29A 4TV7A 3L2CA 3GFJA 5EEGA 1HSJA 3CDHA 1FPQA 4WF2A 4I02A 1OPCA 1TW3A 1YS6A 1ZREA 1BI3A 5D8LB 1PUEE 1SFUA 3MFKA 2QVOA 5ILSA 3R0JA 2Y0MA 2EFPA 1BC8C 1WRJA 3FMRA 1DDNA 2LSOA 2IA1A 4I01A 1JXSA 3ZMZA 3EYIA 3WU0A 4ENNA 2FNPA 4GO1A 3I59A 4LB6B 1C0WA 1W4MA 4OINF 3B02A 4UVBA 1NHAA 4FHTA 3HSRA 1ZG1A 1XGSA 2BE5F 3TOBA 1R5HA 2QM3A 3ZMDA 2HFHA 1JE8A 5D5UB 3ZN0A 1U2WA 1FNNA 3RDIA 5E18F 4BH9A 1SD5A 5L3GA 4RGRA 3WODF 1H9GA 3HTUA 1ZGJA 2OBPA 1IXRC 1QBJA 4FX0A 2L4AA 4ZYHA 2QYOA 4G94A 2RVCA 2ZFWA 3HSEA 4WX9A 5H6QA 1SD7A 2COMA 2EB7A 2O3FA 1K79A 1DPUA 1H0MA 1GXQA 2OU2A 1FLIA 1XCBA 2MD5A 3GWZA 4PZJA 2VE8A 4CZZA 2OAZA 2DQLA 4UVCA 4Z2YA 4G9YA 5E8GA 1W5SA 3PFIA 4LK0F 2ZKZA 4JK1X 3WTYC 1O7LA 4KMFA 3COAC 1IN5A 3ZP5A 3QRFF 2R7DA 3TO9A 1H9TA 1Z91A 5J6XA 3EQLF 2FRHA 4KMUX 4MEYF 4L9NA 1TW2A 4ENMA 4M71A 3KZZA 2TDXA 1IN6A 3IHUA 5BMZA 3C18A 2X0LA 4P55A 2DK5A 4EJTA 1F5TA 3K69A 1DPRA 2V79A 5DDGA 2ETHA 2NNYA 3ZN1A 2C6YA 5BQTA 1AWCA 1KGSA 2A07F 6PAXA 1XDSA 1O57A 2VBXA 4UV9A 3WTSC 2UWMA 3WGHA 2EFOA 3V8JA 1T0FA 4KNYA 3HOSA 1XDUA 4WK8F 4A2UA 4KIFA 5LGNA 4EM1A 2K02A 1S3JA 4XSZF 5L3FA 2JTVA 1JGSA 3DKWA 1KU2A 5D8KB 2HTJA 4IRHA 1ON1A 4JQFA 5CVRA 3BJOA 4M6XA 3E5UA 3CLOA 3BPXA 2DU9A 4HV6A 3KP2A 2D2WA 1R1UA 1MZBA 1U5TA 4RGSA 4LB5A 1JHHA 2FU4A 4CHUA 3RJPA 5HOOA 4MHGA 2ISZA 2ZNYA 3BJ6A 3WTZA 1HW2A 2YU3A 2YSRA 4L5JA 1YO5C 2PN6A 5D5XB 1HKSA 1U5TB 3KCCA 1OMIA 4A5NA 1HW1A 2GXGA 3ZMSA 3LQRA 3GFIA 1KQ9A 4XRFA 3QU6A 3SHFA 1ZRFA 3WGIA 1ZRCA 3HHGA 1R22A 2QBYB 1YW8A 1T38A 2WV0A 4Q4ZF 4MTEA 3VODA 3E6BA 4P9FA 3I0TA 5JVTA 4UHTA 2J5PA 4YFXF 1T2KA 3K1PA 4OIOF 4S05A 3HOTA 1LJ9A 1I6XA 1FOKA 2FBIA 3E6MA 1T98A 5K5RA 3NQOA 3WTVC 4FT8A 2FE3A 3Q5FA 1FYMA 2MC3A 3IWZA 4RAZA 1RZ4A 2EWNA 4OIPF 5E1ZB 1ZHFA 4IHSA 4UVAA 3WTTC 1QZYA 3F21A 4DNCA 3GUDA 2STWA 3FZVA 1P4XA 2YX4A 1LB2A 4U7DA 1SMYF 2KIMA 4YFKF 3FWEA 3LWFA 4NQWA 3E5XA 2P8TA 1T6SA 2FBKA 1AOYA 1FSEA 2Q8KA 3E6DA 2PG4A 3ML6A 2OA4A 4CDGA 1E17A 3CTAA 2CW0F 3FMSA 2E1NA 1R36A 4OU0A 1J75A 2PEXA 3HRUA 4EJWA 1CF7B 4O5VA 4R8HA 3V4GA 2VODA 5E17F 2A6EF 3P9IA 3I54A 1MGTA 3V7RA 1FYLA 2YX7A 2Q0OA 3GO5A 3SXYA 2P6TA 1WWXA 2X4HA 3RPUA 3QP5A 3ZMTA 1YIOA 1G3YA 1KU7A 4KT5C 5A2QK 2Z33A 3OOPA 1EV7A 1WSUA 2P7VB 2EFNA 2GZWA 2HWVA 5K5OA 1IN7A 2GWRA 2CWEA 4HYEA 1TLHB 2UXNA 3NEUA 4CICA 2ZNZA 4RAYA 2Q2EA 4H0EA 3ROUA 5JHUA 4AIHA 1FSHA 1IXCA 3KZYA 1P4AA 5CVJA 5D5WB 5HLIA 4BHBA 1MJ9A 1UB9A 1IRFA 4AIJA 4IJAA 4BXUA 4BQAA 1RUOA 2ACJA 3IRQA 5HS8A 2K4JA 4A0ZA 3L9FA 1KYZA 4UUVA 3BROA 3Q9SA 2HKOA 4KDPA 2PI0A 4WXDA 1J5YA 1ZLJA 3U1DA 4EM0B 4G7ZF 1BJAA 4RB1A 5LRRA 1QZZA 1R58A 1VTNC 1R23A 2CYYA 1I1SA 2DPUA 4U0VA 2A6HF 3E3VA 5L3CA 4IPAA 2FBHA 4BYYA 2ZMEA 2RDPA 2HGCA 4HAMA 3J81K 1YW7A 1CGPA 2XAHA 1WKMA 1IXSB 3O6BB 2QBYA 3C7JA 1G6NA 2HKXA 2UZKA 5A2QZ 4GYIA 2IVMA 2ZBKA 3QP6A 5LHHA 4A6EA 3KP4A 1FC3A 3G3ZA 3MCZA 4QWQA 3WTUC 2P5LC 1YS7A 4A5MA 1B9MA 1P6RA 1XGMA 2G9WA 3M8FA 2EA2A 5BPDA 4U0WA 1FWZA 1J9IA 2RNJA 2RV8A 3M7GA 3HRSA 2PJPA 1XSVA 3KEOA 2LNBA 5DD4A 1K78A 3TO6A 4XLPF 5JFRA 5DCFA 4HZFA 4LG0B 1YG2A 1FBQA 1OYWA 2NNNA 4HX8A 4NB5A 2QENA 5H6RA 3L09A 1K6OA 4IRIA 5TRDA 2VBWA 3GX4X 2FNAA 3WGGA 5FD6A 4E70A 4ESBA 3R4KA 4IVNA 2OD5A 2W85A 1B9NA 2EA4A 1K7AA 3SZTA 2BGCA 3O2PE 4WXCA 4KUMA 1T39A 3RYRA 4L9VA 4LGWA 5K1YA 3PQKA 4LG0A 3LSTA 2GA2A 4EV0A 5D4SA 4HF1A 2CQKA 3KP3A 3SFZA 1A04A 3LA3A 3KP5A 1EH7A 3CUOA 1F9NA 2E7WA 4I0BA 4L0YB 2HS5A 1XSDA 1UHMA 5AIPA 3JSPA 4LMYA 2XAFA 1I5ZA 3CUQC 4YFNF 5LHGA 2P7CB 4ENJA 4EJVA 1ZRDA 4HLXA 2QLZA 2Y75A 4F7ZA 3K1NA 2E1CA 3T0YA 4Y15A 2HYGD 4A0YA 4AWXB 5FLXK 2B0LA 2O03A 5LGUA 3JW4A 2PBIA 3TDUC 4KIBA 1WI9A 4AD9A 2EFWA 1QGPA 2V9VA 2K86A 2PFBA 1IUYA 4P9UA 4MTDA 2AXLA 2QQ9A 2KIUA 4ESFA 3F8CA 2V1XA 1TQPA 2JRTA 4ZZDA 1LVAA 2V1DA 4M9XA 2DPDA 1MKMA 3P9CA 3RKXA 3LQQA 5L3EA 4ENKA 3KE2A 4HF2A 4UXNA 3ECHA 1G3WA 1J2XA 4ON0A 3K1MA 1LQ1A 2IJLA 1XGNA 1WQ2A 2M5WA 2H94A 4WCGA 2DO7A 5BOXA 1ZARA 4GCVA 3HSFA 1FBSA 1SD6A 3WTXC 1PDNC 1GVJA 3T8RA 1FYKA 4ZYGA 5ILUA 4BAYA 3DPTA 1CF7A 4IHTA 5E1WA 3G73A 4G7OF 3GZ5A 2XGXA 4PCQA 5FO5A 2WC2A 3HRMA 4MNUA 3GFLA 3C3WA 2MLKA 3MEXA 2FMYA 2JZYA 4OIQF 3BP8A 1OR7A 2HZTA 4U7BA 2IA0A 3CJNA 4MQ9F 1RIOH 3KEQA 5E1XA 1HSTA 3L00A 1HBXG 4M72A 4P5OA 5KK1A 4EM2A 2K7LA 2PLYA 2NRAC 4GYGA 1BIBA 2NAZA 2VXZA 3FHZA 2P6SA 2KRFA 1U78A 2FQ3A 4U0YA 2A68F 2H6BA 4YG2F 2W57A 2OQGA 1O3RA 3S2WA 2IP2A 2FA5A 2CFXA 1E2XA 2DBBA 2NYXA 4RB3C 2BYVE 2DTRA 1EH8A 1S8NA 2KJCA 3M8EA 1FX7A 2A69F 1QO0D 1RUNA 1MDMA 3U9GA 3I58A 2Z3YA 3HTSB 4Q5SF 3LAPA 1IRGA 4EGYA 2VBZA 1BC7C 2L4MA 2AS5F 4YIIA 3VFZA 5CVIA 2RN7A 5E8IA 2DLLA 3WG9A 3FXRA 5FB2A 2QZ8A 4KN7X 2EJRA 3DQVC 5J8CA 2Z99A 2HDCA 1MDMB 1OYIA 2O0YA 3F22A 3VOEA 4PGHA 1BBYA</