1YFNA

Versatile modes of peptide recognition by the aaa+ adaptor protein sspb- the crystal structure of a sspb-rsea complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
109
structure length
109
Chain Sequence
b'LSQLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPMEYARDGQIVLNIAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTMFEPEAAYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stringent starvation protein B
publication title Versatile modes of peptide recognition by the AAA+ adaptor protein SspB
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 24
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1yfnA00
2QAZA 1OU8A 1OX9A 1OU9A 1ZSZC 2QASA 1TWBA 1OX8A 1ZSZA 1ZSZB 1OULA 1YFNA 2NYSA
chains in the Genus database with same CATH superfamily
1I5OB 1Y96A 3CCLT 3OB9A 5KYWA 1WDXA 1VQ6A 2KR3A 1ZA1B 3EHRA 3I56Q 2M16A 2DPPB 4R56A 3QKJA 2VWFA 1JEGA 3PIPA 4IUVA 1CSKA 2HL3A 2LQNA 2I2LA 2JNGA 5IN1A 2HKQB 2V1RA 1PKTA 5HCKA 2QK0A 4PNOA 4JDSA 3GLXA 4OMPA 3PVLA 4DA4A 1OEBA 4A4GA 1IRXA 2Y4YA 2LMJA 2D9TA 6AT1B 2LX9A 1NJIR 5HK3A 4PFPA 3QDRB 2GCXA 2O4XB 3JCMX 2RK1A 5A0DA 2X4JA 3H0FA 4LDVA 4J7FA 4OB1B 4HCZA 4RTVA 2HKNA 4M78A 2FHDA 1M3AA 3CCEA 4J9IA 5GAMf 2E4HA 5J39A 1VQ5T 1VUBA 2DF6A 5A0GA 2DJQA 2K3XA 1ABOA 2JJ9A 1K73C 2EQUA 1K9MU 1VQKQ 3X28B 1UGQB 2Z0WA 2JZ2A 3CMAA 4ZGJB 2L3QA 1KQSA 2C0OA 3A8OB 4AFSC 1VOMA 1K0XA 4A4FA 2KY9A 2CZ1B 5DM7R 2YHTA 5GAN7 1VQ7A 2VYTA 4JZ4A 5CKFA 3L2ZA 3OS2A 3JB9F 4HCBA 1QVGS 3L2WA 1YJ9Q 2LCLA 4RG2A 3RESA 3OYCA 2ENMA 2HSPA 2KI7A 3NPFA 3CQTA 1WQ7A 1VQ4A 3EG9A 5FWBA 1H3HA 3SD4A 4RKUE 1XOVA 4LD6A 4AFZC 5LJ3j 1Q7YC 1NYGA 2X4XA 1Q82C 4C0FA 1VIEA 3KXTA 4WF2A 3SEMA 2ZGWA 3CXCP 2ED1A 1TUDA 3SWNB 3G6ET 4PJMA 2FRWA 1HXDA 5A0LA 3PE0A 2QDYB 2DAQA 3CC2T 2FPEA 1VQ8Q 3ER0A 2J05A 3CC7A 1TUGB 4HCCA 4AG2C 1UE9A 2EQJA 1VQ9A 1I1JA 1YWPA 3H0HA 4Z88A 2PZ1A 3JCMg 4XU1A 2EFIA 1AWJA 1JJ2A 2EYXA 4J6WA 1AVZC 1TXQA 3LWIA 1XQHA 2HSEB 2X3WD 2DZCA 1Q7YR 2O31A 1YJWQ 3JCMe 2FPFA 5GAN3 7AT1B 2LDMA 1QQJA 2MYSA 2JMAA 4M77F 3I55T 1MMDA 1QCFA 3CCVA 2F2VA 1UGRB 2AHJB 3JCMb 1JU5C 2QASA 1LCKA 3PGGA 4RTYA 5GANf 1E6HA 3QJ6A 1Q81U 5D6WA 3FC3A 2HD0A 4M78D 4Z89A 3CCJT 4P5NA 1LJOA 2VKNA 4J8OA 3JCMJ 1BI3A 1GCPA 5KYYB 3TU4K 2A7YA 5KYUA 1K9MC 4OMOA 2P84A 5J26A 1LPLA 1OPKA 1WHLA 1K8AU 2WACA 5GMKj 3VKIA 2AK5A 1YFNA 4CI0C 2EW3A 2HCKA 1D1BA 2D0QB 5HK0A 3OBYA 4IKFA 2QYZA 4M78G 2DL8A 5IHIA 2DD5A 1CKAA 2D8HA 5DLQE 2DVJA 2R5AA 1UHCA 2F2XA 1VYUA 1H8KA 1YHQA 1FMWA 1ZSZB 4IURA 3V7SA 3HFNA 3G71Q 1M1KC 2V8JA 5GAN2 5EC7A 5KE2A 2FZKB 3BDUA 2KYMA 3MJXA 4QVZA 3EFOA 2PVDB 5CQXA 4JRPA 3HHTB 2MK5A 3MEAA 1EZZB 4J9DA 2KK4A 2XK0A 3X24B 1AEYA 2VXFA 5LJ5j 3RKXA 4ZTJA 2DRKA 2OTJA 1RI9A 1VQLQ 2KMTA 3CCRT 1WXBA 2Y4XA 4C8QA 3CC4T 1Y96B 2H3JA 1NLPC 4YTLA 5FW9A 5KYWB 1QVGA 5IHKA 4KBMB 4N4GA 3LX7A 4M77C 1M1KR 1IZ6A 4XU0A 2VC8A 1W6XA 1OZ2A 3M0TA 3DKMA 3O5ZA 4BY6B 1NG2A 1GBQA 1B7TA 5GAOl 1B07A 1VQNT 4DEXA 3M0RA 3VS0A 1YBYA 5FROA 2JTEA 3CMET 2O9VA 2HQXA 4PLLA 2K57A 1S72A 4II1A 2B8AA 3C95A 4KGZB 4HKEA 4LNPA 5ECAA 4AMCA 4F7UA 4CC2A 2KYBA 4KRTA 1N5ZA 2G3RA 1X01A 1Q81C 3H6ZA 2XU8A 1AWXA 4C92C 2RO0A 1X2QA 3QJYA 1BK2A 3HP9A 4M78B 2JXBA 4M7AE 5LJ3h 3CCQQ 2QXFA 3UATA 1SPKA 4BDYA 2ECZA 2LJ1A 4MMLA 1BU1A 1T0HA 2KQWA 1IGUA 2EKHA 3M0SA 1K8AC 4NOYA 2E6ZA 3M0QA 1B34A 3RR6A 2VGMA 4PJOF 3JCMd 1I5LA 3OYNA 4JS5A 3URGA 3BDLA 4RMOA 1M2VA 3P8BB 5CIUA 1NLOC 5IHNA 1QP3A 3FIFA 3A98A 4FCYA 5GAN4 4N4HA 3CCMQ 3I56T 2DXTA 3OQ5A 1QVFA 1KHIA 3H0IA 3M9QA 2K3YA 1ZA2B 4CC4B 5KCOA 1YCSB 4A4HA 1EFNA 4E47A 1QKWA 3EG9B 4RTUA 1FYNA 1VQOA 1Y71A 2YSQA 9ATCB 2DFUA 4M7AF 4JJNK 4MDWA 3FB9A 3S6WA 4OB0B 4N0AC 3PMTA 2KEAA 1ABQA 3OYJA 2PU9B 3MO8A 1P92A 1UGPB 3OBWA 2L0AA 4QQDA 1EX4A 3QXEB 3CCST 1X69A 1ZHIA 2JUFA 4BB7A 4JUVA 3QHSA 3ZL7C 2YUPA 4FSSA 1NZ9A 4C8QD 4R0KA 3GNGA 2L5QA 4C5HA 3HRTA 3V8KA 1QVPA 1NEGA 2C06A 4L6V5 1G83A 1TU0B 2WSFE 1D3BB 1TG0A 1X27A 4C5EA 2ZPEB 1WQWA 3V7RA 5GAN8 1WLPB 4IIOA 5HKCA 1WGSA 1PSFA 1UG1A 5FU7B 1N9RA 1YITT 3JB9I 3OW2P 1VQKT 3EH1A 4FW2A 3RUXA 1QWFA 2CSIA 4KULA 3QSUA 1JXMA 1O75A 3G4SQ 3UF4A 2DL4A 1Q95G 3PT9A 3OYIA 4E7IA 1Y7XA 4PJOC 3CCLA 2A37A 5LJ3g 1W2BA 2BE7D 1YJ9T 2LT4A 2WSCE 3A8LB 4OMQA 2COYA 2DIQA 4Z8AA 5KYYA 2A28A 5EG2A 2K2MA 3J7AF 2CT3A 5LJ3e 3VS7A 1VQNQ 1QW1A 2YUOA 2HZYA 4DBRA 5LJ5h 1N27A 1BKBA 4KUDK 4RCCA 5KYUB 4E2FB 4F7UG 3WVDB 2ZCFB 1ZLMA 3OYMA 3BY7A 2L2PA 1V1CA 2DXCA 4M7AC 5FU6B 8ATCB 2NUTA 2AIRB 4GY5A 3L2RA 2K7AA 1X6GA 3EG3A 3LW5E 2RI2A 4NL2A 1VQ8T 2LNVA 3M53A 2RJCA 1PKSA 3RERA 4N4IA 1BI0A 3THKA 1M90C 2KRNA 4NS5A 2X3XD 3GNFB 2CREA 4AFQC 2CZ7B 3OYHA 2E64A 2X35A 1KC8R 1KD1U 2RMOA 1RAGB 2EGCA 3REAB 1VQ5A 4Y92A 1YNZA 5IT9E 1YJWT 4XQ3A 5CKHA 1EIFA 5I2MA 4L59A 5CKEA 4DQ2A 2MIOA 4LDWA 2HBWA 2CP5A 2FYKA 2FB7A 1BI1A 2K79A 2MCNA 1OOTA 3M4YA 3VYGA 2IVWA 4C8QB 4ORZA 4DBFA 1W4SA 2A0FB 2DNUA 1M90R 3E19A 2F5TX 2PVGB 2LVMA 2K5FA 2NUPA 1KQ2A 2GQIA 2JM8A 2KT8A 2O01E 3QO3A 4FIBA 3JCMh 2EYYA 3CPWP 2A36A 2PUOB 5L23A 2ZPBB 2AKLA 4FSXA 5I2SA 1M5Q1 4NL3A 5GMKe 1VQMQ 3RMQA 2FG0A 1FMVA 2JT4A 3G1JA 3L2QA 4C0DB 1RAHB 1YIJT 4IIMA 4M77A 3CCSQ 2ZPHB 4LDUA 1T3SA 3OS5A 2J7IA 2BE9B 3G6EA 3CBOA 2M9UA 4F7UB 5IXBA 3UPUA 3CC2A 1QLYA 2HQEA 3G71T 3E9FA 1OX8A 4M75C 2G6FX 4PL6A 2FL7A 2LX7A 2EJ9A 2YXYA 5GAOn 4BD3A 4A53A 5LJ5g 4PJNA 3OYAA 2ZPGB 2RNAA 2XDPA 1YITQ 1H641 5I22A 2CDTA 2MWPA 1JB0E 3TSWA 1YI2Q 3INZA 1RAFB 4J5YA 1SSHA 3EGDA 5LJ5e 2XMFA 1Z9QA 1B34B 3JRZA 2GTJA 3WXMB 3TREA 4C92A 4DBQA 2KAFA 2KROA 1W70A 2LJ3A 1M2VB 1VQLT 5GAMg 2L3PA 3AT1B 4PKCC 3I55A 4PJLA 3VS4A 1WXUA 4M7DE 1MMAA 4OMMA 4A63B 5IXFA 4XTVA 4VUBA 1G8XA 2CZ6B 1N8RU 1FWZA 3OYLA 2MWOA 3JB9D 4AFUC 3F70A 5GAMe 1SHGA 1KD1C 1N9SA 1PSEA 3CCJA 1K73R 1K1ZA 3RIRA 1OPLA 3FDRA 3BFMA 4F16A 1GCQC 1FXXA 5LJ3d 2CH4W 3QWYA 2O2OA 1T0JA 3CD6Q 5FRNA 2D1XA 3RNJA 3NTIA 1FMKA 1IXDA 3JCMf 3JB9G 3I5RA 1RAIB 4J9CA 3GOXA 2QQSA 1D3BA 2QGFB 4M78E 1YJNQ 1BBZA 1Y0MA 2CYZB 2QAZA 4XK8E 4M7DF 2E5QA 3CCQT 5CCAA 4BDZA 2KT1A 4DOVA 1PNJA 4ELYC 1GFCA 1NBEB 4WCIA 1D1AA 2DK3A 2QQRA 2RQVA 1Q82R 2GTOA 4KGVB 4IUTA 4QQ6A 2QEXT 1RLPC 1X2KA 4X9CA 1ZUKA 3V8LA 3VS2A 4OVAA 4XTYA 2IG0A 4M77D 3J80E 2GF7A 2LTOA 4J83A 2QQAA 5KH6A 4ESRA 3TSZA 8AT1B 3OA6A 1GL5A 2OJ2A 3C0CA 2V8KA 5D6YA 1PG5B 3OSSC 5FLXE 3CCRA 3CCMT 3CC4A 2NWMA 1BCOA 3HTRA 2E12A 1FX7A 4J9HA 4EMKC 1WFWA 1UB4A 4HA8A 4O6JA 2COZA 1G3TA 1WXTA 1TSFA 1W1FA 3PIOA 1VYVA 4M78F 2C0IA 3RBBB 2BIVA 2KRMA 4O5VA 2NYSA 2LC4A 4C5IA 4M77G 5FWCA 1XTDA 1ZSZC 2VB6A 1VQNA 4MZTA 2K4YA 3SHWA 5GMKl 5GANg 1YIJQ 4PJOA 2EKOA 3H41A 3CMEA 1BIBA 1D1CA 5CKBA 4CRIA 2YRDA 1SSFA 5D7UA 3QIIA 2GFAA 4C92D 2W0ZA 2ED0A 4JS4A 2HL5C 1AWOA 1WJSA 4BE1A 2NUTB 2OTLQ 1N8RC 2DTOA 2FRYA 1SHFA 5CR2A 3EG2A 2RK2A 2EGAA 4QQGA 3HFOA 3CPWS 2AT1B 1K9MR 3CCUQ 1AZGB 1TUCA 3ZFJA 1KG1A 2DYBA 4IUPA 4C92G 5GMKm 4M4ZA 4M7AA 4M7DC 1MHNA 3M4GA 1M8VA 1Y57A 1X6OA 2QGGA 3LGFA 3HSBA 5LJ5d 1SKUB 2CP6A 4BY6C 1QCOA 2HNIA 1TS9A 3G4ST 2PVOB 1VQ6Q 2XG8D 3QZ5B 4ZTFA 1U3OA 3DLLA 4LDXA 4BACA 4J9BA 3WVEB 2CZ0B 3I56A 1TTHB 4J7IA 5GAMj 2EQKA 4BI4A 1VYTA 3JSCA 1M4ZA 2NUPB 1K0SA 1IB8A 3GF5A 3A8GB 1BB9A 5GAOr 4XTXA 2Y90A 1XNIA 2K5IA 4OB2B 4LXCA 2F1LA 2P0QA 3DB3A 1UGVA 3REBB 1Q86U 2DLPA 2YLBA 4Z02A 1HD3A 4DOWA 2K6DA 3OYEA 2RF0A 4JLGA 1JJ2P 1AHJB 3QBYA 4JLIA 4M77B 2RQRA 2IIMA 2DXBA 1U1SA 4A4EA 1AT1B 2J6KA 2XDDA 4FT4A 2DETA 4HT9A 1KFZA 3OSVA 2EQMA 3M0PA 3KFVA 5GAOm 2OI3A 4J9EA 4OGEA 1I4K1 1KJWA 1WJQA 4ZNXA 2YRVA 3R6NA 1AZEA 4QVDA 2GBQA 4XU2A 2KRSA 3H8ZA 1WYXA 2D0NA 4EDUA 1YP5A 2CGHA 2QEXQ 3CXCS 2AZSA 2DZ9A 5KCHA 1V76A 1YITA 3CMAQ 3EGDB 4F04B 1VQKA 1JRIA 4JJBA 4OMNA 2RPNA 3JCMP 4PJOD 2JTFA 3CBMA 3ULRB 2QTVA 3VV0A 4C8QE 1VQPT 1NEBA 4M75A 3GP8A 3VUBA 4C92B 1OYXA 2W10A 1Q81R 2PUKB 1PWTA 4RUGA 3AHUA 1VQ7Q 3MEVA 5FRMA 1OU9A 4ELZC 2E5KA 1HSQA 2V8IA 4LUEA 2J06A 1F1BB 1RUWA 1ACMB 5CO7A 2LJ0A 5DY9A 3M5AA 1VQ4Q 1MV0B 1YJ9A 3META 2QA4T 1K8AR 1VIFA 2KXDA 2CP0A 4PJOG 4B9WA 3M59A 3ME9A 2EYWA 4FYWB 4TVRA 1VQMT 3RMSA 4RTWA 4M7AD 1UEBA 2CP3A 2GQVA 1U1TA 3OY9A 3C94A 2RQUA 4BUGA 3EG1A 3NGPA 1KIKA 2R58A 2YT6A 1NYFA 1M8MA 2F5KA 3HPWA 2CT4A 2M02A 5GANj 4ATOA 1SEMA 1UJ0A 2GFUA 4C8QF 3CPWA 2CSQA 3FLGA 3LH5A 1VQ8A 1VQ9Q 4CC7A 4UC4A 1NJIU 3UA6A 2RQWA 3VRZA 3P8HA 4M7AG 3TEEA 5GMKh 3E9GA 1PRMC 3MP8A 3H9NA 1GRIA 4E7JA 1YI2T 2E70A 1QKXA 2MF2A 2XICA 3Q1JA 4R55A 1Q86C 1UDLA 1UGSB 2J6OA 3TVTA 1G2BA 5LJ3f 1YJWA 2DMOA 2L3RA 2K5LA 4JJDA 3L42A 1PCXA 2JMCA 3S3OA 4KH1B 2KNBB 3V8JA 1MMNA 4ME7A 2KVQG 4BI8B 1JBMA 1S1NA 1AWWA 1MNEA 1WHKA 5KYNA 1PRLC 1R77A 4XAXB 4D8KA 3MP1A 3JCMQ 2RI3A 3M56A 4X34A 2ROTA 5FU6C 2RJEA 4OMLA 3J81E 1E6GA 1X75C 1VA7A 2DJZA 1HK9A 3CD6T 4QVCA 4QKUA 4E7KA 2E1HA 2DX1A 4PJOB 3C4SA 5DLOA 2R5MA 4FL6A 1PM3A 1RLQC 4M75D 2RHIA 1YIJA 3FJ5A 5GAMh 3JB9J 2DIGA 4FM4B 1N6AA 1YJNT 1YHQQ 1I0CA 2JOYA 3PMIA 2ABLA 1MNDA 2E41A 4HXJA 2VXEA 2GGRA 2EIFA 3G71A 2DERA 2D8JA 1WIEA 3CXCA 1IHVA 2OX7A 5L8RE 4C8QC 1M3BA 1UUEA 2CUBA 2CP7A 2RJFA 4JJCA 4M75G 2L8DA 2DD4A 4M7AB 1OV3A 2OAUA 3RKYA 1QVFP 1VQPQ 2IPOB 4AG1C 2DTIA 2OTJQ 1Q7YU 2COWA 2DRMA 1PHTA 2RD1A 4FU6A 1VQLA 3VRYA 3G7ZA 1Y07A 3OYBA 3QDFA 1JXOA 4MMKA 1NJIC 4XTUA 1X6BA 2DE0X 3I35A 3OMCA 4C0DC 3NFCA 2JTMA 2RI5A 5CAIA 2XHCA 2QA4Q 4M7DA 1UECA 2YWWA 5GJWB 1C6VX 2RHXA 3SDZA 5J3BA 4J9FA 2DBMA 2O9SA 2VASA 4K11A 2RH2A 2H3EB 2LQKA 3EFSA 3M54A 5GAN6 1RABB 1UHFA 1KHCA 2EJGA 1S72Q 1YCYA 4D6WA 2QDLA 1I81A 2LCCA 1G5VA 3RKWA 2DEUA 5LJ5f 2PNIA 1U06A 3UDCA 1OX9A 4E6RA 2JVVA 2OTLT 3CEYA 2HEQA 2C0TA 1GBRA 2LRQA 1B3QA 3EFRA 1QP2A 4E7ZA 4BE0A 2CUDA 1I8FA 4OMFB 3S3NA 5GMKi 3CCQA 3CCUT 2XDBA 1IO6A 2WSEE 2CH4A 1UJYA 2EYQA 1W2BP 4OB3B 2MOXA 1D0YA 2E3HA 2BZ8A 1JO8A 5A2QE 3VUZA 5GANh 1WZOA 2QEXA 3E1SA 2RJDA 2DILA 2X4YA 3EGXA 4M75B 2F2WA 1VQ6T 4KGXB 4HVUA 3FJPA 4FYXB 1QMCA 1RAAB 1NM7A 2DL5A 5IAYA 3X26B 4C5GA 3SWNC 2EQIA 3CCMA 2SEMA 3HL8A 3JCMc 2F69A 5CKDA 2HAXA 2VGNA 4FT2A 1OZ3A 2EGEA 2LZ6B 3OW2S 3OYYA 3PFSA 1JQQA 2LT1A 2VVKA 3A8HB 2ZAEA 4F14A 2E6NA 4JPBW 1QWEA 1R0BG 1VQOQ 1M1KU 1GFDA 1TWBA 1BYMA 5C6SA 2FVUA 1MUZA 3X20B 5GAN5 4M77E 2DM1A 3R6OA 4XU3A 3U23A 1C0MA 2LP5A 1X43A 3LWHA 5KYXA 4E7HA 2ZPFB 2EJFA 1SRLA 2LQWA 1M3CA 3OS1A 3TQ7P 2RHZA 1KD1R 2P0PA 3CCET 4N0AA 2QQBA 4F17A 1TOVA 1C1AA 2DA9A 3MHXA 4M7DD 1YN8A 2MMPA 4BI3A 2LNHB 4AT1B 3NTKA 1WI7A 4GLMA 1RACB 1KQ1A 3MEWA 3CMAT 4FYVB 3UWNA 4C92E 3GIBA 1ARKA 1PD0A 1CKBA 3TCJA 1OI1A 4A54A 4E7SA 2JN0A 3MCAB 3JCMV 1VQ7T 4M7DG 3CCLQ 3G4SA 1UTIA 2K2VA 1ZX6A 2RA2A 4KH0B 3PNWC 1O9SA 3LLRA 1AD5A 2RM4A 2RN8A 3JV3A 1VQ4T 3M55A 2EPDA 1H3ZA 2EAYA 4RTTA 2P4RA 2J6FA 4Y91A 2NLUA 1ZUUA 1NPPA 1QVFS 1MMGA 4PLIA 3HRSA 3A1PA 1J3TA 2V1QA 3A5ZB 4GBQA 3RDVA 3UT1A 3MP6A 4RG8A 4LDYA 4EMKB 3OYDA 4XTWA 5GANe 2YRCA 2M51A 2X9HA 3LH0A 4C92F 2EWNA 4MZPA 5I21A 3CC7T 4EMGA 1KQSP 1YWOA 2DVEA 1MGQA 1WJRA 1TH7A 1VQ9T 2QG9B 4PJJA 3EGUA 4JZ3A 3JB9H 2FEIA 2JS2A 2MI6A 2KGTA 2DL3A 1ZQ1A 4CC3A 1U8RA 1D0ZA 2VUBA 1VQ5Q 4EIKA 2PQWA 3LGLA 1K9AA 3ZBDA 1M30A 3JCMW 4HCKA 2YUNA 3CPFA 3ZEHA 3JAME 1KSWA 1Z9ZA 1M2OA 2CKKA 3CCVT 2DL7A 1RAEB 3MPUB 3ASKA 4DBHA 1N8RR 1LVKA 1VQPA 3MEUA 4L5GA 2DEQA 3VS5A 4RTXA 4JRKA 5CVIA 4KT0E 3QG1A 2SRCA 3L2VA 1DJ7B 1SF9A 3OYFA 3OW2A 2X4WA 3CBPA 3QPHA 5GAMd 5HY6A 1G3YA 5D6XA 1ZUYA 2M1HA 4M7DB 1M27C 3VS3A 1W2BS 2H8HA 4OP0A 3C12A 4OF1A 1IHWA 2QA4A 3VJPA 5I11A 2HMAA 4M78C 2K9GA 4PJOE 1QCNA 2I0NA 2E65A 1MV3A 1VQMA 2KXCA 1NPRA 1D09B 4PFOA 3V7CA 4QT7A 3OMGA 3SB2A 3E2UA 3O8VA 2X51A 2MAMA 3CCSA 4WTOB 4LD9K 3G6EQ 1LOJA 3VS6A 5IH2A 2O4XA 2KE9A 5M9OA 2K3BA 2YUQA 1YHQT 3CC2Q 1UFFA 4D8DA 3CCEQ 1WHJA 1V29B 1K76A 3D7SB 2CP2A 4HVWA 1OU8A 5AT1B 1K4US 2HBPA 4PFZA 3GPLA 4X1VA 3VS1A 2ZZDA 2XI9A 4JRQA 1BIAA 1M9SA 1M1FA 1ZSGA 4HT8A 2JW4A 1OULA 3EAEA 2JM9A 1SG5A 1YI2A 1WX6A 5LL6S 1KC8U 2E10A 1LNXA 3BE3A 1I07A 3EHQA 3BW1A 2OTJT 2XKOC 2M0YA 1SRMA 3OS0A 2EBPA 3I55Q 3I9QA 3EGXB 3T9NA 2JS0A 3EG0A 1WNLA 2BTTA 2RHYA 2O88A 4QW2A 2HQHA 4C0GA 1WHHA 2DTHA 1U5SA 3M0UA 4BE2A 4ZN1A 5GAOq 2LQ8A 3CCJQ 5GJVB 1KK7A 3M58A 1M90U 1A0NB 4J6XA 4RTZA 1OQKA 1BI2A 1R8OB 2QI2A 2RB6A 1S72T 2B86A 3L1AA 4F7UE 4C0ZA 2OAWA 1WHGA 1GXIE 3CD6A 3SWNA 5FU7C 4LUDA 3L2UA 1M1GA 3HRUA 2BKDN 2E3IA 3CC7Q 2KDSA 2ZPIB 5KYXB 2MPXC 2P4TA 3OYKA 3S3MA 2AZVA 5GANd 1GCQA 3PTAA 4IUUA 2ATCB 3QZ9B 4DEYA 2DBKA 4Y28E 4A4KA 4B6MA 1YJNA 2M0OA 2HDAA 3KBGA 4ZGDB 4FW1A 1AOJA 3HKSA 2FZCB 1QVGP 2P0KA 1NE8A 2BZYA 4IUQA 3QWXX 3QYGB 1XJWB 2ROLA 1HYOA 4PK4A 3CCVQ 4V2SA 5CK9A 4M75E 5AYFA 5C0MA 2EVRA 3FEOA 2XD0A 2CS7A 2KBTA 1WPYA 2L3SA 4C8QG 3OYGA 2DXUA 2A08A 1PC0A 3IQLA 3VYHB 2EYZA 3N5BB 4EMHA 4MZMA 1RL2A 3I5SA 1KQSS 4F7UF 3CCRQ 4E7LA 4J6YA 3CC4Q 1WA7A 2XIDA 1IGQA 2ESWA 3GBQA 4ZN3A 2DYIA 2AKKA 2BUDA 2RHUA 4X9DA 2KSSA 4LE9A 2LCSA 2DKGA 1G3SA 3SFMA 3A8MB 2YLCA 1Q86R 2YDLA 1VQOT 1G3WA 2FZGB 4J9GA 1KC8C 2BZXA 2QQ9A 1RI0A 4EMKA 1K73U 4KUIA 3CMEQ 3UA7A 1E7OA 2FO0A 2NUZA 2DO3A 3P8DA 3QYHB 3X25B 1D0XA 3KUFA 2VV5A 1ZBJA 4M75F 2QTXA 2L89A 4HVVA 3FRNA 2OTLA 1PD1A 4GLKA 3PVQA 1BCMA 1ZSZA 4EPCA 1H92A 4Q5WA 4ZGEB 3MKDA 3DLMA 1WHMA 4B9XA 3NMZC 3DB4A 2RQTA 3LYIA 3VU3C 1HJDA 3NHNA 5KE3A 4OGCA 1T3LA 2FPDA 3EH2A 3QUIA 1RADB 5GAOp 3CCUA 4FYYB 1R0CB 1ZBXA 3NTHA 4JRIA 4MDXA 1JJ2S 5CQYA 4LN2A 3EFOB 2D6FA 2GNCA 4ANJA 2PTKA 3M57A 4RCBA 2A3LA 4XTZA 1Q82U 2V26A 1IREB 2R57A
chains in the Genus database with same CATH topology
2QAZA 1OU8A 1OX9A 1OU9A 1ZSZC 2QASA 1TWBA 1OX8A 1ZSZA 1ZSZB 1OULA 1YFNA 2NYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAZ A;  1OU8 A;  1OX9 A;  1OU9 A;  1ZSZ C;  2QAS A;  1TWB A;  1OX8 A;  1ZSZ A;  1ZSZ B;  1OUL A;  1YFN A;  2NYS A; 
#chains in the Genus database with same CATH topology
 1I5O B;  1Y96 A;  3CCL T;  3OB9 A;  5KYW A;  1WDX A;  1VQ6 A;  2KR3 A;  1ZA1 B;  3EHR A;  3I56 Q;  2M16 A;  2DPP B;  4R56 A;  3QKJ A;  2VWF A;  1JEG A;  3PIP A;  4IUV A;  1CSK A;  2HL3 A;  2LQN A;  2I2L A;  2JNG A;  5IN1 A;  2HKQ B;  2V1R A;  1PKT A;  5HCK A;  2QK0 A;  4PNO A;  4JDS A;  3GLX A;  4OMP A;  3PVL A;  4DA4 A;  1OEB A;  4A4G A;  1IRX A;  2Y4Y A;  2LMJ A;  2D9T A;  6AT1 B;  2LX9 A;  1NJI R;  5HK3 A;  4PFP A;  3QDR B;  2GCX A;  2O4X B;  3JCM X;  2RK1 A;  5A0D A;  2X4J A;  3H0F A;  4LDV A;  4J7F A;  4OB1 B;  4HCZ A;  4RTV A;  2HKN A;  4M78 A;  2FHD A;  1M3A A;  3CCE A;  4J9I A;  5GAM f;  2E4H A;  5J39 A;  1VQ5 T;  1VUB A;  2DF6 A;  5A0G A;  2DJQ A;  2K3X A;  1ABO A;  2JJ9 A;  1K73 C;  2EQU A;  1K9M U;  1VQK Q;  3X28 B;  1UGQ B;  2Z0W A;  2JZ2 A;  3CMA A;  4ZGJ B;  2L3Q A;  1KQS A;  2C0O A;  3A8O B;  4AFS C;  1VOM A;  1K0X A;  4A4F A;  2KY9 A;  2CZ1 B;  5DM7 R;  2YHT A;  5GAN 7;  1VQ7 A;  2VYT A;  4JZ4 A;  5CKF A;  3L2Z A;  3OS2 A;  3JB9 F;  4HCB A;  1QVG S;  3L2W A;  1YJ9 Q;  2LCL A;  4RG2 A;  3RES A;  3OYC A;  2ENM A;  2HSP A;  2KI7 A;  3NPF A;  3CQT A;  1WQ7 A;  1VQ4 A;  3EG9 A;  5FWB A;  1H3H A;  3SD4 A;  4RKU E;  1XOV A;  4LD6 A;  4AFZ C;  5LJ3 j;  1Q7Y C;  1NYG A;  2X4X A;  1Q82 C;  4C0F A;  1VIE A;  3KXT A;  4WF2 A;  3SEM A;  2ZGW A;  3CXC P;  2ED1 A;  1TUD A;  3SWN B;  3G6E T;  4PJM A;  2FRW A;  1HXD A;  5A0L A;  3PE0 A;  2QDY B;  2DAQ A;  3CC2 T;  2FPE A;  1VQ8 Q;  3ER0 A;  2J05 A;  3CC7 A;  1TUG B;  4HCC A;  4AG2 C;  1UE9 A;  2EQJ A;  1VQ9 A;  1I1J A;  1YWP A;  3H0H A;  4Z88 A;  2PZ1 A;  3JCM g;  4XU1 A;  2EFI A;  1AWJ A;  1JJ2 A;  2EYX A;  4J6W A;  1AVZ C;  1TXQ A;  3LWI A;  1XQH A;  2HSE B;  2X3W D;  2DZC A;  1Q7Y R;  2O31 A;  1YJW Q;  3JCM e;  2FPF A;  5GAN 3;  7AT1 B;  2LDM A;  1QQJ A;  2MYS A;  2JMA A;  4M77 F;  3I55 T;  1MMD A;  1QCF A;  3CCV A;  2F2V A;  1UGR B;  2AHJ B;  3JCM b;  1JU5 C;  2QAS A;  1LCK A;  3PGG A;  4RTY A;  5GAN f;  1E6H A;  3QJ6 A;  1Q81 U;  5D6W A;  3FC3 A;  2HD0 A;  4M78 D;  4Z89 A;  3CCJ T;  4P5N A;  1LJO A;  2VKN A;  4J8O A;  3JCM J;  1BI3 A;  1GCP A;  5KYY B;  3TU4 K;  2A7Y A;  5KYU A;  1K9M C;  4OMO A;  2P84 A;  5J26 A;  1LPL A;  1OPK A;  1WHL A;  1K8A U;  2WAC A;  5GMK j;  3VKI A;  2AK5 A;  1YFN A;  4CI0 C;  2EW3 A;  2HCK A;  1D1B A;  2D0Q B;  5HK0 A;  3OBY A;  4IKF A;  2QYZ A;  4M78 G;  2DL8 A;  5IHI A;  2DD5 A;  1CKA A;  2D8H A;  5DLQ E;  2DVJ A;  2R5A A;  1UHC A;  2F2X A;  1VYU A;  1H8K A;  1YHQ A;  1FMW A;  1ZSZ B;  4IUR A;  3V7S A;  3HFN A;  3G71 Q;  1M1K C;  2V8J A;  5GAN 2;  5EC7 A;  5KE2 A;  2FZK B;  3BDU A;  2KYM A;  3MJX A;  4QVZ A;  3EFO A;  2PVD B;  5CQX A;  4JRP A;  3HHT B;  2MK5 A;  3MEA A;  1EZZ B;  4J9D A;  2KK4 A;  2XK0 A;  3X24 B;  1AEY A;  2VXF A;  5LJ5 j;  3RKX A;  4ZTJ A;  2DRK A;  2OTJ A;  1RI9 A;  1VQL Q;  2KMT A;  3CCR T;  1WXB A;  2Y4X A;  4C8Q A;  3CC4 T;  1Y96 B;  2H3J A;  1NLP C;  4YTL A;  5FW9 A;  5KYW B;  1QVG A;  5IHK A;  4KBM B;  4N4G A;  3LX7 A;  4M77 C;  1M1K R;  1IZ6 A;  4XU0 A;  2VC8 A;  1W6X A;  1OZ2 A;  3M0T A;  3DKM A;  3O5Z A;  4BY6 B;  1NG2 A;  1GBQ A;  1B7T A;  5GAO l;  1B07 A;  1VQN T;  4DEX A;  3M0R A;  3VS0 A;  1YBY A;  5FRO A;  2JTE A;  3CME T;  2O9V A;  2HQX A;  4PLL A;  2K57 A;  1S72 A;  4II1 A;  2B8A A;  3C95 A;  4KGZ B;  4HKE A;  4LNP A;  5ECA A;  4AMC A;  4F7U A;  4CC2 A;  2KYB A;  4KRT A;  1N5Z A;  2G3R A;  1X01 A;  1Q81 C;  3H6Z A;  2XU8 A;  1AWX A;  4C92 C;  2RO0 A;  1X2Q A;  3QJY A;  1BK2 A;  3HP9 A;  4M78 B;  2JXB A;  4M7A E;  5LJ3 h;  3CCQ Q;  2QXF A;  3UAT A;  1SPK A;  4BDY A;  2ECZ A;  2LJ1 A;  4MML A;  1BU1 A;  1T0H A;  2KQW A;  1IGU A;  2EKH A;  3M0S A;  1K8A C;  4NOY A;  2E6Z A;  3M0Q A;  1B34 A;  3RR6 A;  2VGM A;  4PJO F;  3JCM d;  1I5L A;  3OYN A;  4JS5 A;  3URG A;  3BDL A;  4RMO A;  1M2V A;  3P8B B;  5CIU A;  1NLO C;  5IHN A;  1QP3 A;  3FIF A;  3A98 A;  4FCY A;  5GAN 4;  4N4H A;  3CCM Q;  3I56 T;  2DXT A;  3OQ5 A;  1QVF A;  1KHI A;  3H0I A;  3M9Q A;  2K3Y A;  1ZA2 B;  4CC4 B;  5KCO A;  1YCS B;  4A4H A;  1EFN A;  4E47 A;  1QKW A;  3EG9 B;  4RTU A;  1FYN A;  1VQO A;  1Y71 A;  2YSQ A;  9ATC B;  2DFU A;  4M7A F;  4JJN K;  4MDW A;  3FB9 A;  3S6W A;  4OB0 B;  4N0A C;  3PMT A;  2KEA A;  1ABQ A;  3OYJ A;  2PU9 B;  3MO8 A;  1P92 A;  1UGP B;  3OBW A;  2L0A A;  4QQD A;  1EX4 A;  3QXE B;  3CCS T;  1X69 A;  1ZHI A;  2JUF A;  4BB7 A;  4JUV A;  3QHS A;  3ZL7 C;  2YUP A;  4FSS A;  1NZ9 A;  4C8Q D;  4R0K A;  3GNG A;  2L5Q A;  4C5H A;  3HRT A;  3V8K A;  1QVP A;  1NEG A;  2C06 A;  4L6V 5;  1G83 A;  1TU0 B;  2WSF E;  1D3B B;  1TG0 A;  1X27 A;  4C5E A;  2ZPE B;  1WQW A;  3V7R A;  5GAN 8;  1WLP B;  4IIO A;  5HKC A;  1WGS A;  1PSF A;  1UG1 A;  5FU7 B;  1N9R A;  1YIT T;  3JB9 I;  3OW2 P;  1VQK T;  3EH1 A;  4FW2 A;  3RUX A;  1QWF A;  2CSI A;  4KUL A;  3QSU A;  1JXM A;  1O75 A;  3G4S Q;  3UF4 A;  2DL4 A;  1Q95 G;  3PT9 A;  3OYI A;  4E7I A;  1Y7X A;  4PJO C;  3CCL A;  2A37 A;  5LJ3 g;  1W2B A;  2BE7 D;  1YJ9 T;  2LT4 A;  2WSC E;  3A8L B;  4OMQ A;  2COY A;  2DIQ A;  4Z8A A;  5KYY A;  2A28 A;  5EG2 A;  2K2M A;  3J7A F;  2CT3 A;  5LJ3 e;  3VS7 A;  1VQN Q;  1QW1 A;  2YUO A;  2HZY A;  4DBR A;  5LJ5 h;  1N27 A;  1BKB A;  4KUD K;  4RCC A;  5KYU B;  4E2F B;  4F7U G;  3WVD B;  2ZCF B;  1ZLM A;  3OYM A;  3BY7 A;  2L2P A;  1V1C A;  2DXC A;  4M7A C;  5FU6 B;  8ATC B;  2NUT A;  2AIR B;  4GY5 A;  3L2R A;  2K7A A;  1X6G A;  3EG3 A;  3LW5 E;  2RI2 A;  4NL2 A;  1VQ8 T;  2LNV A;  3M53 A;  2RJC A;  1PKS A;  3RER A;  4N4I A;  1BI0 A;  3THK A;  1M90 C;  2KRN A;  4NS5 A;  2X3X D;  3GNF B;  2CRE A;  4AFQ C;  2CZ7 B;  3OYH A;  2E64 A;  2X35 A;  1KC8 R;  1KD1 U;  2RMO A;  1RAG B;  2EGC A;  3REA B;  1VQ5 A;  4Y92 A;  1YNZ A;  5IT9 E;  1YJW T;  4XQ3 A;  5CKH A;  1EIF A;  5I2M A;  4L59 A;  5CKE A;  4DQ2 A;  2MIO A;  4LDW A;  2HBW A;  2CP5 A;  2FYK A;  2FB7 A;  1BI1 A;  2K79 A;  2MCN A;  1OOT A;  3M4Y A;  3VYG A;  2IVW A;  4C8Q B;  4ORZ A;  4DBF A;  1W4S A;  2A0F B;  2DNU A;  1M90 R;  3E19 A;  2F5T X;  2PVG B;  2LVM A;  2K5F A;  2NUP A;  1KQ2 A;  2GQI A;  2JM8 A;  2KT8 A;  2O01 E;  3QO3 A;  4FIB A;  3JCM h;  2EYY A;  3CPW P;  2A36 A;  2PUO B;  5L23 A;  2ZPB B;  2AKL A;  4FSX A;  5I2S A;  1M5Q 1;  4NL3 A;  5GMK e;  1VQM Q;  3RMQ A;  2FG0 A;  1FMV A;  2JT4 A;  3G1J A;  3L2Q A;  4C0D B;  1RAH B;  1YIJ T;  4IIM A;  4M77 A;  3CCS Q;  2ZPH B;  4LDU A;  1T3S A;  3OS5 A;  2J7I A;  2BE9 B;  3G6E A;  3CBO A;  2M9U A;  4F7U B;  5IXB A;  3UPU A;  3CC2 A;  1QLY A;  2HQE A;  3G71 T;  3E9F A;  1OX8 A;  4M75 C;  2G6F X;  4PL6 A;  2FL7 A;  2LX7 A;  2EJ9 A;  2YXY A;  5GAO n;  4BD3 A;  4A53 A;  5LJ5 g;  4PJN A;  3OYA A;  2ZPG B;  2RNA A;  2XDP A;  1YIT Q;  1H64 1;  5I22 A;  2CDT A;  2MWP A;  1JB0 E;  3TSW A;  1YI2 Q;  3INZ A;  1RAF B;  4J5Y A;  1SSH A;  3EGD A;  5LJ5 e;  2XMF A;  1Z9Q A;  1B34 B;  3JRZ A;  2GTJ A;  3WXM B;  3TRE A;  4C92 A;  4DBQ A;  2KAF A;  2KRO A;  1W70 A;  2LJ3 A;  1M2V B;  1VQL T;  5GAM g;  2L3P A;  3AT1 B;  4PKC C;  3I55 A;  4PJL A;  3VS4 A;  1WXU A;  4M7D E;  1MMA A;  4OMM A;  4A63 B;  5IXF A;  4XTV A;  4VUB A;  1G8X A;  2CZ6 B;  1N8R U;  1FWZ A;  3OYL A;  2MWO A;  3JB9 D;  4AFU C;  3F70 A;  5GAM e;  1SHG A;  1KD1 C;  1N9S A;  1PSE A;  3CCJ A;  1K73 R;  1K1Z A;  3RIR A;  1OPL A;  3FDR A;  3BFM A;  4F16 A;  1GCQ C;  1FXX A;  5LJ3 d;  2CH4 W;  3QWY A;  2O2O A;  1T0J A;  3CD6 Q;  5FRN A;  2D1X A;  3RNJ A;  3NTI A;  1FMK A;  1IXD A;  3JCM f;  3JB9 G;  3I5R A;  1RAI B;  4J9C A;  3GOX A;  2QQS A;  1D3B A;  2QGF B;  4M78 E;  1YJN Q;  1BBZ A;  1Y0M A;  2CYZ B;  2QAZ A;  4XK8 E;  4M7D F;  2E5Q A;  3CCQ T;  5CCA A;  4BDZ A;  2KT1 A;  4DOV A;  1PNJ A;  4ELY C;  1GFC A;  1NBE B;  4WCI A;  1D1A A;  2DK3 A;  2QQR A;  2RQV A;  1Q82 R;  2GTO A;  4KGV B;  4IUT A;  4QQ6 A;  2QEX T;  1RLP C;  1X2K A;  4X9C A;  1ZUK A;  3V8L A;  3VS2 A;  4OVA A;  4XTY A;  2IG0 A;  4M77 D;  3J80 E;  2GF7 A;  2LTO A;  4J83 A;  2QQA A;  5KH6 A;  4ESR A;  3TSZ A;  8AT1 B;  3OA6 A;  1GL5 A;  2OJ2 A;  3C0C A;  2V8K A;  5D6Y A;  1PG5 B;  3OSS C;  5FLX E;  3CCR A;  3CCM T;  3CC4 A;  2NWM A;  1BCO A;  3HTR A;  2E12 A;  1FX7 A;  4J9H A;  4EMK C;  1WFW A;  1UB4 A;  4HA8 A;  4O6J A;  2COZ A;  1G3T A;  1WXT A;  1TSF A;  1W1F A;  3PIO A;  1VYV A;  4M78 F;  2C0I A;  3RBB B;  2BIV A;  2KRM A;  4O5V A;  2NYS A;  2LC4 A;  4C5I A;  4M77 G;  5FWC A;  1XTD A;  1ZSZ C;  2VB6 A;  1VQN A;  4MZT A;  2K4Y A;  3SHW A;  5GMK l;  5GAN g;  1YIJ Q;  4PJO A;  2EKO A;  3H41 A;  3CME A;  1BIB A;  1D1C A;  5CKB A;  4CRI A;  2YRD A;  1SSF A;  5D7U A;  3QII A;  2GFA A;  4C92 D;  2W0Z A;  2ED0 A;  4JS4 A;  2HL5 C;  1AWO A;  1WJS A;  4BE1 A;  2NUT B;  2OTL Q;  1N8R C;  2DTO A;  2FRY A;  1SHF A;  5CR2 A;  3EG2 A;  2RK2 A;  2EGA A;  4QQG A;  3HFO A;  3CPW S;  2AT1 B;  1K9M R;  3CCU Q;  1AZG B;  1TUC A;  3ZFJ A;  1KG1 A;  2DYB A;  4IUP A;  4C92 G;  5GMK m;  4M4Z A;  4M7A A;  4M7D C;  1MHN A;  3M4G A;  1M8V A;  1Y57 A;  1X6O A;  2QGG A;  3LGF A;  3HSB A;  5LJ5 d;  1SKU B;  2CP6 A;  4BY6 C;  1QCO A;  2HNI A;  1TS9 A;  3G4S T;  2PVO B;  1VQ6 Q;  2XG8 D;  3QZ5 B;  4ZTF A;  1U3O A;  3DLL A;  4LDX A;  4BAC A;  4J9B A;  3WVE B;  2CZ0 B;  3I56 A;  1TTH B;  4J7I A;  5GAM j;  2EQK A;  4BI4 A;  1VYT A;  3JSC A;  1M4Z A;  2NUP B;  1K0S A;  1IB8 A;  3GF5 A;  3A8G B;  1BB9 A;  5GAO r;  4XTX A;  2Y90 A;  1XNI A;  2K5I A;  4OB2 B;  4LXC A;  2F1L A;  2P0Q A;  3DB3 A;  1UGV A;  3REB B;  1Q86 U;  2DLP A;  2YLB A;  4Z02 A;  1HD3 A;  4DOW A;  2K6D A;  3OYE A;  2RF0 A;  4JLG A;  1JJ2 P;  1AHJ B;  3QBY A;  4JLI A;  4M77 B;  2RQR A;  2IIM A;  2DXB A;  1U1S A;  4A4E A;  1AT1 B;  2J6K A;  2XDD A;  4FT4 A;  2DET A;  4HT9 A;  1KFZ A;  3OSV A;  2EQM A;  3M0P A;  3KFV A;  5GAO m;  2OI3 A;  4J9E A;  4OGE A;  1I4K 1;  1KJW A;  1WJQ A;  4ZNX A;  2YRV A;  3R6N A;  1AZE A;  4QVD A;  2GBQ A;  4XU2 A;  2KRS A;  3H8Z A;  1WYX A;  2D0N A;  4EDU A;  1YP5 A;  2CGH A;  2QEX Q;  3CXC S;  2AZS A;  2DZ9 A;  5KCH A;  1V76 A;  1YIT A;  3CMA Q;  3EGD B;  4F04 B;  1VQK A;  1JRI A;  4JJB A;  4OMN A;  2RPN A;  3JCM P;  4PJO D;  2JTF A;  3CBM A;  3ULR B;  2QTV A;  3VV0 A;  4C8Q E;  1VQP T;  1NEB A;  4M75 A;  3GP8 A;  3VUB A;  4C92 B;  1OYX A;  2W10 A;  1Q81 R;  2PUK B;  1PWT A;  4RUG A;  3AHU A;  1VQ7 Q;  3MEV A;  5FRM A;  1OU9 A;  4ELZ C;  2E5K A;  1HSQ A;  2V8I A;  4LUE A;  2J06 A;  1F1B B;  1RUW A;  1ACM B;  5CO7 A;  2LJ0 A;  5DY9 A;  3M5A A;  1VQ4 Q;  1MV0 B;  1YJ9 A;  3MET A;  2QA4 T;  1K8A R;  1VIF A;  2KXD A;  2CP0 A;  4PJO G;  4B9W A;  3M59 A;  3ME9 A;  2EYW A;  4FYW B;  4TVR A;  1VQM T;  3RMS A;  4RTW A;  4M7A D;  1UEB A;  2CP3 A;  2GQV A;  1U1T A;  3OY9 A;  3C94 A;  2RQU A;  4BUG A;  3EG1 A;  3NGP A;  1KIK A;  2R58 A;  2YT6 A;  1NYF A;  1M8M A;  2F5K A;  3HPW A;  2CT4 A;  2M02 A;  5GAN j;  4ATO A;  1SEM A;  1UJ0 A;  2GFU A;  4C8Q F;  3CPW A;  2CSQ A;  3FLG A;  3LH5 A;  1VQ8 A;  1VQ9 Q;  4CC7 A;  4UC4 A;  1NJI U;  3UA6 A;  2RQW A;  3VRZ A;  3P8H A;  4M7A G;  3TEE A;  5GMK h;  3E9G A;  1PRM C;  3MP8 A;  3H9N A;  1GRI A;  4E7J A;  1YI2 T;  2E70 A;  1QKX A;  2MF2 A;  2XIC A;  3Q1J A;  4R55 A;  1Q86 C;  1UDL A;  1UGS B;  2J6O A;  3TVT A;  1G2B A;  5LJ3 f;  1YJW A;  2DMO A;  2L3R A;  2K5L A;  4JJD A;  3L42 A;  1PCX A;  2JMC A;  3S3O A;  4KH1 B;  2KNB B;  3V8J A;  1MMN A;  4ME7 A;  2KVQ G;  4BI8 B;  1JBM A;  1S1N A;  1AWW A;  1MNE A;  1WHK A;  5KYN A;  1PRL C;  1R77 A;  4XAX B;  4D8K A;  3MP1 A;  3JCM Q;  2RI3 A;  3M56 A;  4X34 A;  2ROT A;  5FU6 C;  2RJE A;  4OML A;  3J81 E;  1E6G A;  1X75 C;  1VA7 A;  2DJZ A;  1HK9 A;  3CD6 T;  4QVC A;  4QKU A;  4E7K A;  2E1H A;  2DX1 A;  4PJO B;  3C4S A;  5DLO A;  2R5M A;  4FL6 A;  1PM3 A;  1RLQ C;  4M75 D;  2RHI A;  1YIJ A;  3FJ5 A;  5GAM h;  3JB9 J;  2DIG A;  4FM4 B;  1N6A A;  1YJN T;  1YHQ Q;  1I0C A;  2JOY A;  3PMI A;  2ABL A;  1MND A;  2E41 A;  4HXJ A;  2VXE A;  2GGR A;  2EIF A;  3G71 A;  2DER A;  2D8J A;  1WIE A;  3CXC A;  1IHV A;  2OX7 A;  5L8R E;  4C8Q C;  1M3B A;  1UUE A;  2CUB A;  2CP7 A;  2RJF A;  4JJC A;  4M75 G;  2L8D A;  2DD4 A;  4M7A B;  1OV3 A;  2OAU A;  3RKY A;  1QVF P;  1VQP Q;  2IPO B;  4AG1 C;  2DTI A;  2OTJ Q;  1Q7Y U;  2COW A;  2DRM A;  1PHT A;  2RD1 A;  4FU6 A;  1VQL A;  3VRY A;  3G7Z A;  1Y07 A;  3OYB A;  3QDF A;  1JXO A;  4MMK A;  1NJI C;  4XTU A;  1X6B A;  2DE0 X;  3I35 A;  3OMC A;  4C0D C;  3NFC A;  2JTM A;  2RI5 A;  5CAI A;  2XHC A;  2QA4 Q;  4M7D A;  1UEC A;  2YWW A;  5GJW B;  1C6V X;  2RHX A;  3SDZ A;  5J3B A;  4J9F A;  2DBM A;  2O9S A;  2VAS A;  4K11 A;  2RH2 A;  2H3E B;  2LQK A;  3EFS A;  3M54 A;  5GAN 6;  1RAB B;  1UHF A;  1KHC A;  2EJG A;  1S72 Q;  1YCY A;  4D6W A;  2QDL A;  1I81 A;  2LCC A;  1G5V A;  3RKW A;  2DEU A;  5LJ5 f;  2PNI A;  1U06 A;  3UDC A;  1OX9 A;  4E6R A;  2JVV A;  2OTL T;  3CEY A;  2HEQ A;  2C0T A;  1GBR A;  2LRQ A;  1B3Q A;  3EFR A;  1QP2 A;  4E7Z A;  4BE0 A;  2CUD A;  1I8F A;  4OMF B;  3S3N A;  5GMK i;  3CCQ A;  3CCU T;  2XDB A;  1IO6 A;  2WSE E;  2CH4 A;  1UJY A;  2EYQ A;  1W2B P;  4OB3 B;  2MOX A;  1D0Y A;  2E3H A;  2BZ8 A;  1JO8 A;  5A2Q E;  3VUZ A;  5GAN h;  1WZO A;  2QEX A;  3E1S A;  2RJD A;  2DIL A;  2X4Y A;  3EGX A;  4M75 B;  2F2W A;  1VQ6 T;  4KGX B;  4HVU A;  3FJP A;  4FYX B;  1QMC A;  1RAA B;  1NM7 A;  2DL5 A;  5IAY A;  3X26 B;  4C5G A;  3SWN C;  2EQI A;  3CCM A;  2SEM A;  3HL8 A;  3JCM c;  2F69 A;  5CKD A;  2HAX A;  2VGN A;  4FT2 A;  1OZ3 A;  2EGE A;  2LZ6 B;  3OW2 S;  3OYY A;  3PFS A;  1JQQ A;  2LT1 A;  2VVK A;  3A8H B;  2ZAE A;  4F14 A;  2E6N A;  4JPB W;  1QWE A;  1R0B G;  1VQO Q;  1M1K U;  1GFD A;  1TWB A;  1BYM A;  5C6S A;  2FVU A;  1MUZ A;  3X20 B;  5GAN 5;  4M77 E;  2DM1 A;  3R6O A;  4XU3 A;  3U23 A;  1C0M A;  2LP5 A;  1X43 A;  3LWH A;  5KYX A;  4E7H A;  2ZPF B;  2EJF A;  1SRL A;  2LQW A;  1M3C A;  3OS1 A;  3TQ7 P;  2RHZ A;  1KD1 R;  2P0P A;  3CCE T;  4N0A A;  2QQB A;  4F17 A;  1TOV A;  1C1A A;  2DA9 A;  3MHX A;  4M7D D;  1YN8 A;  2MMP A;  4BI3 A;  2LNH B;  4AT1 B;  3NTK A;  1WI7 A;  4GLM A;  1RAC B;  1KQ1 A;  3MEW A;  3CMA T;  4FYV B;  3UWN A;  4C92 E;  3GIB A;  1ARK A;  1PD0 A;  1CKB A;  3TCJ A;  1OI1 A;  4A54 A;  4E7S A;  2JN0 A;  3MCA B;  3JCM V;  1VQ7 T;  4M7D G;  3CCL Q;  3G4S A;  1UTI A;  2K2V A;  1ZX6 A;  2RA2 A;  4KH0 B;  3PNW C;  1O9S A;  3LLR A;  1AD5 A;  2RM4 A;  2RN8 A;  3JV3 A;  1VQ4 T;  3M55 A;  2EPD A;  1H3Z A;  2EAY A;  4RTT A;  2P4R A;  2J6F A;  4Y91 A;  2NLU A;  1ZUU A;  1NPP A;  1QVF S;  1MMG A;  4PLI A;  3HRS A;  3A1P A;  1J3T A;  2V1Q A;  3A5Z B;  4GBQ A;  3RDV A;  3UT1 A;  3MP6 A;  4RG8 A;  4LDY A;  4EMK B;  3OYD A;  4XTW A;  5GAN e;  2YRC A;  2M51 A;  2X9H A;  3LH0 A;  4C92 F;  2EWN A;  4MZP A;  5I21 A;  3CC7 T;  4EMG A;  1KQS P;  1YWO A;  2DVE A;  1MGQ A;  1WJR A;  1TH7 A;  1VQ9 T;  2QG9 B;  4PJJ A;  3EGU A;  4JZ3 A;  3JB9 H;  2FEI A;  2JS2 A;  2MI6 A;  2KGT A;  2DL3 A;  1ZQ1 A;  4CC3 A;  1U8R A;  1D0Z A;  2VUB A;  1VQ5 Q;  4EIK A;  2PQW A;  3LGL A;  1K9A A;  3ZBD A;  1M30 A;  3JCM W;  4HCK A;  2YUN A;  3CPF A;  3ZEH A;  3JAM E;  1KSW A;  1Z9Z A;  1M2O A;  2CKK A;  3CCV T;  2DL7 A;  1RAE B;  3MPU B;  3ASK A;  4DBH A;  1N8R R;  1LVK A;  1VQP A;  3MEU A;  4L5G A;  2DEQ A;  3VS5 A;  4RTX A;  4JRK A;  5CVI A;  4KT0 E;  3QG1 A;  2SRC A;  3L2V A;  1DJ7 B;  1SF9 A;  3OYF A;  3OW2 A;  2X4W A;  3CBP A;  3QPH A;  5GAM d;  5HY6 A;  1G3Y A;  5D6X A;  1ZUY A;  2M1H A;  4M7D B;  1M27 C;  3VS3 A;  1W2B S;  2H8H A;  4OP0 A;  3C12 A;  4OF1 A;  1IHW A;  2QA4 A;  3VJP A;  5I11 A;  2HMA A;  4M78 C;  2K9G A;  4PJO E;  1QCN A;  2I0N A;  2E65 A;  1MV3 A;  1VQM A;  2KXC A;  1NPR A;  1D09 B;  4PFO A;  3V7C A;  4QT7 A;  3OMG A;  3SB2 A;  3E2U A;  3O8V A;  2X51 A;  2MAM A;  3CCS A;  4WTO B;  4LD9 K;  3G6E Q;  1LOJ A;  3VS6 A;  5IH2 A;  2O4X A;  2KE9 A;  5M9O A;  2K3B A;  2YUQ A;  1YHQ T;  3CC2 Q;  1UFF A;  4D8D A;  3CCE Q;  1WHJ A;  1V29 B;  1K76 A;  3D7S B;  2CP2 A;  4HVW A;  1OU8 A;  5AT1 B;  1K4U S;  2HBP A;  4PFZ A;  3GPL A;  4X1V A;  3VS1 A;  2ZZD A;  2XI9 A;  4JRQ A;  1BIA A;  1M9S A;  1M1F A;  1ZSG A;  4HT8 A;  2JW4 A;  1OUL A;  3EAE A;  2JM9 A;  1SG5 A;  1YI2 A;  1WX6 A;  5LL6 S;  1KC8 U;  2E10 A;  1LNX A;  3BE3 A;  1I07 A;  3EHQ A;  3BW1 A;  2OTJ T;  2XKO C;  2M0Y A;  1SRM A;  3OS0 A;  2EBP A;  3I55 Q;  3I9Q A;  3EGX B;  3T9N A;  2JS0 A;  3EG0 A;  1WNL A;  2BTT A;  2RHY A;  2O88 A;  4QW2 A;  2HQH A;  4C0G A;  1WHH A;  2DTH A;  1U5S A;  3M0U A;  4BE2 A;  4ZN1 A;  5GAO q;  2LQ8 A;  3CCJ Q;  5GJV B;  1KK7 A;  3M58 A;  1M90 U;  1A0N B;  4J6X A;  4RTZ A;  1OQK A;  1BI2 A;  1R8O B;  2QI2 A;  2RB6 A;  1S72 T;  2B86 A;  3L1A A;  4F7U E;  4C0Z A;  2OAW A;  1WHG A;  1GXI E;  3CD6 A;  3SWN A;  5FU7 C;  4LUD A;  3L2U A;  1M1G A;  3HRU A;  2BKD N;  2E3I A;  3CC7 Q;  2KDS A;  2ZPI B;  5KYX B;  2MPX C;  2P4T A;  3OYK A;  3S3M A;  2AZV A;  5GAN d;  1GCQ A;  3PTA A;  4IUU A;  2ATC B;  3QZ9 B;  4DEY A;  2DBK A;  4Y28 E;  4A4K A;  4B6M A;  1YJN A;  2M0O A;  2HDA A;  3KBG A;  4ZGD B;  4FW1 A;  1AOJ A;  3HKS A;  2FZC B;  1QVG P;  2P0K A;  1NE8 A;  2BZY A;  4IUQ A;  3QWX X;  3QYG B;  1XJW B;  2ROL A;  1HYO A;  4PK4 A;  3CCV Q;  4V2S A;  5CK9 A;  4M75 E;  5AYF A;  5C0M A;  2EVR A;  3FEO A;  2XD0 A;  2CS7 A;  2KBT A;  1WPY A;  2L3S A;  4C8Q G;  3OYG A;  2DXU A;  2A08 A;  1PC0 A;  3IQL A;  3VYH B;  2EYZ A;  3N5B B;  4EMH A;  4MZM A;  1RL2 A;  3I5S A;  1KQS S;  4F7U F;  3CCR Q;  4E7L A;  4J6Y A;  3CC4 Q;  1WA7 A;  2XID A;  1IGQ A;  2ESW A;  3GBQ A;  4ZN3 A;  2DYI A;  2AKK A;  2BUD A;  2RHU A;  4X9D A;  2KSS A;  4LE9 A;  2LCS A;  2DKG A;  1G3S A;  3SFM A;  3A8M B;  2YLC A;  1Q86 R;  2YDL A;  1VQO T;  1G3W A;  2FZG B;  4J9G A;  1KC8 C;  2BZX A;  2QQ9 A;  1RI0 A;  4EMK A;  1K73 U;  4KUI A;  3CME Q;  3UA7 A;  1E7O A;  2FO0 A;  2NUZ A;  2DO3 A;  3P8D A;  3QYH B;  3X25 B;  1D0X A;  3KUF A;  2VV5 A;  1ZBJ A;  4M75 F;  2QTX A;  2L89 A;  4HVV A;  3FRN A;  2OTL A;  1PD1 A;  4GLK A;  3PVQ A;  1BCM A;  1ZSZ A;  4EPC A;  1H92 A;  4Q5W A;  4ZGE B;  3MKD A;  3DLM A;  1WHM A;  4B9X A;  3NMZ C;  3DB4 A;  2RQT A;  3LYI A;  3VU3 C;  1HJD A;  3NHN A;  5KE3 A;  4OGC A;  1T3L A;  2FPD A;  3EH2 A;  3QUI A;  1RAD B;  5GAO p;  3CCU A;  4FYY B;  1R0C B;  1ZBX A;  3NTH A;  4JRI A;  4MDX A;  1JJ2 S;  5CQY A;  4LN2 A;  3EFO B;  2D6F A;  2GNC A;  4ANJ A;  2PTK A;  3M57 A;  4RCB A;  2A3L A;  4XTZ A;  1Q82 U;  2V26 A;  1IRE B;  2R57 A; 
#chains in the Genus database with same CATH homology
 2QAZ A;  1OU8 A;  1OX9 A;  1OU9 A;  1ZSZ C;  2QAS A;  1TWB A;  1OX8 A;  1ZSZ A;  1ZSZ B;  1OUL A;  1YFN A;  2NYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...