1YFHA

Wt human o6-alkylguanine-dna alkyltransferase bound to dna containing an alkylated cytosine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
175
structure length
165
Chain Sequence
CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the human AGT protein bound to DNA and its implications for damage detection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*TP*GP*GP*AP*TP*GP*(XCY)P*GP*TP*GP*TP*AP*GP*GP*T)-3'
total genus 41
structure length 165
sequence length 175
chains with identical sequence B, C
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1yfhA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1yfhA01
4Y15A 3BWGA 4RB3C 2CQKA 4GGGA 1LB2A 3BJ6A 1AWCA 2RN7A 4HX4A 3QPTA 3B02A 1W7PA 2HQRA 2EFWA 1P2FA 4BH9A 3HSRA 4D0PA 5DEQA 2L54A 2YSRA 4BAYA 2VODA 2M1BA 4HLXA 5BOXA 1WRJA 1R1VA 4FT8A 2P7CB 4B8XA 3F72A 1ZG3A 1QPMA 2XAHA 1XCVA 4LG0A 2BE5F 3V8JA 2RNJA 2JSCA 1ZARA 2GAUA 2M87A 3F6VA 3ZPLA 2DK8A 1MKMA 4EMSA 4EJUA 1Z6RA 1B6AA 2YU3A 2GIVA 2OBPA 4HDVA 3CTAA 2A07F 1MJAA 2KRFA 2L4MA 1SMYF 2ZJ2A 1MJ9A 2IJLA 4ZYHA 2D1HA 2P7VB 3QP6A 1E2XA 5E18F 4MTEA 3I5UA 1QO0D 1ZREA 3Q9SA 2QENA 2FE3A 3HHGA 5LEKA 3GWZA 3LAPA 1SD4A 4A12A 3GVAA 2O61A 5DUKA 3C7JA 1PP8F 3F8MA 1MJBA 3IKVA 3PQKA 1EH8A 3ZP5A 5LRSA 2PMHA 2ZMEB 2B0LA 1BC8C 1DPUA 2E1NA 2STWA 3HRUA 3N97A 2FA5A 3F23A 4QWQA 3KP2A 5ILSA 1FZPB 3F21A 2ELHA 4K2EA 1O3TA 5DV5A 4I0AA 1XGNA 3IRRA 1B1BA 1WI9A 4G9YA 3GX4X 2W24A 2VBXA 2MH2A 3QU6A 3ZMZA 1L0OC 4MQVA 1XDSA 3ABTA 3BZ6A 4E70A 2A6EF 1FSHA 5E17F 5AIQA 2K7LA 1YS7A 1F1ZA 4OU0A 4A5MA 2KIFA 1Z1DA 3GYHX 4AIHA 2CFXA 5BQTA 2VE8A 2H6BA 1BI0A 2DO7A 2IA2A 1ZRCA 2FMLA 1NHAA 3HTUA 5HDGA 1P6RA 5DCMA 4LFUA 4AVPA 3KE2A 4ZZLA 3ELKA 1C0WA 4UNOA 4MQ9F 4ZYGA 3KP5A 4XSXF 5JHUA 3EUHA 2DI3A 4HLYA 4IRGA 3E5QA 1T39A 3L00A 1GXPA 3FMSA 2G9WA 1LEBA 1K78A 4IVNA 2X4HA 1XGSA 2XAQA 3JTGA 3T8TA 1FBSA 4MGRA 1LQ1A 3BOQA 2XVCA 1LDDA 3FZVA 1J75A 1XGOA 4OIRF 1J0RA 1TLHB 2WTEA 1P4XA 5J8FA 4IXAA 4ON0A 3M8EA 4ESJA 2IA0A 3M7GA 2K4BA 5FFZA 1TQPA 2D45A 3DV8A 4HV5A 6PAXA 1G3YA 1P4WA 3HRMA 3TO9A 4PZJA 3F8NA 3KEOA 1W7PD 3CJNA 1ZG5A 3JSOA 4Q4ZF 1BI3A 3JAMK 1DPRA 4KMUX 1ONVA 4UV8A 1HKSA 5ICGA 2ETHA 2CGPA 2M30A 2MH9A 2XAJA 2A68F 3RKYA 5HDNA 5EEHA 2KJCA 4U0WA 3ZMDA 4AWXB 2YR2A 5HLGA 1T38A 1UB9A 3NRVA 4ZZDA 2D2WA 1CF7B 2PBIA 4IHSA 2P4WA 4ETSA 4OIQF 1CGPA 1ZRFA 3TO6A 4KA4A 1D8JA 4WCGA 4EJVA 4F7ZA 4HW0A 5E20A 4S05A 2F2EA 2M8EA 1FP1D 4YIIA 3ZMTA 1U6GA 2QZ8A 3GLXA 2R7FA 4BQAA 5FFXA 2W25A 5K5RA 2NAZA 4RAYA 4LK1F 4BHCA 1WWXA 5ICEA 1KU3A 3BY6A 1K6OA 2F5CA 2GXBA 2L01A 3LQQA 2HQNA 2XROA 4M73A 2A61A 2FMYA 5HDKA 1KYZA 5E1WA 4G94A 1FSEA 3HSEA 1U5TB 4HV6A 2RV8A 1F9NA 3KP4A 3MZHA 2H27A 4CHUA 4EJTA 3SZPA 1HQCA 3F22A 4RB2C 1OYWA 4XLNF 4BXUA 1J9IA 2DBBA 1MGTA 1DDNA 4RGRA 1U2WA 4KUMA 4WX9A 2P5LC 5ICFA 1TQMA 1G3TA 1P4AA 3U9GA 3EYIA 4O5VA 3KLNA 3RKWA 4UVCA 4XBFA 4OIOF 2CW0F 3V8LA 5DYMA 3C18A 4HYEA 5HOOA 3KZYA 1BBYA 1KQ8A 1OYYA 3NQOA 2ZNZA 4KN4X 4KFCA 3ZMVA 1FT9A 2FNAA 2F5FA 1LNWA 4L9TA 1T6SA 1R1UA 3LFKA 4Z2YA 5BPDA 2O0YA 5DCFA 3E6DA 1XSVA 2EFNA 4O3MA 1S7OA 2EV0A 2LNBA 5L3DA 5J6XA 5A2QZ 3TOBA 3O2PE 4I7HA 2XAFA 1IN4A 2K86A 1ZLKA 2JPBA 4BHPA 2HGCA 1KQ9A 2RC4A 3MEXA 3CUOA 4MNUA 4WXDA 2IVMA 3V8KA 3U2RA 1S29A 2RDPA 3BJOA 1MD0A 1STZA 3FM3A 2DFIA 1HBXG 2L02A 3LA2A 1Z05A 3IRQA 1YTYA 5AIPA 5DDGA 2ZBKA 4HAMA 3BPXA 1I6XA 1SFXA 4I0BA 3K1PA 5EEGA 3H92A 1WQ2A 4L5IA 1HKTA 4A0ZA 4GCVA 1X3UA 1IAWA 4I01A 4G6DA 3CO7C 2OD5A 4HF0A 5E8GA 1ZG1A 2YX7A 1T0FA 2MBFA 1ZLJA 2PQ8A 5L3GA 2VN2A 4LMYA 1RNLA 1ON2A 3KP7A 4RS8A 3BJAA 2XKOA 1R1TA 2DTRA 2EA2A 1MDMA 4ENMA 1WKMA 1K7AA 1FX7A 4FHTA 3DKWA 3ROUA 2H6CA 1BIBA 4Q48A 2WWYA 4IHTA 1QZZA 4G7OF 1D8KA 2FOKA 1Z7UA 4A0YA 4KMFA 2VBZA 5JR3A 1O3RA 1B59A 1O7FA 2BV6A 1U5TA 1RZ4A 1R5HA 3E5XA 3QPHA 3P9KA 1SD5A 1ZYRF 2J5PA 5CVIA 1AOYA 4U0VA 3K1MA 4G6QA 3MCZA 1TQIA 3R61A 4HF2A 2HYFA 3KETA 1J7KA 2CWEA 1FWZA 1HW1A 1G4DA 2DW4A 1HSJA 3K9TA 4LD5A 2OQGA 4EM0B 1GXQA 1KU2A 5D4SA 4HQEA 4L0ZB 4DNCA 1JXSA 3WTTC 3DP7A 4P9FA 2ZMEA 1XD7A 3V7CA 1IXSB 1FNNA 1H9GA 1YW9A 4YIFA 2W85A 4L9VA 3WE3A 3WU1B 2O8XA 4Q5SF 3FHZA 3AAFA 3HIFA 1GVJA 4IPAA 3COAC 2MA3A 3QAHA 3FXRA 4CGZA 4XSZF 1JHHA 3GF2A 4O6JA 3P9IA 5FLXZ 1BC7C 1FPQA 2QLZA 2GZWA 3HUGA 2HKOA 2XUBA 3M9AA 2XGXA 3CO6C 1IW7F 1HXDA 5JI6A 2VBYA 1W5SA 3HRSA 4YFNF 3RPQA 1O7LA 4P96A 3I53A 4M74A 3ZQ7A 3KZZA 1I27A 2XAGA 3OOPA 1FYMA 2HWVA 3E6BA 2Y48A 3VB2A 1BI1A 3GFJA 4UXNA 4WXCA 2HEOA 4LLNA 1YS6A 3E6CC 4OIPF 2M5WA 2HOEA 3ECOA 4WF2A 5HS7A 2A69F 2JT1A 1A04A 1XGMA 3HTSB 5JVTA 2EWNA 1LDKB 3K1NA 4MEYF 4U7DA 4M9XA 3E97A 3K0LA 1FLIA 2K02A 2P5VA 2R3SA 1R7JA 1Z9CA 2HYGD 3ULQB 4GO1A 1O57A 5LHGA 3FMQA 4EM1A 1IRFA 3IL2A 2FBIA 2NS0A 3MZYA 4OMZA 3IHUA 3RDIA 1JGSA 1J59A 1O3SA 4R79A 3MWMA 3O3KA 1OMIA 2H09A 2VBWA 1IN5A 3J7AO 3KCCA 2OU2A 2QQAA 2RGVA 4LK0F 1I1SA 5D5VB 2FF4A 4M72A 2HS5A 3Q5FA 1XSDA 2EV5A 3U1DA 3WE2A 2V6CA 3T0YA 2PJPA 2O03A 1IRGA 1D3YA 3VFZA 1IN7A 2EB7A 2O3FA 5F1RA 2V1UA 5D5WB 2VE9A 2CG4A 4N0BA 4UHTA 3IKTA 5H20A 4LB5A 2Z33A 1BJAA 3WTSC 5LHHA 2IW5A 2Q8KA 3J81Z 1T2KA 4WWCA 2XHKA 3H3UA 4LLLA 2FRHA 2MC3A 1S3JA 4UUVA 4OMYA 3C3WA 2NRAC 2BEOA 5E8IA 3SXYA 3GZ5A 4EJOA 2OZUA 4KYWA 5HS8A 2GA1A 3KEQA 1YFHA 4I2OA 3KP6A 2A3SA 2FEZA 1FYKA 2FSWA 2EFOA 2UXNA 1FBQA 4BYYA 2LKPA 2QBYA 2VONA 3M1EA 4RB0A 5DUIA 3HRTA 3DF8A 3RTRA 5CVVA 3W6KB 2QBYB 2HTJA 2QQ9A 3RPUA 1FOKA 1I1GA 1PDNC 1FY7A 4M6XA 3TOAA 4MHGA 3E3VA 4AD9A 3TDUC 2XV4S 2QUFA 2Z99A 4EM2A 4HF1A 3B73A 2ISZA 2STTA 1KYWA 4ESBA 1TNSA 2XASA 4GYGA 2Y75A 3E6MA 2PMUA 1USSA 1R22A 4AIKA 3TQNA 1I5ZA 4A6DA 2J5OA 2EFQA 3VEPA 4Y17A 1PP7U 2DPDA 1ON1A 2LSOA 3ZMUA 4YFKF 1ULYA 2COMA 2WC2A 1UCRA 4AIJA 2ESHA 2OA4A 1OKRA 1XMKA 1PUEE 4WXHA 5IT3A 4KIFA 3G3ZA 5D5XB 4L0YB 3J80Z 1IXRC 3JAMZ 1HKQA 4WK8F 5D6FA 4RGSA 1LDJA 3I64A 2KIUA 3LWFA 2HTSA 1U5TC 1FP2A 5DCMB 5CJ9A 3WG9A 4NB5A 5E1XA 4ZYDA 4CXFA 4ZH4F 1U3EM 1KGSA 3CUQA 4XRFA 2A6HF 3FXQA 3ML6A 4FX4A 2QWWA 3GFLA 2YX4A 1V4RA 4ZYEA 3R0AA 1B4AA 2E1CA 3IWFA 3WTWC 1LEAA 2V9VA 5HLIA 2DQLA 2ISYA 3ECHA 3WTXC 5JFRA 5LRRA 5AONA 4Y13A 1RI7A 4EQQA 4CICA 4HX8A 4RAZA 2G7UA 4YFXF 2V79A 2UZKA 1ZRDA 4OOIA 4ENJA 4QLCU 2L3DA 2PLYA 5CVJA 1QGPA 4Q47A 4P9UA 3I59B 1RIOH 1OR7A 3I54A 1USTA 2G7HA 4CZZA 1TBXA 3PFIA 4ENNA 3CUQB 4G7HF 3ABUA 1YQAA 2JTVA 3DPTA 1R36A 1XCBA 2D1VA 2LF8A 2JPCA 2MD5A 3WTVC 4NQWA 2F5EA 3IC7A 1G6NA 4PDKA 4R1HA 3DFGA 5LBQA 2Q2EA 2ZFWA 1CF7A 2C6YA 2DK5A 3WTYC 3SZTA 4G8XA 2OQRA 2W84A 3RYPA 4IJAA 5LLQA 3H3ZA 5L3EA 1XMAA 3KP3A 2Y0MA 1W5TA 1WSUA 3D5LA 1RUOA 5LHIA 3T1BA 1K79A 5KK1A 3K2ZA 2PG4A 1XDUA 2Q0OA 2DQRA 4LG0B 2DAOA 4M6YA 5K5OA 3J81K 4UVBA 1QQIA 5IT9K 1S8NA 4U88A 3RIRA 5FD6A 3WGIA 4LGWA 4EV0A 5A2QK 2EA4A 4GYIA 3F6OA 3WGHA 2X0LA 1BIAA 5HVQC 2RVCA 2BGCA 5FO5A 1J5YA 3Q9VA 1XSXA 3G73A 4M71A 1Y0UA 3D0SA 1T98A 5E1ZB 4LLGF 4UV9A 4TV7A 1UFMA 3BP8A 1MDMB 2FNPA 3JW4A 3W6JB 2RQPA 5TJJA 4HBLA 2AXLA 5FD5A 5BS6A 1XB4A 2HFHA 3ZN1A 1YW7A 1HSTA 5DD4A 5K5QA 2FU4A 4LJZF 4RGUA 4JK1X 2P6SA 1FYLA 2L4AA 3VOEA 2PEXA 5L3BA 1QBJA 2XKPA 3R6SA 1EH6A 1H0MA 2EV6A 2K4JA 1YYVA 5ERIA 2LF7A 3SQNA 2FXAA 4KN7X 5CVRA 4A5NA 2R7DA 4L18B 2ZXJA 1J2XA 2UWMA 4L5JA 1ODDA 3O6BB 2GWRA 4ASNA 3FF5A 5L3CA 1MZBA 1OPCA 4CO8A 4KT5C 5D4RA 2FBHA 4RB1A 4HZFA 4KDPA 2PN6A 1B9MA 4N9IA 4P55A 2Z9OA 3FMRA 2OZ6A 2ZO4A 3WTUC 1RUNA 1JHFA 3J80K 1R23A 2IRFG 1UHWA 5HS9A 3T5XA 1YO5C 3BPVA 1SD7A 2VOPA 1D5VA 2CO5A 5LGUA 5F6FA 4GXOA 3MAJA 3N4MA 1L3LA 3V4GA 1BM9A 3TKYA 1IZ1A 2V1XA 2E7XA 3JTHA 2LDUA 4N9HA 2ZCWA 2A5YB 4EGYA 2KIMA 3BROA 2JZYA 3I4PA 3ERED 3FM5A 2QYOA 2QVOA 5CVUA 3REOA 1P92A 1IN8A 5ED4A 2P5KA 3LQRA 4KIGA 5IT9Z 2PI0A 1DUXC 1V3FA 4KNYA 1R5GA 1KQ0A 5K1YA 1O3QA 2K27A 4H0EA 1TW2A 1KU7A 2CSOA 3KLOA 3TO7A 5FLXK 2DPUA 3BDDA 1S6LA 4IRIA 3CUQC 2FBKA 3MFKA 2GQQA 3DPLC 3T8RA 5D6EA 1REPC 2OAZA 3JSPA 3K69A 4UVAA 2KKOA 1G3WA 3GZ6A 1H9TA 2ESNA 3QRFF 2JRTA 3R60A 4PGHA 2P6TA 4RGXA 3FWEA 3HOTA 3EYYA 1KA8A 1SMTA 4S04A 4EJWA 3M8FA 1SD6A 5BMZA 4YG2F 4HX7A 4B09A 2P8TA 5FB2A 2XRNA 3VODA 1FC3A 1ZN2A 1BOAA 4DQ2A 3I71A 1ZHFA 4I09A 2EK5A 3DEUA 1OYIA 1VTNC 2FQ3A 4L9JA 3FXUA 1IXCA 5FGMA 4KIBA 2NYXA 1UHMA 3LAJA 2ZKZA 3V7RA 1BI2A 4JQFA 3R4KA 2BYVE 5KVRA 1W4MA 1R58A 2MLGA 1Z6TA 3L2CA 2IPQX 4M9SA 2VT3A 1QZYA 1LVAA 1YLFA 5BPIA 2QM3A 4A0XA 1GHCA 2O6GE 2VOOA 2NNYA 3ZMSA 4CYDA 2ACJA 3L09A 1F4KA 4BHBA 3GUDA 3GXOA 3I0TA 5D8LB 1HW2A 5LGNA 1IF1A 2HZTA 5J8CA 5CYVA 3P7NA 1Z91A 1YIOA 3V7SA 3I58A 3F8CA 3L9FA 3C1DA 1FBUA 4I02A 1EV7A 4ENKA 1S7AA 3OV8A 5DD8A 5ILUA 1E17A 2BBYA 2DLLA 3R0JA 2VC0A 4G7ZF 3QOPA 3RJPA 1K78B 3LA3A 2V1DA 2VC1A 2WV0A 1U8RA 4A6EA 2ADUA 2VT2A 1BN5A 1LJ9A 3TDZC 5TRDA 2AS5F 5CLSA 4HA8A 2CYYA 2EFPA 3L7WA 4KICA 4MTDA 3PQJA 2DT5A 1SAXA 1YG2A 4I98B 4IF4A 1EH7A 4JBAA 1YW8A 4IRHA 3TGNA 5D8KB 3GFMA 3WODF 2RKHA 1QNTA 4FX0A 4NHJA 3I59A 1F5TA 4R8HA 3HOSA 2IA1A 3GFIA 1IN6A 4PGGA 3GO5A 3DXJF 4ESFA 1U78A 3IWZA 3E5UA 3RKXA 1SFUA 2HDCA 3MQ0A 4LB6B 2F5DA 3SHFA 1Q1HA 1TTYA 3P9CA 3HHHA 5ICCA 4HQMA 2GA2A 4EVIA 1R00A 2MLKA 2W57A 5H6RA 4L9NA 3S2WA 1TW3A 1G3SA 4P5OA 1SFEA 2E7WA 2XIGA 3FX3A 2VXZA 1B9NA 3QU3A 2QQBA 4HDUA 2H94A 1KU9A 3DQVC 4XLPF 1ZGAA 3KFWX 3F8BA 4CDGA 1DP7P 4HOBA 3LA7A 5H6QA 3WTZA 3GW2A 3F8FA 2ZNYA 3RI4A 3RYRA 5ILVA 2GXGA 1ZAOA 1TNTA 4MEXF 3ZN0A 2TDXA 3EDPA 4M9ZA 3ISPA 4BNCA 2Z3YA 3NEUA 3EQLF 2DU9A 4PCQA 3LSTA 3CLOA 2IT0A 5HLHA 2EJRA 5L3FA 2IP2A 2NNNA 3SFZA 1XN7A 5D5UB 3GEZA 2M45A 1IUYA 2HKXA 3CDHA 4OINF 5F64A 2UXXA 2Z5UA 3F3XA 1ZGJA 4U0YA 3WGGA 1JE8A 1HW5A 3EETA 1W7PB 4U7BA 3HYIA 2PFBA 4A2UA 5LEJA 4EGZA 2YPRA 1ZH5A 3HSFA 3WU0A 3QP5A 2KJBA 5LGTA 2HR3A
chains in the Genus database with same CATH superfamily
4Y15A 3BWGA 1D1CA 5KCMA 4XQFA 4RB3C 2CQKA 4GGGA 1VFCA 1O4XA 3RQIA 4I6ZA 1TN9A 3TP3A 1LB2A 4GKKE 3BJ6A 4BE2A 1N77A 1AWCA 3LSMA 2K5CA 3TEDA 2XB0X 2RN7A 4ANJA 4HX4A 3VWBA 3QPTA 3OYBA 3B02A 3BG9A 3LSHA 4UUSB 2GM4A 1ITYA 1W7PA 1R49A 2ZFUA 2HQRA 2GHFA 5B3SH 2EFWA 1P2FA 4DW6A 2JYAA 4BH9A 3HSRA 5FLVA 1WI3A 4D0PA 2JP9A 2HI3A 5F04A 5DEQA 2L54A 2YSRA 4BAYA 2VODA 2M1BA 4NXME 2BXZA 4HLXA 1JJ6C 5BOXA 1WRJA 2PRTA 1R1VA 4FT8A 2IHR1 1UZCA 2P7CB 2X48A 4B8XA 3RMPA 3F72A 1X2MA 1UG2A 4DYRA 2IS6A 1ZG3A 5EZHA 2MC4A 3ZQFA 1QPMA 3M8JA 2KONA 2IGNA 4DOZA 2ENAA 4YELA 2XAHA 1XCVA 4LG0A 3G4SI 1UHSA 2BE5F 2EMGA 2V8QB 3BG3A 3V8JA 2RNJA 3JRHA 4AVZA 5FKOA 3CF5F 3OSGA 4F2JC 2JSCA 1ZARA 4A3EJ 3S8PA 2GAUA 2M87A 3F6VA 3ZPLA 1W1WE 2DK8A 1MKMA 2EN1A 4EMSA 2DLQA 1IC8A 4DV3E 4EJUA 1Z6RA 5CQGA 1B6AA 2YU3A 2GIVA 4PSWA 1JKOC 5IYBJ 2OBPA 2JQ7A 4HDVA 1WJPA 2F4MB 3CTAA 2A07F 5EYRA 3MKYB 1MJAA 1IGNA 2JWTA 2KRFA 2L4MA 1SMYF 2ZJ2A 2VJ4A 1MJ9A 2IJLA 4ZYHA 4BJTA 2D1HA 2P7VB 3QP6A 3PNYA 5IP6A 3HJEA 1E2XA 5E18F 2JXPA 1WPKA 1AKHB 3H3VK 4R8OA 4MTEA 3I5UA 4DZPA 1QO0D 2YS9A 1IQOA 2NABA 2XAUA 3SEQA 2D5VA 1ZREA 3OTOE 3BTCA 5EGOB 3Q9SA 2ENCA 4RBOA 4BMJA 2QENA 2FE3A 3HHGA 3T1HE 2EN4A 5LEKA 3TL4X 4AYBN 3GWZA 3LAPA 2UXDE 1SD4A 4A12A 3CC4I 3GVAA 4XICA 1W0TA 2O61A 1V55H 1PJTA 3L2QA 5DUKA 5KL7A 3C7JA 5GPAA 1PP8F 3F8MA 1MJBA 2EL6A 4BUPA 3DEEA 5F0FA 3WU2C 4DV6E 3FBNB 3IKVA 2JA8J 3PUBA 2YTNA 4XLFA 3PQKA 4PFPA 3KPHA 1EH8A 3OYLA 3ZP5A 2E1OA 4DYCA 5LRSA 1Y8QB 3OIPA 5B66C 2M8GX 1S7EA 1IJWC 2ZXHA 3GTLJ 3QWLA 2PMHA 2GXAA 3BZCA 4C9YA 2ZMEB 1E3OC 2B0LA 4B44A 3PIOF 1WHNA 1BC8C 1DPUA 2KIQA 2AHQA 3FKJA 2E1NA 2STWA 2M7BA 3HRUA 2MGQA 3J7Yp 2V86A 3N97A 4F92B 4HRIA 2EPUA 2YTPA 2FA5A 3F23A 3HGYA 2WY7Q 4QWQA 2VKVA 1CQTA 1NG7A 2K3FA 3KP2A 5ILSA 1FZPB 1WJAA 1RRJA 4DMIA 4JI3E 3F21A 2L33A 2ELHA 3A01B 3SJMA 1XX5A 1ACIA 4K2EA 3K70D 1LFPA 2N3HA 1O3TA 3DKXA 1U0JA 1QRYA 5DV5A 4I0AA 2IBDA 1XGNA 2O5RA 3IRRA 4JI1E 1T08B 3OR2C 1B1BA 1A1JA 1WI9A 2GLIA 3OL4A 2L2OA 1WFXA 2LKSA 2YUSA 4G9YA 3CP8A 1FOYA 3S32A 3GX4X 2W24A 2VBXA 2MH2A 2LC2A 3QU6A 2EOEA 2V85A 1D1AA 2VI6A 5KL3A 3ZMZA 2EM5A 1L0OC 2NVXJ 4MQVA 1XDSA 3ABTA 3BZ6A 4E70A 2A6EF 1FSHA 2EOYA 5E17F 3EUKL 2EOJA 5AIQA 2X1DA 3HOVJ 2K7LA 3FXKA 5C4JJ 1YS7A 5A6BD 1F1ZA 2KP6A 3AG3H 4OU0A 4A5MA 2KIFA 4F54A 2JUGA 1WHUA 1QU3A 1Z1DA 3GYHX 4X0GA 4AIHA 3OY9A 2WADA 2CFXA 4N4OB 3MSWA 4RLFA 4PSXA 5BQTA 3CJTB 1MW7A 2VE8A 4RHBB 4B3AA 1IO2A 2LK2A 1AU7A 2H6BA 1BI0A 2DO7A 2HXIA 2IA2A 1ZRCA 2EL4A 1VQMI 4BE1A 4C3HJ 5JVGF 2FMLA 2KHMA 1NHAA 3RKQA 1MH4A 5J1YA 1E0EA 2X6YA 3HTUA 2M9AA 2DGCA 4IZZA 3CJRB 5HDGA 5AE3A 1P6RA 5DCMA 4LFUA 5E3MA 4AVPA 1P7JA 1WJBA 3KE2A 4ZZLA 3ELKA 3ZQQA 4X9JA 1QPIA 3CMYA 1SANA 1C0WA 3KYCB 4UNOA 1GTKA 3OL3A 2J7JA 4MQ9F 3KP5A 4XSXF 4ZYGA 5JHUA 4QTRA 3EUHA 2QA4I 2DI3A 4HLYA 5F3WA 4IRGA 3I4MJ 5EZGA 3EQ1A 3E5QA 1T39A 4R2AA 3L00A 1GXPA 3FMSA 2G9WA 2EQ3A 1LEBA 1K78A 3KYDB 2OCCH 4MLQA 4XLCA 2F4OB 4O24A 1X5WA 1TWFJ 3DWLE 4IVNA 3HPHA 2ZC2A 2X4HA 4DR1E 1XGSA 2XAQA 2LH9A 3CCSI 3JTGA 3T8TA 1FBSA 4MGRA 2DSYA 1LQ1A 4UUSA 3S14J 4F9BB 3BOQA 2XVCA 1LDDA 3FZVA 1J75A 5KHDA 1XGOA 3BTJA 2VL8A 2VKHA 4PJLA 3S16J 4OIRF 3SEZA 1J0RA 1TLHB 4LF4E 5K7FA 3GBGA 5GAGJ 2WTEA 1P4XA 1VZ0A 2LTPA 1EA3A 5J8FA 1MSEC 4IXAA 2UUAE 4ON0A 1BJZA 1HDPA 1FOXA 1ZBTA 3M8EA 2CUFA 3LSIA 4ESJA 1MMGA 2IA0A 1Y39A 2EOMA 3BCAA 5F0HA 4W97A 3M7GA 2K4BA 1X58A 5FFZA 1TQPA 2R5ZB 2O8KA 2EOHA 3IP4B 4OOGC 2D45A 2DFHA 3DV8A 4HEA2 4HV5A 3HGGA 1X3WB 4Z6YA 1ETWA 1PJRA 6PAXA 4HPQA 1G3YA 4S0HB 2W7NA 1P4WA 1U9OA 2DODA 3HRMA 3TO9A 1ZGWA 3CESA 4PZJA 1EKEA 3F8NA 3KEOA 3PO2J 4B3TE 3HBLA 4C2MJ 1W7PD 3CJNA 1ZG5A 3JSOA 4QIWN 4Q4ZF 4A3JJ 2EM9A 1BI3A 3JAMK 1IBME 1DPRA 3VYSB 4KMUX 3PSFA 2MC5A 1ONVA 4XOPA 4UV8A 2LRDA 1UN6B 1HKSA 5ICGA 2ETHA 1SFKA 4E4HA 2CGPA 3THOB 3GZNB 2M30A 2MH9A 1JGGA 4M0VA 2XAJA 4PUSA 1M1EB 2A68F 2CV0A 3RKYA 3OYJA 3L2VA 3G1MA 1WJEA 5HDNA 3MHHC 5EEHA 1GUUA 1JUSA 2KJCA 4U0WA 2K9QA 4XRMA 2K9NA 4GZNC 3ZMDA 4AWXB 3IAM2 1E3HA 4D7MA 4NUBA 2A6TA 1YX5A 2E71A 2PX9A 2RAEA 3IH3A 2YR2A 5DM7F 5HLGA 1SEUA 1T38A 3H9JA 2I10A 2RPCA 1KZHA 2EE8A 5T6JA 1UB9A 3NRVA 3CCQI 2L2NA 4ZZDA 2WCC3 4B43A 2NUEA 3AFHA 1A1KA 2D2WA 1CF7B 2YRMA 3K7AJ 2R5YB 2PBIA 2V87A 1OCOH 2AQFA 3THNA 3S3NA 3OMLA 4IHSA 3GTMJ 2P4WA 4XKCA 4ETSA 4GFBA 5TISC 4OIQF 1CGPA 1ZRFA 3TO6A 4KA4A 1D8JA 4CCKA 3DTEA 4WCGA 1R6RA 3HOZJ 4EJVA 2W48A 2VKEA 4IOCF 2EMAA 4F7ZA 2EZKA 3HXLA 4HW0A 4BQQA 1UELB 3W2AA 3BQYA 5E20A 1WZ2A 2V89A 4S05A 2JOBA 1YHQI 2R7RA 2PJRA 2F2EA 2FX0A 2M8EA 3BR1A 2NUGA 2K9SA 1FP1D 2JMWA 4XNFA 4YIIA 3ZMTA 1U6GA 1PYVA 1W36D 2YT4A 1MEYC 3M07A 2NVTJ 1VQKI 3HUGB 2QZ8A 3GLXA 1SVLA 5M5YJ 1YJNI 2EIKH 5A6KA 2R7FA 1X19A 4BQAA 4NDLA 5FFXA 4Y33A 4BC7A 2YTIA 2W25A 4ZC3A 5K5RA 2NAZA 1Z21A 4RAYA 3L2UA 3W6VA 4R2DA 4LK1F 5CPRB 2MKNA 4BHCA 3UNGC 2KQRA 1WWXA 3CC2I 5LL6R 2BW3B 5ICEA 1KU3A 5E3LA 1JT0A 1LE8A 3BY6A 2LG4A 1WJ5A 2L7FP 1K6OA 5AE1A 4ZDOA 2F5CA 3M1CA 2GXBA 2YTOA 1SVMA 4NNJA 2OPTA 3UR3C 1APLC 2L01A 3LQQA 2GOMA 1HDDC 3GTOJ 2ELZA 2L92A 2F4VE 2JJ7A 1H88C 2HQNA 2DDBA 2L3JA 2XROA 4M73A 1OCCH 1GT0C 2A61A 2FMYA 2R7OA 5HDKA 4L8NA 1KYZA 5E1WA 5IWAE 4RMNA 4WYQB 4IO9F 3WG7H 4G94A 3EPZA 3H5AA 1FSEA 3HSEA 2AQEA 2DIXA 3HZJA 1PKPA 1STUA 1U5TB 4HV6A 2L3CA 4DUZE 2RV8A 1T8IA 4CCJA 2LY2A 3OSFA 1F9NA 3KP4A 4HNVA 3MZHA 2H27A 4CHUA 3SZPA 1ZTRA 1HQCA 3FDYA 3F22A 5FKKA 4RB2C 1OYWA 4RLQA 4F93B 2YWQA 3GTKJ 2XSDC 4XLNF 1IG7A 2EM4A 4BXUA 5DM6F 1J9IA 2DBBA 4ZTJA 1MGTA 5M5WJ 1QU6A 1DDNA 1X3CA 2VPLA 4RGRA 5IP7J 1U2WA 4KUMA 4WX9A 2ZJRF 3GTQJ 4F9CB 2P5LC 2EM0A 5ICFA 1TQMA 1G3TA 3JRCA 3QYFA 1P4AA 1FTZA 1X2NA 3U9GA 2B63J 2HQAA 1X4OA 2MDGA 3EYIA 3NWTA 4O5VA 3KLNA 3RKWA 3PFYA 4UVCA 4XBFA 4MIMA 1DGWY 5DS9A 3AL0C 4OIOF 4XIDA 1AH5A 2LY9A 4V19K 1YYWA 2CW0F 1ZR2A 3V8LA 4ZJZA 5DYMA 3C18A 1HNXE 4HYEA 5HOOA 3KZYA 1BBYA 3V42A 1KQ8A 4KJZA 1YUIA 1OYYA 4R2RA 5KL5A 4AU7A 3NQOA 2ZNZA 3S1QJ 4KN4X 4KFCA 3CZ6A 3ZMVA 1HLVA 1FT9A 3LOCA 2FNAA 2F5FA 2IS2A 3DF6A 1LNWA 4L9TA 2P81A 2HC5A 4NBQA 4X64E 1T6SA 1R1UA 2KT0A 4Y3OA 3LFKA 4Z2YA 1XMOE 5BPDA 2O0YA 1J5EE 5DCFA 2EMZA 5FROA 1HC8A 2R76A 4YHHE 1X48A 3K4JA 3E6DA 1QVTA 3ONQA 4IJDA 3H5RA 3CCLI 1XSVA 2EFNA 4C3JJ 3G6EI 4O3MA 1S7OA 2EV0A 2LNBA 2X6XA 2R7VA 5L3DA 1PJQA 3ZQIA 2W00A 2RSIA 5J6XA 5A2QZ 2ODRC 3TOBA 3O2PE 1ETKA 4I7HA 3L1PA 2JVGA 2XAFA 1YX3A 4PJNA 1IN4A 1P7IA 2K86A 2O9LA 1MMAA 1ZLKA 2JPBA 4BHPA 2OCEA 4DBRA 1ERDA 2HQ5A 2HGCA 2WAQN 2EPNA 1KQ9A 2RC4A 3BZKA 3MEXA 4IKFA 2DA7A 3CUOA 1EF4A 4HSTA 2O7OA 4MNUA 4WXDA 2IVMA 3V8KA 1A5JA 1WVRA 1QVUA 3U2RA 1XC5A 2KHXA 2L7KA 1S29A 2RDPA 3ZQHA 3BJOA 2EMFA 1MD0A 1STZA 2WAQA 3FM3A 2QKLB 3CDIA 2DFIA 2NS8A 2LD5A 1HBXG 4M30A 1WGXA 3PSIA 2L02A 3LA2A 1Z05A 2ZMEC 4JI7E 1N32E 3IRQA 4A93J 4BL0B 3L2RA 1YTYA 5AIPA 5DDGA 3HPSA 2XPWA 1TT0A 2ZBKA 2JOXA 4HAMA 3BPXA 4DIQA 1I6XA 1SFXA 4I0BA 2RTXA 3K1PA 5EEGA 4O4KA 1POGA 3F9KA 3H92A 2DT6A 3MZ8A 1WQ2A 4L5IA 1HKTA 4A0ZA 2X51A 4FASD 1YPNA 1GV5A 3ZRGA 4GCVA 1X6FA 2LOOA 4X8WA 1X3UA 1IAWA 4I01A 4FCYA 2DMPA 2Z2SB 2KDOA 4OWRB 3PO3J 2EOFA 2CUZA 1ZELA 4G6DA 4UB6C 3OIQA 2V26A 3CO7C 2OD5A 1LFUP 2GPIA 4HF0A 3DBRB 5E8GA 1ZG1A 2YX7A 1T0FA 4DV4E 2MBFA 1A1LA 2DRPA 1ZLJA 2PQ8A 5L3GA 3OYAA 2JVAA 1N75A 2VN2A 4LMYA 1RNLA 1ON2A 4LFBE 5J3LA 3KP7A 4RS8A 4BBYA 1EKZA 3BJAA 2XKOA 1R1TA 5F08A 3O8HA 1Z3YA 1XG1A 3K10A 4FETA 3LSKA 4C30A 2DTRA 2EA2A 1MDMA 2ENHA 4ENMA 1WKMA 2CQNA 1K7AA 2EM6A 1Z77A 2M9HA 4B3ME 5FJ8J 1AAYA 1FX7A 2DJIA 4FHTA 3PNTA 3DKWA 3ROUA 2H6CA 2VQGA 1FKAE 1BIBA 4Q48A 2WWYA 4N4RB 4IHTA 2F48A 2F5VA 4XR6A 1N78A 4DR3E 2EMHA 1QZZA 1XTAA 4DBQA 4G7OF 3S15J 2EN7A 4JI0E 1D8KA 2FOKA 2BY1A 4J19A 2R93J 1WH5A 1Z7UA 4BQOA 4A0YA 2EOQA 1X4PA 4KMFA 4MO7A 2VBZA 5JR3A 2I13A 3HEFA 1O3RA 1B59A 1O7FA 2BV6A 1VF9A 2LE2A 3M99B 2L0KA 1U5TA 4CUGA 1MNDA 1RZ4A 1R5HA 3E5XA 3QPHA 2EOOA 3P9KA 4QSHA 1TC3C 1SD5A 1ZYRF 2J5PA 1NK3P 2CH0A 2UUCE 5CVIA 4XKVA 1AOYA 4U0VA 2EPOA 3K1MA 4G6QA 3MCZA 1TQIA 4R2PA 1BR2A 3R61A 4HF2A 3DTIA 2HYFA 5FRMA 2DLKA 1RC7A 5GTIC 5B5EC 2K9MA 3KETA 3LMLA 1J7KA 1Y6IA 2CWEA 5JLWA 1DQUA 1FWZA 1HW1A 1OCRH 4XK4A 2KDZA 2NVYJ 1S72I 4DV7E 4NZVA 1G4DA 2DW4A 5EJCA 2I9IA 1HSJA 2XGCA 3I55I 4BY7J 2WAFA 3K9TA 2BZTA 2OQGA 4LD5A 1ETOA 4EM0B 2YTJA 1GXQA 1KU2A 5D4SA 2CRGA 2ELKA 4HQEA 4L0ZB 4DNCA 2B7EA 4TUIA 1JXSA 3WTTC 3DP7A 4P9FA 2HPMA 1K6YA 2ZMEA 3CCRI 2LT7A 1XD7A 3V7CA 4F6NA 1IXSB 1FNNA 1H9GA 2X1CA 2LRSA 2HXOA 1YW9A 2R0QC 3Q0WA 4YIFA 2W85A 2F8BA 4NC7A 4L9VA 4BEHB 3WE3A 2VUMJ 3PL8A 3K4MA 3WU1B 1LFBA 3ASOH 2E1MC 4CSWA 1GV2A 2O8XA 4Q5SF 2PJRB 2EQ0A 3FHZA 3AAFA 3DBLB 4RA2A 3L2WA 3HIFA 1V54H 2DOEA 1LE8B 1GVJA 4IPAA 5GADJ 3COAC 2MA3A 1YYOA 3QAHA 3FXRA 4JV5E 4CGZA 2IGOA 2NOGA 3ECRA 3Q0UA 2JR1A 4XSZF 2X6WA 2EM2A 1JHHA 3GF2A 4O6JA 3P9IA 5LMUE 5FLXZ 4II2A 3HTXA 4D5CA 3LLHA 1BC7C 1FPQA 1MBHA 2YU9J 2E36A 2QLZA 2W4SA 2GZWA 3HUGA 2HKOA 3LSPA 1LUJB 2M1SA 2LKXA 4XONA 2XUBA 3M9AA 3NAUA 1X6HA 2XGXA 3CO6C 5C4XJ 4BBSJ 1H8AC 1IW7F 1HXDA 2E19A 1VQLI 5JI6A 3S1NJ 4BQNA 1YSAC 1T95A 2VBYA 4NC6A 1W5SA 3HRSA 3F0CA 4FQGA 2ECCA 2ZB9A 4YFNF 3RPQA 1EJ9A 1HR0E 3ERMA 1DU6A 2M7QA 1O7LA 2EZLA 2HVQA 1ETYA 4P96A 2DMYA 1VQPI 2ADRA 3I53A 4M74A 4AQYE 3ZQ7A 3OS0A 2GBYA 3KZZA 1I27A 2XAGA 4YY3E 4M3EA 3OOPA 1FYMA 2DA3A 2HWVA 4P1WA 3B6AA 3E0JB 3RQ4A 3ZOBA 4Y52J 3FBIB 3BC8A 3WHBA 1SAUA 2PMZN 3E6BA 2Y48A 3VB2A 1BI1A 3S17J 3GFJA 4UXNA 4WXCA 1JKQC 2HEOA 1YRNB 4LLNA 2G0EA 1FEXA 1VQ7I 3J7AY 1YS6A 3E6CC 4OIPF 2M5WA 3M4OJ 2EOZA 2HOEA 3ECOA 1ZAAC 3ADLA 4WF2A 5HS7A 2A69F 2JT1A 2XSJC 2H36X 1A04A 3LL7A 3TQMA 1XGMA 1S9HA 5CFFE 2KISA 1JUPA 2BY3A 3HTSB 2MKDA 5JVTA 2CTDA 4DR4E 3OYDA 2EWNA 1LDKB 3E1SA 3K1NA 3U21A 2VF1A 1TP4A 3OYIA 2JVHA 4MEYF 4BS9A 4U7DA 1MBFA 4M9XA 3OYMA 1X1DA 3E97A 5IYCJ 1HOMA 3K0LA 1FLIA 3BT9A 3SDGA 2K02A 2P5VA 2QGUA 2R3SA 1B8IA 3DU5A 1R7JA 4J00A 3KYLA 1MNMC 4A3BJ 1Z9CA 3FXLA 2HYGD 3ULQB 4F55A 1P47A 4GO1A 2EMKA 3JAMC 2JSPA 1O57A 4LF6E 4JP0A 3FMQA 5LHGA 1IRFA 4EM1A 4XLAA 3IL2A 3CCVI 5AC5A 2FBIA 2NS0A 3MZYA 4OMZA 3IHUA 3TBIA 3RDIA 1JGSA 1RQ0A 1J59A 4R79A 3MWMA 3O3KA 1O3SA 4WPYA 2XF6A 4WSGA 1OMIA 4NQWB 1FJGE 2VLAA 5KNLA 3PNVA 1JT6A 3HL2A 2DTZA 2H09A 2VBWA 1IN5A 3J7AO 2E2IJ 3KCCA 2OU2A 1P9QC 5A6JA 2L9VA 2QQAA 2RGVA 3BCBA 4LK0F 2WB1A 1I1SA 3CMMA 5D5VB 3QOEA 2FF4A 4M72A 2V9KA 2HS5A 3Q5FA 3NARA 1XSDA 1GDTA 2EV5A 4W1UA 1QHHD 4FE7A 2V1NA 3U1DA 3WE2A 4X1EA 2V6CA 3HOYJ 3T0YA 2PJPA 4BE0A 1N33E 1BA5A 2KFDA 2WB1N 5IOYA 1GLNA 4XLEA 2BOLA 2O03A 1JKRC 2R92J 1IRGA 1D3YA 3VFZA 1IN7A 2LFBA 4F52A 3LMMA 2UUZA 2EB7A 2O3FA 5B1AH 1FIPA 2V88A 2RNGA 1OCZH 5J1UA 5F1RA 2V1UA 1MNEA 4IL6C 2HNHA 3C2HA 5D5WB 2VE9A 2UXCE 2CG4A 5LGTA 2LMDA 2XPUA 4M9VC 2H1LA 1J09A 4N0BA 4UHTA 3IKTA 3M3YJ 5IYDJ 4QPOA 5H20A 4DR2E 5CQEA 4LB5A 2Z33A 2QF7A 3JRAA 2I8DA 1BJAA 3WTSC 2H8RA 3TP0A 1FJLA 4BACA 5LHHA 2IW5A 4AYBA 2Q8KA 3J81Z 1T2KA 4WWCA 2XHKA 1K83J 3LNQA 5H2FC 3H3UA 3CQZJ 4LLLA 2FRHA 4BCAA 2MC3A 1S3JA 4UUVA 4OMYA 3C3WA 3BR3A 2HDDA 2NRAC 1VQOI 5LFAA 3HC7A 4D1QA 2BEOA 1U8BA 4M3GA 5E8IA 2XGEA 3SXYA 3RSNA 3GZ5A 4B48A 4EJOA 2OZUA 4LIUA 4KYWA 2DA6A 2UUBE 2EINH 2BY2A 5HS8A 4Q28A 2GA1A 1Z1BA 3KEQA 2FD5A 3ZR8X 1YFHA 4CYCB 1T4NA 1YYKA 4I2OA 2OTJI 3KP6A 2A3SA 2R4GA 1ZBQA 2YPNA 2FEZA 2M0CA 1PDAA 3HPZA 3QG5C 4G6TB 1FYKA 5KL4A 1QZEA 2FSWA 2EFOA 1PJSA 2UXNA 1FBQA 2KRCA 2LKPA 4BYYA 2DCEA 4PK4A 1OCPA 2QBYA 3EUHC 2LTRA 4LFCE 2DFEA 2VONA 1G59A 4P7DA 5HNFA 3M1EA 1QHGA 1ZK8A 4GEQB 3K4KA 4RB0A 5DUIA 1MSFC 2D9HA 3HRTA 3DF8A 3RTRA 5CVVA 3H0GJ 3HDDA 3W6KB 5J1RA 5J4YA 2QBYB 3BR6A 1T0FC 2HTJA 3S1MJ 2QQ9A 1WJDA 4RDUA 3RPUA 5HODA 1FOKA 2EM3A 2LBFA 1I1GA 2CSHA 1PDNC 2EORA 1FY7A 4M6XA 4XRSG 3I56I 2E5LE 4DGWB 2Y0SN 4PJ0C 4ZTFA 3TOAA 2L7ZA 4XLHA 3S1RJ 1I94E 4MHGA 4DKKA 3A03A 4EJTA 2F4IA 3E3VA 4AD9A 3TDUC 4BY1J 2TRTA 2XB5A 2XV4S 2QUFA 1W5CC 2UXBE 2BVLA 3W2VA 3RCOA 2Z99A 4L5EA 4EM2A 3MKZA 3B73A 4HF1A 2ISZA 2STTA 3SYTA 1IDZA 1N36E 3DEWA 4BJ5C 2MC6A 1KYWA 3CCMI 4ESBA 1TNSA 2EIMH 2KL4A 2XGDA 2XASA 4IX7A 4NXNE 3H9QA 2IS4A 4GYGA 2ELJA 2Y75A 3E6MA 2XC7A 1DU0A 1TZLA 2K85A 2PMUA 1USSA 1R22A 4AIKA 2JN6A 3TQNA 2B7TA 1I5ZA 4A6DA 2J5OA 4DR5E 1T4LB 1YZ9A 5LMNE 1J26A 2KMUA 2EFQA 5M3FJ 1BB8A 3VEPA 1B72B 4Y17A 1D0YA 2CQXA 2L9RA 1H89C 2LYCA 1PP7U 2VQFE 2DPDA 2ELYA 1L4SA 1ON1A 2LSOA 1TF6A 1YI2I 2FTXB 4HG2A 3OOUA 3ZMUA 4IEJA 4YFKF 2Y2ZA 5EF6A 1AKHA 4FISA 1ULYA 2BHZA 2COMA 1A6IA 1I3QJ 3SFIA 2WC2A 2VRDA 1UCRA 4AIJA 1ENHA 2ESHA 2EMBA 3IAS2 2A5WA 5E79C 2OA4A 1OKRA 1XMKA 5GAEJ 4WXHA 1PUEE 3ADIA 1Y8RB 5IT3A 2M4GA 1UAAA 2WBSA 4KIFA 2MDRA 4ZDLA 2CV1A 4R03A 3G3ZA 4YRVA 2VXDA 5D5XB 4L0YB 3J80Z 2CPNA 2EBIA 4JI5E 4IHYA 2Y9ZA 5GAHJ 1IXRC 3JAMZ 2EJ4A 2Q8UA 3D1NI 3VPRA 1HKQA 2M34A 4WK8F 4A3KJ 5D6FA 3J80C 2YRKA 4RGSA 3JRDA 1LDJA 2KLOA 2DT7B 3HOUJ 3I64A 3S93A 3ZQCA 1QA6A 2EIJH 1FMWA 1Z0XA 3JU0A 2KIUA 3FK7A 3LWFA 2CFOA 2HTSA 3ADJA 4LF5E 2WV1A 3FISA 1U9NA 2Y30A 4XRSA 2EMCA 2EZHA 3PUFA 5IOZA 1U5TC 1LLMC 1FP2A 1G2DC 2CQQA 4DV1E 5DCMB 4A3DJ 5CJ9A 2ID6A 3QQAA 4B4CA 3EPKA 1LKXA 3WG9A 4NB5A 1I6HJ 2R7ZJ 5E1XA 4ZYDA 1ZQ3P 4CXFA 4ZH4F 3OS2A 5DTDA 1U3EM 2EMIA 1KGSA 3CUQA 3AG4H 2EMLA 4DV5E 4XRFA 2UV1A 3FXQA 2A6HF 2VKDA 1UG0A 3ML6A 3A01A 4FX4A 2QWWA 3GFLA 2YX4A 4OAYA 1KYQA 2LP0A 4RAGA 4IHVA 2FGGA 4TUGA 1DP3A 1V4RA 4ZYEA 1AA7A 3R0AA 2CMPA 1B4AA 2LREA 2EPMX 3ZCOA 2E1CA 4LF9E 3IWFA 3WTWC 2BHYA 4JX5A 1YITI 3OMYA 3ESWB 1A1GA 1LEAA 2DA4A 3MD2A 3WHCA 1JKPC 2V9VA 3DCFA 3QPSA 3CJQB 5HLIA 2DQLA 1LVKA 2CUJA 2ISYA 3ECHA 3WTXC 5JFRA 1SR9A 4E7HA 2EWLA 1ETVA 2BY0A 5LRRA 2NUFA 5AONA 4RAFA 4Y13A 3IWDA 2LUQA 2YRHA 4AIDA 3FXJA 1RI7A 4EQQA 4CICA 1Z7LA 2VJ5A 3KX2A 4HX8A 3K70C 1NCSA 3H9GA 5ADZA 1XNQE 4RAZA 2G7UA 3K4CA 2V79A 4YFXF 4D7NA 4OOIA 2UZKA 1ZRDA 1VQ8I 2JUCA 3JRGA 3HKZA 3ZXSA 1YIJI 3MVPA 3QODA 5F27A 4ENJA 4QLCU 2L3DA 3UK3C 3CCUI 2PLYA 3VYYA 5CVJA 2E5ZA 2XF7A 1QGPA 5BNGA 1RR8C 3RZOJ 1VQ6I 4Q47A 2Y31A 2HHHE 5FKMA 3G71I 4P9UA 1B8IB 3I59B 3MMYB 4XL9A 1OR7A 1RIOH 1IBKE 3I54A 2YU8A 1OCTC 4Y4RA 2Z16A 1USTA 2G7HA 4CZZA 1TBXA 3DJWA 3PFIA 4ENNA 1ZU1A 4LFAE 3CUQB 1SVOA 4JYKA 4G7HF 3ABUA 4E7JA 3AG2H 1YQAA 2JTVA 2XRLA 3TW7A 2YTDA 3DPTA 1MBGA 1XMXA 1R36A 2KZVA 5JLXA 1XCBA 2D1VA 2LF8A 2JPCA 2MD5A 3WTVC 2L8TA 4NQWA 2F5EA 2L2KB 3IC7A 3S3OA 2M4IA 2EMWA 3J81C 2LJHA 3EPHA 1G6NA 2ZXWH 2KZGA 4PDKA 3DFGA 4R1HA 5LBQA 1UBDC 4XN0A 2Q2EA 4KISA 1K4SA 1D1BA 2ZFWA 3A2KA 1X49A 1CF7A 5AC4A 4A69C 2LBFB 2C6YA 2DK5A 1T33A 2FOWA 3WTYC 3O8GA 2EZ6A 3ZGKA 5C44J 3SZTA 3GLLA 1NG6A 4G8XA 2OQRA 2W84A 3LFUA 2L7MP 1XS9A 1JI8A 4C3IJ 3RYPA 4IJAA 5LLQA 3H3ZA 4C2UA 5IT9C 2L9SA 3CCEI 1NEIA 4MFEA 5L3EA 3LSGA 3JRFA 5HNHA 1IUFA 2CS3A 3F6GA 4IQJA 5A69A 2AXTC 1PUFB 1FIAA 2HPIA 3BLYA 2VQCA 4BXFA 4BXXJ 1XMAA 1GQEA 3KP3A 2DDAA 2Y0MA 2ZSIB 1W5TA 1WSUA 3D5LA 1RUOA 5LHIA 3AG1H 3T1BA 1OR7C 1K79A 2ZM6E 5KK1A 4A3MJ 3K2ZA 2WBMA 2PG4A 1XDUA 2DMNA 3OS1A 2Q0OA 2DQRA 4LG0B 1TWGJ 2DAOA 3B6CA 4MLVA 4M6YA 5K5OA 3J81K 2ECBA 3GCMA 2EN3A 3FIWA 4NC8A 2EPXA 3PJRA 4UVBA 3H0DA 1QQIA 5LD2C 1F2IG 5KAFC 5IT9K 1S8NA 2CW7A 1AHDP 2DFFA 4UUTA 2EM7A 1Y1WJ 4U88A 3RIRA 5FD6A 3WGIA 4LIVA 5C3EJ 1MH3A 2VPRA 2K3PA 4LGWA 2ZXIA 1OFCX 4EV0A 5A2QK 3G1OA 2EA4A 2F6CA 4GYIA 3F6OA 3OYFA 4DR6E 3HM5A 1XPXA 3WGHA 5B1BH 2B3TB 2JA7J 1JTYA 2X0LA 1BIAA 4M6VA 4CH7A 2RVCA 2BGCA 3H1CA 5FO5A 1J5YA 5HVQC 3Q9VA 1XSXA 2DA5A 3IH2A 2JK3A 3G73A 2ZJQF 4M71A 3CMAI 1Y0UA 1UJ8A 1JJ8C 3D0SA 4JX6A 2JY9A 2EM8A 1T98A 2OJED 5E1ZB 4G12A 4LLGF 4UV9A 5CKTA 3J7YJ 3MHSC 4TV7A 3QYEA 4KITB 1JK2A 1RR7A 2JA2A 1UFMA 3UKGA 3BP8A 1VQ9I 1MDMB 3W2WA 2FNPA 2EPAA 2V6EA 3JW4A 2DA1A 1I39A 2VASA 2BBGA 3TW6A 3W6JB 3GTPJ 2VQHA 2Z1DA 3BG6A 2RQPA 2X6OA 3S2DJ 4XKWA 5TJJA 1HF0A 3D5SC 4HBLA 2AXLA 5FD5A 4LU9A 5BS6A 1XB4A 2HFHA 1MMSA 2R7XA 3ZN1A 2ZJPF 1YW7A 1HSTA 5DD4A 2CU7A 5K5QA 3ADGA 2FU4A 2Y69H 2EPCA 1YE9A 4LJZF 2MD0A 4RGUA 4JK1X 2P6SA 1FYLA 2L4AA 3VOEA 4CCMA 2PEXA 3FK6A 4LOCA 3HQ1A 2K40A 1Q1VA 5L3BA 3T1YE 3K6GA 4A3CJ 2L5QA 2Y9YA 2UU9E 4I76A 4ZDPA 1UHZA 4M3FA 1QBJA 2XKPA 3R6SA 4B47A 4F6MA 1EH6A 2ICWG 1H0MA 2N8XA 3TMOA 2EV6A 4BJ6C 2K4JA 1YYVA 5ERIA 2LF7A 2EPFA 1K61A 5M5XJ 3SQNA 2FXAA 2XF5A 4KN7X 5CVRA 1R9TJ 4AM3A 2EOIA 4A5NA 2L9NA 4XMYA 3VSKA 2R7DA 4DV2E 4L18B 2ZXJA 2RREA 2VB6A 1J2XA 1T56A 2OTLI 3ABMH 2VQEE 2RS6A 4RM2A 5F1JA 2UWMA 4L5JA 1ODDA 3O6BB 2CV2A 2GWRA 4ASNA 3OIOA 3FF5A 5L3CA 1MZBA 1OPCA 1JUMA 4CO8A 3VYRB 2IEKA 3H35A 4O5GA 2DMTA 4KT5C 4ABZA 5FLXC 5D4RA 2FBHA 4RB1A 2BVMA 4HZFA 3DU6A 2R7TA 3BR2A 1G8XA 4KDPA 2PN6A 1B9MA 1X47A 4N9IA 4P55A 5EG0B 3OYEA 5E3NA 2Z9OA 3PM1A 2DOAA 3P1XA 3FMRA 5IP9J 2R7WA 4UY8I 2QEXI 2OZ6A 3FHNA 2ZO4A 4L5NC 2HOSA 4DV0E 1VI0A 2EOSA 1TF3A 3WTUC 1RUNA 1OISA 3AKZA 2DOFA 4E7LA 1JHFA 3BF2A 3J80K 2EP3A 4JYAE 1NK2P 1R23A 2IRFG 2P0WA 1UHWA 4II3A 2ME0A 5HS9A 3T5XA 1YO5C 2EMXA 2LVSA 3BPVA 5F0CA 2NVUB 3JREA 4CCOA 3OYNA 1SD7A 2VOPA 2K9LA 1I50J 3VHTB 1TWHJ 1R5ID 1X6EA 1D5VA 4D5FA 2CO5A 5EEAA 1A1IA 5LGUA 1Z67A 5FRNA 2HVRA 4Q35B 3CCJI 2Q1ZB 4HTGA 2LMZA 3J7AG 4DR7E 3I3LA 5F6FA 2ME6A 2IS1A 2L6MA 4GXOA 1JTXA 3MAJA 4M3DA 1HNZE 3N4MA 1L3LA 3V4GA 3IV5A 1BM9A 2DJNA 1HA8A 3TKYA 1IZ1A 2V1XA 2E7XA 2R7UA 1VQNI 3FXOA 3QYBA 1Y1VJ 5GP9A 1B69A 3EPJA 1WH7A 2LBSB 2ODRD 1X1CA 3JTHA 2LDUA 2H1KA 4K0KE 4N9HA 2EPKX 2ZCWA 4U87A 1JK1A 2A5YB 4BKXA 5TGTA 4EGYA 4X6AJ 2KIMA 3HB9A 1D5YA 2DA2A 3A02A 3BROA 2JZYA 3I4PA 1OJLA 3ERED 3FM5A 1X1AA 4BBRJ 2RS7A 2RQQA 2QYOA 3ABLH 3FIGA 2DMUA 2QVOA 5CVUA 3REOA 1P92A 3F6HA 1IN8A 5ED4A 2ZSHB 2AO9A 2EPZA 2P5KA 2R7QA 3LQRA 4KIGA 4LG3A 4E7ZA 2PI0A 5IT9Z 1DUXC 4M2ZA 1V3FA 4AC0A 1GVDA 4I99C 1VQ4I 2YTFA 4KNYA 1R5GA 1KQ0A 3CLQA 1BW6A 5K1YA 2E72A 2M0MA 1O3QA 2YSOA 2HVSA 1DI2A 1R4MB 2K27A 3CC7I 1E3PA 4H0EA 3BQZA 1TW2A 1KU7A 2CSOA 3KLOA 3TO7A 5FLXK 1IV6A 2DPUA 2EH3A 2V7FA 3BDDA 2IXSA 4XM3A 1S6LA 4HNTA 4IRIA 3S3MA 2DB2A 4J8ZA 1IRXA 3CUQC 3SDBA 3BR5A 2FBKA 2IGKA 3MFKA 2KPMA 2GQQA 1DGRM 3DPLC 2YTQA 3T8RA 2QKMB 5D6EA 1REPC 2OAZA 3EUAA 3JSPA 2KRHA 3K69A 4UVAA 4BC9A 2KKOA 1G3WA 3CF2A 5GTHC 3GZ6A 3HOWJ 1H9TA 2ESNA 3OYGA 3QRFF 3GTGJ 1X1BA 2JRTA 3R60A 4PGHA 2P6TA 4RGXA 2LJUA 2YU5A 3FWEA 3VYXA 3C4TA 3HOTA 3EYYA 4X65E 1KA8A 1SMTA 1NH3A 4S04A 1WJCA 5KL2A 4EJWA 4EEFG 3M8FA 5J40A 2XDVA 3C4BA 1SD6A 5BMZA 1B72A 3GMEA 3EPLA 1SC7A 1IV8A 2QSGX 2IGMA 2LV2A 1TL8A 4YG2F 1D0XA 3DLLF 3K4LA 1RESA 4DYQA 4HX7A 4B09A 2B9DA 1FMVA 2P8TA 5FB2A 2XRNA 4RM3A 3VODA 1FC3A 1ZN2A 4ZYAA 1ZR9A 4E6KG 4BEHA 2E5NA 1D0ZA 1BOAA 4KHPE 4M3BA 1A6QA 1VQ5I 4DQ2A 5IXMB 4JX4A 1KONA 2NOJB 3D5RC 3I71A 1ZHFA 3C6KA 4I09A 4F3QA 2EK5A 3DEUA 1MBJA 3G2BA 4XKBA 1OYIA 3OYCA 2OUMA 3KIOA 1V5EA 3JTZA 1VTNC 2FQ3A 1W0UA 4XN3A 4L9JA 5A6BA 2V4JC 3FXUA 4R2SA 1IXCA 5FGMA 4KIBA 1LPQA 4RH8A 2NYXA 1XMQE 2OV7A 4HEIA 4GDFA 2X1EA 1UHMA 2EPRA 3AV0A 3LAJA 3Q3SA 3H36A 2ZKZA 3V7RA 3K4BA 4CA0A 1BI2A 3BG5A 4JQFA 3R4KA 4HNUA 3BTLA 2BYVE 5KVRA 1IDYA 1W4MA 3K2AA 2MG4A 4DZJA 1R58A 2MLGA 2QSFX 1MBEA 1Z6TA 5A2QC 4I8OA 2RSMA 3L2CA 2HGHA 5IY5H 2IPQX 3C6MA 2PMZA 2NVQJ 4M9SA 2VT3A 1RETA 1QZYA 1LVAA 1YLFA 4X66E 4KZSA 5BPIA 4CCLA 1IMUA 2QM3A 4A0XA 1GHCA 2O6GE 2VOOA 2EPPA 2NNYA 2CUEA 2WBTA 1X3ZB 4GRIA 3ZMSA 1R4NB 3L09A 4CYDA 2ACJA 4BGDA 4BHBA 1F4KA 5IV8B 1YOVB 3GUDA 4IOAF 3FXMA 3GXOA 3C2GA 3I0TA 4CYCA 3I4NJ 4WSPA 3MN2A 2LUPB 5D8LB 2M2EA 1YJWI 1HW2A 5LGNA 3J7ZI 4H4KC 1K4TA 1IF1A 2HZTA 1ZR4A 3BG7A 5J8CA 1ORKA 2KOUA 3DTKA 5CYVA 2TCTA 3BGHA 3P7NA 2XPVA 1Z91A 3Q0VA 1YIOA 3V7SA 4D9JA 3LSRA 3I58A 2E2JJ 2CQ7A 2HYJA 2N8GA 3DLAA 3BTIA 3F8CA 4YEJA 2R5ZA 2WBUA 4R2QA 2MW8A 5GPCA 5IPAA 3L9FA 3C1DA 1IRZA 1FBUA 2VQLA 2Q2EB 2FV4B 4I02A 1EV7A 2V83A 1RC9A 2GOXB 3A0BC 1V5GA 1S7AA 4ENKA 2JPAA 2DYRH 3OYKA 5KL6A 2EZIA 3OV8A 5DD8A 5ILUA 3ASNH 3G1LA 4FE4A 1MMDA 2X9DA 2E2HJ 1YUJA 3W3CA 4HSRA 1E17A 4LTYA 5J4VA 2MYSA 3DPUA 2HOTA 2BBYA 3H5NA 2DLLA 2M3AA 1W36C 2LCEA 4OAZA 2K4VA 3R0JA 2VC0A 1DGCA 2E1MB 4B1RA 2DMQA 5HLTA 4G7ZF 3QOPA 2E34A 2QCOA 4JOMA 3RJPA 1K78B 2QSHX 4JI8E 3A0HC 2V1DA 3LA3A 2YTGA 4QPQA 2RQLA 5BR8E 1YJ9I 1SFOJ 2VC1A 2EMYA 3QPLA 1X1PA 2WV0A 4A6EA 3JRIA 1U8RA 2ADUA 2VT2A 4OX9E 4N4NB 1VNDA 2FJ1A 2M7AA 1BN5A 3I9V2 5TSEA 3N05A 1LJ9A 1DQ3A 3TDZC 5TRDA 1TT5B 2W82A 2EQRA 2NS7A 3NWSA 2MFZA 1N3GA 4PFOA 2AS5F 1A31A 1XNRE 2LY1A 2R5YA 4V2FA 3AUZA 1Y56A 2W1OA 2YZTA 5CLSA 1N25A 1G2FC 4HA8A 2CYYA 2EFPA 3L7WA 3OWTA 4KICA 3PQJA 4V2GA 4MTDA 1IBLE 3X2QH 2DT5A 1BBOA 1A35A 2BW3A 1N34E 2WZOA 1SAXA 1YG2A 4I98B 1UMQA 4IF4A 4PJMA 1EH7A 4O43A 3DKYA 3S2HJ 4BU2A 4JBAA 2A05A 3VSLA 1YW8A 4IRHA 5EGOA 4JI2E 2WY8Q 3JR9A 3HOXJ 3FKIJ 2EN2A 3TGNA 1A1FA 2B7VA 5JHFA 3A1YA 4B3SE 1F43A 5D8KB 5DNYA 3E7LA 3GFMA 2VIXA 3WODF 1TWCJ 2RKHA 4MFDA 3IUOA 1QNTA 4FX0A 4NHJA 4F9AB 3BR0A 4E7SA 1UILA 4LITA 2HOAA 1BR1A 2OC6A 3H09A 5A6AA 3I59A 1F5TA 1ZKGA 2A25A 2I5UA 2DMIA 4R8HA 5FLMJ 1A1HA 5FKNA 2LO3A 3MKWB 3HOSA 3IH4A 4IHXA 3CP2A 4NHRA 2IA1A 3GFIA 4F91B 1MMNA 3BBGA 4E7IA 1BW5A 1IN6A 5K7ZA 4PGGA 2H8WA 3GO5A 1MBKA 1YRNA 3DBHB 5E3OA 2N3GA 3DXJF 4ESFA 3IWCA 3IWZA 3RKXA 3E5UA 3U1KA 5M3MJ 4MLOA 3MQ0A 1SFUA 1U78A 4LB6B 2HDCA 2F5DA 1T4OA 3SHFA 2EN8A 5AE2A 2VE7C 2R1FA 1Q1HA 1TTYA 3P9CA 3HHHA 5ICCA 2MABA 4HQMA 2GA2A 4EVIA 4A3LJ 1R00A 2MLKA 1O0WA 2W57A 5H6RA 4L9NA 1S5LC 3JCUC 3S2WA 1HCRA 1KJKA 1Y0NA 3ABKH 4KT6A 4A3FJ 4FK5C 3KWRA 3KZIC 1OQYA 1BOBA 1TW3A 2Y0SA 4UB8C 1G3SA 1RKTA 4EATA 1BBGA 2DXIA 2HU9A 2EN6A 4P5OA 1SFEA 2E7WA 2XIGA 3OR1C 3FX3A 2VXZA 1B9NA 4PJJA 3QU3A 4BDYA 4GKJE 2QQBA 2X85A 1RMDA 1MIJA 4HDUA 9ANTA 1ETXA 2H94A 3VK6A 1KU9A 3C2BA 2E35A 3ZOQB 1G2HA 2DN0A 3DQVC 1Z3XA 2EOXA 4IHWA 2EL5A 3LSJA 1R71A 5FKLA 3VYUB 4XLPF 3RPUD 1ZGAA 2M4KA 3KFWX 4AUXA 3F8BA 4CDGA 1DP7P 2NA2A 3MKLA 2OF7A 4HOBA 3LA7A 1NTCA 5H6QA 2ID3A 2E60A 2WA0A 3VDXA 3WTZA 4DJAA 3ZQLA 2LTSA 4Y7NJ 1WCMJ 3OYHA 2V9PA 3GW2A 4CZCA 1HNWE 3HKZN 4WFTA 4ITVA 4C2TA 3F8FA 4XORA 2ZNYA 2LLKA 2YTEA 3RI4A 4E7KA 3KEYA 2YSPA 3RYRA 5ILVA 2DYSH 2HZDA 3ZQGA 4JI4E 2GXGA 1ZAOA 1TNTA 4B3XA 4J01A 4MEXF 3HG9A 1RPWA 3ZN0A 2TDXA 2GLOA 2COBA 3EDPA 2WAEA 1BL0A 1F36A 1WXRA 2QQ8A 2BXYA 4M9ZA 3ISPA 3SZGA 4BNCA 1PVEA 2JA6J 2R7SA 1IQSA 2FQ4A 2Z3YA 3NEUA 3EQLF 2DU9A 3K4NA 3CMEI 4PCQA 3LSTA 1GZ6A 3CLOA 2IT0A 1I3AA 4R2EA 5HLHA 2EJRA 2IAIA 2GIZA 2VJJA 5L3FA 4A3GJ 4DUYE 4B3RE 2IP2A 2NNNA 2NXNB 1XN7A 3SFZA 2HDWA 3VYTB 5D5UB 3RZDJ 1V5FA 4R2CA 2E1MA 4LF8E 1WHQA 1PUFA 2CW8A 4IQ4A 3CCYA 3GEZA 3IWBA 2M45A 2BB8A 2HJJA 2LVHA 4YIRX 1IUYA 4JI6E 5EDNA 4IS1C 4BDZA 1A36A 2HKXA 2JRMA 3CDHA 4OINF 2VJIA 4LF7E 5F64A 2UXXA 2Z5UA 4P78A 5AASA 3PIPF 4CCNA 2EILH 3K6QA 1ETQA 2EPLX 3F3XA 2MSYA 1ZGJA 1TWAJ 5KAIC 4KWYA 2CT1A 4U0YA 3HPGA 3WGGA 5J47A 5K7HA 2K7IA 3GTJJ 3A4CA 1BR4A 1JE8A 1HW5A 4XOTA 2JA5J 2L2MA 1RKWA 3EETA 3CD6I 2EQ1A 1W7PB 5EG0A 4X62E 4FTHA 1WJFA 4U7BA 2B9SA 3HYIA 3P5JA 2PFBA 4A2UA 3AL0B 5LEJA 4EGZA 3JRBA 2LR8A 2YPRA 1ZH5A 4A3IJ 3HSFA 1OLTA 3WU0A 1FTTA 3CDLA 2JWOA 3QP5A 3BIDA 2KJBA 2CJJA 2FUG2 1FOWA 2HR3A
chains in the Genus database with same CATH topology
4Y15A 3BWGA 4RB3C 2CQKA 4GGGA 1LB2A 3BJ6A 1AWCA 2RN7A 4HX4A 3QPTA 3B02A 1W7PA 2HQRA 2EFWA 1P2FA 4BH9A 3HSRA 4D0PA 5DEQA 2L54A 2YSRA 4BAYA 2VODA 2M1BA 4HLXA 5BOXA 1WRJA 1R1VA 4FT8A 2P7CB 4B8XA 3F72A 1ZG3A 1QPMA 2XAHA 1XCVA 4LG0A 2BE5F 3V8JA 2RNJA 2JSCA 1ZARA 2GAUA 2M87A 3F6VA 3ZPLA 2DK8A 1MKMA 4EMSA 4EJUA 1Z6RA 1B6AA 2YU3A 2GIVA 2OBPA 4HDVA 3CTAA 2A07F 1MJAA 2KRFA 2L4MA 1SMYF 2ZJ2A 1MJ9A 2IJLA 4ZYHA 2D1HA 2P7VB 3QP6A 1E2XA 5E18F 4MTEA 3I5UA 1QO0D 1ZREA 3Q9SA 2QENA 2FE3A 3HHGA 5LEKA 3GWZA 3LAPA 1SD4A 4A12A 3GVAA 2O61A 5DUKA 3C7JA 1PP8F 3F8MA 1MJBA 3IKVA 3PQKA 1EH8A 3ZP5A 5LRSA 2PMHA 2ZMEB 2B0LA 1BC8C 1DPUA 2E1NA 2STWA 3HRUA 3N97A 2FA5A 3F23A 4QWQA 3KP2A 5ILSA 1FZPB 3F21A 2ELHA 4K2EA 1O3TA 5DV5A 4I0AA 1XGNA 3IRRA 1B1BA 1WI9A 4G9YA 3GX4X 2W24A 2VBXA 2MH2A 3QU6A 3ZMZA 1L0OC 4MQVA 1XDSA 3ABTA 3BZ6A 4E70A 2A6EF 1FSHA 5E17F 5AIQA 2K7LA 1YS7A 1F1ZA 4OU0A 4A5MA 2KIFA 1Z1DA 3GYHX 4AIHA 2CFXA 5BQTA 2VE8A 2H6BA 1BI0A 2DO7A 2IA2A 1ZRCA 2FMLA 1NHAA 3HTUA 5HDGA 1P6RA 5DCMA 4LFUA 4AVPA 3KE2A 4ZZLA 3ELKA 1C0WA 4UNOA 4MQ9F 4ZYGA 3KP5A 4XSXF 5JHUA 3EUHA 2DI3A 4HLYA 4IRGA 3E5QA 1T39A 3L00A 1GXPA 3FMSA 2G9WA 1LEBA 1K78A 4IVNA 2X4HA 1XGSA 2XAQA 3JTGA 3T8TA 1FBSA 4MGRA 1LQ1A 3BOQA 2XVCA 1LDDA 3FZVA 1J75A 1XGOA 4OIRF 1J0RA 1TLHB 2WTEA 1P4XA 5J8FA 4IXAA 4ON0A 3M8EA 4ESJA 2IA0A 3M7GA 2K4BA 5FFZA 1TQPA 2D45A 3DV8A 4HV5A 6PAXA 1G3YA 1P4WA 3HRMA 3TO9A 4PZJA 3F8NA 3KEOA 1W7PD 3CJNA 1ZG5A 3JSOA 4Q4ZF 1BI3A 3JAMK 1DPRA 4KMUX 1ONVA 4UV8A 1HKSA 5ICGA 2ETHA 2CGPA 2M30A 2MH9A 2XAJA 2A68F 3RKYA 5HDNA 5EEHA 2KJCA 4U0WA 3ZMDA 4AWXB 2YR2A 5HLGA 1T38A 1UB9A 3NRVA 4ZZDA 2D2WA 1CF7B 2PBIA 4IHSA 2P4WA 4ETSA 4OIQF 1CGPA 1ZRFA 3TO6A 4KA4A 1D8JA 4WCGA 4EJVA 4F7ZA 4HW0A 5E20A 4S05A 2F2EA 2M8EA 1FP1D 4YIIA 3ZMTA 1U6GA 2QZ8A 3GLXA 2R7FA 4BQAA 5FFXA 2W25A 5K5RA 2NAZA 4RAYA 4LK1F 4BHCA 1WWXA 5ICEA 1KU3A 3BY6A 1K6OA 2F5CA 2GXBA 2L01A 3LQQA 2HQNA 2XROA 4M73A 2A61A 2FMYA 5HDKA 1KYZA 5E1WA 4G94A 1FSEA 3HSEA 1U5TB 4HV6A 2RV8A 1F9NA 3KP4A 3MZHA 2H27A 4CHUA 4EJTA 3SZPA 1HQCA 3F22A 4RB2C 1OYWA 4XLNF 4BXUA 1J9IA 2DBBA 1MGTA 1DDNA 4RGRA 1U2WA 4KUMA 4WX9A 2P5LC 5ICFA 1TQMA 1G3TA 1P4AA 3U9GA 3EYIA 4O5VA 3KLNA 3RKWA 4UVCA 4XBFA 4OIOF 2CW0F 3V8LA 5DYMA 3C18A 4HYEA 5HOOA 3KZYA 1BBYA 1KQ8A 1OYYA 3NQOA 2ZNZA 4KN4X 4KFCA 3ZMVA 1FT9A 2FNAA 2F5FA 1LNWA 4L9TA 1T6SA 1R1UA 3LFKA 4Z2YA 5BPDA 2O0YA 5DCFA 3E6DA 1XSVA 2EFNA 4O3MA 1S7OA 2EV0A 2LNBA 5L3DA 5J6XA 5A2QZ 3TOBA 3O2PE 4I7HA 2XAFA 1IN4A 2K86A 1ZLKA 2JPBA 4BHPA 2HGCA 1KQ9A 2RC4A 3MEXA 3CUOA 4MNUA 4WXDA 2IVMA 3V8KA 3U2RA 1S29A 2RDPA 3BJOA 1MD0A 1STZA 3FM3A 2DFIA 1HBXG 2L02A 3LA2A 1Z05A 3IRQA 1YTYA 5AIPA 5DDGA 2ZBKA 4HAMA 3BPXA 1I6XA 1SFXA 4I0BA 3K1PA 5EEGA 3H92A 1WQ2A 4L5IA 1HKTA 4A0ZA 4GCVA 1X3UA 1IAWA 4I01A 4G6DA 3CO7C 2OD5A 4HF0A 5E8GA 1ZG1A 2YX7A 1T0FA 2MBFA 1ZLJA 2PQ8A 5L3GA 2VN2A 4LMYA 1RNLA 1ON2A 3KP7A 4RS8A 3BJAA 2XKOA 1R1TA 2DTRA 2EA2A 1MDMA 4ENMA 1WKMA 1K7AA 1FX7A 4FHTA 3DKWA 3ROUA 2H6CA 1BIBA 4Q48A 2WWYA 4IHTA 1QZZA 4G7OF 1D8KA 2FOKA 1Z7UA 4A0YA 4KMFA 2VBZA 5JR3A 1O3RA 1B59A 1O7FA 2BV6A 1U5TA 1RZ4A 1R5HA 3E5XA 3QPHA 3P9KA 1SD5A 1ZYRF 2J5PA 5CVIA 1AOYA 4U0VA 3K1MA 4G6QA 3MCZA 1TQIA 3R61A 4HF2A 2HYFA 3KETA 1J7KA 2CWEA 1FWZA 1HW1A 1G4DA 2DW4A 1HSJA 3K9TA 4LD5A 2OQGA 4EM0B 1GXQA 1KU2A 5D4SA 4HQEA 4L0ZB 4DNCA 1JXSA 3WTTC 3DP7A 4P9FA 2ZMEA 1XD7A 3V7CA 1IXSB 1FNNA 1H9GA 1YW9A 4YIFA 2W85A 4L9VA 3WE3A 3WU1B 2O8XA 4Q5SF 3FHZA 3AAFA 3HIFA 1GVJA 4IPAA 3COAC 2MA3A 3QAHA 3FXRA 4CGZA 4XSZF 1JHHA 3GF2A 4O6JA 3P9IA 5FLXZ 1BC7C 1FPQA 2QLZA 2GZWA 3HUGA 2HKOA 2XUBA 3M9AA 2XGXA 3CO6C 1IW7F 1HXDA 5JI6A 2VBYA 1W5SA 3HRSA 4YFNF 3RPQA 1O7LA 4P96A 3I53A 4M74A 3ZQ7A 3KZZA 1I27A 2XAGA 3OOPA 1FYMA 2HWVA 3E6BA 2Y48A 3VB2A 1BI1A 3GFJA 4UXNA 4WXCA 2HEOA 4LLNA 1YS6A 3E6CC 4OIPF 2M5WA 2HOEA 3ECOA 4WF2A 5HS7A 2A69F 2JT1A 1A04A 1XGMA 3HTSB 5JVTA 2EWNA 1LDKB 3K1NA 4MEYF 4U7DA 4M9XA 3E97A 3K0LA 1FLIA 2K02A 2P5VA 2R3SA 1R7JA 1Z9CA 2HYGD 3ULQB 4GO1A 1O57A 5LHGA 3FMQA 4EM1A 1IRFA 3IL2A 2FBIA 2NS0A 3MZYA 4OMZA 3IHUA 3RDIA 1JGSA 1J59A 1O3SA 4R79A 3MWMA 3O3KA 1OMIA 2H09A 2VBWA 1IN5A 3J7AO 3KCCA 2OU2A 2QQAA 2RGVA 4LK0F 1I1SA 5D5VB 2FF4A 4M72A 2HS5A 3Q5FA 1XSDA 2EV5A 3U1DA 3WE2A 2V6CA 3T0YA 2PJPA 2O03A 1IRGA 1D3YA 3VFZA 1IN7A 2EB7A 2O3FA 5F1RA 2V1UA 5D5WB 2VE9A 2CG4A 4N0BA 4UHTA 3IKTA 5H20A 4LB5A 2Z33A 1BJAA 3WTSC 5LHHA 2IW5A 2Q8KA 3J81Z 1T2KA 4WWCA 2XHKA 3H3UA 4LLLA 2FRHA 2MC3A 1S3JA 4UUVA 4OMYA 3C3WA 2NRAC 2BEOA 5E8IA 3SXYA 3GZ5A 4EJOA 2OZUA 4KYWA 5HS8A 2GA1A 3KEQA 1YFHA 4I2OA 3KP6A 2A3SA 2FEZA 1FYKA 2FSWA 2EFOA 2UXNA 1FBQA 4BYYA 2LKPA 2QBYA 2VONA 3M1EA 4RB0A 5DUIA 3HRTA 3DF8A 3RTRA 5CVVA 3W6KB 2QBYB 2HTJA 2QQ9A 3RPUA 1FOKA 1I1GA 1PDNC 1FY7A 4M6XA 3TOAA 4MHGA 3E3VA 4AD9A 3TDUC 2XV4S 2QUFA 2Z99A 4EM2A 4HF1A 3B73A 2ISZA 2STTA 1KYWA 4ESBA 1TNSA 2XASA 4GYGA 2Y75A 3E6MA 2PMUA 1USSA 1R22A 4AIKA 3TQNA 1I5ZA 4A6DA 2J5OA 2EFQA 3VEPA 4Y17A 1PP7U 2DPDA 1ON1A 2LSOA 3ZMUA 4YFKF 1ULYA 2COMA 2WC2A 1UCRA 4AIJA 2ESHA 2OA4A 1OKRA 1XMKA 1PUEE 4WXHA 5IT3A 4KIFA 3G3ZA 5D5XB 4L0YB 3J80Z 1IXRC 3JAMZ 1HKQA 4WK8F 5D6FA 4RGSA 1LDJA 3I64A 2KIUA 3LWFA 2HTSA 1U5TC 1FP2A 5DCMB 5CJ9A 3WG9A 4NB5A 5E1XA 4ZYDA 4CXFA 4ZH4F 1U3EM 1KGSA 3CUQA 4XRFA 2A6HF 3FXQA 3ML6A 4FX4A 2QWWA 3GFLA 2YX4A 1V4RA 4ZYEA 3R0AA 1B4AA 2E1CA 3IWFA 3WTWC 1LEAA 2V9VA 5HLIA 2DQLA 2ISYA 3ECHA 3WTXC 5JFRA 5LRRA 5AONA 4Y13A 1RI7A 4EQQA 4CICA 4HX8A 4RAZA 2G7UA 4YFXF 2V79A 2UZKA 1ZRDA 4OOIA 4ENJA 4QLCU 2L3DA 2PLYA 5CVJA 1QGPA 4Q47A 4P9UA 3I59B 1RIOH 1OR7A 3I54A 1USTA 2G7HA 4CZZA 1TBXA 3PFIA 4ENNA 3CUQB 4G7HF 3ABUA 1YQAA 2JTVA 3DPTA 1R36A 1XCBA 2D1VA 2LF8A 2JPCA 2MD5A 3WTVC 4NQWA 2F5EA 3IC7A 1G6NA 4PDKA 4R1HA 3DFGA 5LBQA 2Q2EA 2ZFWA 1CF7A 2C6YA 2DK5A 3WTYC 3SZTA 4G8XA 2OQRA 2W84A 3RYPA 4IJAA 5LLQA 3H3ZA 5L3EA 1XMAA 3KP3A 2Y0MA 1W5TA 1WSUA 3D5LA 1RUOA 5LHIA 3T1BA 1K79A 5KK1A 3K2ZA 2PG4A 1XDUA 2Q0OA 2DQRA 4LG0B 2DAOA 4M6YA 5K5OA 3J81K 4UVBA 1QQIA 5IT9K 1S8NA 4U88A 3RIRA 5FD6A 3WGIA 4LGWA 4EV0A 5A2QK 2EA4A 4GYIA 3F6OA 3WGHA 2X0LA 1BIAA 5HVQC 2RVCA 2BGCA 5FO5A 1J5YA 3Q9VA 1XSXA 3G73A 4M71A 1Y0UA 3D0SA 1T98A 5E1ZB 4LLGF 4UV9A 4TV7A 1UFMA 3BP8A 1MDMB 2FNPA 3JW4A 3W6JB 2RQPA 5TJJA 4HBLA 2AXLA 5FD5A 5BS6A 1XB4A 2HFHA 3ZN1A 1YW7A 1HSTA 5DD4A 5K5QA 2FU4A 4LJZF 4RGUA 4JK1X 2P6SA 1FYLA 2L4AA 3VOEA 2PEXA 5L3BA 1QBJA 2XKPA 3R6SA 1EH6A 1H0MA 2EV6A 2K4JA 1YYVA 5ERIA 2LF7A 3SQNA 2FXAA 4KN7X 5CVRA 4A5NA 2R7DA 4L18B 2ZXJA 1J2XA 2UWMA 4L5JA 1ODDA 3O6BB 2GWRA 4ASNA 3FF5A 5L3CA 1MZBA 1OPCA 4CO8A 4KT5C 5D4RA 2FBHA 4RB1A 4HZFA 4KDPA 2PN6A 1B9MA 4N9IA 4P55A 2Z9OA 3FMRA 2OZ6A 2ZO4A 3WTUC 1RUNA 1JHFA 3J80K 1R23A 2IRFG 1UHWA 5HS9A 3T5XA 1YO5C 3BPVA 1SD7A 2VOPA 1D5VA 2CO5A 5LGUA 5F6FA 4GXOA 3MAJA 3N4MA 1L3LA 3V4GA 1BM9A 3TKYA 1IZ1A 2V1XA 2E7XA 3JTHA 2LDUA 4N9HA 2ZCWA 2A5YB 4EGYA 2KIMA 3BROA 2JZYA 3I4PA 3ERED 3FM5A 2QYOA 2QVOA 5CVUA 3REOA 1P92A 1IN8A 5ED4A 2P5KA 3LQRA 4KIGA 5IT9Z 2PI0A 1DUXC 1V3FA 4KNYA 1R5GA 1KQ0A 5K1YA 1O3QA 2K27A 4H0EA 1TW2A 1KU7A 2CSOA 3KLOA 3TO7A 5FLXK 2DPUA 3BDDA 1S6LA 4IRIA 3CUQC 2FBKA 3MFKA 2GQQA 3DPLC 3T8RA 5D6EA 1REPC 2OAZA 3JSPA 3K69A 4UVAA 2KKOA 1G3WA 3GZ6A 1H9TA 2ESNA 3QRFF 2JRTA 3R60A 4PGHA 2P6TA 4RGXA 3FWEA 3HOTA 3EYYA 1KA8A 1SMTA 4S04A 4EJWA 3M8FA 1SD6A 5BMZA 4YG2F 4HX7A 4B09A 2P8TA 5FB2A 2XRNA 3VODA 1FC3A 1ZN2A 1BOAA 4DQ2A 3I71A 1ZHFA 4I09A 2EK5A 3DEUA 1OYIA 1VTNC 2FQ3A 4L9JA 3FXUA 1IXCA 5FGMA 4KIBA 2NYXA 1UHMA 3LAJA 2ZKZA 3V7RA 1BI2A 4JQFA 3R4KA 2BYVE 5KVRA 1W4MA 1R58A 2MLGA 1Z6TA 3L2CA 2IPQX 4M9SA 2VT3A 1QZYA 1LVAA 1YLFA 5BPIA 2QM3A 4A0XA 1GHCA 2O6GE 2VOOA 2NNYA 3ZMSA 4CYDA 2ACJA 3L09A 1F4KA 4BHBA 3GUDA 3GXOA 3I0TA 5D8LB 1HW2A 5LGNA 1IF1A 2HZTA 5J8CA 5CYVA 3P7NA 1Z91A 1YIOA 3V7SA 3I58A 3F8CA 3L9FA 3C1DA 1FBUA 4I02A 1EV7A 4ENKA 1S7AA 3OV8A 5DD8A 5ILUA 1E17A 2BBYA 2DLLA 3R0JA 2VC0A 4G7ZF 3QOPA 3RJPA 1K78B 3LA3A 2V1DA 2VC1A 2WV0A 1U8RA 4A6EA 2ADUA 2VT2A 1BN5A 1LJ9A 3TDZC 5TRDA 2AS5F 5CLSA 4HA8A 2CYYA 2EFPA 3L7WA 4KICA 4MTDA 3PQJA 2DT5A 1SAXA 1YG2A 4I98B 4IF4A 1EH7A 4JBAA 1YW8A 4IRHA 3TGNA 5D8KB 3GFMA 3WODF 2RKHA 1QNTA 4FX0A 4NHJA 3I59A 1F5TA 4R8HA 3HOSA 2IA1A 3GFIA 1IN6A 4PGGA 3GO5A 3DXJF 4ESFA 1U78A 3IWZA 3E5UA 3RKXA 1SFUA 2HDCA 3MQ0A 4LB6B 2F5DA 3SHFA 1Q1HA 1TTYA 3P9CA 3HHHA 5ICCA 4HQMA 2GA2A 4EVIA 1R00A 2MLKA 2W57A 5H6RA 4L9NA 3S2WA 1TW3A 1G3SA 4P5OA 1SFEA 2E7WA 2XIGA 3FX3A 2VXZA 1B9NA 3QU3A 2QQBA 4HDUA 2H94A 1KU9A 3DQVC 4XLPF 1ZGAA 3KFWX 3F8BA 4CDGA 1DP7P 4HOBA 3LA7A 5H6QA 3WTZA 3GW2A 3F8FA 2ZNYA 3RI4A 3RYRA 5ILVA 2GXGA 1ZAOA 1TNTA 4MEXF 3ZN0A 2TDXA 3EDPA 4M9ZA 3ISPA 4BNCA