1YFHA

Wt human o6-alkylguanine-dna alkyltransferase bound to dna containing an alkylated cytosine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
175
structure length
165
Chain Sequence
b'CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*TP*GP*GP*AP*TP*GP*(XCY)P*GP*TP*GP*TP*AP*GP*GP*T)-3'
publication title The structure of the human AGT protein bound to DNA and its implications for damage detection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 41
structure length 165
sequence length 175
chains with identical sequence B, C
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1yfhA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1yfhA01
1K6OA 2Q0OA 1O7LA 1QQIA 4ZH4F 4HF2A 4N9IA 4O3MA 1LB2A 3JAMZ 2K4BA 5CVRA 3J81K 4OIRF 4A6EA 3U1DA 1L3LA 3TGNA 3ULQB 2FRHA 1XMAA 3CUQA 4RB0A 2P7VB 3IHUA 1YIOA 5AIQA 4ASNA 2P5KA 2V9VA 2FSWA 3LAPA 4KN4X 3GF2A 4KA4A 1O7FA 5CYVA 1O3QA 1YG2A 2M87A 2WC2A 4HOBA 4K2EA 3I59B 4KYWA 3C1DA 1ZG1A 3F8BA 4OMYA 2ZNYA 1DPUA 3T8TA 2Z5UA 2YR2A 3LWFA 3QAHA 1IUYA 4EV0A 3I4PA 3FMRA 3IRRA 1R58A 1HBXG 5IT9Z 3FMQA 1KU9A 1USSA 4HZFA 1B6AA 1LNWA 5E17F 2FQ3A 2PQ8A 4HX8A 2DAOA 5BPDA 3V7CA 3L00A 3ZMUA 4P9UA 1GXQA 1WQ2A 1YW7A 5DCFA 1TQMA 5BQTA 2ZNZA 4EM2A 3ECHA 2HKOA 1G3WA 2JT1A 2XUBA 5HVQC 2V6CA 3SXYA 3WU0A 2DO7A 2QBYA 2ZKZA 1BIAA 1G6NA 2E1NA 2XKOA 3JSOA 2BBYA 1MJ9A 2NRAC 3OOPA 3GXOA 5ICCA 3VEPA 2F5CA 2PJPA 1SFUA 1P4WA 2E7XA 2QQAA 4P9FA 2BYVE 5LHGA 2MH2A 3GZ5A 1LDJA 3KP4A 2FMLA 4M9SA 4IVNA 2Y75A 2FBIA 2VBWA 1EV7A 1SMYF 1I5ZA 5LGUA 3EYYA 5L3DA 4L9VA 5LGTA 5IT3A 3ERED 1U6GA 2EV0A 1BI0A 3RPQA 2XROA 3HSRA 1XSVA 3IC7A 1DPRA 2LDUA 3QU3A 3ZMSA 5DYMA 2HTSA 2NAZA 3C18A 3DXJF 4UV9A 4DNCA 1S6LA 2V79A 1SD5A 1STZA 4GCVA 1IZ1A 2P6TA 2CFXA 4KN7X 1V3FA 1B1BA 4O6JA 2PN6A 3SHFA 3NEUA 4WK8F 4EM0B 1XGMA 3LAJA 3EYIA 3KLOA 3MZYA 2DBBA 1BC7C 3B73A 4QWQA 4UNOA 5FLXK 2XASA 2PEXA 1YQAA 2DW4A 2GQQA 1D5VA 4WCGA 1IXSB 5L3FA 4LG0A 1XCVA 3M9AA 4QLCU 2RGVA 1IN8A 3K1MA 5LLQA 4L9TA 1FX7A 3Q9VA 1XCBA 1FZPB 1HKTA 1BC8C 5CVJA 2ZO4A 1KA8A 1T0FA 1JHHA 1IF1A 3KEQA 1ON1A 2YU3A 1U3EM 3TO9A 1BN5A 3R0AA 1FBUA 2M30A 2HQNA 2GA2A 3LQQA 1J59A 2LNBA 3FM5A 3MQ0A 3REOA 5ED4A 2ZMEA 2CQKA 2MD5A 3PQKA 1W7PA 1ZRFA 4U88A 4KIGA 2RVCA 2VBYA 1FBQA 1UB9A 4G94A 4A5NA 1ONVA 2JPBA 4ZYHA 1OMIA 2VONA 2QWWA 5F64A 3LA7A 1UFMA 2DQRA 5TJJA 1BM9A 1DDNA 1J7KA 4Q5SF 2O61A 3WTZA 2FMYA 4XSXF 1KU2A 3IWFA 4UHTA 5LHIA 2A07F 2GA1A 5FFZA 2D1HA 1ZN2A 4MEXF 3O2PE 2P7CB 2NNNA 4G7OF 5KK1A 2EB7A 5D4SA 3BP8A 3WGGA 3MFKA 1ZG3A 2GXBA 4BHPA 3NRVA 3IRQA 1TNTA 3IKVA 4LK1F 2HWVA 1EH7A 5D4RA 2DTRA 3P9KA 1B9NA 2JPCA 2PMHA 2O8XA 2RC4A 2FEZA 1ZLJA 4WXDA 4I7HA 3HOSA 3M8EA 4PDKA 3V7SA 2QQ9A 4A0YA 1HW5A 5E1XA 3RYRA 1B9MA 1J75A 1BI3A 1KQ9A 3GO5A 4IRHA 4ESJA 2HQRA 2XRNA 4FX0A 1OYYA 3QOPA 3HRTA 3ZPLA 2XAQA 1MJAA 1U8RA 3W6KB 5FD6A 3FF5A 4EJWA 4A0XA 3GVAA 5EEHA 3I59A 2D1VA 1D8JA 3KP2A 1QNTA 2XAJA 1XB4A 2UXXA 4HF0A 5DCMB 5ICGA 1FC3A 5DEQA 3K2ZA 1ZREA 4PZJA 1XSDA 2HS5A 5D8KB 2LKPA 4N0BA 3EUHA 1FBSA 1BIBA 2VOPA 4HQMA 2R7DA 1K7AA 2G7HA 3MZHA 3BOQA 3VB2A 2HEOA 3SFZA 2P5LC 2IP2A 2CYYA 2EV6A 2RQPA 3HYIA 4Z2YA 3LQRA 1IRFA 3EDPA 3T0YA 4G7HF 3BJ6A 4MGRA 1ULYA 3RKWA 5LBQA 1K78B 1MKMA 2ZJ2A 2O6GE 2A5YB 3MCZA 1S3JA 4PGHA 3K0LA 2NS0A 2R3SA 3WTTC 1FSHA 3HTSB 2L01A 1RI7A 4YFNF 2EFOA 4UVCA 1IW7F 3C7JA 1F4KA 2PMUA 2DPUA 1FYKA 1EH6A 1Z6TA 3CUOA 1WRJA 2CWEA 3EQLF 1F5TA 2V1DA 3VODA 5DDGA 1U78A 2EFNA 1REPC 2DFIA 4MEYF 2EFPA 5CVUA 3GFIA 2H6BA 4MHGA 4UUVA 1RIOH 3KP3A 2MH9A 1W4MA 2ETHA 3I5UA 3PFIA 1FYLA 3CJNA 4UVAA 1FPQA 5D6EA 5K5QA 4MQ9F 4MTDA 2KIUA 3WTWC 1VTNC 3FZVA 1QZZA 3ECOA 1I1GA 3H3UA 1YFHA 4M74A 3JSPA 1H9TA 2O03A 2CW0F 1WI9A 2LSOA 1YS7A 3FXUA 3GZ6A 4WXCA 1FT9A 3E5QA 3E6CC 2XKPA 3GWZA 3JW4A 2VBZA 4D0PA 3DV8A 4WX9A 4MQVA 3G3ZA 3J80Z 2UXNA 2W25A 1TQPA 1Z1DA 1XDUA 1GXPA 1OYWA 2K27A 2VT3A 5J8CA 3F22A 1IN5A 2FOKA 4KMFA 2DLLA 1T98A 3BJAA 3IWZA 4WF2A 4AD9A 4IJAA 5CVIA 4EQQA 5E18F 5J6XA 1XGOA 1AWCA 2VOOA 1Q1HA 2A6EF 5KVRA 4OIQF 2QENA 3D0SA 2ZFWA 4L5JA 3ZMTA 4WWCA 2DK8A 4JQFA 3T8RA 4GXOA 4BHBA 1SFXA 5AONA 2HZTA 5JI6A 1JGSA 3KP5A 1OKRA 3J80K 2FNPA 2Y48A 3WODF 4LFUA 1IN7A 1SD4A 1T39A 4OOIA 3JAMK 4HQEA 2Z3YA 2D2WA 4IRGA 1IXCA 2OQGA 4AWXB 1YTYA 4L0YB 2HR3A 1FWZA 4RB1A 4R79A 5LEJA 2GXGA 3I53A 4I98B 1F9NA 2XVCA 2EJRA 3HTUA 3RKYA 3D5LA 2NYXA 2EA2A 4KICA 3F8CA 3DQVC 3CTAA 3TDUC 2LF7A 2IJLA 2RV8A 5FFXA 3N4MA 4RGRA 3KLNA 2W84A 3PQJA 1S29A 4YIFA 1YYVA 1JXSA 1O3SA 3F8NA 1SD6A 5L3BA 1DP7P 2YPRA 3KP6A 4YIIA 4ENKA 1SAXA 4HLYA 1T38A 3K69A 2E7WA 2K02A 4G6DA 2OZUA 1ZG5A 5IT9K 3AAFA 2OA4A 1WSUA 2X0LA 4N9HA 3ISPA 3R61A 1A04A 3WGHA 4LK0F 1XMKA 4M71A 2F2EA 3RJPA 1KU7A 2ESNA 2OQRA 3CO6C 3LFKA 2UWMA 4EJUA 4BYYA 1T2KA 1X3UA 4OIPF 5D5WB 5ICEA 3ZN1A 1P92A 4Q47A 1ZGJA 2YX7A 1GHCA 3LA2A 3V4GA 5DCMA 4ETSA 2BGCA 2Q2EA 2IA2A 4EJOA 3O6BB 3EETA 4EGZA 2K4JA 3BZ6A 4M9ZA 1R36A 2F5FA 3DP7A 5HLIA 2H94A 3F21A 3F72A 5JVTA 1MDMB 1FLIA 1KYWA 1WWXA 4YFKF 4HBLA 3F3XA 4LGWA 1UHWA 4CGZA 3TOBA 3ZQ7A 2QVOA 2C6YA 2QQBA 3RPUA 4BXUA 1K78A 3M7GA 3M1EA 2IVMA 1ZH5A 4LLLA 1GVJA 3N97A 1B4AA 2L4AA 1YS6A 3I54A 5H20A 2DQLA 1B59A 1U2WA 1U5TC 4R1HA 4BQAA 4XLPF 5L3EA 4F7ZA 4O5VA 1I1SA 5DD8A 2W24A 1D8KA 1P6RA 5LRSA 5DUKA 3P9CA 1LDDA 2VE9A 2VN2A 2FXAA 3L7WA 3TOAA 1BBYA 2QYOA 1NHAA 1R7JA 1R5HA 2ELHA 4JK1X 2EV5A 3SZPA 3WGIA 2OZ6A 5D6FA 1ZLKA 1ON2A 4HV5A 3Q5FA 2QM3A 4ESBA 2QLZA 1SMTA 5H6RA 3ZN0A 4Q4ZF 2YX4A 2O0YA 2OU2A 4CXFA 2J5PA 4ZYDA 5DD4A 1QO0D 2XAGA 2L02A 5J8FA 3ELKA 1P2FA 1FSEA 1G3SA 2RDPA 5K5RA 3FWEA 2QZ8A 2ZBKA 1FY7A 1BI1A 3RKXA 4E70A 5L3GA 5HS8A 4GGGA 4A0ZA 4KDPA 2VE8A 3IL2A 1XGNA 1YO5C 1J0RA 3F8MA 4S04A 3ZMZA 4A5MA 4I2OA 4YFXF 3ZMVA 2M45A 4TV7A 2KJBA 1P4AA 2WWYA 4HX4A 3KE2A 2DI3A 3HOTA 2DU9A 1YW9A 1FOKA 3KZZA 3J7AO 3GUDA 2HFHA 1IXRC 4Y17A 2JSCA 1AOYA 1XDSA 2XHKA 1IN4A 3QRFF 2L54A 2OD5A 1ODDA 3BWGA 2M8EA 2GIVA 3GX4X 2STTA 2MBFA 3SQNA 4M9XA 1EH8A 1F1ZA 4L9NA 3RI4A 4EVIA 3K9TA 2JRTA 3HRUA 3R60A 4LLNA 2DT5A 2EFWA 1QBJA 4L18B 3NQOA 4G9YA 3CUQC 3E6DA 1V4RA 1PP7U 4I09A 1C0WA 2XAFA 1HXDA 2HYFA 2MC3A 3WTSC 3BPXA 3WE2A 2GZWA 3I64A 3KZYA 3F6OA 4KT5C 5EEGA 2CGPA 1UCRA 5D5UB 1I6XA 2BE5F 4A12A 4LG0B 3I58A 5CVVA 2A6HF 2ISZA 1OYIA 3E5XA 5F6FA 5HDNA 3WTUC 1MD0A 3C3WA 3BPVA 3TO6A 3JTGA 1JE8A 1TTYA 1CGPA 4OIOF 3M8FA 2W57A 4LLGF 1RUOA 4PCQA 5ILUA 3ML6A 3WU1B 5A2QZ 4LB5A 2UZKA 2OBPA 5LHHA 2XV4S 4U7DA 2ZMEB 1OPCA 4HDUA 4KMUX 3W6JB 4XLNF 4FT8A 5ICFA 2K7LA 3L2CA 3DEUA 3J81Z 5CJ9A 1FNNA 1DUXC 2K86A 2NNYA 4AIJA 1HQCA 2FF4A 2AXLA 2M5WA 2IA0A 1OR7A 2Z33A 3R0JA 4B09A 3DPLC 1R1UA 3HUGA 1HSTA 4IXAA 3TQNA 3HHGA 4I0AA 2PI0A 1MDMA 4IPAA 1LJ9A 1TLHB 4WXHA 4RAYA 2EK5A 2F5EA 3TDZC 4HA8A 1Z7UA 3V8KA 1SFEA 2WV0A 3VOEA 3GYHX 5BS6A 5LEKA 2D45A 3Q9SA 2QUFA 4CYDA 2CG4A 3RTRA 1MGTA 4M6XA 4CHUA 4L0ZB 1J2XA 2IA1A 2IRFG 2MLGA 2MA3A 2Q8KA 4UV8A 1Z91A 4L5IA 4XBFA 1TBXA 3WTXC 3BJOA 3T5XA 2P8TA 1KQ8A 3HSFA 4LD5A 2R7FA 4LMYA 3WTYC 3L09A 3H3ZA 5F1RA 1LEAA 2G7UA 2JZYA 4BHCA 2L3DA 5HOOA 2H6CA 4U0YA 1O3TA 3P7NA 4KNYA 5H6QA 4G7ZF 3KETA 2XGXA 1U5TB 1D3YA 2BV6A 1CF7B 1I27A 3FHZA 1XGSA 3RYPA 1R5GA 4UXNA 4U0VA 1TW2A 3T1BA 2VT2A 1TQIA 1MZBA 4ENJA 3U9GA 1ZHFA 5FGMA 1G3TA 5D8LB 1L0OC 1LEBA 3GFMA 4MTEA 2XAHA 1O3RA 3WG9A 2AS5F 1TNSA 2GWRA 5DUIA 1QPMA 5LRRA 1Z05A 1S7OA 2IW5A 2H27A 3WE3A 5HDGA 5HS9A 3OV8A 1R00A 3RDIA 3G73A 4GYGA 1R1TA 3QU6A 1BI2A 3DKWA 4EMSA 1FYMA 1MJBA 5AIPA 5L3CA 2G9WA 2VC1A 4UVBA 3TKYA 3KP7A 4RB3C 1HW1A 3V8JA 4Q48A 1S8NA 4LB6B 2P6SA 3FX3A 3GEZA 2X4HA 1YLFA 3BDDA 2CO5A 5HLGA 1HKQA 3KFWX 4OU0A 3CDHA 5FLXZ 3E5UA 4BAYA 1RZ4A 1R23A 5E20A 2KIFA 5FB2A 3V8LA 1W5TA 2YSRA 3F23A 3COAC 1E2XA 2HGCA 1KQ0A 5BPIA 5JHUA 3RIRA 1QZYA 4H0EA 2MLKA 5HDKA 3HIFA 1XSXA 2P5VA 1Z9CA 4AVPA 1USTA 2A68F 2ESHA 2EA4A 4EM1A 2PFBA 4P55A 1W7PD 1FP1D 1P4XA 4M73A 3GW2A 3MWMA 3E6BA 3FXRA 4RGUA 1ZAOA 3BROA 4KIBA 3V7RA 2ACJA 2VXZA 2VBXA 2W85A 4ESFA 3LSTA 1K79A 3CUQB 1HW2A 2B0LA 3I0TA 2EFQA 1J5YA 4HLXA 2L4MA 2ZCWA 4GYIA 4EGYA 3DFGA 3MEXA 2VODA 3IKTA 4GO1A 2LF8A 3WTVC 3GFLA 1ZARA 5FO5A 4IRIA 4RS8A 1W5SA 2VC0A 3H92A 5JFRA 3QPTA 2HDCA 2IPQX 4HAMA 4NQWA 3R6SA 1ZRCA 2FA5A 2F5DA 3TO7A 5E1ZB 3HRSA 2ZXJA 2V1UA 3QP5A 1XN7A 3GFJA 4LJZF 2PLYA 3HRMA 3R4KA 4I02A 1KU3A 4RB2C 3E3VA 5HS7A 4XRFA 1H9GA 3HSEA 4DQ2A 5K1YA 6PAXA 3F6VA 4NB5A 1SD7A 2IT0A 4L9JA 5E8IA 2COMA 1PP8F 4XSZF 2JTVA 4EJTA 4CICA 1R22A 1XD7A 4MNUA 4PGGA 5BMZA 2Z99A 1TW3A 5K5OA 2QBYB 3HHHA 2KRFA 4RGSA 4AIHA 4KIFA 3QP6A 4IHSA 1LQ1A 2A61A 3K1PA 3DPTA 3E6MA 3FM3A 1PDNC 1LVAA 4M72A 5FD5A 1IRGA 2PG4A 2GAUA 4I01A 2RN7A 3DF8A 4P5OA 1HKSA 3P9IA 5ILSA 4BH9A 2FE3A 3MAJA 4CZZA 3KCCA 1G4DA 2CSOA 4U7BA 2KJCA 2V1XA 1E17A 1FP2A 4RGXA 1RNLA 4ENMA 4KFCA 3L9FA 1U5TA 1O57A 3ZMDA 1CF7A 5ERIA 4EJVA 5JR3A 4HV6A 2TDXA 2A3SA 1H0MA 3ZP5A 2HTJA 1S7AA 4RAZA 4B8XA 1ZYRF 2A69F 1RUNA 2RKHA 3ABUA 1BOAA 4YG2F 1T6SA 4G8XA 3BY6A 1BJAA 5HLHA 4G6QA 1UHMA 2EWNA 4U0WA 4FX4A 1Y0UA 2STWA 2ADUA 4S05A 2FBKA 4ZZDA 1IAWA 5BOXA 4HW0A 1G3YA 1QGPA 4IHTA 4ZYGA 5E1WA 2O3FA 3CO7C 3LA3A 1LDKB 3O3KA 2FU4A 4NHJA 2KKOA 4CO8A 1ZGAA 3FMSA 5LGNA 5CLSA 2OAZA 5TRDA 4A6DA 3SZTA 1J9IA 3K1NA 2DPDA 4KUMA 1ZRDA 3VFZA 2PBIA 3ABTA 1WKMA 4Y15A 4P96A 4ZZLA 5D5VB 2XIGA 5ILVA 1W7PB 4OMZA 2HYGD 4I0BA 4ON0A 3B02A 1IN6A 4R8HA 3U2RA 2E1CA 2WTEA 1R1VA 4HDVA 5DV5A 4HYEA 3GLXA 2FBHA 3E97A 4A2UA 4HF1A 2M1BA 3FXQA 1KYZA 2KIMA 2FNAA 2J5OA 3CLOA 3KEOA 2RNJA 1Z6RA 3I71A 4AIKA 2P4WA 2ISYA 5E8GA 4Y13A 5D5XB 3F8FA 2H09A 4OINF 1PUEE 4JBAA 4CDGA 1YW8A 4FHTA 4IF4A 1KGSA 3ROUA 1JHFA 2DK5A 2Z9OA 3JTHA 4M6YA 4BNCA 5A2QK 2HKXA 2HOEA 4ZYEA 3S2WA 4ENNA 2BEOA 1HSJA 2Y0MA 4HX7A 3QPHA
chains in the Genus database with same CATH superfamily
1K6OA 2Q0OA 1O7LA 2UXBE 5GADJ 2VJJA 1QQIA 4ZH4F 4R2RA 1HNWE 4HF2A 4DOZA 4N9IA 4O3MA 3FK7A 2EILH 1IQOA 1LB2A 3PUBA 3KWRA 3JAMZ 2K4BA 5CVRA 3J81K 4OIRF 4FQGA 3IWBA 2EE8A 4X66E 4A6EA 5T6JA 3GTLJ 2EOOA 2KZGA 3U1DA 1L3LA 3TGNA 2JVHA 3ULQB 2FRHA 4DW6A 4AM3A 1XMAA 3I9V2 3CUQA 3BF2A 4RB0A 4B3AA 2P7VB 5GTHC 1J5EE 3IHUA 1YIOA 2UXDE 2HNHA 5AIQA 3J7AY 4ASNA 3DU5A 4UY8I 3H0GJ 4LOCA 3C2HA 1BJZA 2P5KA 2V9VA 2VKEA 2UUAE 4WFTA 3K4CA 2FSWA 3LAPA 3ABLH 4L5EA 4PJMA 2LBFA 2GOMA 4II3A 4KN4X 5IYCJ 2EMHA 2YWQA 2DT6A 3ZQHA 3CF5F 4F6NA 2XGCA 3GF2A 3SDGA 4KA4A 1O7FA 5CYVA 1N75A 1O3QA 3OYMA 4LFBE 1YG2A 3CJTB 2EINH 3UKGA 1QHGA 2DB2A 1WZ2A 2M87A 2WC2A 4HOBA 2LO3A 4NC7A 1R9TJ 1N33E 4K2EA 3L2UA 2VKVA 1ETOA 4LF6E 3BTLA 3I59B 2JA5J 4KYWA 3C1DA 1ZG1A 2EPCA 3F8BA 3CZ6A 1IQSA 4OMYA 5TGTA 2ID3A 1NCSA 2KPMA 2ZNYA 1DPUA 3T8TA 2Z5UA 3S8PA 3HB9A 3BR3A 2DMYA 3QWLA 3JCUC 4QSHA 2YR2A 2Y31A 3H5RA 3LWFA 5E79C 2I5UA 2L7ZA 3C4BA 3QAHA 5GPCA 2NS7A 4EEFG 4IZZA 2LYCA 1D1AA 2VJ4A 3OY9A 1IUYA 2JR1A 4EV0A 3I4PA 1Y8RB 3CC2I 2MW8A 3K6GA 2R7XA 2R92J 3FMRA 2JUCA 4M3EA 3ZRGA 3IRRA 1R58A 1HBXG 2JP9A 5IT9Z 2HVRA 4DV7E 3ASOH 2E1MC 4XRMA 2EOSA 3L2RA 5BR8E 2FQ4A 5F0CA 3VSLA 3FMQA 4UB6C 1KU9A 1USSA 3PSIA 1X6FA 5KL5A 4CCKA 1YUJA 4DR7E 2OPTA 4W97A 4HZFA 4OOGC 5IP6A 1B6AA 1LNWA 4CH7A 2FQ3A 2PQ8A 4HX8A 5E17F 2DAOA 5BPDA 5EDNA 3V7CA 2RREA 3L00A 3M07A 4C9YA 1B8IB 3ZMUA 1ZBTA 2MYSA 3B6AA 4S0HB 4P9UA 1X4OA 4JI3E 1GXQA 1WQ2A 1YW7A 1JT0A 5DCFA 1TQMA 5BQTA 2ZNZA 2ECCA 3O8GA 2JUGA 4EM2A 3ECHA 4BQOA 2HKOA 5FKNA 1G3WA 2JT1A 1B72B 2XUBA 5HVQC 1OCOH 2AHQA 2V6CA 3SXYA 4FETA 3QYBA 3WU0A 1F43A 2DO7A 1HA8A 2LLKA 2QBYA 4F6MA 4HEIA 2ZKZA 1BIAA 3SFIA 1G6NA 3ZQFA 2E1NA 4E7SA 4LF5E 4JP0A 2OV7A 2XKOA 2KRHA 3JSOA 2BBYA 3PM1A 1MJ9A 1ZGWA 2NRAC 3OOPA 3GXOA 2NVUB 3K4JA 5ICCA 4IHXA 3J80C 3S93A 2F5CA 1WI3A 3KYDB 3VEPA 1SFUA 2PJPA 1P4WA 2E7XA 2QF7A 3JAMC 2QQAA 4P9FA 2BYVE 5LHGA 2MH2A 5IOYA 2M7QA 2EM4A 1SFKA 3GZ5A 1LDJA 3KP4A 2VLAA 1YJ9I 3LSHA 3TW7A 2PRTA 2FMLA 3H1CA 4M9SA 1A6IA 2FUG2 3CDIA 2EMFA 4IVNA 1VQ9I 2LV2A 2Y75A 4J01A 2ELZA 2CFOA 2FBIA 2VBWA 1EV7A 1NG6A 1SMYF 3A01B 2L3CA 1I5ZA 5LGUA 3EYYA 3F0CA 5L3DA 2EL5A 4L9VA 5HNFA 5LGTA 1TT0A 5IT3A 1N3GA 1UZCA 3ERED 3SZGA 1H88C 1U6GA 2EV0A 1BI0A 3O8HA 3RPQA 1PJRA 2XROA 3HSRA 4GFBA 1TF3A 3P1XA 1XSVA 3JRDA 3IC7A 1QZEA 1DPRA 2LDUA 2EOMA 3QU3A 3ZMSA 5DYMA 3LSJA 2HTSA 2NAZA 3M4OJ 3C18A 3DF6A 3QPLA 4DV2E 3DXJF 4UV9A 4DNCA 2JA2A 2Z1DA 1S6LA 4C30A 4F93B 2V89A 1XG1A 2V79A 1L4SA 1SD5A 1VNDA 3VPRA 1AKHB 3ZOQB 1STZA 4GCVA 1IZ1A 2KZVA 2Y2ZA 1LFUP 2ZM6E 2P6TA 2CFXA 5AE1A 4KN7X 2QEXI 3RQ4A 2KFDA 2BHZA 1V3FA 1B1BA 4IHYA 2N8GA 2ENCA 4O6JA 4CCOA 4YEJA 1MMGA 3LSIA 4NBQA 5IXMB 2PN6A 3K2AA 3H5NA 3SHFA 3NEUA 4WK8F 4EM0B 1VQNI 2EP3A 1XGMA 3LAJA 2WB1N 2Q8UA 2KDZA 2GPIA 3DTEA 4BE1A 3W2VA 3EYIA 4JX5A 3KLOA 3GMEA 3MZYA 2DBBA 5DS9A 1BC7C 1IBME 3B73A 4QWQA 4UNOA 1PYVA 2KISA 1Y1VJ 5FLXK 1PUFB 2XASA 4XMYA 4KISA 2LMZA 2PEXA 2A5WA 1YQAA 1WJDA 4ZYAA 5EGOA 2EIKH 3JU0A 2XAUA 1RPWA 2M0MA 2K3FA 3M99B 2F6CA 1DQUA 4E4HA 3HXLA 2QA4I 2GXAA 1QU6A 2DIXA 1ETKA 4R2AA 2QKMB 3ZQIA 2DW4A 2VKDA 4RLQA 4C2UA 2EN7A 2LOOA 2EPFA 2GQQA 2X6YA 2MC4A 4WCGA 1IXSB 3CCJI 1D5VA 5L3FA 4LG0A 1XCVA 1VFCA 2DOFA 2CH0A 3M9AA 4FASD 4QLCU 2RGVA 1IN8A 3K1MA 5LLQA 4L9TA 1FX7A 1I50J 3Q9VA 1XCBA 1FZPB 1HKTA 3K6QA 1BC8C 5CVJA 4F3QA 2ZO4A 3CCMI 2VJIA 9ANTA 2M8GX 1NH3A 1KA8A 2DRPA 3JRGA 5B1AH 2JMWA 1N36E 1P7JA 1T0FA 5IV8B 1JHHA 1P7IA 1IF1A 1MH3A 4PFOA 3KEQA 1ON1A 2YU3A 2X1DA 3BG7A 4PFPA 1U3EM 3TO9A 1BN5A 1IRZA 3BQYA 3R0AA 1FBUA 1N77A 2IAIA 2LY1A 3H3VK 2EM7A 1V54H 3RMPA 2M30A 1IJWC 2HJJA 2RSMA 1XTAA 1T8IA 1GUUA 2GOXB 2HQNA 5C4XJ 2GA2A 3LQQA 3HPGA 2YTNA 1J59A 2LNBA 3FM5A 2X6OA 3MQ0A 4A3LJ 4PSWA 2CPNA 3REOA 2EN6A 2RSIA 5ED4A 3SEZA 2JOBA 3PIOF 2ZMEA 2RNGA 1ZQ3P 2CQKA 1K6YA 1IO2A 2MD5A 2HOAA 2R5ZA 1WHUA 3PQKA 2BW3B 1W7PA 4IX7A 1ZRFA 1D0YA 1ZAAC 4U88A 4KIGA 1DU0A 2RVCA 2XB5A 3BR6A 2WA0A 1DGCA 3HGYA 4DJAA 2VBYA 3OS2A 2MDGA 2HQAA 1X3CA 2EPZA 2EM2A 1FBQA 1UB9A 2XF6A 4G94A 4A5NA 3LNQA 3THOB 2EN3A 1OCZH 4KITB 2R7TA 1ONVA 2JPBA 4ZYHA 1OMIA 5IYDJ 3H35A 2VONA 4NHRA 1WXRA 1WJFA 2QWWA 5F64A 3LA7A 1UFMA 2QGUA 2DQRA 5TJJA 1BM9A 4BJ5C 1DDNA 4O24A 4F54A 1J7KA 2X51A 4Q5SF 2O61A 2YRMA 2ZXWH 3C6MA 3WTZA 1YJNI 3CDLA 2FMYA 4BXXJ 3PUFA 4XSXF 1KU2A 3IAM2 2W7NA 2CQ7A 3PNVA 4WSGA 3IWFA 5J1UA 4CYCB 1UJ8A 1DI2A 4CA0A 3JRAA 3OYJA 3OMLA 2R7RA 4UHTA 4DUYE 5LHIA 5CKTA 3GTKJ 3AL0B 2A07F 2HXOA 1GT0C 1RKTA 3DPUA 4JX4A 2GA1A 1HLVA 2R93J 4ZDPA 3BQZA 2JVAA 1W1WE 1PJTA 1YRNB 5FFZA 2D1HA 1W36C 4NXNE 1ZN2A 5B5EC 4MEXF 3OS1A 2K85A 1K83J 1IG7A 5AC4A 3O2PE 2HU9A 4HNTA 2CV2A 2P7CB 2RS6A 1JK2A 2NNNA 2LY2A 2X48A 4G7OF 5KK1A 1V5GA 2EB7A 2MFZA 3Q3SA 5D4SA 2R5YB 2HDDA 4DV4E 2LUQA 4BE2A 4M0VA 3BP8A 3WGGA 3MFKA 1ZG3A 3W2WA 2GXBA 2HQ5A 4BHPA 2YTOA 3NRVA 3IRQA 3DEWA 2B7EA 1TNTA 2A25A 3IKVA 1RC7A 4LK1F 2HWVA 1EH7A 5D4RA 2DTRA 1A5JA 2EL6A 3ONQA 2ADRA 2HI3A 3P9KA 4JI2E 1B9NA 2I10A 3H9JA 1N25A 2DA6A 2JPCA 2EMWA 2KL4A 4BE0A 2M9HA 2PMHA 2O8XA 2RC4A 2VQEE 2EZ6A 2FEZA 2JA8J 5EZHA 1ZLJA 4WXDA 4I7HA 5A69A 4HNVA 3JREA 3M8EA 3HOSA 2VJ5A 1HCRA 4PDKA 3V7SA 3JRIA 2QQ9A 3OYBA 4A0YA 1OLTA 1HW5A 5E1XA 3RYRA 1B9MA 1J75A 1BI3A 4ABZA 5E3NA 1OR7C 4BS9A 1KQ9A 4BJTA 3GO5A 4IRHA 4ESJA 2HQRA 2DYSH 2XRNA 2V26A 3A02A 4FX0A 4PJJA 1OYYA 3QOPA 3EQ1A 3HRTA 3G1OA 3ZPLA 4A3FJ 2XAQA 5J1YA 1MJAA 1U8RA 3W6KB 4B3TE 4HNUA 5FD6A 4LIUA 2V1NA 3FF5A 4EJWA 4A0XA 2W1OA 4IKFA 2MC5A 1MBEA 4XKWA 3GVAA 3VWBA 3BTIA 3QG5C 2Y69H 3SEQA 5EZGA 5LL6R 5EEHA 3I59A 3ZGKA 2D1VA 1D8JA 3FBNB 2E1OA 3KP2A 4MFDA 4EATA 1QNTA 4F2JC 3BC8A 2XAJA 4RLFA 3LMLA 1XB4A 4JI7E 2UXXA 1UG0A 4HF0A 5DCMB 5ICGA 3CD6I 1FC3A 2JA7J 1APLC 3HKZA 2N3GA 2BOLA 2Q2EB 5DEQA 2PMZN 2CV1A 1XMQE 3K2ZA 1ZREA 4DMIA 3KPHA 3ECRA 3TW6A 5JLXA 4NC6A 4WSPA 3G4SI 1W5CC 4PZJA 4E6KG 2HS5A 5D8KB 2LKPA 1XSDA 2DSYA 3I3LA 3EPKA 1MIJA 4N0BA 3LSMA 3EUHA 4F9CB 3CP8A 4RBOA 2CQQA 3MKYB 1FBSA 1BIBA 2VOPA 5J1RA 2VIXA 1I3QJ 2EMCA 4HQMA 2R7DA 1FTZA 1K7AA 2NUFA 2G7HA 3MZHA 2E2IJ 3ZQLA 1LPQA 5LMNE 3LSPA 1K4SA 3BOQA 3VB2A 5EG0B 3SDBA 2HEOA 2LT7A 1B8IA 2V88A 4XLHA 3SFZA 3DLLF 3CMEI 2P5LC 2IP2A 2L6MA 2CYYA 2EV6A 3OIPA 2RQPA 3IH2A 3VHTB 3HYIA 4Z2YA 3LQRA 5AE2A 4AQYE 2IBDA 1IRFA 3EDPA 3T0YA 4G7HF 4F9AB 2HZDA 4E7HA 1B72A 2Y0SN 3BJ6A 4MGRA 3J7Yp 3BR1A 3GBGA 3GTGJ 3H9GA 1U0JA 1ULYA 3VYUB 3MHHC 3RKWA 5LBQA 1GZ6A 2HDWA 1K78B 5AC5A 1MKMA 5KCMA 1LLMC 1QVUA 2ZJ2A 2O6GE 1QVTA 4U87A 2A5YB 3MCZA 1S3JA 3OTOE 4BEHB 2L2NA 1IBLE 1S7EA 1TWAJ 2L8TA 2YTDA 4RM2A 4PGHA 4M3DA 2DA5A 3K0LA 4N4RB 2JPAA 2EPXA 2NS0A 3BG9A 3LLHA 2LBSB 3LSRA 1JUSA 2R3SA 1JI8A 3WTTC 1FSHA 2R7VA 3HTSB 2L01A 1RI7A 3CESA 4YFNF 3T1YE 4YRVA 2EFOA 4UVCA 1IW7F 2EIMH 3C7JA 4M2ZA 1F4KA 4X62E 2PMUA 2DPUA 4X65E 4BDYA 1ETQA 1CQTA 1X3WB 1FYKA 2VE7C 1EH6A 1TWGJ 1Z6TA 3CUOA 3EPLA 1WRJA 3ZCOA 2I8DA 2CWEA 4DZJA 1LUJB 2VL8A 3EQLF 1DGRM 3A01A 1IRXA 1F5TA 2EMZA 2EN8A 2V1DA 1A1KA 3VODA 5DDGA 1U78A 2EFNA 2DMIA 5J3LA 1REPC 2DFIA 4MEYF 4NC8A 2KIQA 3CCSI 2EFPA 1YYKA 2L5QA 5CVUA 1ZR2A 3GFIA 2H6BA 3UNGC 2V83A 4MHGA 2LR8A 1RIOH 4UUVA 3KP3A 3L2VA 3BR2A 3OYAA 1IC8A 4XONA 2MH9A 2YU8A 2Q1ZB 1FIPA 1W4MA 2ETHA 4PJNA 3I5UA 3PFIA 4IOAF 1FYLA 4B48A 4QIWN 2OCCH 3CJNA 3Q0WA 1EKEA 1FPQA 3DU6A 4UVAA 5D6EA 5K5QA 5M3FJ 1AKHA 2CSHA 4MQ9F 1D0ZA 3X2QH 2WAQN 2KMUA 3Q0UA 4BKXA 4BBRJ 4MTDA 2IS4A 2KIUA 3G1LA 3WTWC 5M5YJ 4JYKA 1VTNC 1T08B 5C4JJ 3FZVA 2IXSA 1QZZA 3IH4A 1FTTA 2K9SA 1YSAC 3ECOA 1I1GA 2LREA 3BR5A 2JSPA 3H3UA 1YFHA 3HOVJ 4M74A 3JSPA 3FXMA 4MLQA 4X1EA 1RETA 1H9TA 1S72I 2O03A 1XC5A 2CW0F 3AG4H 4BUPA 2IGKA 2KQRA 5EEAA 1WI9A 2LSOA 1YS7A 3FXUA 3MKWB 4WXCA 5FJ8J 1FT9A 3GZ6A 4DUZE 3E5QA 3E6CC 2XKPA 3GWZA 3JW4A 1BR4A 1ETVA 3Q0VA 4BC9A 5FKKA 2K9NA 3RZOJ 2VBZA 3THNA 3HOYJ 5J40A 2ELYA 1T4OA 3MSWA 2KT0A 4D0PA 3DV8A 2NOGA 2QSHX 4WX9A 1NK2P 3QPSA 4MQVA 2O9LA 4ZTFA 3G3ZA 3ZR8X 3J80Z 4OX9E 2UXNA 2IGNA 2W25A 1X19A 2YRKA 4XOPA 5K7FA 2CUJA 1TQPA 1Z1DA 3BGHA 2YT4A 1XDUA 3QYEA 1GXPA 1OYWA 1WPKA 2K27A 2DFFA 2TRTA 2VT3A 3AKZA 5J8CA 3F22A 1IN5A 4RMNA 2FOKA 1IGNA 1MSFC 3NAUA 2EN2A 4KMFA 3CCQI 2DA4A 2DLLA 1T98A 4HEA2 4IS1C 3BJAA 4J8ZA 1WJCA 2V7FA 3IWZA 4WF2A 2WBMA 4AD9A 2DJIA 4IJAA 5CVIA 4EQQA 5E18F 5J6XA 2DFHA 2KHMA 5EYRA 1XGOA 1BR2A 1AWCA 2XF5A 2GIZA 2VOOA 1MBJA 1Q1HA 2A6EF 4ZTJA 5KVRA 2E60A 4OIQF 5J4YA 4IHVA 2O5RA 4Y7NJ 1R49A 2QENA 3D0SA 1MMAA 2ZFWA 1PVEA 1UILA 4L5JA 3ZMTA 3ASNH 4WWCA 4XICA 2DK8A 3MN2A 4B4CA 1YX3A 4JQFA 3T8RA 4GXOA 3LSGA 4BHBA 5B66C 3CCVI 4JI1E 1SFXA 4XIDA 1XPXA 5AONA 2B63J 2BW3A 1OJLA 2DJNA 2EWLA 3HG9A 2WY8Q 4C3JJ 2HZTA 4B1RA 1T56A 5JI6A 1JGSA 4GZNC 2O8KA 5F1JA 2ZSHB 2NA2A 3KP5A 1OKRA 4MFEA 3J80K 2FNPA 3CCEI 2EOJA 2Y48A 3WODF 4LFUA 1IN7A 2DDAA 1SD4A 3FIWA 3FBIB 1UHSA 1T39A 5AASA 4OOIA 3JAMK 4HQEA 2Z3YA 4RM3A 3FHNA 1N34E 4BQQA 2D2WA 4DR6E 2R7ZJ 4IRGA 4A3MJ 2R0QC 1IXCA 2OQGA 4AWXB 4IJDA 1YTYA 4L0YB 2M7BA 2EMIA 2RS7A 4WYQB 2HR3A 2N8XA 1FWZA 4RB1A 2E2HJ 4R79A 4JI6E 5LEJA 2GXGA 2LKXA 1QRYA 2VPLA 2YTEA 3I53A 1JT6A 3FXKA 4I98B 1F9NA 2XVCA 2EJRA 2L0KA 2YTQA 4CYCA 3HTUA 1BBGA 3RKYA 2VI6A 3D5LA 2NYXA 5HODA 1T0FC 2EA2A 4KICA 2Y9ZA 2ME0A 3F8CA 2EOHA 3DQVC 2EPAA 3CTAA 2EMXA 3TDUC 2LF7A 2D9HA 2IJLA 5F0FA 3EUAA 2RV8A 1YRNA 3PSFA 2DN0A 5FFXA 4XKBA 4DV5E 3CMYA 3N4MA 1GQEA 1MSEC 3DWLE 3K70C 2HGHA 4RGRA 3MD2A 1N78A 5LMUE 3KLNA 2W84A 3PQJA 1S29A 4YIFA 2LY9A 2R7UA 1F2IG 2V9KA 2JXPA 2HXIA 1YYVA 2BXZA 2R5YA 1JXSA 2ZMEC 3S2HJ 1O3SA 2O7OA 2DMNA 3F8NA 4L5NC 1SD6A 5L3BA 1E3OC 1DP7P 2YPRA 2Z16A 3KP6A 4YIIA 4ENKA 3GTOJ 2LUPB 3U1KA 2UV1A 1GVDA 4IOCF 1W0UA 1SC7A 1SAXA 2F5VA 3OL3A 4HLYA 4RDUA 3OYNA 1T38A 3K69A 4LFAE 1MNDA 2E7WA 4V2FA 2CJJA 4KJZA 3S15J 3PO2J 4K0KE 3MZ8A 3ADLA 2K02A 4G6DA 2OZUA 1ZG5A 4G6TB 3NWSA 2FJ1A 4B3RE 5IT9K 3AAFA 2GM4A 4JI0E 2OA4A 3CCRI 3CMMA 1WSUA 2X0LA 3LSKA 3TP0A 4CSWA 4N9HA 3EPHA 1YOVB 3ISPA 3R61A 2XPWA 1A04A 1LE8B 3WGHA 5A6BD 4LK0F 1HNZE 3GZNB 3CLQA 4YHHE 2WBSA 1XMKA 4CCJA 3TBIA 1OCTC 4M71A 2F2EA 3RJPA 4FE4A 2LFBA 3S3OA 2EN4A 1J09A 3KZIC 2E36A 1AU7A 1KU7A 2ESNA 2OQRA 3CO6C 5FRNA 3LFKA 5F08A 2CUZA 2LJHA 4OAYA 4BACA 2UWMA 4EJUA 1MNEA 2EM3A 1G2FC 4IL6C 4BYYA 2M4KA 1T2KA 1X3UA 2BY0A 3H9QA 4OIPF 5D5WB 1ZR9A 4CCLA 5ICEA 1G2DC 2KHXA 1N32E 3ZN1A 1P92A 4Q47A 3JRFA 1ZGJA 2YX7A 1GHCA 3LA2A 2XRLA 3V4GA 5DCMA 3VYRB 1SVMA 5KNLA 1WH5A 4ETSA 2BGCA 2HVSA 2Q2EA 2IA2A 1VF9A 2CS3A 1MEYC 3F6HA 3IP4B 2CQXA 4EJOA 3O6BB 3EETA 4I99C 3HOXJ 4EGZA 3RCOA 1B69A 2XSDC 1UN6B 3RZDJ 1YYOA 2K4JA 3BZ6A 4KT6A 3A4CA 4M9ZA 1R36A 2F5FA 4TUIA 3DP7A 1X1CA 1SAUA 5HLIA 4BL0B 2DOEA 3HUGB 4E7KA 2JJ7A 2H94A 2YPNA 3F21A 3BBGA 3HOUJ 3F72A 3K70D 1JTYA 5JVTA 1MDMB 2K40A 1FLIA 1KYWA 3K4MA 4R2QA 1WWXA 2LJUA 5FKMA 5EG0A 3L1PA 5J4VA 5K7HA 4YFKF 4HBLA 3F3XA 4LGWA 2OF7A 4DR3E 3ESWB 2MKDA 1UHWA 2EQRA 3E7LA 3OYFA 4CGZA 3A03A 3TOBA 1WCMJ 3ZQ7A 2QVOA 2VRDA 2DA2A 2C6YA 1A1GA 1ZTRA 2QQBA 3G71I 3RPUA 1WFXA 4O43A 3CMAI 3WU2C 3VYXA 3C2BA 3GTJJ 4BXUA 2CRGA 4J00A 1K78A 3I4NJ 3M7GA 3M1EA 4KZSA 5CFFE 4KWYA 2IVMA 1ZH5A 4GDFA 4BEHA 2EIJH 2DDBA 4PJ0C 3GLLA 1RMDA 2ZJPF 4LLLA 1GVJA 4ANJA 3N97A 4O4KA 3K4NA 1B4AA 2L4AA 2JYAA 2AQEA 2WZOA 1YS6A 3HOZJ 1WJBA 3BZKA 3I54A 5H20A 2DQLA 1B59A 1U2WA 3OSFA 1A35A 1JGGA 1VQ5I 4A3EJ 2EOXA 1U5TC 1UG2A 2VQHA 2M34A 4R1HA 3D1NI 4BQAA 4XLPF 5L3EA 2M7AA 4F7ZA 4DKKA 4O5VA 1I1SA 4P1WA 1Y8QB 5DD8A 2W24A 1D8KA 3S3NA 1P6RA 2XPVA 2EM8A 5LRSA 5JHFA 3HM5A 2EMGA 5DUKA 1JUPA 2L9NA 4D1QA 3DBHB 1X49A 3P9CA 1LDDA 2VE9A 2VN2A 2FXAA 2H8WA 4C3HJ 3L7WA 3OR1C 3TOAA 2L2KB 2BY1A 1BBYA 2QYOA 4Q28A 1NHAA 1R7JA 1R5HA 2L7MP 4B43A 2ELHA 1JTXA 1RKWA 3HZJA 4JK1X 2V4JC 1X58A 2EV5A 3SZPA 2EPNA 2GBYA 3WGIA 2OZ6A 2JY9A 1BBOA 4UUSA 5D6FA 2YTPA 1X1BA 4XLEA 2DMTA 1ON2A 4HV5A 1ZLKA 3Q5FA 3K7AJ 2QM3A 3OIQA 1LFPA 1FKAE 4ESBA 2QLZA 2BVLA 2XPUA 1SMTA 5H6RA 3ZN0A 2LTPA 1A1JA 2LK2A 1JKRC 2EMKA 1FMVA 1P47A 1HC8A 1AHDP 2B3TB 3QOEA 4Q4ZF 1YITI 1Y39A 3VYYA 2ID6A 2O0YA 2YX4A 2OU2A 4I6ZA 3OYIA 2HPMA 5TSEA 4X64E 2LVSA 4CXFA 1WVRA 4GKJE 2CW7A 2LC2A 2J5PA 4N4NB 4ZYDA 2CU7A 3S3MA 5DD4A 5E3LA 2EZKA 1QO0D 2XAGA 2L02A 1HDDC 4R2DA 2QKLB 5J8FA 5DNYA 3ELKA 1NK3P 2K9QA 2QQ8A 4AIDA 5KL7A 3I4MJ 1P2FA 1FSEA 1G3SA 1JKQC 2RDPA 4AYBA 5K5RA 2Y30A 3FWEA 4C2MJ 2KDOA 2QZ8A 1ETWA 2ZBKA 4M30A 2ZC2A 3CCLI 1FY7A 5FLMJ 1BI1A 3RKXA 4E70A 2EOZA 1BA5A 2YS9A 5L3GA 1OFCX 5DM6F 1FOXA 5HS8A 1PJSA 1RR7A 4NXME 3EUKL 4GGGA 2UUZA 2VQGA 4ZC3A 4BXFA 4A0ZA 3UR3C 1TWHJ 1ZK8A 2R7OA 3CF2A 4KDPA 2VE8A 3E1SA 1DP3A 3IL2A 4Y4RA 2XGEA 2W4SA 1XGNA 3E0JB 2R4GA 3TEDA 2EPUA 2FV4B 1YO5C 2NVXJ 1J0RA 4A3GJ 3M8JA 2X6XA 3F8MA 2DT7B 2VKHA 3M1CA 2NVYJ 1WJ5A 3AV0A 4S04A 1POGA 3ZMZA 2MSYA 4II2A 4A5MA 2EOYA 3S32A 5B1BH 4I2OA 1O4XA 2LD5A 5KL2A 4YFXF 1ZKGA 5F0HA 3ZMVA 3ABMH 2M45A 2LG4A 1JUMA 2EPMX 3HOWJ 4TV7A 2RTXA 3U21A 2KJBA 2NUEA 1P4AA 1U8BA 5KL6A 2WWYA 4HX4A 1R5ID 3KE2A 3S1RJ 2DI3A 2BZTA 2YRHA 5J47A 3HOTA 2EL4A 2DU9A 1TC3C 1YW9A 1FOKA 3KZZA 3J7AO 2EQ0A 5KAIC 3DBLB 3GUDA 3F9KA 2E35A 2ZXHA 3MHSC 3H5AA 2W48A 2V9PA 3AFHA 4YELA 2HFHA 5M5WJ 1IXRC 4Y17A 2K7IA 2JSCA 1AOYA 5FKLA 4ITVA 1XDSA 4BBSJ 1HNXE 2XHKA 1IN4A 3QRFF 2L54A 2OD5A 3OYCA 2R1FA 1R6RA 1ODDA 5IPAA 2EPKX 2NABA 1Y1WJ 4O5GA 3BWGA 2E2JJ 2M8EA 2NUGA 3PO3J 2GIVA 2LKSA 1X3ZB 3GX4X 2FOWA 2STTA 2MBFA 2FD5A 3SQNA 4M9XA 1EH8A 1F1ZA 1TWFJ 5F04A 1BR1A 2EOQA 4L8NA 4L9NA 3RI4A 4EVIA 4XQFA 1X47A 3K9TA 2JRTA 3HRUA 3R60A 4BCAA 5H2FC 4A3JJ 5EJCA 1JKOC 4LLNA 1W36D 2KOUA 2DT5A 1W0TA 2EMAA 2EFWA 4IO9F 1QBJA 1T4NA 1YHQI 4M3GA 1H8AC 1A1HA 4HSRA 4L18B 2BXYA 3NQOA 4G9YA 2NS8A 3A1YA 2Y9YA 3CUQC 3E6DA 1V4RA 1PP7U 2J7JA 4I09A 1C0WA 2HOSA 2BY2A 2BB8A 2DLKA 2XAFA 1HXDA 2BBGA 2E34A 4C3IJ 5EF6A 4X0GA 2WADA 4D5FA 2HYFA 2MC3A 2RPCA 2I13A 3BTCA 4DV6E 3WTSC 1YE9A 1QU3A 2KRCA 1A6QA 3BPXA 1OCPA 3WE2A 1DU6A 2GZWA 3CQZJ 3I64A 3KZYA 3J7YJ 1MBKA 5BNGA 1SANA 3F6OA 4KT5C 3MMYB 5EEGA 1JJ8C 3GCMA 1TWCJ 2CGPA 1K4TA 2E1MB 1UCRA 3KYLA 5D5UB 3BG6A 1I6XA 2BE5F 3BT9A 3W3CA 2DCEA 3D5RC 2L9VA 3WG7H 4A12A 2IHR1 4CUGA 2K3PA 4LG0B 4XKCA 3I58A 3NWTA 3GTQJ 5CVVA 2A6HF 5KHDA 2P0WA 3G6EI 2ISZA 1OYIA 3E5XA 2UXCE 1YI2I 4ZDOA 5F6FA 2IGMA 5HDNA 3WTUC 3JRBA 1MD0A 3C3WA 2IS6A 3BPVA 3TO6A 4DV0E 2X9DA 3JTGA 1ZR4A 1JE8A 3TMOA 2ZSIB 4A3DJ 2HVQA 1TTYA 1CGPA 4OIOF 1P9QC 3M8FA 2W57A 4LLGF 1RUOA 4PCQA 3CJRB 5ILUA 4NUBA 3WHBA 3ML6A 3WU1B 4JI4E 1LE8A 3HKZN 1TP4A 1PKPA 1X5WA 2ENHA 4F55A 5A2QZ 5B3SH 3F6GA 2AQFA 2XC7A 4LB5A 4XR6A 3JRCA 3DCFA 2FTXB 5HNHA 2UZKA 4C2TA 3WHCA 5IWAE 2WAFA 4P78A 2OBPA 3OL4A 5LHHA 4YY3E 3UK3C 3PJRA 2XV4S 4U7DA 2ZMEB 4DIQA 4DYRA 2Z2SB 2EBIA 1OPCA 4XLAA 4HDUA 4KMUX 1AA7A 2GLOA 2ELKA 3FIGA 3W6JB 4XLNF 1RRJA 4FT8A 1X6EA 5ICFA 2K7LA 1GTKA 5GAGJ 3L2CA 2X1EA 3DEUA 5CQEA 2AXTC 4XN0A 3J81Z 3J7AG 4A93J 3PFYA 1UHZA 2MC6A 1FEXA 4M3FA 3OYLA 4NQWB 3S1MJ 5IOZA 3QYFA 5CJ9A 1FNNA 1DUXC 3ADJA 3T1HE 3TL4X 2K86A 1ZU1A 1U9OA 2NNYA 4AIJA 1HQCA 5AE3A 2FF4A 4N4OB 4I76A 5M3MJ 2L92A 2OTJI 4LG3A 2YTIA 2AXLA 2M5WA 2IA0A 1NTCA 1OR7A 3ERMA 2Z33A 3R0JA 1VQOI 4XOTA 1XS9A 3JTZA 2V87A 4B09A 3DPLC 4DGWB 5A6JA 4LITA 1XMXA 1FJLA 3EPJA 1PUFA 1R1UA 2OCEA 4WPYA 3HUGA 1HSTA 4IXAA 3TQNA 2UU9E 1EKZA 1TL8A 3HHGA 4I0AA 4D7MA 2PI0A 1MDMA 4PUSA 4IPAA 1LJ9A 1TLHB 4WXHA 4RAYA 2QSGX 4PSXA 3VDXA 2EK5A 2F5EA 2GHFA 3VK6A 2M3AA 4MO7A 3TDZC 4HA8A 2JA6J 2VF1A 4A3BJ 1Z7UA 2OJED 5KAFC 2DTZA 4DV1E 3V8KA 3A2KA 4MLOA 2EM6A 3FXLA 3HC7A 3W6VA 1SFEA 2WV0A 3BCAA 3VOEA 3JR9A 3GYHX 2HC5A 3FXOA 5BS6A 5LEKA 4CZCA 1YYWA 3OSGA 2D45A 4IEJA 4JYAE 2EPLX 1Z21A 3Q9SA 4DR2E 2W00A 2QUFA 4CYDA 4HSTA 1RQ0A 3VYSB 1KJKA 2M1SA 2CTDA 2CG4A 5JVGF 2CT1A 3RTRA 3PNTA 1MGTA 1X1AA 1G59A 4LF8E 4M6XA 3OR2C 1VQ4I 2N3HA 4CHUA 2YSOA 4L0ZB 1J2XA 3S1QJ 2IA1A 4BU2A 2IRFG 2MLGA 4HTGA 3H09A 2MA3A 2Q8KA 4UV8A 1Z91A 4W1UA 2OUMA 4L5IA 3HJEA 3HL2A 3LMMA 4XBFA 1Q1VA 2R7WA 1TBXA 3WTXC 2NVQJ 1IV8A 3BJOA 3T5XA 1VQKI 2L2MA 1DGWY 1HR0E 2P8TA 2DA3A 3HSFA 1KQ8A 4LD5A 2MKNA 4D5CA 3OYHA 1MMSA 2R7FA 4LMYA 1R4NB 3WTYC 1PJQA 3L09A 4R2CA 3BG3A 2KONA 3DLAA 3H3ZA 2EN1A 2WBTA 2AO9A 2VXDA 5F1RA 1LEAA 2G7UA 2JZYA 4BHCA 1GDTA 2R7SA 1XNRE 2L3DA 5HOOA 4F92B 2H6CA 2BHYA 4U0YA 1X1PA 1O3TA 3OS0A 5A2QC 3P7NA 2E5ZA 2YTGA 2IS2A 1ACIA 4XLCA 1QA6A 1E3PA 4KNYA 4R03A 4V19K 1HF0A 5H6QA 1YUIA 2EPRA 2ODRC 2EH3A 4G7ZF 4DBQA 2XGXA 1X1DA 3KETA 1U5TB 2ENAA 1D3YA 2BV6A 1CF7B 2A6TA 1I27A 1PDAA 3FHZA 1XGSA 3RYPA 1R5GA 4UXNA 3IWCA 1Y6IA 4U0VA 1TW2A 1TZLA 3T1BA 2VT2A 4Z6YA 1TQIA 3H36A 1MZBA 4ENJA 1KZHA 1A31A 3J81C 2E71A 3KX2A 1EF4A 3U9GA 2YTFA 2L2OA 2V85A 1ZHFA 5FGMA 1G3TA 1IV6A 2EM9A 1WJAA 5CPRB 2ZXIA 1L0OC 4NNJA 5D8LB 4ZDLA 1JJ6C 1LEBA 2LCEA 2V8QB 3HPZA 2QSFX 1V5EA 2E5LE 5FRMA 4XL9A 3ZOBA 1WHNA 3GFMA 4MTEA 2XAHA 3IV5A 1O3RA 4F9BB 3WG9A 2AS5F 3BIDA 1TNSA 2GWRA 5DUIA 1ORKA 2W82A 3CC4I 1QPMA 5LRRA 1UBDC 1Z05A 1BOBA 5A6KA 4BGDA 1S7OA 2IW5A 4I8OA 2H8RA 1WH7A 1I94E 2H27A 3WE3A 5HDGA 5HS9A 1R4MB 4BY1J 3KYCB 3OWTA 3OV8A 1R00A 3RDIA 2RQLA 3G73A 4A69C 1EJ9A 4B47A 2B7TA 1VQ8I 2WB1A 4GYGA 1R1TA 2LE2A 3QU6A 4LF4E 1BI2A 2ZFUA 1X2NA 2DMQA 1D5YA 2VB6A 1V55H 2JRMA 3DKWA 2EOIA 2FX0A 1FOYA 2CUFA 3ABKH 4EMSA 1FYMA 1MJBA 5AIPA 1SR9A 4RA2A 5L3CA 1WJPA 1X48A 2G9WA 2VC1A 1MH4A 4UVBA 4BJ6C 3TKYA 2E5NA 2VQLA 3KP7A 4JI8E 4DR4E 3V42A 2K9MA 4RB3C 3S14J 1HW1A 4XK4A 3V8JA 4Q48A 1S8NA 4FCYA 2JWOA 1LFBA 4LB6B 4HRIA 1LVKA 2P6SA 2F48A 1HDPA 1Y0NA 4RAGA 3FX3A 3GEZA 4R2PA 3AG3H 1G2HA 2X4HA 3FKIJ 2FGGA 1YLFA 3BDDA 2CO5A 5HLGA 1NEIA 4D9JA 1HKQA 5GPAA 3KFWX 5FROA 2MD0A 3TQMA 4OU0A 4Y33A 2DLQA 3CDHA 5FLXZ 3MKLA 1ITYA 4E7JA 3E5UA 4BAYA 1RZ4A 1R23A 3NARA 2DA7A 3HEFA 5A6AA 5E20A 2ODRD 4BQNA 2KIFA 5FB2A 3V8LA 3OMYA 3G1MA 2YU9J 1W5TA 2YSRA 3F23A 1VQLI 3COAC 1E2XA 1VQ6I 1DQ3A 4X9JA 4B3ME 3K4KA 4LFCE 1ZBQA 2HGCA 3I56I 1RC9A 3RPUD 1KQ0A 1BB8A 3AG2H 5BPIA 5JHUA 3RIRA 5CQGA 1QZYA 1A1FA 4Y3OA 5TISC 4PJLA 4H0EA 4BMJA 2MGQA 2MLKA 2A05A 5JLWA 3AUZA 4UB8C 5HDKA 3HIFA 1XSXA 2P5VA 1Z0XA 4QTRA 1OQYA 1D0XA 1LKXA 1Z9CA 4XM3A 4AVPA 2JQ7A 2L3JA 2EMLA 3RQIA 1USTA 2B9SA 2A68F 2ESHA 4XLFA 1WJEA 2WV1A 2EA4A 1NG7A 4UUTA 2HOTA 4E7ZA 2YUSA 2V86A 2L33A 1AAYA 3A0BC 2LP0A 4QPOA 4EM1A 5A6BA 2PFBA 1D1CA 3ZQQA 2ZJRF 1E0EA 3RSNA 4OAZA 5IT9C 1S9HA 5KL3A 2PJRB 4P55A 3CC7I 1W7PD 3BZCA 1FP1D 3KEYA 1Z67A 1P4XA 4NDLA 4IHWA 4M73A 3GW2A 3QQAA 3OYGA 3MWMA 2F4IA 3E6BA 4A3IJ 3FXRA 3PIPF 1BW5A 4RGUA 1ZAOA 5LFAA 2M2EA 1TN9A 3LOCA 3BROA 4KIBA 3V7RA 3HPSA 3SYTA 2HPIA 1E3HA 2ACJA 3K10A 2VXZA 4FISA 1IDZA 2VBXA 2CUEA 2NXNB 2E1MA 2JN6A 1GV2A 2W85A 4ESFA 4GRIA 5LD2C 1R71A 2YZTA 3SJMA 1ETXA 2F8BA 3LSTA 5GP9A 1QPIA 1K79A 3CUQB 2X85A 1HW2A 2YSPA 2B0LA 3BTJA 4XRSA 4Y52J 3I0TA 4G12A 4RAFA 2EFQA 2EOEA 2JWTA 4XRSG 2ZJQF 1J5YA 2ME6A 4LF9E 4HLXA 3M3YJ 2DODA 2L4MA 2CW8A 2ZCWA 2IGOA 2EM0A 4GYIA 4KHPE 2LBFB 1MBGA 3EUHC 2K9LA 1UELB 4GKKE 4EGYA 4XORA 3DFGA 3B6CA 3MEXA 5GAHJ 1MMNA 1YX5A 2VODA 3IKTA 4FK5C 4GO1A 2LF8A 3WTVC 4RH8A 1VQMI 1I6HJ 1MBHA 2F4OB 3KIOA 3GFLA 5FLXC 1ZARA 5FO5A 1U9NA 1K61A 1GV5A 2H1LA 2L9RA 4TUGA 4IRIA 4RS8A 2YU5A 4M3BA 2L7KA 4E7IA 1W5SA 5E3MA 3C4TA 3FXJA 2V6EA 2VC0A 3H92A 2NOJB 1HOMA 4LU9A 5JFRA 4HPQA 3QPTA 1FMWA 1XNQE 2EZLA 2HDCA 2IPQX 1H89C 4H4KC 3OIOA 2EMYA 4B44A 4HAMA 3DTIA 5HLTA 1XMOE 4NQWA 3R6SA 1ZRCA 4DZPA 2FA5A 2F5DA 3TO7A 2DOAA 5E1ZB 1RR8C 3HRSA 2K4VA 1D1BA 1IMUA 2ZXJA 2V1UA 2XB0X 3QP5A 1XN7A 2VPRA 3GFJA 4LTYA 1J26A 4LJZF 4D7NA 3ZQGA 2PLYA 3HRMA 1UMQA 2MDRA 2LRDA 4X6AJ 3R4KA 4I02A 2ECBA 4V2GA 3G2BA 1KU3A 4RB2C 5M5XJ 3E3VA 5HS7A 5ADZA 5E3OA 2PX9A 1GLNA 4XRFA 1H9GA 3HSEA 4DQ2A 5K1YA 6PAXA 3F6VA 4NB5A 1RESA 1IDYA 1SD7A 2PMZA 2IT0A 3PNYA 4L9JA 2COBA 2COMA 5E8IA 1PP8F 2M4IA 3C6KA 3DKXA 4XSZF 2JTVA 2L9SA 4OWRB 1IUFA 5IP9J 4EJTA 2EM5A 4CICA 1R22A 1WGXA 3IH3A 4E7LA 1XD7A 4MNUA 3IUOA 4PGGA 4ZJZA 5BMZA 2EORA 3DKYA 2Z99A 1TW3A 5FKOA 5GTIC 3LFUA 5K5OA 2QBYB 5GAEJ 2VQCA 3HHHA 4AU7A 2KRFA 2BVMA 4RGSA 1M1EB 2ICWG 3BG5A 2QCOA 4AIHA 4KIFA 3FKJA 3QP6A 3CCUI 2X1CA 4IHSA 1LQ1A 4RHBB 2A61A 3K1PA 3DPTA 3E6MA 3VSKA 1SFOJ 3FM3A 4NZVA 1PDNC 5F27A 1VZ0A 2KLOA 4MIMA 4F91B 1LVAA 1OISA 1YIJI 3CCYA 3DTKA 1A1LA 4M72A 3FDYA 4J19A 5FD5A 4LF7E 3HBLA 3MKZA 2HYJA 1IRGA 2LRSA 2PG4A 3N05A 2GAUA 2DXIA 2MABA 3C2GA 2DFEA 4I01A 1YJWI 4BBYA 4DYQA 2RN7A 1EA3A 2M4GA 1SVLA 2Y0SA 4HG2A 1TT5B 3IAS2 2WBUA 3DF8A 4XNFA 2P81A 4B3XA 4GEQB 1JK1A 4MLVA 4P5OA 1HKSA 3P9IA 1X2MA 5ILSA 4BH9A 2H36X 1UAAA 1YPNA 1FJGE 4AUXA 3W2AA 3A0HC 1JKPC 2FE3A 3MAJA 4B3SE 4CCMA 4CZZA 2GLIA 3KCCA 2BY3A 5K7ZA 3L2WA 1G4DA 3K4BA 2CSOA 4U7BA 2KJCA 3HGGA 2DYRH 2V1XA 1E17A 1FP2A 4JOMA 2CMPA 4RGXA 5FLVA 5IYBJ 2XDVA 1RNLA 4XN3A 4ENMA 2OC6A 4AYBN 1Z1BA 4KFCA 2DMPA 3P5JA 3OYDA 3L9FA 3LL7A 5C44J 1U5TA 1O57A 3ZMDA 3S1NJ 1CF7A 5ERIA 2XGDA 4EJVA 3OYKA 3DEEA 4HV6A 5JR3A 2TDXA 2LVHA 2A3SA 1H0MA 3ADGA 4DYCA 4BDZA 4DR1E 5DM7F 2EJ4A 3ZP5A 4AC0A 2WAEA 1O0WA 2HTJA 1S7AA 4RAZA 3MVPA 2JK3A 3S2DJ 4B8XA 1MNMC 1ZYRF 2A69F 2R76A 2L7FP 3IWDA 1RUNA 2RKHA 3S17J 2EPPA 4M6VA 2E19A 2M9AA 3ABUA 2F4MB 2EMBA 1BOAA 1T6SA 4G8XA 4YG2F 3BY6A 1BJAA 5HLHA 4G6QA 4QPQA 5EGOB 2WAQA 1UHMA 2EWNA 3DBRB 4U0WA 4FX4A 4DV3E 1Y0UA 2STWA 3PL8A 2ADUA 1ETYA 1F36A 5F3WA 4X8WA 2RAEA 1G8XA 1KONA 1MW7A 2VUMJ 4S05A 2WCC3 4DBRA 4DR5E 3GTMJ 1Z3XA 2FBKA 2LH9A 2LTRA 4ZZDA 4CCNA 4XKVA 1IAWA 5BOXA 4HW0A 3H0DA 1G3YA 2RQQA 1AH5A 2F4VE 1QGPA 4JI5E 1S5LC 4IHTA 4ZYGA 5IP7J 5E1WA 2O3FA 4BC7A 3J7ZI 3OOUA 3CO7C 3LA3A 2LMDA 3OYEA 3DJWA 1SVOA 1LDKB 2M0CA 3ADIA 3CP2A 1A36A 1V5FA 3O3KA 3HTXA 1VI0A 1STUA 1X6HA 2FU4A 4NHJA 1I3AA 1X4PA 2KKOA 4CO8A 2B9DA 1ZGAA 3FMSA 3I55I 2OTLI 1T33A 2JOXA 2CV0A 4FTHA 5LGNA 5CLSA 1ENHA 2OAZA 4AVZA 5TRDA 3ZQCA 4A6DA 1T95A 3SZTA 1J9IA 3K1NA 2DMUA 1XX5A 2DPDA 2HHHE 2XSJC 4KUMA 1ZRDA 3VFZA 4LIVA 3ABTA 2PBIA 2CQNA 1Y56A 2DA1A 4IQJA 2LTSA 2B7VA 1WKMA 4Y15A 5IY5H 4IQ4A 2EZIA 3BLYA 4BY7J 4P96A 1VQ7I 2JVGA 4ZZLA 3S16J 5D5VB 3JRHA 2XIGA 2R5ZB 4FE7A 2IEKA 3ZXSA 5ILVA 2NVTJ 1W7PB 4JV5E 4OMZA 2HYGD 4I0BA 3TP3A 4ON0A 1VQPI 3B02A 1IN6A 4R8HA 1QHHD 3AL0C 1KYQA 2X6WA 1Z3YA 3K4LA 1IBKE 2TCTA 3U2RA 2E1CA 2WTEA 1R1VA 4HDVA 1TF6A 2EOFA 2IS1A 2I9IA 3HDDA 4UUSB 5DTDA 5DV5A 1SEUA 4HYEA 1BL0A 3GLXA 2FBHA 4Q35B 1FOWA 2ELJA 3D5SC 3HPHA 3E97A 4A2UA 2D5VA 2M1BA 2WY7Q 3FXQA 4HF1A 1KYZA 2KIMA 2FNAA 1MMDA 2J5OA 3CLOA 4R2SA 5C3EJ 3KEOA 2RNJA 1Z77A 1Z6RA 2ZB9A 3I71A 1OCCH 4AIKA 3AG1H 2EQ1A 2YTJA 3HQ1A 1T4LB 2P4WA 3GTPJ 2ISYA 5E8GA 1A1IA 4Y13A 2UUCE 5D5XB 2H1KA 1BW6A 2H09A 3F8FA 4OINF 1PUEE 3VYTB 4JBAA 2XF7A 2EQ3A 1MBFA 4CDGA 4F52A 2UUBE 1WHQA 1YW8A 4FHTA 4IF4A 1KGSA 1ERDA 3ROUA 1JHFA 2R7QA 3QODA 2E72A 2DK5A 2EPOA 5KL4A 2Z9OA 3JTHA 4M6YA 2DGCA 3BR0A 3RKQA 4A3CJ 1ZELA 3BCBA 4BNCA 4R2EA 3FISA 5A2QK 2HKXA 2MG4A 4A3KJ 2HOEA 2KP6A 4R8OA 2EZHA 1I39A 3EPZA 3L2QA 4ZYEA 4YIRX 4P7DA 3S2WA 4ENNA 2PJRA 1OCRH 2BEOA 1YZ9A 3CJQB 2G0EA 3FK6A 1FIAA 4PK4A 4M9VC 1Z7LA 2K5CA 1HSJA 2VASA 4JX6A 2Y0MA 4HX7A 2VQFE 3QPHA
chains in the Genus database with same CATH topology
1K6OA 2Q0OA 1O7LA 1QQIA 4ZH4F 4HF2A 4N9IA 4O3MA 1LB2A 3JAMZ 2K4BA 5CVRA 3J81K 4OIRF 4A6EA 3U1DA 1L3LA 3TGNA 3ULQB 2FRHA 1XMAA 3CUQA 4RB0A 2P7VB 3IHUA 1YIOA 5AIQA 4ASNA 2P5KA 2V9VA 2FSWA 3LAPA 4KN4X 3GF2A 4KA4A 1O7FA 5CYVA 1O3QA 1YG2A 2M87A 2WC2A 4HOBA 4K2EA 3I59B 4KYWA 3C1DA 1ZG1A 3F8BA 4OMYA 2ZNYA 1DPUA 3T8TA 2Z5UA 2YR2A 3LWFA 3QAHA 1IUYA 4EV0A 3I4PA 3FMRA 3IRRA 1R58A 1HBXG 5IT9Z 3FMQA 1KU9A 1USSA 4HZFA 1B6AA 1LNWA 5E17F 2FQ3A 2PQ8A 4HX8A 2DAOA 5BPDA 3V7CA 3L00A 3ZMUA 4P9UA 1GXQA 1WQ2A 1YW7A 5DCFA 1TQMA 5BQTA 2ZNZA 4EM2A 3ECHA 2HKOA 1G3WA 2JT1A 2XUBA 5HVQC 2V6CA 3SXYA 3WU0A 2DO7A 2QBYA 2ZKZA 1BIAA 1G6NA 2E1NA 2XKOA 3JSOA 2BBYA 1MJ9A 2NRAC 3OOPA 3GXOA 5ICCA 3VEPA 2F5CA 2PJPA 1SFUA 1P4WA 2E7XA 2QQAA 4P9FA 2BYVE 5LHGA 2MH2A 3GZ5A 1LDJA 3KP4A 2FMLA 4M9SA 4IVNA 2Y75A 2FBIA 2VBWA 1EV7A 1SMYF 1I5ZA 5LGUA 3EYYA 5L3DA 4L9VA 5LGTA 5IT3A 3ERED 1U6GA 2EV0A 1BI0A 3RPQA 2XROA 3HSRA 1XSVA 3IC7A 1DPRA 2LDUA 3QU3A 3ZMSA 5DYMA 2HTSA 2NAZA 3C18A 3DXJF 4UV9A 4DNCA 1S6LA 2V79A 1SD5A 1STZA 4GCVA 1IZ1A 2P6TA 2CFXA 4KN7X 1V3FA 1B1BA 4O6JA 2PN6A 3SHFA 3NEUA 4WK8F 4EM0B 1XGMA 3LAJA 3EYIA 3KLOA 3MZYA 2DBBA 1BC7C 3B73A 4QWQA 4UNOA 5FLXK 2XASA 2PEXA 1YQAA 2DW4A 2GQQA 1D5VA 4WCGA 1IXSB 5L3FA 4LG0A 1XCVA 3M9AA 4QLCU 2RGVA 1IN8A 3K1MA 5LLQA 4L9TA 1FX7A 3Q9VA 1XCBA 1FZPB 1HKTA 1BC8C 5CVJA 2ZO4A 1KA8A 1T0FA 1JHHA 1IF1A 3KEQA 1ON1A 2YU3A 1U3EM 3TO9A 1BN5A 3R0AA 1FBUA 2M30A 2HQNA 2GA2A 3LQQA 1J59A 2LNBA 3FM5A 3MQ0A 3REOA 5ED4A 2ZMEA 2CQKA 2MD5A 3PQKA 1W7PA 1ZRFA 4U88A 4KIGA 2RVCA 2VBYA 1FBQA 1UB9A 4G94A 4A5NA 1ONVA 2JPBA 4ZYHA 1OMIA 2VONA 2QWWA 5F64A 3LA7A 1UFMA 2DQRA 5TJJA 1BM9A 1DDNA 1J7KA 4Q5SF 2O61A 3WTZA 2FMYA 4XSXF 1KU2A 3IWFA 4UHTA 5LHIA 2A07F 2GA1A 5FFZA 2D1HA 1ZN2A 4MEXF 3O2PE 2P7CB 2NNNA 4G7OF 5KK1A 2EB7A 5D4SA 3BP8A 3WGGA 3MFKA 1ZG3A 2GXBA 4BHPA 3NRVA 3IRQA 1TNTA 3IKVA 4LK1F 2HWVA 1EH7A 5D4RA 2DTRA 3P9KA 1B9NA 2JPCA 2PMHA 2O8XA 2RC4A 2FEZA 1ZLJA 4WXDA 4I7HA 3HOSA 3M8EA 4PDKA 3V7SA 2QQ9A 4A0YA 1HW5A 5E1XA 3RYRA 1B9MA 1J75A 1BI3A 1KQ9A 3GO5A 4IRHA 4ESJA 2HQRA 2XRNA 4FX0A 1OYYA 3QOPA 3HRTA 3ZPLA 2XAQA 1MJAA 1U8RA 3W6KB 5FD6A 3FF5A 4EJWA 4A0XA 3GVAA 5EEHA 3I59A 2D1VA 1D8JA 3KP2A 1QNTA 2XAJA 1XB4A 2UXXA 4HF0A 5DCMB 5ICGA 1FC3A 5DEQA 3K2ZA 1ZREA 4PZJA 1XSDA 2HS5A 5D8KB 2LKPA 4N0BA 3EUHA 1FBSA 1BIBA 2VOPA 4HQMA 2R7DA 1K7AA 2G7HA 3MZHA 3BOQA 3VB2A 2HEOA 3SFZA 2P5LC 2IP2A 2CYYA 2EV6A 2RQPA 3HYIA 4Z2YA 3LQRA 1IRFA 3EDPA 3T0YA 4G7HF 3BJ6A 4MGRA 1ULYA 3RKWA 5LBQA 1K78B 1MKMA 2ZJ2A 2O6GE 2A5YB 3MCZA 1S3JA 4PGHA 3K0LA 2NS0A 2R3SA 3WTTC 1FSHA 3HTSB 2L01A 1RI7A 4YFNF 2EFOA 4UVCA 1IW7F 3C7JA 1F4KA 2PMUA 2DPUA 1FYKA 1EH6A 1Z6TA 3CUOA 1WRJA 2CWEA 3EQLF 1F5TA 2V1DA 3VODA 5DDGA 1U78A 2EFNA 1REPC 2DFIA 4MEYF 2EFPA 5CVUA 3GFIA 2H6BA 4MHGA 4UUVA 1RIOH 3KP3A 2MH9A 1W4MA 2ETHA 3I5UA 3PFIA 1FYLA 3CJNA 4UVAA 1FPQA 5D6EA 5K5QA 4MQ9F 4MTDA 2KIUA 3WTWC 1VTNC 3FZVA 1QZZA 3ECOA 1I1GA 3H3UA 1YFHA 4M74A 3JSPA 1H9TA 2O03A 2CW0F 1WI9A 2LSOA 1YS7A 3FXUA 3GZ6A 4WXCA 1FT9A 3E5QA 3E6CC 2XKPA 3GWZA 3JW4A 2VBZA 4D0PA 3DV8A 4WX9A 4MQVA 3G3ZA 3J80Z 2UXNA 2W25A 1TQPA 1Z1DA 1XDUA 1GXPA 1OYWA 2K27A 2VT3A 5J8CA 3F22A 1IN5A 2FOKA 4KMFA 2DLLA 1T98A 3BJAA 3IWZA 4WF2A 4AD9A 4IJAA 5CVIA 4EQQA 5E18F 5J6XA 1XGOA 1AWCA 2VOOA 1Q1HA 2A6EF 5KVRA 4OIQF 2QENA 3D0SA 2ZFWA 4L5JA 3ZMTA 4WWCA 2DK8A 4JQFA 3T8RA 4GXOA 4BHBA 1SFXA 5AONA 2HZTA 5JI6A 1JGSA 3KP5A 1OKRA 3J80K 2FNPA 2Y48A 3WODF 4LFUA 1IN7A 1SD4A 1T39A 4OOIA 3JAMK 4HQEA 2Z3YA 2D2WA 4IRGA 1IXCA 2OQGA 4AWXB 1YTYA 4L0YB 2HR3A 1FWZA 4RB1A 4R79A 5LEJA 2GXGA 3I53A 4I98B 1F9NA 2XVCA 2EJRA 3HTUA 3RKYA 3D5LA 2NYXA 2EA2A 4KICA 3F8CA 3DQVC 3CTAA 3TDUC 2LF7A 2IJLA 2RV8A 5FFXA 3N4MA 4RGRA 3KLNA 2W84A 3PQJA 1S29A 4YIFA 1YYVA 1JXSA 1O3SA 3F8NA 1SD6A 5L3BA 1DP7P 2YPRA 3KP6A 4YIIA 4ENKA 1SAXA 4HLYA 1T38A 3K69A 2E7WA 2K02A 4G6DA 2OZUA 1ZG5A 5IT9K 3AAFA 2OA4A 1WSUA 2X0LA 4N9HA 3ISPA 3R61A 1A04A 3WGHA 4LK0F 1XMKA 4M71A 2F2EA 3RJPA 1KU7A 2ESNA 2OQRA 3CO6C 3LFKA 2UWMA 4EJUA 4BYYA 1T2KA 1X3UA 4OIPF 5D5WB 5ICEA 3ZN1A 1P92A 4Q47A 1ZGJA 2YX7A 1GHCA 3LA2A 3V4GA 5DCMA 4ETSA 2BGCA 2Q2EA 2IA2A 4EJOA 3O6BB 3EETA 4EGZA 2K4JA 3BZ6A 4M9ZA 1R36A 2F5FA 3DP7A 5HLIA 2H94A 3F21A 3F72A 5JVTA 1MDMB 1FLIA 1KYWA 1WWXA 4YFKF 4HBLA 3F3XA 4LGWA 1UHWA 4CGZA 3TOBA 3ZQ7A 2QVOA 2C6YA 2QQBA 3RPUA 4BXUA 1K78A 3M7GA 3M1EA 2IVMA 1ZH5A 4LLLA 1GVJA 3N97A 1B4AA 2L4AA 1YS6A 3I54A 5H20A 2DQLA 1B59A 1U2WA 1U5TC 4R1HA 4BQAA 4XLPF 5L3EA 4F7ZA 4O5VA 1I1SA 5DD8A 2W24A 1D8KA 1P6RA 5LRSA 5DUKA 3P9CA 1LDDA 2VE9A 2VN2A 2FXAA 3L7WA 3TOAA 1BBYA 2QYOA 1NHAA 1R7JA 1R5HA 2ELHA 4JK1X 2EV5A 3SZPA 3WGIA 2OZ6A 5D6FA 1ZLKA 1ON2A 4HV5A 3Q5FA 2QM3A 4ESBA 2QLZA 1SMTA 5H6RA 3ZN0A 4Q4ZF 2YX4A 2O0YA 2OU2A 4CXFA 2J5PA 4ZYDA 5DD4A 1QO0D 2XAGA 2L02A 5J8FA 3ELKA 1P2FA 1FSEA 1G3SA 2RDPA 5K5RA 3FWEA 2QZ8A 2ZBKA 1FY7A 1BI1A 3RKXA 4E70A 5L3GA 5HS8A 4GGGA 4A0ZA 4KDPA 2VE8A 3IL2A 1XGNA 1YO5C 1J0RA 3F8MA 4S04A 3ZMZA 4A5MA 4I2OA 4YFXF 3ZMVA 2M45A 4TV7A 2KJBA 1P4AA 2WWYA 4HX4A 3KE2A 2DI3A 3HOTA 2DU9A 1YW9A 1FOKA 3KZZA 3J7AO 3GUDA 2HFHA 1IXRC 4Y17A 2JSCA 1AOYA 1XDSA 2XHKA 1IN4A 3QRFF 2L54A 2OD5A 1ODDA 3BWGA 2M8EA 2GIVA 3GX4X 2STTA 2MBFA 3SQNA 4M9XA 1EH8A 1F1ZA 4L9NA 3RI4A 4EVIA 3K9TA 2JRTA 3HRUA 3R60A 4LLNA 2DT5A 2EFWA 1QBJA 4L18B 3NQOA 4G9YA 3CUQC 3E6DA 1V4RA 1PP7U 4I09A 1C0WA 2XAFA 1HXDA 2HYFA 2MC3A 3WTSC 3BPXA 3WE2A 2GZWA 3I64A 3KZYA 3F6OA 4KT5C 5EEGA 2CGPA 1UCRA 5D5UB 1I6XA 2BE5F 4A12A 4LG0B 3I58A 5CVVA 2A6HF 2ISZA 1OYIA 3E5XA 5F6FA 5HDNA 3WTUC 1MD0A 3C3WA 3BPVA 3TO6A 3JTGA 1JE8A 1TTYA 1CGPA 4OIOF 3M8FA 2W57A 4LLGF 1RUOA 4PCQA 5ILUA 3ML6A 3WU1B 5A2QZ 4LB5A 2UZKA 2OBPA 5LHHA 2XV4S 4U7DA 2ZMEB 1OPCA 4HDUA 4KMUX 3W6JB 4XLNF 4FT8A 5ICFA 2K7LA 3L2CA 3DEUA 3J81Z 5CJ9A 1FNNA 1DUXC 2K86A 2NNYA 4AIJA 1HQCA 2FF4A 2AXLA 2M5WA 2IA0A 1OR7A 2Z33A 3R0JA 4B09A 3DPLC 1R1UA 3HUGA 1HSTA 4IXAA 3TQNA 3HHGA 4I0AA 2PI0A 1MDMA 4IPAA 1LJ9A 1TLHB 4WXHA 4RAYA 2EK5A 2F5EA 3TDZC 4HA8A 1Z7UA 3V8KA 1SFEA 2WV0A 3VOEA 3GYHX 5BS6A 5LEKA 2D45A 3Q9SA 2QUFA 4CYDA 2CG4A 3RTRA 1MGTA 4M6XA 4CHUA 4L0ZB 1J2XA 2IA1A 2IRFG 2MLGA 2MA3A 2Q8KA 4UV8A 1Z91A 4L5IA 4XBFA 1TBXA 3WTXC 3BJOA 3T5XA 2P8TA 1KQ8A 3HSFA 4LD5A 2R7FA 4LMYA 3WTYC 3L09A 3H3ZA 5F1RA 1LEAA 2G7UA 2JZYA 4BHCA 2L3DA 5HOOA 2H6CA 4U0YA 1O3TA 3P7NA 4KNYA 5H6QA 4G7ZF 3KETA 2XGXA 1U5TB 1D3YA 2BV6A 1CF7B 1I27A 3FHZA 1XGSA 3RYPA 1R5GA 4UXNA 4U0VA 1TW2A 3T1BA 2VT2A 1TQIA 1MZBA 4ENJA 3U9GA 1ZHFA 5FGMA 1G3TA 5D8LB 1L0OC 1LEBA 3GFMA 4MTEA 2XAHA 1O3RA 3WG9A 2AS5F 1TNSA 2GWRA 5DUIA 1QPMA 5LRRA 1Z05A 1S7OA 2IW5A 2H27A 3WE3A 5HDGA 5HS9A 3OV8A 1R00A 3RDIA 3G73A 4GYGA 1R1TA 3QU6A 1BI2A 3DKWA 4EMSA 1FYMA 1MJBA 5AIPA 5L3CA 2G9WA 2VC1A 4UVBA 3TKYA 3KP7A 4RB3C 1HW1A 3V8JA 4Q48A 1S8NA 4LB6B 2P6SA 3FX3A 3GEZA 2X4HA 1YLFA 3BDDA 2CO5A 5HLGA 1HKQA 3KFWX 4OU0A 3CDHA 5FLXZ 3E5UA 4BAYA 1RZ4A 1R23A 5E20A 2KIFA 5FB2A 3V8LA 1W5TA 2YSRA 3F23A 3COAC 1E2XA 2HGCA 1KQ0A 5BPIA 5JHUA 3RIRA 1QZYA 4H0EA 2MLKA 5HDKA 3HIFA 1XSXA 2P5VA 1Z9CA 4AVPA 1USTA 2A68F 2ESHA 2EA4A 4EM1A 2PFBA 4P55A 1W7PD 1FP1D 1P4XA 4M73A 3GW2A 3MWMA 3E6BA 3FXRA 4RGUA 1ZAOA 3BROA 4KIBA 3V7RA 2ACJA 2VXZA 2VBXA 2W85A 4ESFA 3LSTA 1K79A 3CUQB 1HW2A 2B0LA 3I0TA 2EFQA 1J5YA 4HLXA 2L4MA 2ZCWA 4GYIA 4EGYA 3DFGA 3MEXA 2VODA 3IKTA 4GO1A 2LF8A 3WTVC 3GFLA 1ZARA 5FO5A 4IRIA 4RS8A 1W5SA 2VC0A 3H92A 5JFRA 3QPTA 2HDCA 2IPQX 4HAMA 4NQWA 3R6SA 1ZRCA 2FA5A 2F5DA 3TO7A 5E1ZB 3HRSA 2ZXJA 2V1UA 3QP5A 1XN7A 3GFJA 4LJZF 2PLYA 3HRMA 3R4KA 4I02A 1KU3A 4RB2C 3E3VA 5HS7A 4XRFA 1H9GA 3HSEA 4DQ2A 5K1YA 6PAXA 3F6VA 4NB5A 1SD7A 2IT0A 4L9JA 5E8IA 2COMA 1PP8F 4XSZF 2JTVA 4EJTA 4CICA 1R22A 1XD7A 4MNUA 4PGGA 5BMZA 2Z99A 1TW3A 5K5OA 2QBYB 3HHHA 2KRFA 4RGSA 4AIHA 4KIFA 3QP6A 4IHSA 1LQ1A 2A61A 3K1PA 3DPTA 3E6MA 3FM3A 1PDNC 1LVAA 4M72A 5FD5A 1IRGA 2PG4A 2GAUA 4I01A 2RN7A 3DF8A 4P5OA 1HKSA 3P9IA 5ILSA 4BH9A 2FE3A 3MAJA 4CZZA 3KCCA 1G4DA 2CSOA 4U7BA 2KJCA 2V1XA 1E17A 1FP2A 4RGXA 1RNLA 4ENMA 4KFCA 3L9FA 1U5TA 1O57A 3ZMDA 1CF7A 5ERIA 4EJVA 5JR3A 4HV6A 2TDXA 2A3SA 1H0MA 3ZP5A 2HTJA 1S7AA 4RAZA 4B8XA 1ZYRF 2A69F 1RUNA 2RKHA 3ABUA 1BOAA 4YG2F 1T6SA 4G8XA 3BY6A 1BJAA 5HLHA 4G6QA 1UHMA 2EWNA 4U0WA 4FX4A 1Y0UA 2STWA 2ADUA 4S05A 2FBKA 4ZZDA 1IAWA 5BOXA 4HW0A 1G3YA 1QGPA 4IHTA 4ZYGA 5E1WA 2O3FA 3CO7C 3LA3A 1LDKB 3O3KA 2FU4A 4NHJA 2KKOA 4CO8A 1ZGAA 3FMSA 5LGNA 5CLSA 2OAZA 5TRDA 4A6DA 3SZTA 1J9IA 3K1NA 2DPDA 4KUMA 1ZRDA 3VFZA 2PBIA 3ABTA 1WKMA 4Y15A 4P96A 4ZZLA 5D5VB 2XIGA 5ILVA 1W7PB 4OMZA 2HYGD 4I0BA 4ON0A 3B02A 1IN6A 4R8HA 3U2RA 2E1CA 2WTEA 1R1VA 4HDVA 5DV5A 4HYEA 3GLXA 2FBHA 3E97A</