1YFHA

Wt human o6-alkylguanine-dna alkyltransferase bound to dna containing an alkylated cytosine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
175
structure length
165
Chain Sequence
CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*TP*GP*GP*AP*TP*GP*(XCY)P*GP*TP*GP*TP*AP*GP*GP*T)-3'
publication title The structure of the human AGT protein bound to DNA and its implications for damage detection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 41
structure length 165
sequence length 175
chains with identical sequence B, C
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1yfhA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1yfhA01
2HTJA 4OIOF 5JHUA 2YU3A 2OZUA 1R5HA 3NRVA 2FU4A 4A0ZA 1DUXC 2VBZA 5E17F 3MQ0A 3TO6A 2XVCA 4A12A 4XLPF 1S7AA 4BH9A 5L3FA 5K5RA 3KLNA 4BHCA 2QZ8A 2VOPA 2GXBA 2A68F 1S3JA 5LEKA 3QU6A 1RUOA 2DAOA 2MD5A 3WTUC 4EM2A 1ZG3A 4KNYA 3D5LA 2OBPA 4G7ZF 2F2EA 3U9GA 2E7XA 4XSZF 3CO6C 2ZKZA 1NHAA 4BXUA 3REOA 4ENJA 1O3TA 2O61A 1FC3A 2O03A 2IT0A 4G7OF 3BPXA 2QWWA 3DQVC 1LDDA 2NNYA 2F5CA 4IRHA 2EJRA 1F5TA 3GFJA 4RGSA 1AOYA 2QM3A 2STWA 2OZ6A 1ZGJA 1KQ0A 3OV8A 5F6FA 4LJZF 4K2EA 2IJLA 4HA8A 4XSXF 2V1XA 1BJAA 1SMYF 3VODA 5K5QA 2LSOA 2O8XA 5CVRA 3IKVA 4OMYA 5HVQC 1BC8C 4OIRF 3C3WA 4PZJA 1RZ4A 2O3FA 3O2PE 4IPAA 4Y17A 1HW5A 1Z1DA 3BJOA 2A6HF 2M45A 3GW2A 3F3XA 3RKYA 1W5TA 1LEAA 1TTYA 2XASA 1FP1D 5JVTA 3IWZA 4HZFA 4U0YA 5E20A 3KP3A 5LGUA 3JTHA 4CICA 3GEZA 4HW0A 3ZMTA 3F22A 1XGOA 3VEPA 2PMHA 2J5PA 4LMYA 2K27A 3FXRA 3MCZA 3VFZA 1Z05A 3WODF 5J8CA 2W25A 3KE2A 4P9FA 3P9IA 1SAXA 1ZLKA 2FXAA 2ISZA 1R58A 3BP8A 1Y0UA 1ON1A 3ULQB 1G3SA 2K4JA 2HKXA 3W6JB 2P4WA 5HS7A 5FFZA 3KP5A 2GAUA 1WQ2A 4M9XA 5ERIA 2GA2A 4EVIA 4O3MA 4HDUA 2H27A 4EGZA 4L5IA 3I5UA 1ZHFA 3G3ZA 1D8KA 2MH9A 1T6SA 2DO7A 4O6JA 1ZYRF 1R22A 2CG4A 2H6CA 2P6SA 3K9TA 4YIIA 3ECHA 3CO7C 1ULYA 2ZBKA 2CGPA 2H6BA 5E1WA 2FBHA 4FT8A 1J59A 5DUIA 4I0BA 3SZPA 2JPBA 4I2OA 4LFUA 4ETSA 2FQ3A 2QBYB 1IW7F 4EJOA 4P96A 1G3WA 3DP7A 2QQBA 4WX9A 1UHMA 4U0VA 4WF2A 1K6OA 2EV6A 1FP2A 1SMTA 2ETHA 2HS5A 3SZTA 1YLFA 2DK5A 2X0LA 2RNJA 5ILVA 2FSWA 3E3VA 4MHGA 1P4XA 3MWMA 1SFXA 5H6RA 2BYVE 3F8NA 4LB6B 2MBFA 5D6EA 4I01A 3LFKA 2XHKA 1E2XA 4EJUA 3E6MA 2YPRA 4UV8A 5LRSA 5FD6A 3I0TA 5CVIA 2ZFWA 2H94A 3MAJA 2QVOA 2OU2A 1ZREA 1Z9CA 4L18B 1XSDA 3RKXA 1YIOA 2W57A 4ZYHA 3AAFA 3CUQA 1MDMB 3J80K 3GUDA 4CDGA 1R00A 4O5VA 1R36A 5FO5A 1J9IA 2ZMEA 4HQMA 3E6BA 4DNCA 3V8KA 5LGTA 3Q5FA 3M8EA 2IVMA 2ZNYA 4UNOA 4HF0A 3VOEA 3IRRA 1H9TA 1R1VA 4U0WA 2LF8A 1MGTA 1S7OA 2YX4A 3LSTA 3VB2A 1FT9A 2R7DA 2HOEA 4KYWA 3BOQA 3TQNA 5HDNA 1TNTA 1O7LA 3WGHA 2IW5A 1OYWA 3RYPA 2Z9OA 4ESBA 4YG2F 1SFEA 4UUVA 2G7HA 3H3ZA 4ENKA 3V7SA 4LG0B 4PGGA 4RAZA 2PEXA 2GQQA 3JSPA 5IT9K 5FLXK 2RN7A 3HIFA 1IN5A 1EV7A 3ZMSA 1QZZA 1PP7U 3F72A 3FM3A 1IF1A 3IHUA 1SFUA 5DD8A 3ZN1A 4KFCA 4CHUA 3LAPA 1FOKA 2EB7A 4MTEA 2DQLA 2P5KA 3GYHX 3R4KA 2G7UA 2JSCA 2KKOA 4MQVA 3SQNA 1DDNA 3JAMK 3EETA 2FA5A 4UXNA 4L0ZB 3WTTC 3BJ6A 1HKQA 5HLHA 2OA4A 3E5UA 4MQ9F 1ZRCA 4CGZA 5TRDA 1U5TB 5CVVA 4Y13A 2MLGA 3DXJF 4IHTA 2M1BA 1QGPA 4KMFA 2PBIA 2KJBA 5ICGA 2F5FA 1RNLA 3DV8A 2V79A 4GYGA 1K78A 1RUNA 1J5YA 1R1UA 5ED4A 1TQMA 1I1SA 4MGRA 4A6EA 2FOKA 5DCFA 2O6GE 1S29A 3EQLF 3JW4A 3CUOA 4HF1A 3DFGA 5DEQA 2LDUA 1SD4A 4KN7X 4ASNA 5BS6A 4OMZA 4I09A 2HYFA 3RJPA 3WTWC 4EQQA 2CSOA 4ZYDA 2ELHA 3DEUA 2FF4A 2UWMA 4A0YA 1XMAA 5LHIA 1YS7A 3WGGA 2JTVA 4ZZDA 4HDVA 1LJ9A 5DCMA 3HTUA 3FZVA 4YFKF 1EH7A 1ZGAA 1KU9A 4IRGA 2P8TA 1S8NA 3BJAA 2HR3A 3OOPA 4GXOA 4MEXF 3TKYA 2EV5A 2ZCWA 5K5OA 4RAYA 5FB2A 2GWRA 2HGCA 1MJBA 2HQNA 1BI3A 1UHWA 2LF7A 1Z6TA 2A3SA 4KIFA 1KU2A 2QLZA 3ERED 1W7PB 2IP2A 4ESFA 4KMUX 5A2QZ 2KIMA 5LBQA 2FNPA 1F9NA 3R0JA 3V7CA 5JFRA 4LD5A 4QLCU 1PP8F 1XCVA 3Q9SA 1GXQA 1YQAA 4B09A 3ECOA 1QZYA 2CQKA 3TOAA 3BWGA 1T39A 2P7VB 2CO5A 3M1EA 1F1ZA 4ZYGA 1QBJA 3F6VA 1S6LA 1ZRDA 2Q2EA 2WWYA 3E5XA 1TW3A 2HYGD 1X3UA 1I1GA 3LWFA 3H92A 5DD4A 1L3LA 2LNBA 4F7ZA 1SD5A 4EV0A 3CDHA 3QP6A 1BOAA 2EFWA 1XGMA 4LGWA 3GO5A 3H3UA 1L0OC 3HUGA 4AD9A 3S2WA 2XV4S 2HDCA 2NS0A 3HRUA 2E7WA 1O3SA 4CO8A 4I02A 5KK1A 1XB4A 1KU7A 1QQIA 3T8RA 3CLOA 5DYMA 4OU0A 3JSOA 5D6FA 4HF2A 3IL2A 3KLOA 2AXLA 4M73A 5F64A 4YFXF 4HX7A 3IRQA 3PQJA 1R7JA 4M9SA 1QO0D 4M71A 1H0MA 3HSFA 1IUYA 2QUFA 4BQAA 5L3BA 4JBAA 4WXHA 3L9FA 3M9AA 4HBLA 1T38A 4KT5C 3WTSC 1HKTA 3WE3A 3KETA 3J81Z 2P5VA 4WXCA 1WSUA 1IXRC 2YX7A 1XCBA 4A5NA 3SFZA 1P4WA 2VN2A 1UCRA 2COMA 4L9JA 6PAXA 4CZZA 4M9ZA 1FSEA 1JHHA 1MZBA 1IRGA 1RI7A 2DPUA 3TO9A 2D1HA 5HS8A 3P9KA 1JHFA 3HYIA 2FMLA 4G9YA 3KEQA 4IHSA 3IWFA 3TO7A 1YW8A 1IN4A 1IXSB 4WCGA 2BV6A 2RDPA 4IF4A 2UXNA 1HSTA 3HRTA 4LB5A 1UB9A 4LLNA 3ML6A 2PJPA 4HX4A 1B4AA 2DTRA 4RB2C 1E17A 3EDPA 4PDKA 4DQ2A 2MH2A 2R3SA 4EJWA 2XIGA 2D45A 3BROA 2JZYA 1TBXA 4RGUA 1V4RA 1W7PD 3CUQC 1O3QA 2DPDA 4MNUA 2ISYA 4G94A 3QPTA 1BC7C 2ESNA 4S05A 3WG9A 4L0YB 2DW4A 2D2WA 2Y75A 1RIOH 4P9UA 2DK8A 4CYDA 2RGVA 3E5QA 4R8HA 3ABTA 1BIAA 1LDJA 5E8GA 1KQ8A 4M6YA 3I59B 3C7JA 1IN8A 2BGCA 4JK1X 4OIQF 3KZYA 2XUBA 3LA7A 2UZKA 2L54A 3GXOA 4U7DA 3FM5A 1YFHA 4AVPA 3N97A 1BI2A 3LA2A 2BE5F 2JRTA 1B1BA 2GIVA 1O3RA 3RPQA 4G8XA 5E1ZB 1MD0A 1YYVA 1UFMA 3FHZA 1GHCA 1LQ1A 4L9NA 5A2QK 3IC7A 5IT3A 1OPCA 2F5DA 5JI6A 5DV5A 1LEBA 1Q1HA 3BY6A 4R1HA 4A0XA 2HTSA 1I5ZA 2L02A 3QPHA 2CFXA 4UVBA 3BDDA 4UVCA 2K02A 3K1MA 5TJJA 2PLYA 4WWCA 3RIRA 1XDSA 1JXSA 3HOTA 1IN6A 2ZNZA 5E18F 4B8XA 3KP6A 4KICA 5BPIA 3F21A 2HQRA 3HTSB 1FSHA 2ZJ2A 5D8KB 1FNNA 2XKOA 1SD6A 5L3EA 3K1PA 4I7HA 2K7LA 3R0AA 3DKWA 2Q8KA 1HW1A 2CW0F 2JPCA 3L2CA 4P55A 3NQOA 2QYOA 4HLXA 1FZPB 3P7NA 1WKMA 1LDKB 2RQPA 1STZA 2W84A 4NQWA 2KJCA 3EYYA 2XAJA 3GFMA 3T5XA 2FBIA 3ISPA 1OYYA 1OYIA 1R23A 2VT3A 5FD5A 4ZYEA 1TW2A 3ZQ7A 4A5MA 1BI0A 2PI0A 1MJ9A 5CYVA 5LLQA 2ESHA 3PFIA 1USSA 2OQGA 4HV5A 2VBWA 1EH8A 1FBQA 3M7GA 2M5WA 3TOBA 2DI3A 1HXDA 3QOPA 1OR7A 3RTRA 4YIFA 4P5OA 1U3EM 1J75A 3F8MA 1CF7B 3J81K 1F4KA 2VONA 4PCQA 5HOOA 1JGSA 1TQPA 2MA3A 5J8FA 2P6TA 2UXXA 1TQIA 5EEGA 5AIQA 2W24A 4ENMA 4EM1A 2WV0A 4MEYF 5JR3A 2YSRA 3COAC 4HLYA 3WGIA 1ZN2A 3TDUC 4IXAA 3PQKA 4G6DA 4N9HA 3I4PA 1CGPA 3KP2A 3HHGA 2FNAA 2OD5A 1G3TA 1WI9A 2M8EA 1GXPA 3E97A 1QPMA 3O3KA 1ZLJA 1YW7A 3E6CC 1IRFA 1IXCA 5H20A 1XD7A 3GF2A 1ZAOA 1DP7P 3GZ6A 1VTNC 3HOSA 5D5WB 4I98B 2DFIA 4GYIA 3WU0A 1DPRA 3R60A 3FXQA 3ZP5A 3KFWX 4IJAA 2XAGA 1EH6A 2QBYA 1G6NA 5E8IA 2RVCA 5HS9A 1FYKA 2L3DA 1BI1A 2XAHA 1XMKA 3F8BA 2M30A 4RGRA 3L09A 4XBFA 1W4MA 4RS8A 1BIBA 4KUMA 3I54A 3LA3A 2HFHA 3E6DA 2KIUA 1OKRA 4ZZLA 1U78A 3ZMVA 2DQRA 4HOBA 4AIHA 2EFOA 2ACJA 1G3YA 2RC4A 1PDNC 1R5GA 4KIBA 2DT5A 1XN7A 2JT1A 1AWCA 3I58A 2EFNA 4WK8F 5ILSA 2PG4A 4L9TA 2Q0OA 3ROUA 4Q47A 3WE2A 4HV6A 1REPC 1I6XA 2KIFA 2O0YA 2B0LA 1B59A 3WU1B 4Y15A 3B02A 3LQRA 5CJ9A 2XRNA 4NB5A 5D4RA 2ZMEB 4RB3C 1Z91A 3CTAA 3J80Z 3V4GA 1D8JA 1YG2A 3D0SA 1FYLA 1ONVA 1MDMA 2EV0A 2IA1A 1XSVA 3W6KB 2VOOA 3V7RA 2XGXA 4Q4ZF 4HYEA 4IVNA 4IRIA 1BN5A 3LQQA 5D5VB 4FX0A 4E70A 3JTGA 5DUKA 4FHTA 1T0FA 5CVJA 2F5EA 3L00A 3P9CA 2FEZA 3SXYA 4KA4A 4ON0A 1FPQA 2Z5UA 3SHFA 3RKWA 3FMQA 3C1DA 4LLLA 4A6DA 5HLGA 2AS5F 4N9IA 2IA2A 2GZWA 4KN4X 3GZ5A 2FMYA 3FF5A 4NHJA 1TLHB 2HEOA 3MZYA 1HW2A 2Z99A 2GXGA 4R79A 3N4MA 2OAZA 1A04A 4U88A 1V3FA 5IT9Z 5FLXZ 3I53A 1U5TC 4LG0A 2VBYA 3ZMUA 5D5XB 1U8RA 4QWQA 4UV9A 3F8CA 5D8LB 1LB2A 5HDKA 2MLKA 3TGNA 2EA2A 2V6CA 2Y0MA 4N0BA 2WC2A 1KU3A 2VBXA 4RB0A 3FXUA 4Q5SF 4OOIA 2HZTA 4UHTA 2EFQA 4GGGA 2G9WA 1ODDA 2W85A 5HDGA 1C0WA 3ZMDA 1BBYA 1YW9A 3T0YA 4EM0B 2KRFA 1B9NA 2BBYA 3ZPLA 2L4MA 2PFBA 3JAMZ 3GVAA 1P6RA 2YR2A 3R61A 1FBSA 2EWNA 2VODA 1XGSA 4RB1A 3FMSA 1D3YA 1CF7A 3GFIA 3FX3A 3KP4A 4PGHA 1K78B 3M8FA 1U5TA 3RYRA 4U7BA 2EFPA 2V1UA 2A07F 4KIGA 1FWZA 3WTXC 3T1BA 1T2KA 2FRHA 4D0PA 1ZG1A 3RI4A 1ZH5A 4AIJA 2P5LC 2VE8A 4M74A 4L9VA 1IZ1A 5ILUA 3DPLC 5LEJA 3K0LA 5DCMB 3F8FA 3ELKA 4AIKA 1XSXA 1P92A 5L3CA 3DPTA 2EK5A 1SD7A 5ICCA 3ZMZA 1ON2A 5E1XA 3L7WA 2VT2A 2NNNA 1B9MA 3QP5A 5BMZA 1QNTA 3Q9VA 1PUEE 1Z7UA 4Q48A 3V8LA 4AWXB 1J2XA 2RV8A 2L4AA 5FFXA 4WXDA 5DDGA 1B6AA 5D4SA 3HSRA 5AIPA 4OIPF 1YTYA 3QU3A 4ESJA 4XRFA 1U2WA 3WTYC 3U2RA 3ABUA 1I27A 3HRSA 2QENA 4HQEA 5CLSA 2E1NA 1DPUA 4A2UA 2V9VA 1TNSA 2FE3A 3FWEA 4HAMA 2DU9A 2TDXA 4S04A 4FX4A 4MTDA 1IN7A 1MJAA 2NRAC 1YS6A 2L01A 2HKOA 4G6QA 3KCCA 4EJTA 3GFLA 2VE9A 3RPUA 1W7PA 2OQRA 1JE8A 1FYMA 2DLLA 3GWZA 1FY7A 5KVRA 2QQAA 4XLNF 3ZN0A 5LHHA 1LNWA 1KYWA 3GX4X 1HQCA 1O7FA 2IRFG 2C6YA 4ENNA 5BPDA 2VC0A 2IA0A 2PQ8A 5ICEA 3MZHA 3R6SA 4KDPA 1U6GA 2ADUA 1FX7A 4LK0F 1XDUA 2A69F 1ZRFA 3DF8A 4RGXA 3KZZA 3IKTA 3TDZC 4BHBA 3B73A 3C18A 5D5UB 4LK1F 3I64A 5BOXA 2P7CB 4UVAA 3K69A 5H6QA 4CXFA 3J7AO 2VC1A 1USTA 4I0AA 2XROA 2IPQX 1K79A 3MEXA 1KA8A 4EGYA 2K86A 1R1TA 1J7KA 3GLXA 5CVUA 5K1YA 2PN6A 3MFKA 4EMSA 4JQFA 2DBBA 3V8JA 2M87A 2LKPA 2MC3A 2R7FA 1P2FA 2RKHA 1HSJA 1D5VA 3QRFF 4GO1A 2A6EF 4L5JA 1W5SA 4ZH4F 4YFNF 3KEOA 1P4AA 1WWXA 4Z2YA 4M6XA 2A5YB 2NAZA 3QAHA 2K4BA 2EA4A 2VXZA 1XGNA 3O6BB 4TV7A 5FGMA 3T8TA 3G73A 2Y48A 1H9GA 3HHHA 1MKMA 1LVAA 2PMUA 1T98A 5F1RA 2QQ9A 5LGNA 3EUHA 3CJNA 4EJVA 5AONA 2Z33A 2WTEA 1G4DA 2CWEA 1K7AA 4H0EA 1KQ9A 2D1VA 3HRMA 1J0RA 2FBKA 5ICFA 2V1DA 1FBUA 4BYYA 1ZARA 5L3DA 1FLIA 2E1CA 1GVJA 3F23A 1O57A 3FMRA 2HWVA 1Z6RA 1WRJA 3LAJA 2XKPA 2XAFA 1KYZA 2H09A 3I71A 4OINF 4BAYA 2A61A 3RDIA 5LRRA 5EEHA 2STTA 3EYIA 2XAQA 3HSEA 1OMIA 5BQTA 1ZG5A 2ZO4A 2Z3YA 3KP7A 3K1NA 4BNCA 4M72A 3BZ6A 1YO5C 3U1DA 5L3GA 3WTVC 4GCVA 2ZXJA 2BEOA 5HLIA 5J6XA 2X4HA 3K2ZA 3F6OA 3WTZA 2CYYA 1HBXG 5LHGA 2J5OA 4BHPA 1HKSA 4G7HF 1BM9A 4LLGF 4HX8A 1KGSA 2GA1A 2NYXA 3NEUA 3CUQB 3BPVA 3I59A 1IAWA
chains in the Genus database with same CATH superfamily
2HTJA 2NUGA 4OIOF 4F9BB 5JHUA 2YU3A 2HQAA 2OZUA 5IT9C 2L3JA 1R5HA 1MBFA 3NRVA 5FLXC 2FU4A 2CJJA 2KHXA 4B4CA 2K3PA 4A0ZA 1DUXC 2VBZA 5E17F 2KOUA 3MQ0A 3TO6A 2E1MB 2XVCA 4A12A 4XLPF 1Y1VJ 2BW3A 1TC3C 1N3GA 1S7AA 2EOQA 2LG4A 4BH9A 3QYBA 5L3FA 5K5RA 1IV8A 5IPAA 2CPNA 3KLNA 3K4CA 4BHCA 2QZ8A 1A1GA 4XQFA 2VOPA 3EUAA 2GXBA 1A36A 2A68F 1S3JA 5LEKA 3MZ8A 3PFYA 4WPYA 3QU6A 2EOJA 1N75A 1FOWA 1RUOA 2H1LA 1Z3YA 2DAOA 4HPQA 2ELYA 1RC7A 4DV6E 2IS6A 2LMDA 2MD5A 2M4KA 3WTUC 2F5VA 1ZG3A 4QPQA 1DQUA 4EM2A 1XS9A 4KNYA 3D5LA 5KNLA 2JJ7A 2LRSA 2OBPA 4G7ZF 2F2EA 3U9GA 1YX3A 3JRDA 3HG9A 5LMUE 2E7XA 2JMWA 3BC8A 2R0QC 4BKXA 4XSZF 3CO6C 2ZKZA 1OCCH 1NHAA 2B7VA 4BXUA 3REOA 3JTZA 4AIDA 4ENJA 3TP3A 1O3TA 2O61A 1FC3A 2O03A 2IT0A 4G7OF 4D7MA 3C4BA 3CF2A 3JAMC 1YUJA 2EMWA 3LOCA 2OTJI 3BPXA 3H09A 4JI3E 2QWWA 2Y0SA 2UXBE 1JJ6C 3DQVC 2EL4A 2LYCA 1LDDA 3JCUC 5K7HA 3WHCA 2NNYA 2DMUA 2CRGA 3LMLA 2F5CA 4IRHA 2EJRA 1F5TA 4IHXA 1MBGA 3GFJA 2LVSA 2DMQA 3OYFA 1K6YA 3DTEA 4RGSA 1AOYA 2HJJA 3G71I 2QM3A 2VJJA 2OZ6A 1ZGJA 3PIPF 2STWA 1KQ0A 1FIAA 3OV8A 3L2WA 3WG7H 5M5XJ 3OR2C 5F6FA 4LJZF 2RQQA 4K2EA 2IJLA 4HA8A 2MDGA 2NVUB 4XSXF 2LK2A 4NXME 2V1XA 2X1CA 1BJAA 1SMYF 1TWCJ 4NQWB 2V26A 3QYFA 3VODA 4F3QA 1X1AA 3IH3A 5K5QA 1VQMI 2HXIA 2LSOA 2O8XA 1QHHD 5CVRA 3IKVA 2E2HJ 4OMYA 4DV7E 5HVQC 1BC8C 4OIRF 3C3WA 3ZQIA 3IH4A 4PZJA 4P7DA 4LG3A 1RZ4A 2O3FA 3O2PE 3DKXA 4IPAA 3PSFA 1IRZA 3ZOQB 5K7ZA 3AL0B 3BG7A 1HF0A 4Y17A 1HW5A 2JR1A 2P0WA 2LC2A 1Z1DA 2L9RA 4LU9A 3BJOA 1A6QA 2A6HF 2M45A 3GW2A 3F3XA 3NWTA 1VQ6I 2R4GA 1OQYA 3RKYA 2DRPA 4DR2E 1W5TA 4M30A 1LEAA 1QVUA 1TTYA 4MLOA 2XASA 2EM5A 1FP1D 5JVTA 3KYLA 3IWZA 4HZFA 3GBGA 4U0YA 2EIJH 5HLTA 5E20A 3KP3A 5LGUA 2DMPA 3TBIA 4IO9F 3JTHA 1X3WB 4CICA 3GEZA 4HW0A 4P1WA 2DTZA 2IGMA 3ZMTA 2QA4I 1NG6A 4BC7A 3F22A 1XGOA 3VEPA 2PMHA 2J5PA 2DA7A 4LMYA 2VQCA 2E2IJ 5E3MA 2K27A 1PDAA 2PRTA 1JGGA 2D9HA 2OF7A 3FXRA 3MCZA 1IQSA 5E3LA 3VFZA 4ZYAA 3LLHA 1SAUA 1Z05A 3WODF 1HNWE 5J8CA 1LFPA 4RHBB 2W25A 4S0HB 3KE2A 4BXXJ 2Y30A 3A0BC 4LF4E 4P9FA 1P7IA 1G2HA 3P9IA 3W2VA 4A3GJ 1SAXA 2JA2A 2FXAA 4C3JJ 1ZLKA 4RM3A 2ISZA 1R58A 2DDBA 4IOAF 3BP8A 1Y0UA 3G1OA 1ON1A 1JTYA 3ULQB 1G3SA 4NUBA 2JPAA 1IQOA 3HOWJ 2K4JA 2HKXA 1GDTA 1SVLA 1ZAAC 3W6JB 2P4WA 5HS7A 5FFZA 1IDZA 1WH5A 2FQ4A 3DTIA 3KP5A 1U9OA 4LF5E 2GAUA 1WQ2A 2K9SA 4M9XA 5ERIA 5GAHJ 1W5CC 2GA2A 3JREA 4CUGA 4EVIA 1F2IG 5IYBJ 4O3MA 4HDUA 4DV2E 4B3RE 2H27A 3W2WA 3KEYA 2LUPB 2E1OA 4EGZA 5F3WA 2PJRA 2MSYA 3I5UA 4L5IA 4R8OA 1ZHFA 3G3ZA 5E3OA 3RCOA 5M3FJ 1D8KA 4I76A 2MH9A 1MMAA 1T6SA 2DO7A 3U1KA 4O6JA 1ZYRF 2Q8UA 2LP0A 4M2ZA 1R22A 2CG4A 2H6CA 2Y0SN 2BXZA 1X2MA 2O5RA 2P6SA 3K9TA 3LSMA 2DFFA 4YIIA 4AYBA 3ECHA 4JI4E 3CO7C 1SVOA 5AC4A 1BJZA 1ULYA 1QU6A 2FJ1A 3CLQA 2ZBKA 2CGPA 3W3CA 4A3KJ 2VI6A 3A02A 2H6BA 2LY9A 5E1WA 3PNVA 4KISA 2FBHA 1YI2I 4FT8A 2H8RA 1J59A 2H8WA 2OCCH 1D1BA 3BTCA 3E0JB 3H9JA 3HGGA 2ICWG 5DUIA 2QSGX 1YX5A 1OCRH 3I3LA 4I0BA 2X6WA 3SZPA 1BBOA 2JPBA 4I2OA 4LFUA 4ETSA 2FQ3A 4Q28A 1GUUA 3TQMA 2K3FA 4JX6A 3G1MA 2QBYB 1IW7F 2EZ6A 2W1OA 3H9GA 4EJOA 1NCSA 4P96A 1RMDA 1G3WA 3DP7A 2QQBA 2IS2A 3T1HE 2AQEA 3S93A 3BQZA 4WX9A 3LNQA 3VYYA 1UHMA 3E1SA 4U0VA 2QF7A 1W1WE 4WF2A 1K6OA 2EZIA 4F92B 2EV6A 1FP2A 1SMTA 2EP3A 2GPIA 2ETHA 1WHUA 3L2RA 2HVQA 2HS5A 3Q0VA 2EWLA 3SZTA 4PJJA 4A3IJ 5AE1A 3DTKA 4DBRA 1Y39A 1PKPA 2XF5A 1YLFA 1GV5A 2DK5A 3AFHA 1N77A 2X0LA 3HXLA 3LSHA 1UBDC 2MKNA 2RNJA 5ILVA 2FSWA 3E3VA 4MHGA 5LFAA 1TT0A 1ACIA 2VL8A 2F4OB 2L2MA 1P4XA 3MWMA 2FTXB 1SFXA 2CW8A 4DR1E 2E2JJ 5H6RA 2BYVE 3F8NA 3OS1A 1R71A 3H5NA 2MBFA 4LB6B 1Z67A 2W48A 4BXFA 2KHMA 4ITVA 3S2DJ 3OYMA 2YU8A 3HPHA 5D6EA 4I01A 3OYHA 3RZOJ 1ZU1A 2EMZA 1T8IA 1A1FA 3LFKA 2XHKA 1E2XA 2A5WA 4BEHB 2LKSA 4EJUA 2FD5A 3E6MA 4IHYA 4DV5E 3CZ6A 2YPRA 4A3DJ 3QYEA 4UV8A 4XN3A 5LRSA 4W1UA 2M3AA 3I0TA 5CVIA 5FD6A 1S5LC 2IEKA 2ZFWA 2H94A 3MAJA 5EF6A 4BE2A 2QVOA 3H5AA 2A25A 3FKJA 3GZNB 4DUYE 3CCSI 4DR4E 2OU2A 3BG3A 1JJ8C 4ZC3A 1YPNA 1ZREA 3S32A 1Z9CA 4L18B 4UUSA 3BR2A 1XSDA 1W36D 2B63J 1LPQA 1E0EA 3RKXA 2L92A 1OFCX 1YIOA 2W57A 2HC5A 4ZYHA 2DN0A 2L6MA 3AAFA 3AG1H 4FETA 3CUQA 3HKZN 3HGYA 1MDMB 3J80K 4CCLA 3GUDA 4YIRX 5EZHA 2L5QA 4CDGA 2MFZA 3M07A 1X1DA 1R00A 2Q2EB 4O5VA 1R36A 2YUSA 3BCBA 3A03A 3OSGA 5FO5A 2VKDA 1J9IA 4YEJA 1JKQC 2E1MA 2EQRA 2ZMEA 4E7ZA 4KITB 2L7FP 2L9VA 4HQMA 3K7AJ 4ZDOA 1G2DC 3E6BA 4DNCA 1JK1A 1OCPA 1VQ8I 2M9HA 3V8KA 5LGTA 3Q5FA 3M8EA 5A6KA 2IVMA 2UUZA 2ZNYA 3Q0UA 5F04A 4XIDA 4UNOA 1TL8A 1MIJA 4HF0A 2IGOA 5M3MJ 4B3ME 3VOEA 3IRRA 1H9TA 4Y33A 1R1VA 5FRMA 4U0WA 4F91B 2LF8A 4AYBN 4N4NB 2LBFB 1MGTA 4J19A 1S7OA 2P81A 1UILA 2YX4A 3RMPA 4CYCB 4B48A 2JN6A 3LSTA 1DGRM 4W97A 5AASA 3DKYA 2WAFA 3VB2A 2VQFE 3HUGB 1FT9A 2R7DA 2A6TA 2HOEA 5E3NA 3OYIA 4KYWA 3BOQA 3TQNA 5HDNA 3JR9A 1A1IA 1TNTA 3QPSA 2UU9E 1PUFA 1WFXA 1X19A 4MLQA 1O7LA 1ZR9A 4YELA 2MC5A 3WU2C 3WGHA 2VLAA 4PSXA 3HTXA 2IW5A 1OYWA 3RYPA 1SEUA 2Z9OA 4ESBA 4YG2F 2O8KA 3TW6A 1SFEA 3OIPA 3PUBA 4UUVA 1FEXA 2G7HA 1BBGA 3G2BA 3H3ZA 4ENKA 4BCAA 3V7SA 4LG0B 4YHHE 3CC7I 4PGGA 4RAZA 4O43A 1X3CA 2EMCA 2PEXA 4O4KA 2GQQA 1GV2A 3FISA 3JSPA 3EUHC 2F4MB 5KCMA 5IT9K 4B3SE 3ZCOA 5FLXK 3ADJA 2RN7A 2JK3A 1RR7A 4XRMA 3HIFA 1IN5A 2XF7A 1EV7A 2MD0A 1QZZA 3ZMSA 1PP7U 3H36A 3A01B 5F0HA 4BE0A 1E3HA 3F72A 5FKLA 3FM3A 1IF1A 1GQEA 2EPPA 1QU3A 1A1KA 3IHUA 5HNFA 1SFUA 5DD8A 3C6MA 4LITA 3ZN1A 4XRSG 4KFCA 4XL9A 4IS1C 1HCRA 4BACA 3GLLA 4G6TB 4CHUA 3LAPA 1OCZH 1FOKA 2EB7A 2ID3A 1S7EA 2EN7A 2M0MA 5TGTA 2Z1DA 2L0KA 4MTEA 3KIOA 2DQLA 1IMUA 4Y3OA 2B9DA 3B6CA 2P5KA 3GYHX 3R4KA 2VQGA 2G7UA 4BJ5C 2JSCA 2D5VA 2KKOA 3OIQA 2EZLA 2VPRA 4XR6A 1PYVA 4MQVA 3SQNA 1DDNA 2R7VA 2BBGA 3BQYA 2O7OA 2RQLA 2CV2A 3JAMK 3EETA 2FA5A 4UXNA 2R5YB 4L0ZB 4NXNE 4DGWB 3BJ6A 1KONA 3WTTC 1HKQA 5HLHA 4QTRA 1DP3A 4KHPE 2OA4A 3E5UA 4CH7A 4NHRA 4Q35B 1X1BA 1N36E 4V2FA 2EL5A 4MQ9F 4UB8C 1ZRCA 4CGZA 5TRDA 1U5TB 2L7KA 3JRHA 2RS7A 5CVVA 4Y13A 1HDPA 2VJ5A 5EYRA 2MLGA 3DXJF 4IHTA 2M9AA 3H0DA 3HQ1A 3L2UA 2X1EA 2HOTA 2M1BA 3BR0A 2EPAA 1QGPA 4E7HA 1NH3A 4KMFA 1LE8B 2PBIA 2EJ4A 2KJBA 5ICGA 2F5FA 1RNLA 1EKZA 1X6HA 1IRXA 1H8AC 4D7NA 2XPVA 3K6GA 1WH7A 3AKZA 3C2HA 3DV8A 2V79A 4GYGA 4JP0A 1K78A 1RUNA 2I10A 2IAIA 2K85A 4DR5E 2KQRA 3VSLA 1MMGA 1Y6IA 5A6BA 3K4LA 5DTDA 2JA7J 2CU7A 1HDDC 4I8OA 4RH8A 1J5YA 4HEA2 1R1UA 5ED4A 1TQMA 1I1SA 2EMKA 4MGRA 4UB6C 3HOUJ 2EM2A 1XMXA 4A6EA 2FOKA 5DCFA 2IGKA 2ELZA 2O6GE 2LT7A 1VQ9I 2EOSA 2DMTA 4OOGC 2BVLA 2YSOA 4AQYE 1S29A 3EQLF 1I3QJ 1ZBTA 3JW4A 5GP9A 1SC7A 3PJRA 2VXDA 3L2QA 3CUOA 3DU6A 3KYDB 4HF1A 3DFGA 5DEQA 2HNHA 2LDUA 3H35A 1SD4A 4KN7X 2Z16A 4ASNA 5BS6A 4OMZA 1FOYA 1IC8A 5M5WJ 5J1YA 4I09A 3L1PA 2DSYA 1RC9A 2HYFA 3E7LA 3RJPA 2CQNA 1NTCA 5FKOA 3WTWC 2YTIA 5EG0A 2YRHA 4EQQA 5IY5H 3I4NJ 2WZOA 4F9AB 3LSKA 4GFBA 2CSOA 4ZYDA 2ELHA 2OV7A 3DEUA 3AUZA 1M1EB 2UUAE 2FF4A 2UWMA 2HPMA 2HZDA 4A0YA 3H0GJ 1XMAA 2IXSA 5LHIA 1YS7A 2LD5A 3WGGA 2JTVA 2EPXA 4ZZDA 1DGCA 4HDVA 1ETQA 1LJ9A 5DCMA 3ZRGA 1BW6A 1X5WA 1GVDA 3HTUA 3SFIA 3FZVA 3EPZA 2EOHA 3CDIA 1EH7A 1ZGAA 4YFKF 4B1RA 1KU9A 5IYCJ 4FCYA 2M0CA 5J4YA 4IRGA 3IUOA 2CT1A 2P8TA 3EPKA 4D9JA 2VQHA 1S8NA 3BJAA 2HR3A 3OOPA 1YSAC 3UKGA 4GXOA 4MEXF 3HB9A 2E35A 4CSWA 3TKYA 4DYRA 2EV5A 3OS0A 2ZCWA 5HNHA 5K5OA 1I39A 2BY0A 4RAYA 4L8NA 1A1HA 3OL4A 5FB2A 2GWRA 2HGCA 1MJBA 2HQNA 3QPLA 3S1NJ 1BI3A 3CCVI 2NS7A 4PFPA 3RSNA 2R7TA 1UHWA 2LF7A 1Z6TA 2A3SA 2EMBA 3CJQB 2L2NA 2OCEA 4KIFA 1KU2A 1P9QC 2QLZA 4GDFA 2V9PA 4OAZA 2I5UA 2YWQA 3ADLA 1X3ZB 1W7PB 2IP2A 4ESFA 3ERED 3DCFA 2W7NA 4KMUX 5A2QZ 5EEAA 2VE7C 2KIMA 5LBQA 2FNPA 4BGDA 1F9NA 1Z3XA 3R0JA 3V7CA 5JFRA 3C4TA 1XNRE 3BTLA 1XMOE 4B3AA 4DR3E 4R2RA 4LD5A 4QLCU 1PP8F 2LO3A 1WCMJ 2DMNA 4XKVA 2WAQA 1TWAJ 3C2BA 3L2VA 5IXMB 1XCVA 2JXPA 3DWLE 3Q9SA 1U0JA 1GXQA 1YQAA 2NXNB 4B09A 3ECOA 1QZYA 4A3JJ 2CQKA 3GTOJ 3TOAA 3BWGA 2L9SA 3BCAA 2LREA 2QEXI 1T39A 4R03A 2EPNA 2P7VB 2CO5A 3M1EA 1TN9A 1F1ZA 4ZYGA 1QBJA 3HBLA 1E3OC 2NABA 3F6VA 2DFHA 3CP2A 5KL3A 1UHSA 4CCMA 4JX4A 1S6LA 4P78A 1OLTA 4IQJA 1B69A 1ZRDA 2Q2EA 2WWYA 3E5XA 2KP6A 4IHWA 1TW3A 5F08A 2HYGD 3GTQJ 1X3UA 2EM4A 1I1GA 3LWFA 4A93J 4DYCA 3H92A 3QQAA 2IHR1 5DD4A 1L3LA 4LFAE 2V8QB 2WBUA 3ZQFA 1O0WA 2NVQJ 2LNBA 4AUXA 4DJAA 1GT0C 1MSEC 2Y31A 3OOUA 5C44J 3UNGC 1B72A 4F7ZA 1SD5A 1VQPI 2RSIA 1IBKE 2JA8J 4C3HJ 1DU0A 1LFUP 4EV0A 1YHQI 4BY1J 2OC6A 3CDHA 2XSJC 4XOPA 2EOXA 3BBGA 4RAFA 4BL0B 3QP6A 3RZDJ 1H88C 1BOAA 1AKHA 4QPOA 4HNTA 2VKVA 2ENHA 1TWGJ 2EFWA 3HEFA 2JWOA 1ZR2A 5CFFE 1XGMA 4LGWA 3GO5A 5EZGA 3H3UA 1YRNA 1L0OC 3HUGA 4AD9A 5JVGF 1B8IA 1D1AA 3S2WA 2XV4S 4M3BA 1UJ8A 1HLVA 2CFOA 2HDCA 2NS0A 2I8DA 3QWLA 5FROA 2ECBA 2E7WA 3HRUA 4XICA 1O3SA 4PJ0C 3DLAA 4CO8A 1SFKA 4I02A 2UUBE 5KK1A 1XB4A 5EJCA 1KU7A 1QQIA 4XORA 3ASOH 3FBIB 4XN0A 3T8RA 2EBIA 2WCC3 3CLOA 1U9NA 1RPWA 3SDBA 5DYMA 2YU5A 3ESWB 2B7TA 3AG4H 4OU0A 2M2EA 2JA6J 3JSOA 5D6FA 2X48A 4HF2A 1WJCA 2VQLA 3IL2A 3KLOA 2AXLA 3JU0A 1QVTA 4M73A 3OL3A 5F64A 4Y7NJ 4YFXF 4HX7A 3OYKA 3FXKA 3IRQA 3H3VK 1R4NB 3PQJA 4DKKA 4DIQA 1JKRC 1R7JA 4M9SA 1PJRA 1QO0D 4M71A 1H0MA 2EIKH 2COBA 3D5RC 3HSFA 3TL4X 2F4VE 1NG7A 1IUYA 3UK3C 2QUFA 1RETA 2EQ1A 2JRMA 2MG4A 4BQAA 4N4OB 2QQ8A 1UZCA 1WZ2A 5L3BA 4JBAA 4WXHA 3L9FA 2YU9J 3K4JA 3M9AA 4HBLA 1D0ZA 1T38A 1Y56A 4XOTA 3K2AA 3K70C 2DA2A 4CA0A 2GBYA 5CKTA 5J1UA 4KT5C 3WTSC 1HKTA 2EOZA 3WE3A 1ORKA 2R76A 3KETA 3J81Z 2P5VA 4WXCA 1WSUA 2DYSH 1YYOA 1IXRC 5TISC 3HDDA 1WJPA 2YX7A 3NAUA 3THNA 3M1CA 1XCBA 4A5NA 3SFZA 4X1EA 1P4WA 2VN2A 1UCRA 1T56A 2COMA 4L9JA 6PAXA 4CZZA 2IS4A 1FTTA 4O24A 4M9ZA 1G8XA 1FSEA 4JI5E 1JHHA 1PJTA 3HKZA 1MZBA 1IRGA 2RAEA 2DMIA 1RI7A 4C3IJ 1RQ0A 2WAQN 1POGA 2DPUA 2K4VA 3TO9A 2R5ZB 5T6JA 3TW7A 2LV2A 3LL7A 2D1HA 2EH3A 3HOXJ 5HS8A 3P9KA 1JHFA 3HYIA 2FMLA 2FX0A 4G9YA 2DJNA 3KEQA 3A2KA 3ECRA 4BMJA 4IHSA 3VYTB 3IWFA 5GTHC 1WVRA 4II3A 3TO7A 1YW8A 5B1BH 4IEJA 1X48A 4DV4E 3SZGA 3RKQA 4LF6E 2VRDA 1IN4A 2L8TA 2RPCA 1IXSB 1F36A 2K9LA 4WCGA 4D5CA 2HDDA 4R2SA 2HGHA 5GPCA 2BV6A 2JA5J 2JUCA 2L9NA 3K4BA 3D5SC 2RDPA 2E60A 3K4KA 2UXNA 4IF4A 1HSTA 3FXLA 2N3GA 2JYAA 3PNYA 3C6KA 1VQLI 2IGNA 4ZDLA 2KPMA 4JYKA 2Y9ZA 3HRTA 3CMEI 4LB5A 3F6HA 2LH9A 1UB9A 4LLNA 2LBSB 3ML6A 1BOBA 4HX4A 3BLYA 2PJPA 1BW5A 1B4AA 2DTRA 2L7MP 1OJLA 4RB2C 1MNEA 1E17A 1WHNA 1T4LB 4CCNA 3EDPA 4PDKA 4DZPA 4IOCF 4R2QA 2DA1A 1JK2A 2YTEA 1LE8A 5KL4A 4DQ2A 2E5ZA 2MH2A 2R3SA 4XK4A 4EJWA 1D5YA 3SEZA 4JI2E 1EJ9A 2XB5A 3FXOA 4LIUA 2XIGA 2D45A 3BROA 2CQQA 2B9SA 2JZYA 1RESA 3DBRB 1TBXA 4CZCA 4RGUA 2CV0A 2VF1A 1V4RA 2YPNA 1V54H 1W7PD 3S17J 2EZHA 2EOIA 4O5GA 1T33A 3CUQC 3VHTB 4XLCA 1O3QA 3I4MJ 3G4SI 5FLMJ 2DJIA 2XPWA 2DPDA 4IX7A 2GOXB 3CCMI 4MNUA 2WBMA 2VB6A 3CCJI 4Y52J 3OYGA 2ELJA 2ISYA 2XDVA 2Y9YA 2E1MC 2ZMEC 4G94A 3QPTA 2WAEA 1WJAA 2F48A 2ESNA 1BC7C 2CH0A 1TF3A 4S05A 3WG9A 4L0YB 2DW4A 2D2WA 2NS8A 2Y75A 5IOYA 1RIOH 1FOXA 2EN8A 2R1FA 2KT0A 4A69C 1I3AA 1X2NA 1NK3P 4P9UA 2AXTC 3FDYA 3J7AY 4CCJA 4V19K 2DK8A 4CYDA 1BR4A 4DW6A 2RGVA 2XB0X 5CQEA 3E5QA 4R8HA 2EM0A 4IL6C 4IJDA 3ABTA 1BIAA 2ADRA 4WSPA 2LVHA 3FK7A 1Z21A 2K9MA 1LDJA 5E8GA 1KQ8A 1MEYC 4M6YA 4KZSA 3I59B 1XMQE 4DZJA 3C7JA 1E3PA 1IN8A 1JKOC 2BGCA 4JK1X 4OIQF 3KZYA 4RLQA 5GAEJ 2XUBA 2JOBA 3LA7A 1ZK8A 2EMGA 9ANTA 3N05A 2UZKA 2L54A 3GXOA 4U7DA 2BXYA 2BW3B 3FM5A 1YFHA 2OTLI 2RTXA 2QKMB 4AVPA 1VNDA 2LLKA 3N97A 5KHDA 2JY9A 1BI2A 3LA2A 4DR6E 2QCOA 2BE5F 2JRTA 2EM9A 2CTDA 1B1BA 2DLQA 4C2UA 2GIVA 2BB8A 2CUEA 1O3RA 3RPQA 4G8XA 5E1ZB 1MD0A 2EN2A 1YYVA 1N78A 2E36A 3BGHA 2DA3A 1UFMA 3FHZA 3S8PA 1GHCA 5DS9A 1LQ1A 3BR6A 4L9NA 5A2QK 3A4CA 4DYQA 3SJMA 2V89A 3IC7A 5IT3A 1OPCA 1EKEA 2F5DA 5JI6A 2MABA 3BR1A 5DV5A 3JRGA 3KX2A 3PNTA 2WA0A 1LEBA 1Q1HA 3BY6A 3FK6A 1WI3A 2HOAA 4R1HA 3EPLA 4A0XA 2HTSA 1I5ZA 2L02A 2CS3A 2CFXA 2BHZA 3BDDA 3LSIA 3QPHA 4UVBA 2K02A 3K1MA 5TJJA 3GTMJ 4GZNC 2DA5A 1F43A 3AL0C 5KL7A 4HNUA 4F2JC 5EDNA 2FOWA 5A6JA 2N3HA 1T95A 3FKIJ 4JI8E 3GTJJ 2PLYA 4NC7A 4M3GA 3S1RJ 5FRNA 4WWCA 3RIRA 2VKHA 2M4GA 5GPAA 2EORA 1XDSA 3M8JA 1JXSA 1QRYA 3PL8A 2EQ3A 4X62E 4LF9E 1TWFJ 2DA6A 3MKWB 3HOTA 4R2DA 3D1NI 1IN6A 2ZNZA 4U87A 4A3BJ 3B6AA 1HOMA 5E18F 4B8XA 3KP6A 4KICA 5BPIA 2EOFA 4B43A 2XPUA 3F21A 1W0TA 4BBYA 1HNXE 3HPSA 3MHHC 2HQRA 4RA2A 3HTSB 2R7QA 3ZR8X 1FSHA 2ZJ2A 1CQTA 5D8KB 3FIGA 2RNGA 3H5RA 4OX9E 1ETOA 3OSFA 2WADA 1FNNA 2NOGA 2XKOA 3LSJA 1SD6A 3S3NA 5L3EA 4NNJA 2XC7A 1FKAE 3K1PA 2WY7Q 2K7LA 3R0AA 3DKWA 4I7HA 2Q8KA 5LD2C 1HW1A 3BZKA 4RBOA 1FMWA 2CW0F 2JPCA 3L2CA 4P55A 4B3XA 3NQOA 2ODRC 2XGDA 3OYBA 1VF9A 2QYOA 3VDXA 2AHQA 4M3DA 4HLXA 1FZPB 2EPUA 1XNQE 3P7NA 2CV1A 1WKMA 2V88A 4B44A 1LDKB 4L5EA 2RQPA 1STZA 2W84A 4GRIA 4NQWA 1WHQA 2H36X 2KJCA 4NBQA 3EYYA 4TUIA 2XAJA 3GFMA 3FBNB 3T5XA 2FBIA 3ISPA 2WB1A 3F6GA 1OYYA 1OYIA 3PO2J 1R23A 4ZTJA 4AC0A 4FASD 3DU5A 2VT3A 4FK5C 5FD5A 1ETXA 3CJRB 2E5NA 2VJ4A 1IG7A 3VPRA 4PK4A 3W6VA 2FUG2 4ZYEA 2HQ5A 1TW2A 3VYRB 3ZQ7A 2I9IA 4A5MA 4JI7E 3EPHA 4TUGA 1BI0A 2W4SA 2PI0A 3RQIA 2EILH 1MJ9A 2GOMA 1N25A 5CYVA 1YOVB 5LLQA 3OYNA 2AO9A 2ESHA 3KWRA 2LY2A 4BBSJ 3PFIA 1USSA 2CMPA 2XAUA 1MNMC 2OQGA 4QSHA 1BB8A 3S15J 4BU2A 4HV5A 1UG2A 2VBWA 4X66E 1A1JA 4CCKA 4BBRJ 4B3TE 2HYJA 3O8GA 1EH8A 1FBQA 2FV4B 3MN2A 3M7GA 2M5WA 3TOBA 2DI3A 3I56I 1HXDA 3QOPA 5JHFA 1OR7A 3BG9A 3RTRA 4YIFA 2EMXA 2WY8Q 4P5OA 4F6MA 1U3EM 1J75A 3F8MA 2EN6A 4RLFA 4L5NC 2Z2SB 4MFDA 2KL4A 1CF7B 2R7WA 5FJ8J 3J81K 3PIOF 1FMVA 1F4KA 3VWBA 3OMLA 1MBEA 2VONA 1QA6A 3GTKJ 4XLAA 4PCQA 1MSFC 1ETVA 3CCYA 3W2AA 1YJ9I 4YY3E 5HOOA 1JGSA 1FIPA 1D0YA 3QOEA 2M1SA 4LFBE 1TQPA 2MA3A 2YTPA 4RMNA 3OY9A 3DLLF 2F4IA 3IP4B 5J8FA 2P6TA 2UXXA 1TQIA 3IWCA 4HNVA 2HI3A 5EEGA 3S1MJ 3WHBA 5AIQA 2W24A 2PJRB 2CUFA 1WXRA 4X0GA 2E5LE 4ENMA 4EM1A 2JQ7A 5IWAE 4E7KA 4Y4RA 1H89C 2WV0A 5J1RA 1EA3A 4MEYF 2EPKX 4K0KE 5JR3A 5M5YJ 2YSRA 5B1AH 3COAC 4XONA 4HLYA 3WGIA 2EZKA 2R7ZJ 1ZN2A 3TDUC 2EMHA 1SANA 4IXAA 3PQKA 2WBTA 1MMSA 4G6DA 4NC8A 1S72I 4N9HA 3I4PA 4LTYA 3S3MA 1O4XA 1CGPA 5A2QC 3KP2A 3IH2A 1XG1A 3HHGA 2F6CA 1WJEA 5C3EJ 2FNAA 2OD5A 1G3TA 1WI9A 1HC8A 1IBLE 3IV5A 2M8EA 1GXPA 2HHHE 1T4OA 1G2FC 3LMMA 2TRTA 3K6QA 3E97A 2EPZA 2V9KA 1Q1VA 1QPMA 4BC9A 3ADIA 3O3KA 1YIJI 1ZLJA 1YW7A 3E6CC 3FXJA 4XRSA 1IRFA 2EIMH 2OUMA 1ZQ3P 1IXCA 2NVYJ 4RDUA 2Y69H 5H20A 1N32E 1X6EA 1XD7A 2Y2ZA 2X9DA 2ELKA 1ZAOA 3G1LA 3GF2A 4E7JA 1DP7P 3RQ4A 3GZ6A 1A35A 3CJTB 2WV1A 3HOSA 1VTNC 5D5WB 4I98B 4X6AJ 2YTNA 3BT9A 3K4MA 2DFIA 4A3FJ 1X47A 3ZOBA 3ZQHA 3MSWA 3KPHA 4GYIA 3WU0A 1DPRA 2LFBA 3C2GA 3FXQA 3R60A 3ZP5A 3KFWX 4HSRA 4IJAA 2ECCA 4D5FA 4C2TA 2X6XA 2EPFA 2XAGA 1EH6A 2QBYA 1G6NA 5E8IA 1IGNA 4R2CA 2RVCA 1WJ5A 2YT4A 5AE3A 5HS9A 1FYKA 1A5JA 2L3DA 2WB1N 3X2QH 1BI1A 2XAHA 5IV8B 4E7SA 4RM2A 1YZ9A 2HDWA 5JLXA 1IUFA 2N8GA 4BS9A 1XMKA 3BF2A 2YSPA 3F8BA 2M30A 2K40A 3I55I 3DJWA 4RGRA 2EOOA 1G59A 2XRLA 3L09A 3IAM2 4XBFA 4BDYA 2V6EA 3S2HJ 2LKXA 1J5EE 3QODA 1W4MA 3EUKL 4RS8A 1J26A 2BOLA 1Z0XA 3NARA 1BIBA 4KUMA 1GZ6A 2UUCE 3I54A 5FKKA 2LOOA 3LA3A 1RKTA 5BR8E 3OTOE 4I99C 4J01A 2LCEA 2HFHA 3E6DA 4AU7A 2K9QA 4C2MJ 1IBME 2MGQA 1X1CA 2EN3A 2KIUA 2Q1ZB 1OKRA 4ZZLA 1N34E 3FHNA 3MMYB 1U78A 4C30A 4X64E 3ZMVA 2DQRA 4HOBA 4AIHA 2EFOA 2ACJA 1G3YA 1ERDA 2RC4A 3LSRA 2V87A 1V5EA 5KAIC 1PDNC 1R5GA 3VYSB 4KIBA 2ENCA 2YTJA 2DODA 2DT5A 4V2GA 1XN7A 4UUSB 3HPZA 1L4SA 2EMYA 2JT1A 1AWCA 3I58A 2EFNA 4WK8F 1UMQA 5ILSA 1QHGA 2OJED 2PG4A 4UUTA 2EPCA 4L9TA 1T08B 2KZVA 2Q0OA 3ROUA 3K4NA 2BVMA 4Q47A 3WE2A 4HV6A 4BEHA 2DGCA 5CQGA 1U8BA 1REPC 3FXMA 1I6XA 3MVPA 2KIFA 2G0EA 3MD2A 2EMAA 2RREA 2O0YA 2B0LA 5AE2A 3MHSC 1B59A 2DCEA 4Y15A 3WU1B 1NEIA 3B02A 3LQRA 3ABKH 5CJ9A 2XRNA 4NB5A 5D4RA 2ZMEB 4RB3C 1Z91A 2ZSIB 3CTAA 4NDLA 2XGCA 1DGWY 1YE9A 2M4IA 1FJGE 3J80Z 2EM3A 4BDZA 3V4GA 4AM3A 1KYQA 1D1CA 2XF6A 4G12A 1V5GA 1D8JA 2XSDC 1SFOJ 1YG2A 3I9V2 3O8HA 2F8BA 3D0SA 1FYLA 1ZR4A 1ONVA 1MDMA 3GTLJ 2EV0A 4BQNA 5DM7F 2IA1A 2DOEA 1XSVA 3IAS2 3W6KB 2X6OA 4PJLA 1X4PA 1ETWA 2VOOA 5B66C 3J81C 3V7RA 3TP0A 2LR8A 2XGXA 4Q4ZF 4ABZA 4HYEA 3ZQLA 1JKPC 4IVNA 3S3OA 1WJBA 4XM3A 4IRIA 3P1XA 1UG0A 1BN5A 3LQQA 5LL6R 3GCMA 4ZTFA 2O9LA 2I13A 2B7EA 3JRBA 1D0XA 5GTIC 5D5VB 4FX0A 4E70A 2GIZA 2R7OA 3JTGA 5DUKA 4FHTA 1PUFB 2EPRA 4MFEA 1T0FA 5CVJA 5DNYA 2F5EA 3L00A 3P9CA 4KT6A 1JI8A 2L33A 2FEZA 3SXYA 4JI0E 4KA4A 2LBFA 4ON0A 1X6FA 1FPQA 2J7JA 5LMNE 2Z5UA 4CYCA 2W00A 3SHFA 3RKWA 3FMQA 1APLC 2JOXA 2TCTA 2GXAA 3SDGA 3MKZA 4IZZA 3C1DA 4LLLA 4A6DA 1DI2A 5HLGA 2AS5F 1X58A 2EOEA 4N9IA 2QKLB 2YTQA 2A05A 3DBLB 4ZDPA 3HJEA 5IP7J 5K7FA 2E72A 2EPLX 2IA2A 2GZWA 4KN4X 2E34A 2KRHA 3GZ5A 2DT7B 2FMYA 2EQ0A 1X1PA 3FF5A 4NHJA 1TLHB 1STUA 1RKWA 2EPMX 2M34A 1MH4A 2HEOA 3MZYA 2LUQA 5KL5A 2VPLA 1V55H 4WSGA 1HW2A 2Z99A 4X65E 1IDYA 2GXGA 1VQ7I 3PM1A 1BA5A 4R79A 3ADGA 2GHFA 3N4MA 2OAZA 1R5ID 3OYJA 2HOSA 1YUIA 4JYAE 1A04A 4GKKE 4U88A 1V3FA 5IT9Z 2DDAA 5FLXZ 3CCQI 3I53A 1U5TC 4LG0A 4OWRB 5F27A 2VBYA 1YYKA 3J7AG 3ZMUA 1S9HA 3Q0WA 5D5XB 4BQQA 1U8RA 4QWQA 3JRCA 4UV9A 3F8CA 3AG2H 5D8LB 3OYDA 2HVRA 2ZXHA 2KDZA 1LB2A 1N33E 3IWDA 5CPRB 4BJTA 2MLKA 5HDKA 4HRIA 3TGNA 2EOMA 2EA2A 2M8GX 2V6CA 4LF8E 2Y0MA 4N0BA 2R7UA 4X9JA 2WC2A 1KU3A 3K70D 2VBXA 4RB0A 3ZQCA 3FXUA 1JUPA 3CMAI 4Q5SF 1YYWA 4OOIA 4D1QA 3A01A 2HZTA 2BY3A 4UHTA 3J7ZI 1ZGWA 4HSTA 4B47A 1MBJA 2EFQA 4GGGA 5JLWA 1T4NA 4M0VA 2ZFUA 2G9WA 5AC5A 2DFEA 1ODDA 2NUFA 2W85A 5HDGA 5EGOB 3ZMDA 2ZJQF 1C0WA 2CUJA 1BBYA 1YW9A 3T0YA 3THOB 1UN6B 4EM0B 2EMFA 2KRFA 2EINH 1B9NA 3ASNH 4MIMA 3TEDA 2VQEE 3CC2I 2BBYA 4HEIA 4JI1E 1QZEA 3U21A 1VFCA 2L4MA 3ZPLA 2PFBA 3JAMZ 3OYCA 3GVAA 1P6RA 4E7IA 5KL6A 1OCOH 2YR2A 3R61A 2KISA 2BZTA 3QG5C 5J3LA 1FBSA 4BQOA 2EWNA 4BUPA 2M7BA 2VODA 1XGSA 4RB1A 2L2KB 3F9KA 4AVZA 3FMSA 4IKFA 3P5JA 3IWBA 2R5YA 1D3YA 1VI0A 1CF7A 3GFIA 3FX3A 3TMOA 3KP4A 2DT6A 4PGHA 1K78B 4XLFA 4XNFA 2R7XA 1MW7A 2E19A 2JVAA 3M8FA 2KMUA 5BNGA 3HPGA 4FE4A 3GTGJ 1TF6A 1U5TA 4JOMA 3VK6A 2GLOA 4FTHA 3RYRA 4EATA 2H1KA 3ERMA 3MKLA 4U7BA 4XKWA 2EFPA 2UXCE 2V1UA 2A07F 2DLKA 2HPIA 1Z1BA 1IO2A 4KIGA 1FWZA 1NK2P 1VQKI 1JUMA 4GEQB 3WTXC 3BTJA 3T1BA 1T2KA 2VIXA 2FRHA 1X49A 1FTZA 1WJDA 4D0PA 1ZG1A 3AV0A 3RI4A 3CF5F 1R6RA 1ZH5A 4AIJA 2CSHA 1R4MB 2EM6A 2P5LC 1AU7A 2VE8A 3RPUD 1ZKGA 3MKYB 2MW8A 5EG0B 5C4JJ 4FISA 2WBSA 1P47A 1X4OA 3HC7A 2UXDE 1YJNI 2FGGA 3DPUA 4M74A 3A0HC 4L9VA 3BR3A 1IZ1A 3PUFA 4PFOA 5B5EC 3DEEA 1IV6A 5ILUA 3DPLC 3CCLI 1MMNA 3KZIC 5LEJA 3HZJA 4M3EA 2OPTA 3EPJA 3K0LA 5DCMB 2PMZA 3F8FA 3ELKA 4AIKA 1XSXA 2JSPA 1P92A 4J8ZA 3OR1C 4H4KC 5L3CA 1GTKA 3DPTA 4ZJZA 2EK5A 1SD7A 3CESA 5ICCA 4XLHA 2V86A 5KL2A 1Y8RB 2JWTA 3ZMZA 1ON2A 4XLEA 5E1XA 3L7WA 1Z77A 2ZJRF 3CMYA 2VT2A 2NNNA 5HODA 2LJHA 1I6HJ 1UAAA 3J7Yp 1B9MA 3QP5A 5BMZA 2MYSA 1QNTA 2BY1A 3VYUB 2EMIA 3Q9VA 1K83J 1Z7UA 1PUEE 4Q48A 3V8LA 2LY1A 4AWXB 1J2XA 2RV8A 2L4AA 3CMMA 4R2PA 3V42A 5FKNA 3PSIA 5FFXA 2DB2A 4WXDA 5DDGA 1B6AA 3CCUI 5D4SA 3CDLA 4MLVA 4NZVA 4UY8I 1HR0E 2KLOA 3HSRA 3EQ1A 5AIPA 4OIPF 1YTYA 3QU3A 1OCTC 4ESJA 4XRFA 1U2WA 1JUSA 3BR5A 3WTYC 2V85A 2X1DA 4C9YA 1KJKA 2DYRH 4F9CB 2KRCA 3BZCA 4ANJA 1K4TA 1QPIA 4DOZA 4F55A 1TP4A 3U2RA 4M9VC 1LLMC 2IBDA 3ABUA 1I27A 2KIQA 3HRSA 3HOZJ 4LOCA 3M4OJ 2QENA 4HQEA 5CLSA 2K9NA 2ZJPF 2E1NA 4RAGA 1DPUA 2YTDA 4A2UA 2V9VA 1TNSA 4BJ6C 2FE3A 3FWEA 4HAMA 3LFUA 2DU9A 2TDXA 4R2EA 2CUZA 4S04A 4JV5E 1ZELA 4FX4A 4MTDA 1IN7A 1MJAA 2NRAC 1BL0A 2LJUA 1AA7A 2YTFA 1YS6A 2L01A 1W36C 2B3TB 2HKOA 4G6QA 2YTGA 3KCCA 5J40A 3HOVJ 1EF4A 1PVEA 4JX5A 2ME6A 2NUEA 4EJTA 3S14J 3GFLA 4QIWN 5B3SH 1MH3A 3RPUA 1W7PA 2VE9A 1V5FA 2OQRA 3OYEA 4A3LJ 2NOJB 5IYDJ 4XKCA 1JE8A 2R7SA 3DEWA 5C4XJ 2V1NA 1FYMA 2QSFX 2DLLA 2L7ZA 5IP9J 4R2AA 1R49A 3GWZA 1FY7A 5KVRA 2QQAA 4M3FA 2R93J 4N4RB 4XLNF 1JT6A 4DV3E 3ZN0A 4PSWA 5LHHA 5A6AA 1LNWA 1AHDP 2K7IA 3JRAA 2QGUA 1P7JA 1KYWA 1GLNA 4J00A 2JUGA 4E6KG 3GX4X 1HQCA 1O7FA 3NWSA 2IRFG 1IJWC 3OYLA 1TZLA 4II2A 1B72B 2EPOA 3BIDA 2JVGA 4E4HA 3OYAA 2X51A 2C6YA 3GMEA 4ENNA 5BPDA 5GAGJ 2VC0A 4PJNA 1W0UA 2IA0A 4DR7E 2BY2A 1A31A 2PQ8A 5ICEA 3MZHA 3R6SA 4BE1A 1OR7C 2CQ7A 4KDPA 1U6GA 2RS6A 2ADUA 1FX7A 1AKHB 2R7RA 3JRFA 1HA8A 2JP9A 2AQFA 3H9QA 2M7AA 4DUZE 4LK0F 4PUSA 2GM4A 1XDUA 3DBHB 2A69F 1YRNB 5FLVA 2MDRA 2YRKA 1B8IB 2LTSA 1BR1A 2ODRD 1SR9A 1J09A 1ZRFA 1PJSA 4WFTA 3DF8A 4RGXA 1MMDA 1Y1WJ 1XTAA 3KZZA 3IKTA 2DOFA 2RSMA 4E7LA 5J4VA 3S1QJ 1MNDA 3TDZC 4BHBA 3B73A 3C18A 4XMYA 5D5UB 1VQOI 1UELB 2PMZN 3CQZJ 4LK1F 3I64A 1VQNI 1LFBA 2ZXWH 5BOXA 2P7CB 2ZC2A 2X85A 4DV1E 3CCEI 1VZ0A 1A6IA 1LKXA 2HU9A 4UVAA 3OS2A 3K69A 3OIOA 5H6QA 4CXFA 3J7AO 2VC1A 1USTA 4I0AA 1DQ3A 3UR3C 3ZXSA 1XX5A 2KFDA 2XROA 2IPQX 2IS1A 1K79A 5GADJ 1FJLA 2YZTA 2L3CA 2DMYA 1BR2A 3MEXA 5A6BD 1KA8A 2DIXA 1OISA 4EGYA 2K86A 1R1TA 2ENAA 5IP6A 1J7KA 1LUJB 2V83A 3GLXA 2ZXIA 5CVUA 5IOZA 3F0CA 2KDOA 1PJQA 1ENHA 2NVTJ 3AG3H 4F93B 5K1YA 2NVXJ 2PN6A 5F1JA 2R92J 3MFKA 4WYQB 2W82A 4EMSA 3HOYJ 2V7FA 4JQFA 5DM6F 2M7QA 2VASA 2DBBA 3BTIA 3V8JA 2M87A 5A69A 2YS9A 2LKPA 2MC3A 2R7FA 4DMIA 1P2FA 3CP8A 1ZTRA 2ID6A 4M6VA 2RKHA 5H2FC 1HSJA 1D5VA 5F0FA 3QRFF 4GO1A 2A6EF 2ZM6E 2MC6A 4F6NA 4LFCE 4L5JA 1TT5B 1W5SA 4ZH4F 1RRJA 4YFNF 3KEOA 4HTGA 4F54A 1P4AA 2XGEA 1WJFA 4FQGA 1WWXA 4Z2YA 4M6XA 1DU6A 2A5YB 1MBHA 1AAYA 3A1YA 2NAZA 3ZGKA 4IQ4A 1ITYA 3CD6I 3OWTA 4HG2A 1VQ5I 1WPKA 1YITI 3QAHA 5F0CA 2K4BA 1UHZA 2VUMJ 1KZHA 2DXIA 2MC4A 1LVKA 2EA4A 2VXZA 4F52A 4BY7J 2ME0A 3OMYA 5ADZA 1XGNA 3O6BB 2GLIA 5EGOA 2E71A 3KYCB 4TV7A 5FGMA 3T8TA 3G73A 3CCRI 2YRMA 2X6YA 1XC5A 2Y48A 5TSEA 1H9GA 3HHHA 3ZQQA 1MKMA 2CW7A 4CCOA 1LVAA 3SEQA 2PMUA 2R5ZA 3T1YE 1T98A 5J47A 5F1RA 1A1LA 2QQ9A 3ZQGA 5LGNA 5E79C 3ONQA 3EUHA 2EN1A 4A3MJ 3S16J 3CJNA 2JVHA 4X8WA 2V4JC 3BG6A 1MBKA 5AONA 4EJVA 2Z33A 2WTEA 4IHVA 4LIVA 2MKDA 3JRIA 1YJWI 1WGXA 2EE8A 1G4DA 3M3YJ 4FE7A 2KZGA 1VQ4I 2N8XA 3G6EI 2CWEA 1K7AA 4H0EA 1KQ9A 2VKEA 2D1VA 3HRMA 1ETKA 4YRVA 4A3CJ 2ZB9A 2LTRA 1J0RA 2FBKA 3J80C 2UV1A 3K10A 5KAFC 4XKBA 5ICFA 2V1DA 4I6ZA 1FBUA 4BYYA 3HL2A 3Q3SA 2YTOA 2DOAA 3LSPA 4LF7E 1ZARA 5L3DA 1FLIA 2E1CA 4NC6A 2BHYA 1GVJA 3F23A 1O57A 2LMZA 4UVCA 2L2OA 1SVMA 4A3EJ 2ZSHB 3FMRA 2HWVA 1Z6RA 1WRJA 2LTPA 2VJIA 3LAJA 1R9TJ 2EM7A 2XKPA 2XAFA 1KYZA 4PJMA 2K5CA 2H09A 3I71A 3LSGA 1K4SA 4OINF 4BAYA 4KWYA 2HVSA 1ETYA 2A61A 3RDIA 5LRRA 1I94E 5EEHA 2STTA 3EYIA 4JI6E 3FIWA 4OAYA 3GTPJ 2XAQA 2NA2A 2DA4A 3HSEA 4Z6YA 1OMIA 5BQTA 1ZG5A 2ZO4A 1AH5A 2QSHX 2Z3YA 4DBQA 1JTXA 3KP7A 3K1NA 4BNCA 3DF6A 2PX9A 3ABLH 5FKMA 1RR8C 2HXOA 3ABMH 1Y8QB 1I50J 4M72A 3BZ6A 1YO5C 3U1DA 3HM5A 5L3GA 3SYTA 3WTVC 4GCVA 4DV0E 1ZBQA 2ZXJA 2EM8A 2BEOA 5HLIA 4EEFG 4KJZA 5J6XA 3VYXA 2LE2A 2CQXA 2EN4A 2KONA 1TWHJ 1T0FC 1Z7LA 2X4HA 3K2ZA 3H1CA 3BG5A 4MO7A 3M99B 3F6OA 2EMLA 1K61A 1Y0NA 3WTZA 1JT0A 2CYYA 1HBXG 5LHGA 2J5OA 4BHPA 1HKSA 4G7HF 1BM9A 4LLGF 3PO3J 4HX8A 2EOYA 1KGSA 2EL6A 2GA1A 4GKJE 3VSKA 3CC4I 2NYXA 3NEUA 1XPXA 2LRDA 3BPVA 3CUQB 3J7YJ 3I59A 1HNZE 1IAWA
chains in the Genus database with same CATH topology
2HTJA 4OIOF 5JHUA 2YU3A 2OZUA 1R5HA 3NRVA 2FU4A 4A0ZA 1DUXC 2VBZA 5E17F 3MQ0A 3TO6A 2XVCA 4A12A 4XLPF 1S7AA 4BH9A 5L3FA 5K5RA 3KLNA 4BHCA 2QZ8A 2VOPA 2GXBA 2A68F 1S3JA 5LEKA 3QU6A 1RUOA 2DAOA 2MD5A 3WTUC 4EM2A 1ZG3A 4KNYA 3D5LA 2OBPA 4G7ZF 2F2EA 3U9GA 2E7XA 4XSZF 3CO6C 2ZKZA 1NHAA 4BXUA 3REOA 4ENJA 1O3TA 2O61A 1FC3A 2O03A 2IT0A 4G7OF 3BPXA 2QWWA 3DQVC 1LDDA 2NNYA 2F5CA 4IRHA 2EJRA 1F5TA 3GFJA 4RGSA 1AOYA 2QM3A 2STWA 2OZ6A 1ZGJA 1KQ0A 3OV8A 5F6FA 4LJZF 4K2EA 2IJLA 4HA8A 4XSXF 2V1XA 1BJAA 1SMYF 3VODA 5K5QA 2LSOA 2O8XA 5CVRA 3IKVA 4OMYA 5HVQC 1BC8C 4OIRF 3C3WA 4PZJA 1RZ4A 2O3FA 3O2PE 4IPAA 4Y17A 1HW5A 1Z1DA 3BJOA 2A6HF 2M45A 3GW2A 3F3XA 3RKYA 1W5TA 1LEAA 1TTYA 2XASA 1FP1D 5JVTA 3IWZA 4HZFA 4U0YA 5E20A 3KP3A 5LGUA 3JTHA 4CICA 3GEZA 4HW0A 3ZMTA 3F22A 1XGOA 3VEPA 2PMHA 2J5PA 4LMYA 2K27A 3FXRA 3MCZA 3VFZA 1Z05A 3WODF 5J8CA 2W25A 3KE2A 4P9FA 3P9IA 1SAXA 1ZLKA 2FXAA 2ISZA 1R58A 3BP8A 1Y0UA 1ON1A 3ULQB 1G3SA 2K4JA 2HKXA 3W6JB 2P4WA 5HS7A 5FFZA 3KP5A 2GAUA 1WQ2A 4M9XA 5ERIA 2GA2A 4EVIA 4O3MA 4HDUA 2H27A 4EGZA 4L5IA 3I5UA 1ZHFA 3G3ZA 1D8KA 2MH9A 1T6SA 2DO7A 4O6JA 1ZYRF 1R22A 2CG4A 2H6CA 2P6SA 3K9TA 4YIIA 3ECHA 3CO7C 1ULYA 2ZBKA 2CGPA 2H6BA 5E1WA 2FBHA 4FT8A 1J59A 5DUIA 4I0BA 3SZPA 2JPBA 4I2OA 4LFUA 4ETSA 2FQ3A 2QBYB 1IW7F 4EJOA 4P96A 1G3WA 3DP7A 2QQBA 4WX9A 1UHMA 4U0VA 4WF2A 1K6OA 2EV6A 1FP2A 1SMTA 2ETHA 2HS5A 3SZTA 1YLFA 2DK5A 2X0LA 2RNJA 5ILVA 2FSWA 3E3VA 4MHGA 1P4XA 3MWMA 1SFXA 5H6RA 2BYVE 3F8NA 4LB6B 2MBFA 5D6EA 4I01A 3LFKA 2XHKA 1E2XA 4EJUA 3E6MA 2YPRA 4UV8A 5LRSA 5FD6A 3I0TA 5CVIA 2ZFWA 2H94A 3MAJA 2QVOA 2OU2A 1ZREA 1Z9CA 4L18B 1XSDA 3RKXA 1YIOA 2W57A 4ZYHA 3AAFA 3CUQA 1MDMB 3J80K 3GUDA 4CDGA 1R00A 4O5VA 1R36A 5FO5A 1J9IA 2ZMEA 4HQMA 3E6BA 4DNCA 3V8KA 5LGTA 3Q5FA 3M8EA 2IVMA 2ZNYA 4UNOA 4HF0A 3VOEA 3IRRA 1H9TA 1R1VA 4U0WA 2LF8A 1MGTA 1S7OA 2YX4A 3LSTA 3VB2A 1FT9A 2R7DA 2HOEA 4KYWA 3BOQA 3TQNA 5HDNA 1TNTA 1O7LA 3WGHA 2IW5A 1OYWA 3RYPA 2Z9OA 4ESBA 4YG2F 1SFEA 4UUVA 2G7HA 3H3ZA 4ENKA 3V7SA 4LG0B 4PGGA 4RAZA 2PEXA 2GQQA 3JSPA 5IT9K 5FLXK 2RN7A 3HIFA 1IN5A 1EV7A 3ZMSA 1QZZA 1PP7U 3F72A 3FM3A 1IF1A 3IHUA 1SFUA 5DD8A 3ZN1A 4KFCA 4CHUA 3LAPA 1FOKA 2EB7A 4MTEA 2DQLA 2P5KA 3GYHX 3R4KA 2G7UA 2JSCA 2KKOA 4MQVA 3SQNA 1DDNA 3JAMK 3EETA 2FA5A 4UXNA 4L0ZB 3WTTC 3BJ6A 1HKQA 5HLHA 2OA4A 3E5UA 4MQ9F 1ZRCA 4CGZA 5TRDA 1U5TB 5CVVA 4Y13A 2MLGA 3DXJF 4IHTA 2M1BA 1QGPA 4KMFA 2PBIA 2KJBA 5ICGA 2F5FA 1RNLA 3DV8A 2V79A 4GYGA 1K78A 1RUNA 1J5YA 1R1UA 5ED4A 1TQMA 1I1SA 4MGRA 4A6EA 2FOKA 5DCFA 2O6GE 1S29A 3EQLF 3JW4A 3CUOA 4HF1A 3DFGA 5DEQA 2LDUA 1SD4A 4KN7X 4ASNA 5BS6A 4OMZA 4I09A 2HYFA 3RJPA 3WTWC 4EQQA 2CSOA 4ZYDA 2ELHA 3DEUA 2FF4A 2UWMA 4A0YA 1XMAA 5LHIA 1YS7A 3WGGA 2JTVA 4ZZDA 4HDVA 1LJ9A 5DCMA 3HTUA 3FZVA 4YFKF 1EH7A 1ZGAA 1KU9A 4IRGA 2P8TA 1S8NA 3BJAA 2HR3A 3OOPA 4GXOA 4MEXF 3TKYA 2EV5A 2ZCWA 5K5OA 4RAYA 5FB2A 2GWRA 2HGCA 1MJBA 2HQNA 1BI3A 1UHWA 2LF7A 1Z6TA 2A3SA 4KIFA 1KU2A 2QLZA 3ERED 1W7PB 2IP2A 4ESFA 4KMUX 5A2QZ 2KIMA 5LBQA 2FNPA 1F9NA 3R0JA 3V7CA 5JFRA 4LD5A 4QLCU 1PP8F 1XCVA 3Q9SA 1GXQA 1YQAA 4B09A 3ECOA 1QZYA 2CQKA 3TOAA 3BWGA 1T39A 2P7VB 2CO5A 3M1EA 1F1ZA 4ZYGA 1QBJA 3F6VA 1S6LA 1ZRDA 2Q2EA 2WWYA 3E5XA 1TW3A 2HYGD 1X3UA 1I1GA 3LWFA 3H92A 5DD4A 1L3LA 2LNBA 4F7ZA 1SD5A 4EV0A 3CDHA 3QP6A 1BOAA 2EFWA 1XGMA 4LGWA 3GO5A 3H3UA 1L0OC 3HUGA 4AD9A 3S2WA 2XV4S 2HDCA 2NS0A 3HRUA 2E7WA 1O3SA 4CO8A 4I02A 5KK1A 1XB4A 1KU7A 1QQIA 3T8RA 3CLOA 5DYMA 4OU0A 3JSOA 5D6FA 4HF2A 3IL2A 3KLOA 2AXLA 4M73A 5F64A 4YFXF 4HX7A 3IRQA 3PQJA 1R7JA 4M9SA 1QO0D 4M71A 1H0MA 3HSFA 1IUYA 2QUFA 4BQAA 5L3BA 4JBAA 4WXHA 3L9FA 3M9AA 4HBLA 1T38A 4KT5C 3WTSC 1HKTA 3WE3A 3KETA 3J81Z 2P5VA 4WXCA 1WSUA 1IXRC 2YX7A 1XCBA 4A5NA 3SFZA 1P4WA 2VN2A 1UCRA 2COMA 4L9JA 6PAXA 4CZZA 4M9ZA 1FSEA 1JHHA 1MZBA 1IRGA 1RI7A 2DPUA 3TO9A 2D1HA 5HS8A 3P9KA 1JHFA 3HYIA 2FMLA 4G9YA 3KEQA 4IHSA 3IWFA 3TO7A 1YW8A 1IN4A 1IXSB 4WCGA 2BV6A 2RDPA 4IF4A 2UXNA 1HSTA 3HRTA 4LB5A 1UB9A 4LLNA 3ML6A 2PJPA 4HX4A 1B4AA 2DTRA 4RB2C 1E17A 3EDPA 4PDKA 4DQ2A 2MH2A 2R3SA 4EJWA 2XIGA 2D45A 3BROA 2JZYA 1TBXA 4RGUA 1V4RA 1W7PD 3CUQC 1O3QA 2DPDA 4MNUA 2ISYA 4G94A 3QPTA 1BC7C 2ESNA 4S05A 3WG9A 4L0YB 2DW4A 2D2WA 2Y75A 1RIOH 4P9UA 2DK8A 4CYDA 2RGVA 3E5QA 4R8HA 3ABTA 1BIAA 1LDJA 5E8GA 1KQ8A 4M6YA 3I59B 3C7JA 1IN8A 2BGCA 4JK1X 4OIQF 3KZYA 2XUBA 3LA7A 2UZKA 2L54A 3GXOA 4U7DA 3FM5A 1YFHA 4AVPA 3N97A 1BI2A 3LA2A 2BE5F 2JRTA 1B1BA 2GIVA 1O3RA 3RPQA 4G8XA 5E1ZB 1MD0A 1YYVA 1UFMA 3FHZA 1GHCA 1LQ1A 4L9NA 5A2QK 3IC7A 5IT3A 1OPCA 2F5DA 5JI6A 5DV5A 1LEBA 1Q1HA 3BY6A 4R1HA 4A0XA 2HTSA 1I5ZA 2L02A 3QPHA 2CFXA 4UVBA 3BDDA 4UVCA 2K02A 3K1MA 5TJJA 2PLYA 4WWCA 3RIRA 1XDSA 1JXSA 3HOTA 1IN6A 2ZNZA 5E18F 4B8XA 3KP6A 4KICA 5BPIA 3F21A 2HQRA 3HTSB 1FSHA 2ZJ2A 5D8KB 1FNNA 2XKOA 1SD6A 5L3EA 3K1PA 4I7HA 2K7LA 3R0AA 3DKWA 2Q8KA 1HW1A 2CW0F 2JPCA 3L2CA 4P55A 3NQOA 2QYOA 4HLXA 1FZPB 3P7NA 1WKMA 1LDKB 2RQPA 1STZA 2W84A 4NQWA 2KJCA 3EYYA 2XAJA 3GFMA 3T5XA 2FBIA 3ISPA 1OYYA 1OYIA 1R23A 2VT3A 5FD5A 4ZYEA 1TW2A 3ZQ7A 4A5MA 1BI0A 2PI0A 1MJ9A 5CYVA 5LLQA 2ESHA 3PFIA 1USSA 2OQGA 4HV5A 2VBWA 1EH8A 1FBQA 3M7GA 2M5WA 3TOBA 2DI3A 1HXDA 3QOPA 1OR7A 3RTRA 4YIFA 4P5OA 1U3EM 1J75A 3F8MA 1CF7B 3J81K 1F4KA 2VONA 4PCQA 5HOOA 1JGSA 1TQPA 2MA3A 5J8FA 2P6TA 2UXXA 1TQIA 5EEGA 5AIQA 2W24A 4ENMA 4EM1A 2WV0A 4MEYF 5JR3A 2YSRA 3COAC 4HLYA 3WGIA 1ZN2A 3TDUC 4IXAA 3PQKA 4G6DA 4N9HA 3I4PA 1CGPA 3KP2A 3HHGA 2FNAA 2OD5A 1G3TA 1WI9A 2M8EA 1GXPA 3E97A 1QPMA 3O3KA 1ZLJA 1YW7A 3E6CC 1IRFA 1IXCA 5H20A 1XD7A 3GF2A 1ZAOA 1DP7P 3GZ6A 1VTNC 3HOSA 5D5WB 4I98B 2DFIA 4GYIA 3WU0A 1DPRA 3R60A 3FXQA 3ZP5A 3KFWX 4IJAA 2XAGA 1EH6A 2QBYA 1G6NA 5E8IA 2RVCA 5HS9A 1FYKA 2L3DA 1BI1A 2XAHA 1XMKA 3F8BA 2M30A 4RGRA 3L09A 4XBFA 1W4MA 4RS8A 1BIBA 4KUMA 3I54A 3LA3A 2HFHA 3E6DA 2KIUA 1OKRA 4ZZLA 1U78A 3ZMVA 2DQRA 4HOBA 4AIHA 2EFOA 2ACJA 1G3YA 2RC4A 1PDNC 1R5GA 4KIBA 2DT5A 1XN7A 2JT1A 1AWCA 3I58A 2EFNA 4WK8F 5ILSA 2PG4A 4L9TA 2Q0OA 3ROUA 4Q47A 3WE2A 4HV6A 1REPC 1I6XA 2KIFA 2O0YA 2B0LA 1B59A 3WU1B 4Y15A 3B02A 3LQRA 5CJ9A 2XRNA 4NB5A 5D4RA 2ZMEB 4RB3C 1Z91A 3CTAA 3J80Z 3V4GA 1D8JA 1YG2A 3D0SA 1FYLA 1ONVA 1MDMA 2EV0A 2IA1A 1XSVA 3W6KB 2VOOA 3V7RA 2XGXA 4Q4ZF 4HYEA 4IVNA 4IRIA 1BN5A 3LQQA 5D5VB 4FX0A 4E70A 3JTGA 5DUKA 4FHTA 1T0FA 5CVJA 2F5EA 3L00A 3P9CA 2FEZA 3SXYA 4KA4A 4ON0A 1FPQA 2Z5UA 3SHFA 3RKWA 3FMQA 3C1DA 4LLLA 4A6DA 5HLGA 2AS5F 4N9IA 2IA2A 2GZWA 4KN4X 3GZ5A 2FMYA 3FF5A 4NHJA 1TLHB 2HEOA 3MZYA 1HW2A 2Z99A 2GXGA 4R79A 3N4MA 2OAZA 1A04A 4U88A 1V3FA 5IT9Z 5FLXZ 3I53A 1U5TC 4LG0A 2VBYA 3ZMUA 5D5XB 1U8RA 4QWQA 4UV9A 3F8CA 5D8LB 1LB2A 5HDKA 2MLKA 3TGNA 2EA2A 2V6CA 2Y0MA 4N0BA 2WC2A 1KU3A 2VBXA 4RB0A 3FXUA 4Q5SF 4OOIA 2HZTA 4UHTA 2EFQA 4GGGA 2G9WA 1ODDA 2W85A 5HDGA 1C0WA 3ZMDA 1BBYA 1YW9A 3T0YA 4EM0B 2KRFA 1B9NA 2BBYA 3ZPLA 2L4MA 2PFBA 3JAMZ 3GVAA 1P6RA 2YR2A 3R61A 1FBSA 2EWNA 2VODA 1XGSA 4RB1A 3FMSA 1D3YA 1CF7A 3GFIA 3FX3A 3KP4A 4PGHA 1K78B 3M8FA 1U5TA 3RYRA 4U7BA 2EFPA 2V1UA 2A07F 4KIGA 1FWZA 3WTXC 3T1BA 1T2KA 2FRHA 4D0PA 1ZG1A 3RI4A 1ZH5A 4AIJA 2P5LC 2VE8A 4M74A 4L9VA 1IZ1A 5ILUA 3DPLC 5LEJA 3K0LA 5DCMB 3F8FA 3ELKA 4AIKA 1XSXA 1P92A 5L3CA 3DPTA 2EK5A 1SD7A 5ICCA 3ZMZA 1ON2A 5E1XA 3L7WA 2VT2A 2NNNA 1B9MA 3QP5A 5BMZA 1QNTA 3Q9VA 1PUEE 1Z7UA 4Q48A 3V8LA 4AWXB 1J2XA 2RV8A 2L4AA 5FFXA 4WXDA 5DDGA 1B6AA 5D4SA 3HSRA 5AIPA 4OIPF 1YTYA 3QU3A 4ESJA 4XRFA 1U2WA 3WTYC 3U2RA 3ABUA 1I27A 3HRSA 2QENA 4HQEA 5CLSA 2E1NA 1DPUA 4A2UA 2V9VA 1TNSA 2FE3A 3FWEA 4HAMA 2DU9A 2TDXA 4S04A 4FX4A 4MTDA 1IN7A 1MJAA 2NRAC 1YS6A 2L01A 2HKOA 4G6QA 3KCCA 4EJTA 3GFLA 2VE9A 3RPUA 1W7PA 2OQRA 1JE8A 1FYMA 2DLLA 3GWZA 1FY7A 5KVRA 2QQAA 4XLNF 3ZN0A 5LHHA 1LNWA 1KYWA 3GX4X 1HQCA 1O7FA 2IRFG 2C6YA 4ENNA 5BPDA 2VC0A 2IA0A 2PQ8A 5ICEA 3MZHA 3R6SA 4KDPA 1U6GA 2ADUA 1FX7A 4LK0F 1XDUA 2A69F 1ZRFA 3DF8A 4RGXA 3KZZA 3IKTA 3TDZC 4BHBA 3B73A 3C18A 5D5UB 4LK1F 3I64A 5BOXA 2P7CB 4UVAA 3K69A 5H6QA 4CXFA 3J7AO 2VC1A 1USTA 4I0AA 2XROA 2IPQX 1K79A 3MEXA 1KA8A 4EGYA 2K86A 1R1TA 1J7KA 3GLXA 5CVUA 5K1YA 2PN6A 3MFKA 4EMSA 4JQFA 2DBBA 3V8JA 2M87A 2LKPA 2MC3A 2R7FA 1P2FA 2RKHA 1HSJA 1D5VA 3QRFF 4GO1A 2A6EF 4L5JA 1W5SA 4ZH4F 4YFNF 3KEOA 1P4AA 1WWXA 4Z2YA 4M6XA 2A5YB 2NAZA 3QAHA 2K4BA 2EA4A 2VXZA 1XGNA 3O6BB 4TV7A 5FGMA 3T8TA 3G73A 2Y48A 1H9GA 3HHHA 1MKMA 1LVAA 2PMUA 1T98A 5F1RA 2QQ9A 5LGNA 3EUHA 3CJNA 4EJVA 5AONA 2Z33A 2WTEA 1G4DA 2CWEA 1K7AA 4H0EA 1KQ9A 2D1VA 3HRMA 1J0RA 2FBKA 5ICFA 2V1DA 1FBUA 4BYYA 1ZARA 5L3DA 1FLIA 2E1CA 1GVJA 3F23A 1O57A 3FMRA 2HWVA 1Z6RA 1WRJA 3LAJA 2XKPA 2XAFA 1KYZA 2H09A 3I71A 4OINF 4BAYA 2A61A 3RDIA