1YFSA

The crystal structure of alanyl-trna synthetase in complex with l-alanine
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
457
structure length
448
Chain Sequence
SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanyl-tRNA synthetase
publication title Breaking sieve for steric exclusion of a noncognate amino acid from active site of a tRNA synthetase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 158
structure length 448
sequence length 457
chains with identical sequence B
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2005-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1yfsA01
4TWAA 2QHUA 3HY0A 4XU0A 1RIQA 1X56A 3QTCA 3E9HA 2QHVA 4XEOA 4H2SA 1BBWA 3V7CA 3VBBA 3IKLA 3REUA 2ZXFA 2DQ3A 4RQEA 2I4LA 3V7RA 3L4GB 1QE0A 3L2ZA 4HVCA 3RKXA 1NYQA 2DXUA 2DDZA 4YRMA 1EIYB 2RHQB 2ODRD 2PMEA 4YCVA 4XU2A 2QHSA 2ZR3A 3TEHB 1B8AA 1YFRA 1N9WA 2DJZA 1LYLA 4P74A 2XTIA 3VQYA 4CS4A 1BIAA 2ZZEA 5C51B 1WU7A 2ALYA 2IY5B 4KR2A 4HWTA 3PZCA 2CGHA 1YFTA 4K87A 3ICAA 2E41A 1E24A 1H4SA 3LC0A 1SESA 3NETA 4XTVA 1E1OA 12ASA 3V7SA 2DTHA 3EFRA 1YB3A 2Q5IA 3EFSA 3RL6A 4E51A 3VQVA 1EIYA 2AMCB 2RHQA 4P3OA 4YRTA 1L0WA 3QNEA 2C7IA 2EAYA 4EX5A 5KNNA 3UGQA 1H4VB 1WLEA 2ZINA 3A5YA 4XTUA 3A74A 4YRGA 3TEHA 1G5IA 3MF1A 4CS3A 2EWNA 4P72C 1Z7NA 3IG2A 2CJAA 2Q5HA 4TTVA 2AKWB 4YCUA 2EJFA 4TVYA 3TEGA 2DXTA 2DU5A 1WPYA 2J3MA 1NYRA 4PHCA 2ZCEA 3QO5A 2IY5A 3PCOB 5HGQA 2ZT8A 1PYSB 2EJ9A 3CMQA 4O2DA 1ADYA 1HXDA 1W66A 3W3SA 1YGBA 1BIBA 2ZTGA 1USYC 1WNLA 3RIRA 1G5HA 3E9IA 4K86A 3HY1A 4XTXA 2AMCA 3MF2A 4YRSA 4WJ4A 1QF6A 4XU3A 4UP9A 2DVEA 4YRLA 4KR3A 3V8KA 4BW9A 1KMNA 1NJ6A 2AKWA 1H4TA 4DPGA 2E1HA 3FJPA 4LNSA 5E3IA 2Q7EA 1EQRA 4NCXA 2ZR2A 4YRJA 1NJ8A 3RKYA 4XTWA 5C52B 1IL2A 1PYSA 4CH5A 1NJ5A 2DEQA 2CIMA 4YRCA 1YFSA 4H2XA 4G85A 3RF1A 1ATIA 4CS2A 2E65A 3HXZA 2CJ9A 2ZNIA 2Q7HA 3A31A 3HXXA 4RQFA 2ZIOA 3HXYA 4HWRA 4X5OA 2E5AA 3A5ZA 2QHTA 3G1ZA 1JJCB 1X2GA 4P73C 2DZ9A 1B70B 2ZT5A 4TVWA 4CH6A 3HFZB 3L4GA 1EVLA 3HRKA 1B7YB 3HXVA 5ELNA 3MEYA 3LSQA 3REXA 2DZCA 1SERA 4XTYA 1ASYA 4YREA 2DTIA 4WJ3M 1BBUA 3P8VA 4H2VA 4H2YA 4UPAA 4EO4A 4P75C 2I4OA 1B76A 4P73A 3UH0A 2ZNJA 2Q7GA 1FYFA 2EL9A 3V8JA 3HTZA 3RGLA 4CH3A 4DQ2A 2FYKA 2ZIMA 4XTZA 2I4MA 2I4NA 4H02A 2CJBA 2J3LA 1X2HA 1KOGA 1EOVA 3DSQA 3HRIA 1B70A 3BFMA 4YRKA 3HFZA 2P0LA 4P72A 2ARTA 2E64A 2ZT7A 1B7YA 1C0AA 1H4QA 1SRYA 3A32A 4WI1A 4BWAA 4YDQA 3RKWA 2ARUA 4AH6A 4CH4A 4WF2A 3TUPA 11ASA 2G4CA 4P74C 4YRIA 1USYA 4YYEA 1X01A 1HTTA 3IKMB 2ARSA 3P8TA 5K1PA 5K1XA 1X55A 3NENA 3P8YA 4YROA 3VQWA 4HWOA 3PCOA 4OLFA 3WQZA 3RUXA 2DU7A 3V8LA 5ELOA 4H2UA 4RDXA 4TVAB 1GGMA 1VQZA 5F5WA 4HWSA 3NELA 4TQFA 4YRFA 2HNIA 4YPFA 1HC7A 2ZGWA 3BJUA 5C53B 1ADJA 4RMFA 1EVKA 2ZZGA 4Q6GA 2RHSB 3UFGA 2ZZFA 1NJ2A 1WQ7A 4ZIBA 2E10A 3OD1A 3HXWA 3M4PA 1NJ1A 3KFUA 4XEMA 3QO8A 4KQEA 2ODRC 3VQXA 3A7RA 1SETA 3HFVA 4HA8A 4XU1A 4Q15A 4P71C 2DKGA 2DQ0A 3R07A 3HXUA 4HWPA 1EFWA 4UP7A 2EJGA 4K88A 4J15A 1X54A 1Z7MA 3A7AA 4OP0A 3IALA 2C8MA 3A7UA 2PMFA 3L1AA 1WYDA 4TVAA 4H2WA 4G84A 3I7FA 4P3NA 1ASZA 4YRRA 1KMMA 4UP8A 4TQDA 2RHSA 4L87A 4H2TA 3QO7A 4P71A 3ERRA 4YRQA 1JJCA 4YRPA 1J5WA 2P5IA 2DTOA 1E1TA 4YCWA 1NNHA 2E3CA 4P75A 3UGTA 4PG3A 2ZT6A 4H2XB 4YRNA 1E22A 1G51A 2XGTA 3M4QA 3LSSA 4ZTZB 1WQWA 3NEMA 2ALYB 3RACA 4YP0A 4ZTUB 4P3PA
chains in the Genus database with same CATH superfamily
4TWAA 2QHUA 3HY0A 4XU0A 1RIQA 1X56A 3QTCA 3E9HA 2QHVA 4XEOA 4H2SA 1BBWA 3V7CA 3VBBA 3IKLA 3REUA 2ZXFA 2DQ3A 4RQEA 2I4LA 3V7RA 3L4GB 1QE0A 3L2ZA 4HVCA 3RKXA 1NYQA 2DXUA 2DDZA 4YRMA 1EIYB 2RHQB 2ODRD 2PMEA 4YCVA 4XU2A 2QHSA 2ZR3A 3TEHB 1B8AA 1YFRA 1N9WA 2DJZA 1LYLA 4P74A 2XTIA 3VQYA 4CS4A 1BIAA 2ZZEA 5C51B 1WU7A 2ALYA 2IY5B 4KR2A 4HWTA 3PZCA 2CGHA 1YFTA 4K87A 3ICAA 2E41A 1E24A 1H4SA 3LC0A 1SESA 3NETA 4XTVA 1E1OA 12ASA 3V7SA 2DTHA 3EFRA 1YB3A 2Q5IA 3EFSA 3RL6A 4E51A 3VQVA 1EIYA 2AMCB 2RHQA 4P3OA 4YRTA 1L0WA 3QNEA 2C7IA 2EAYA 4EX5A 5KNNA 3UGQA 1H4VB 1WLEA 2ZINA 3A5YA 4XTUA 3A74A 4YRGA 3TEHA 1G5IA 3MF1A 4CS3A 2EWNA 4P72C 1Z7NA 3IG2A 2CJAA 2Q5HA 4TTVA 2AKWB 4YCUA 2EJFA 4TVYA 3TEGA 2DXTA 2DU5A 1WPYA 2J3MA 1NYRA 4PHCA 2ZCEA 3QO5A 2IY5A 3PCOB 5HGQA 2ZT8A 1PYSB 2EJ9A 3CMQA 4O2DA 1ADYA 1HXDA 1W66A 3W3SA 1YGBA 1BIBA 2ZTGA 1USYC 1WNLA 3RIRA 1G5HA 3E9IA 4K86A 3HY1A 4XTXA 2AMCA 3MF2A 4YRSA 2NS6A 4WJ4A 1QF6A 4XU3A 4UP9A 2DVEA 4YRLA 4KR3A 3V8KA 4BW9A 1KMNA 1NJ6A 2AKWA 1H4TA 4DPGA 2E1HA 3FJPA 4LNSA 5E3IA 2Q7EA 1EQRA 4NCXA 2ZR2A 4YRJA 1NJ8A 3RKYA 4XTWA 5C52B 1IL2A 1PYSA 4CH5A 1NJ5A 2DEQA 2CIMA 4YRCA 1YFSA 4H2XA 4G85A 3RF1A 1ATIA 4CS2A 2E65A 3HXZA 2CJ9A 2ZNIA 2Q7HA 3A31A 3HXXA 4RQFA 2ZIOA 3HXYA 4HWRA 4X5OA 2E5AA 3A5ZA 2QHTA 3G1ZA 1JJCB 1X2GA 4P73C 2DZ9A 1B70B 2ZT5A 4TVWA 4CH6A 3HFZB 3L4GA 1EVLA 3HRKA 1B7YB 3HXVA 5ELNA 3MEYA 3LSQA 3REXA 2DZCA 1SERA 4XTYA 1ASYA 4YREA 2DTIA 4WJ3M 1BBUA 3P8VA 4H2VA 4H2YA 4UPAA 4EO4A 4P75C 2I4OA 1B76A 4P73A 3UH0A 2ZNJA 2Q7GA 1FYFA 2EL9A 3V8JA 3HTZA 3RGLA 4CH3A 4DQ2A 2FYKA 2ZIMA 4XTZA 2I4MA 2I4NA 4H02A 2CJBA 2J3LA 1X2HA 1KOGA 1EOVA 3DSQA 3HRIA 1B70A 3BFMA 4YRKA 3HFZA 2P0LA 4P72A 2ARTA 2E64A 2ZT7A 1B7YA 1C0AA 1H4QA 1SRYA 4LVIA 3A32A 4WI1A 4BWAA 4YDQA 3RKWA 2ARUA 4AH6A 4CH4A 4WF2A 3TUPA 11ASA 2G4CA 4P74C 4YRIA 1USYA 4YYEA 1X01A 1HTTA 3IKMB 2ARSA 3P8TA 5K1PA 5K1XA 1X55A 3NENA 3P8YA 4YROA 3VQWA 4HWOA 3PCOA 4OLFA 3WQZA 3RUXA 2DU7A 3V8LA 5ELOA 4HT4A 4H2UA 4RDXA 4TVAB 1GGMA 1VQZA 5F5WA 4HWSA 3NELA 4TQFA 4YRFA 2HNIA 4YPFA 1HC7A 2A8EA 2ZGWA 3BJUA 5C53B 1ADJA 4RMFA 1EVKA 2ZZGA 4Q6GA 4LVKA 2RHSB 3UFGA 2ZZFA 4LVMA 1NJ2A 1WQ7A 4ZIBA 2E10A 3OD1A 3HXWA 3M4PA 1NJ1A 3KFUA 4XEMA 3QO8A 4KQEA 2ODRC 3VQXA 3A7RA 1SETA 3HFVA 4HA8A 4XU1A 4LVLA 4Q15A 4P71C 2DKGA 2DQ0A 3R07A 3HXUA 4HWPA 1EFWA 4UP7A 2EJGA 4K88A 4J15A 1X54A 1Z7MA 3A7AA 4OP0A 3IALA 2C8MA 3A7UA 2PMFA 3L1AA 1WYDA 4TVAA 4H2WA 4G84A 4LVJA 3I7FA 4P3NA 1ASZA 4YRRA 3MQZA 1KMMA 4UP8A 4TQDA 2RHSA 4L87A 4H2TA 3QO7A 4P71A 3ERRA 4YRQA 1JJCA 4YRPA 1J5WA 2P5IA 2DTOA 1E1TA 4YCWA 1NNHA 2E3CA 4P75A 3UGTA 4PG3A 2ZT6A 4H2XB 4YRNA 1E22A 1G51A 2XGTA 3M4QA 3LSSA 4ZTZB 1WQWA 3NEMA 2ALYB 3RACA 4YP0A 4ZTUB 4P3PA
chains in the Genus database with same CATH topology
4TWAA 2QHUA 3HY0A 4XU0A 1RIQA 1X56A 3QTCA 3E9HA 2QHVA 4XEOA 4H2SA 1BBWA 3V7CA 3VBBA 3IKLA 3REUA 2ZXFA 2DQ3A 4RQEA 2I4LA 3V7RA 3L4GB 1QE0A 3L2ZA 4HVCA 3RKXA 1NYQA 2DXUA 2DDZA 4YRMA 1EIYB 2RHQB 2ODRD 2PMEA 4YCVA 4XU2A 2QHSA 2ZR3A 3TEHB 1B8AA 1YFRA 1N9WA 2DJZA 1LYLA 4P74A 2XTIA 3VQYA 4CS4A 1BIAA 2ZZEA 5C51B 1WU7A 2ALYA 2IY5B 4KR2A 4HWTA 3PZCA 2CGHA 1YFTA 4K87A 3ICAA 2E41A 1E24A 1H4SA 3LC0A 1SESA 3NETA 4XTVA 1E1OA 12ASA 3V7SA 2DTHA 3EFRA 1YB3A 2Q5IA 3EFSA 3RL6A 4E51A 3VQVA 1EIYA 2AMCB 2RHQA 4P3OA 4YRTA 1L0WA 3QNEA 2C7IA 2EAYA 4EX5A 5KNNA 3UGQA 1H4VB 1WLEA 2ZINA 3A5YA 4XTUA 3A74A 4YRGA 3TEHA 1G5IA 3MF1A 4CS3A 2EWNA 4P72C 1Z7NA 3IG2A 2CJAA 2Q5HA 4TTVA 2AKWB 4YCUA 2EJFA 4TVYA 3TEGA 2DXTA 2DU5A 1WPYA 2J3MA 1NYRA 4PHCA 2ZCEA 3QO5A 2IY5A 3PCOB 5HGQA 2ZT8A 1PYSB 2EJ9A 3CMQA 4O2DA 1ADYA 1HXDA 1W66A 3W3SA 1YGBA 1BIBA 2ZTGA 1USYC 1WNLA 3RIRA 1G5HA 3E9IA 4K86A 3HY1A 4XTXA 2AMCA 3MF2A 4YRSA 2NS6A 4WJ4A 1QF6A 4XU3A 4UP9A 2DVEA 4YRLA 4KR3A 3V8KA 4BW9A 1KMNA 1NJ6A 2AKWA 1H4TA 4DPGA 2E1HA 3FJPA 4LNSA 5E3IA 2Q7EA 1EQRA 4NCXA 2ZR2A 4YRJA 1NJ8A 3RKYA 4XTWA 5C52B 1IL2A 1PYSA 4CH5A 1NJ5A 2DEQA 2CIMA 4YRCA 1YFSA 4H2XA 4G85A 3RF1A 1ATIA 4CS2A 2E65A 3HXZA 2CJ9A 2ZNIA 2Q7HA 3A31A 3HXXA 4RQFA 2ZIOA 3HXYA 4HWRA 4X5OA 2E5AA 3A5ZA 2QHTA 3G1ZA 1JJCB 1X2GA 4P73C 2DZ9A 1B70B 2ZT5A 4TVWA 4CH6A 3HFZB 3L4GA 1EVLA 3HRKA 1B7YB 3HXVA 5ELNA 3MEYA 3LSQA 3REXA 2DZCA 1SERA 4XTYA 1ASYA 4YREA 2DTIA 4WJ3M 1BBUA 3P8VA 4H2VA 4H2YA 4UPAA 4EO4A 4P75C 2I4OA 1B76A 4P73A 3UH0A 2ZNJA 2Q7GA 1FYFA 2EL9A 3V8JA 3HTZA 3RGLA 4CH3A 4DQ2A 2FYKA 2ZIMA 4XTZA 2I4MA 2I4NA 4H02A 2CJBA 2J3LA 1X2HA 1KOGA 1EOVA 3DSQA 3HRIA 1B70A 3BFMA 4YRKA 3HFZA 2P0LA 4P72A 2ARTA 2E64A 2ZT7A 1B7YA 1C0AA 1H4QA 1SRYA 4LVIA 3A32A 4WI1A 4BWAA 4YDQA 3RKWA 2ARUA 4AH6A 4CH4A 4WF2A 3TUPA 11ASA 2G4CA 4P74C 4YRIA 1USYA 4YYEA 1X01A 1HTTA 3IKMB 2ARSA 3P8TA 5K1PA 5K1XA 1X55A 3NENA 3P8YA 4YROA 3VQWA 4HWOA 3PCOA 4OLFA 3WQZA 3RUXA 2DU7A 3V8LA 5ELOA 4HT4A 4H2UA 4RDXA 4TVAB 1GGMA 1VQZA 5F5WA 4HWSA 3NELA 4TQFA 4YRFA 2HNIA 4YPFA 1HC7A 2A8EA 2ZGWA 3BJUA 5C53B 1ADJA 4RMFA 1EVKA 2ZZGA 4Q6GA 4LVKA 2RHSB 3UFGA 2ZZFA 4LVMA 1NJ2A 1WQ7A 4ZIBA 2E10A 3OD1A 3HXWA 3M4PA 1NJ1A 3KFUA 4XEMA 3QO8A 4KQEA 2ODRC 3VQXA 3A7RA 1SETA 3HFVA 4HA8A 4XU1A 4LVLA 4Q15A 4P71C 2DKGA 2DQ0A 3R07A 3HXUA 4HWPA 1EFWA 4UP7A 2EJGA 4K88A 4J15A 1X54A 1Z7MA 3A7AA 4OP0A 3IALA 2C8MA 3A7UA 2PMFA 3L1AA 1WYDA 4TVAA 4H2WA 4G84A 4LVJA 3I7FA 4P3NA 1ASZA 4YRRA 3MQZA 1KMMA 4UP8A 4TQDA 2RHSA 4L87A 4H2TA 3QO7A 4P71A 3ERRA 4YRQA 1JJCA 4YRPA 1J5WA 2P5IA 2DTOA 1E1TA 4YCWA 1NNHA 2E3CA 4P75A 3UGTA 4PG3A 2ZT6A 4H2XB 4YRNA 1E22A 1G51A 2XGTA 3M4QA 3LSSA 4ZTZB 1WQWA 3NEMA 2ALYB 3RACA 4YP0A 4ZTUB 4P3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TWA A;  2QHU A;  3HY0 A;  4XU0 A;  1RIQ A;  1X56 A;  3QTC A;  3E9H A;  2QHV A;  4XEO A;  4H2S A;  1BBW A;  3V7C A;  3VBB A;  3IKL A;  3REU A;  2ZXF A;  2DQ3 A;  4RQE A;  2I4L A;  3V7R A;  3L4G B;  1QE0 A;  3L2Z A;  4HVC A;  3RKX A;  1NYQ A;  2DXU A;  2DDZ A;  4YRM A;  1EIY B;  2RHQ B;  2ODR D;  2PME A;  4YCV A;  4XU2 A;  2QHS A;  2ZR3 A;  3TEH B;  1B8A A;  1YFR A;  1N9W A;  2DJZ A;  1LYL A;  4P74 A;  2XTI A;  3VQY A;  4CS4 A;  1BIA A;  2ZZE A;  5C51 B;  1WU7 A;  2ALY A;  2IY5 B;  4KR2 A;  4HWT A;  3PZC A;  2CGH A;  1YFT A;  4K87 A;  3ICA A;  2E41 A;  1E24 A;  1H4S A;  3LC0 A;  1SES A;  3NET A;  4XTV A;  1E1O A;  12AS A;  3V7S A;  2DTH A;  3EFR A;  1YB3 A;  2Q5I A;  3EFS A;  3RL6 A;  4E51 A;  3VQV A;  1EIY A;  2AMC B;  2RHQ A;  4P3O A;  4YRT A;  1L0W A;  3QNE A;  2C7I A;  2EAY A;  4EX5 A;  5KNN A;  3UGQ A;  1H4V B;  1WLE A;  2ZIN A;  3A5Y A;  4XTU A;  3A74 A;  4YRG A;  3TEH A;  1G5I A;  3MF1 A;  4CS3 A;  2EWN A;  4P72 C;  1Z7N A;  3IG2 A;  2CJA A;  2Q5H A;  4TTV A;  2AKW B;  4YCU A;  2EJF A;  4TVY A;  3TEG A;  2DXT A;  2DU5 A;  1WPY A;  2J3M A;  1NYR A;  4PHC A;  2ZCE A;  3QO5 A;  2IY5 A;  3PCO B;  5HGQ A;  2ZT8 A;  1PYS B;  2EJ9 A;  3CMQ A;  4O2D A;  1ADY A;  1HXD A;  1W66 A;  3W3S A;  1YGB A;  1BIB A;  2ZTG A;  1USY C;  1WNL A;  3RIR A;  1G5H A;  3E9I A;  4K86 A;  3HY1 A;  4XTX A;  2AMC A;  3MF2 A;  4YRS A;  4WJ4 A;  1QF6 A;  4XU3 A;  4UP9 A;  2DVE A;  4YRL A;  4KR3 A;  3V8K A;  4BW9 A;  1KMN A;  1NJ6 A;  2AKW A;  1H4T A;  4DPG A;  2E1H A;  3FJP A;  4LNS A;  5E3I A;  2Q7E A;  1EQR A;  4NCX A;  2ZR2 A;  4YRJ A;  1NJ8 A;  3RKY A;  4XTW A;  5C52 B;  1IL2 A;  1PYS A;  4CH5 A;  1NJ5 A;  2DEQ A;  2CIM A;  4YRC A;  1YFS A;  4H2X A;  4G85 A;  3RF1 A;  1ATI A;  4CS2 A;  2E65 A;  3HXZ A;  2CJ9 A;  2ZNI A;  2Q7H A;  3A31 A;  3HXX A;  4RQF A;  2ZIO A;  3HXY A;  4HWR A;  4X5O A;  2E5A A;  3A5Z A;  2QHT A;  3G1Z A;  1JJC B;  1X2G A;  4P73 C;  2DZ9 A;  1B70 B;  2ZT5 A;  4TVW A;  4CH6 A;  3HFZ B;  3L4G A;  1EVL A;  3HRK A;  1B7Y B;  3HXV A;  5ELN A;  3MEY A;  3LSQ A;  3REX A;  2DZC A;  1SER A;  4XTY A;  1ASY A;  4YRE A;  2DTI A;  4WJ3 M;  1BBU A;  3P8V A;  4H2V A;  4H2Y A;  4UPA A;  4EO4 A;  4P75 C;  2I4O A;  1B76 A;  4P73 A;  3UH0 A;  2ZNJ A;  2Q7G A;  1FYF A;  2EL9 A;  3V8J A;  3HTZ A;  3RGL A;  4CH3 A;  4DQ2 A;  2FYK A;  2ZIM A;  4XTZ A;  2I4M A;  2I4N A;  4H02 A;  2CJB A;  2J3L A;  1X2H A;  1KOG A;  1EOV A;  3DSQ A;  3HRI A;  1B70 A;  3BFM A;  4YRK A;  3HFZ A;  2P0L A;  4P72 A;  2ART A;  2E64 A;  2ZT7 A;  1B7Y A;  1C0A A;  1H4Q A;  1SRY A;  3A32 A;  4WI1 A;  4BWA A;  4YDQ A;  3RKW A;  2ARU A;  4AH6 A;  4CH4 A;  4WF2 A;  3TUP A;  11AS A;  2G4C A;  4P74 C;  4YRI A;  1USY A;  4YYE A;  1X01 A;  1HTT A;  3IKM B;  2ARS A;  3P8T A;  5K1P A;  5K1X A;  1X55 A;  3NEN A;  3P8Y A;  4YRO A;  3VQW A;  4HWO A;  3PCO A;  4OLF A;  3WQZ A;  3RUX A;  2DU7 A;  3V8L A;  5ELO A;  4H2U A;  4RDX A;  4TVA B;  1GGM A;  1VQZ A;  5F5W A;  4HWS A;  3NEL A;  4TQF A;  4YRF A;  2HNI A;  4YPF A;  1HC7 A;  2ZGW A;  3BJU A;  5C53 B;  1ADJ A;  4RMF A;  1EVK A;  2ZZG A;  4Q6G A;  2RHS B;  3UFG A;  2ZZF A;  1NJ2 A;  1WQ7 A;  4ZIB A;  2E10 A;  3OD1 A;  3HXW A;  3M4P A;  1NJ1 A;  3KFU A;  4XEM A;  3QO8 A;  4KQE A;  2ODR C;  3VQX A;  3A7R A;  1SET A;  3HFV A;  4HA8 A;  4XU1 A;  4Q15 A;  4P71 C;  2DKG A;  2DQ0 A;  3R07 A;  3HXU A;  4HWP A;  1EFW A;  4UP7 A;  2EJG A;  4K88 A;  4J15 A;  1X54 A;  1Z7M A;  3A7A A;  4OP0 A;  3IAL A;  2C8M A;  3A7U A;  2PMF A;  3L1A A;  1WYD A;  4TVA A;  4H2W A;  4G84 A;  3I7F A;  4P3N A;  1ASZ A;  4YRR A;  1KMM A;  4UP8 A;  4TQD A;  2RHS A;  4L87 A;  4H2T A;  3QO7 A;  4P71 A;  3ERR A;  4YRQ A;  1JJC A;  4YRP A;  1J5W A;  2P5I A;  2DTO A;  1E1T A;  4YCW A;  1NNH A;  2E3C A;  4P75 A;  3UGT A;  4PG3 A;  2ZT6 A;  4H2X B;  4YRN A;  1E22 A;  1G51 A;  2XGT A;  3M4Q A;  3LSS A;  4ZTZ B;  1WQW A;  3NEM A;  2ALY B;  3RAC A;  4YP0 A;  4ZTU B;  4P3P A; 
#chains in the Genus database with same CATH topology
 4TWA A;  2QHU A;  3HY0 A;  4XU0 A;  1RIQ A;  1X56 A;  3QTC A;  3E9H A;  2QHV A;  4XEO A;  4H2S A;  1BBW A;  3V7C A;  3VBB A;  3IKL A;  3REU A;  2ZXF A;  2DQ3 A;  4RQE A;  2I4L A;  3V7R A;  3L4G B;  1QE0 A;  3L2Z A;  4HVC A;  3RKX A;  1NYQ A;  2DXU A;  2DDZ A;  4YRM A;  1EIY B;  2RHQ B;  2ODR D;  2PME A;  4YCV A;  4XU2 A;  2QHS A;  2ZR3 A;  3TEH B;  1B8A A;  1YFR A;  1N9W A;  2DJZ A;  1LYL A;  4P74 A;  2XTI A;  3VQY A;  4CS4 A;  1BIA A;  2ZZE A;  5C51 B;  1WU7 A;  2ALY A;  2IY5 B;  4KR2 A;  4HWT A;  3PZC A;  2CGH A;  1YFT A;  4K87 A;  3ICA A;  2E41 A;  1E24 A;  1H4S A;  3LC0 A;  1SES A;  3NET A;  4XTV A;  1E1O A;  12AS A;  3V7S A;  2DTH A;  3EFR A;  1YB3 A;  2Q5I A;  3EFS A;  3RL6 A;  4E51 A;  3VQV A;  1EIY A;  2AMC B;  2RHQ A;  4P3O A;  4YRT A;  1L0W A;  3QNE A;  2C7I A;  2EAY A;  4EX5 A;  5KNN A;  3UGQ A;  1H4V B;  1WLE A;  2ZIN A;  3A5Y A;  4XTU A;  3A74 A;  4YRG A;  3TEH A;  1G5I A;  3MF1 A;  4CS3 A;  2EWN A;  4P72 C;  1Z7N A;  3IG2 A;  2CJA A;  2Q5H A;  4TTV A;  2AKW B;  4YCU A;  2EJF A;  4TVY A;  3TEG A;  2DXT A;  2DU5 A;  1WPY A;  2J3M A;  1NYR A;  4PHC A;  2ZCE A;  3QO5 A;  2IY5 A;  3PCO B;  5HGQ A;  2ZT8 A;  1PYS B;  2EJ9 A;  3CMQ A;  4O2D A;  1ADY A;  1HXD A;  1W66 A;  3W3S A;  1YGB A;  1BIB A;  2ZTG A;  1USY C;  1WNL A;  3RIR A;  1G5H A;  3E9I A;  4K86 A;  3HY1 A;  4XTX A;  2AMC A;  3MF2 A;  4YRS A;  2NS6 A;  4WJ4 A;  1QF6 A;  4XU3 A;  4UP9 A;  2DVE A;  4YRL A;  4KR3 A;  3V8K A;  4BW9 A;  1KMN A;  1NJ6 A;  2AKW A;  1H4T A;  4DPG A;  2E1H A;  3FJP A;  4LNS A;  5E3I A;  2Q7E A;  1EQR A;  4NCX A;  2ZR2 A;  4YRJ A;  1NJ8 A;  3RKY A;  4XTW A;  5C52 B;  1IL2 A;  1PYS A;  4CH5 A;  1NJ5 A;  2DEQ A;  2CIM A;  4YRC A;  1YFS A;  4H2X A;  4G85 A;  3RF1 A;  1ATI A;  4CS2 A;  2E65 A;  3HXZ A;  2CJ9 A;  2ZNI A;  2Q7H A;  3A31 A;  3HXX A;  4RQF A;  2ZIO A;  3HXY A;  4HWR A;  4X5O A;  2E5A A;  3A5Z A;  2QHT A;  3G1Z A;  1JJC B;  1X2G A;  4P73 C;  2DZ9 A;  1B70 B;  2ZT5 A;  4TVW A;  4CH6 A;  3HFZ B;  3L4G A;  1EVL A;  3HRK A;  1B7Y B;  3HXV A;  5ELN A;  3MEY A;  3LSQ A;  3REX A;  2DZC A;  1SER A;  4XTY A;  1ASY A;  4YRE A;  2DTI A;  4WJ3 M;  1BBU A;  3P8V A;  4H2V A;  4H2Y A;  4UPA A;  4EO4 A;  4P75 C;  2I4O A;  1B76 A;  4P73 A;  3UH0 A;  2ZNJ A;  2Q7G A;  1FYF A;  2EL9 A;  3V8J A;  3HTZ A;  3RGL A;  4CH3 A;  4DQ2 A;  2FYK A;  2ZIM A;  4XTZ A;  2I4M A;  2I4N A;  4H02 A;  2CJB A;  2J3L A;  1X2H A;  1KOG A;  1EOV A;  3DSQ A;  3HRI A;  1B70 A;  3BFM A;  4YRK A;  3HFZ A;  2P0L A;  4P72 A;  2ART A;  2E64 A;  2ZT7 A;  1B7Y A;  1C0A A;  1H4Q A;  1SRY A;  4LVI A;  3A32 A;  4WI1 A;  4BWA A;  4YDQ A;  3RKW A;  2ARU A;  4AH6 A;  4CH4 A;  4WF2 A;  3TUP A;  11AS A;  2G4C A;  4P74 C;  4YRI A;  1USY A;  4YYE A;  1X01 A;  1HTT A;  3IKM B;  2ARS A;  3P8T A;  5K1P A;  5K1X A;  1X55 A;  3NEN A;  3P8Y A;  4YRO A;  3VQW A;  4HWO A;  3PCO A;  4OLF A;  3WQZ A;  3RUX A;  2DU7 A;  3V8L A;  5ELO A;  4HT4 A;  4H2U A;  4RDX A;  4TVA B;  1GGM A;  1VQZ A;  5F5W A;  4HWS A;  3NEL A;  4TQF A;  4YRF A;  2HNI A;  4YPF A;  1HC7 A;  2A8E A;  2ZGW A;  3BJU A;  5C53 B;  1ADJ A;  4RMF A;  1EVK A;  2ZZG A;  4Q6G A;  4LVK A;  2RHS B;  3UFG A;  2ZZF A;  4LVM A;  1NJ2 A;  1WQ7 A;  4ZIB A;  2E10 A;  3OD1 A;  3HXW A;  3M4P A;  1NJ1 A;  3KFU A;  4XEM A;  3QO8 A;  4KQE A;  2ODR C;  3VQX A;  3A7R A;  1SET A;  3HFV A;  4HA8 A;  4XU1 A;  4LVL A;  4Q15 A;  4P71 C;  2DKG A;  2DQ0 A;  3R07 A;  3HXU A;  4HWP A;  1EFW A;  4UP7 A;  2EJG A;  4K88 A;  4J15 A;  1X54 A;  1Z7M A;  3A7A A;  4OP0 A;  3IAL A;  2C8M A;  3A7U A;  2PMF A;  3L1A A;  1WYD A;  4TVA A;  4H2W A;  4G84 A;  4LVJ A;  3I7F A;  4P3N A;  1ASZ A;  4YRR A;  3MQZ A;  1KMM A;  4UP8 A;  4TQD A;  2RHS A;  4L87 A;  4H2T A;  3QO7 A;  4P71 A;  3ERR A;  4YRQ A;  1JJC A;  4YRP A;  1J5W A;  2P5I A;  2DTO A;  1E1T A;  4YCW A;  1NNH A;  2E3C A;  4P75 A;  3UGT A;  4PG3 A;  2ZT6 A;  4H2X B;  4YRN A;  1E22 A;  1G51 A;  2XGT A;  3M4Q A;  3LSS A;  4ZTZ B;  1WQW A;  3NEM A;  2ALY B;  3RAC A;  4YP0 A;  4ZTU B;  4P3P A; 
#chains in the Genus database with same CATH homology
 4TWA A;  2QHU A;  3HY0 A;  4XU0 A;  1RIQ A;  1X56 A;  3QTC A;  3E9H A;  2QHV A;  4XEO A;  4H2S A;  1BBW A;  3V7C A;  3VBB A;  3IKL A;  3REU A;  2ZXF A;  2DQ3 A;  4RQE A;  2I4L A;  3V7R A;  3L4G B;  1QE0 A;  3L2Z A;  4HVC A;  3RKX A;  1NYQ A;  2DXU A;  2DDZ A;  4YRM A;  1EIY B;  2RHQ B;  2ODR D;  2PME A;  4YCV A;  4XU2 A;  2QHS A;  2ZR3 A;  3TEH B;  1B8A A;  1YFR A;  1N9W A;  2DJZ A;  1LYL A;  4P74 A;  2XTI A;  3VQY A;  4CS4 A;  1BIA A;  2ZZE A;  5C51 B;  1WU7 A;  2ALY A;  2IY5 B;  4KR2 A;  4HWT A;  3PZC A;  2CGH A;  1YFT A;  4K87 A;  3ICA A;  2E41 A;  1E24 A;  1H4S A;  3LC0 A;  1SES A;  3NET A;  4XTV A;  1E1O A;  12AS A;  3V7S A;  2DTH A;  3EFR A;  1YB3 A;  2Q5I A;  3EFS A;  3RL6 A;  4E51 A;  3VQV A;  1EIY A;  2AMC B;  2RHQ A;  4P3O A;  4YRT A;  1L0W A;  3QNE A;  2C7I A;  2EAY A;  4EX5 A;  5KNN A;  3UGQ A;  1H4V B;  1WLE A;  2ZIN A;  3A5Y A;  4XTU A;  3A74 A;  4YRG A;  3TEH A;  1G5I A;  3MF1 A;  4CS3 A;  2EWN A;  4P72 C;  1Z7N A;  3IG2 A;  2CJA A;  2Q5H A;  4TTV A;  2AKW B;  4YCU A;  2EJF A;  4TVY A;  3TEG A;  2DXT A;  2DU5 A;  1WPY A;  2J3M A;  1NYR A;  4PHC A;  2ZCE A;  3QO5 A;  2IY5 A;  3PCO B;  5HGQ A;  2ZT8 A;  1PYS B;  2EJ9 A;  3CMQ A;  4O2D A;  1ADY A;  1HXD A;  1W66 A;  3W3S A;  1YGB A;  1BIB A;  2ZTG A;  1USY C;  1WNL A;  3RIR A;  1G5H A;  3E9I A;  4K86 A;  3HY1 A;  4XTX A;  2AMC A;  3MF2 A;  4YRS A;  2NS6 A;  4WJ4 A;  1QF6 A;  4XU3 A;  4UP9 A;  2DVE A;  4YRL A;  4KR3 A;  3V8K A;  4BW9 A;  1KMN A;  1NJ6 A;  2AKW A;  1H4T A;  4DPG A;  2E1H A;  3FJP A;  4LNS A;  5E3I A;  2Q7E A;  1EQR A;  4NCX A;  2ZR2 A;  4YRJ A;  1NJ8 A;  3RKY A;  4XTW A;  5C52 B;  1IL2 A;  1PYS A;  4CH5 A;  1NJ5 A;  2DEQ A;  2CIM A;  4YRC A;  1YFS A;  4H2X A;  4G85 A;  3RF1 A;  1ATI A;  4CS2 A;  2E65 A;  3HXZ A;  2CJ9 A;  2ZNI A;  2Q7H A;  3A31 A;  3HXX A;  4RQF A;  2ZIO A;  3HXY A;  4HWR A;  4X5O A;  2E5A A;  3A5Z A;  2QHT A;  3G1Z A;  1JJC B;  1X2G A;  4P73 C;  2DZ9 A;  1B70 B;  2ZT5 A;  4TVW A;  4CH6 A;  3HFZ B;  3L4G A;  1EVL A;  3HRK A;  1B7Y B;  3HXV A;  5ELN A;  3MEY A;  3LSQ A;  3REX A;  2DZC A;  1SER A;  4XTY A;  1ASY A;  4YRE A;  2DTI A;  4WJ3 M;  1BBU A;  3P8V A;  4H2V A;  4H2Y A;  4UPA A;  4EO4 A;  4P75 C;  2I4O A;  1B76 A;  4P73 A;  3UH0 A;  2ZNJ A;  2Q7G A;  1FYF A;  2EL9 A;  3V8J A;  3HTZ A;  3RGL A;  4CH3 A;  4DQ2 A;  2FYK A;  2ZIM A;  4XTZ A;  2I4M A;  2I4N A;  4H02 A;  2CJB A;  2J3L A;  1X2H A;  1KOG A;  1EOV A;  3DSQ A;  3HRI A;  1B70 A;  3BFM A;  4YRK A;  3HFZ A;  2P0L A;  4P72 A;  2ART A;  2E64 A;  2ZT7 A;  1B7Y A;  1C0A A;  1H4Q A;  1SRY A;  4LVI A;  3A32 A;  4WI1 A;  4BWA A;  4YDQ A;  3RKW A;  2ARU A;  4AH6 A;  4CH4 A;  4WF2 A;  3TUP A;  11AS A;  2G4C A;  4P74 C;  4YRI A;  1USY A;  4YYE A;  1X01 A;  1HTT A;  3IKM B;  2ARS A;  3P8T A;  5K1P A;  5K1X A;  1X55 A;  3NEN A;  3P8Y A;  4YRO A;  3VQW A;  4HWO A;  3PCO A;  4OLF A;  3WQZ A;  3RUX A;  2DU7 A;  3V8L A;  5ELO A;  4HT4 A;  4H2U A;  4RDX A;  4TVA B;  1GGM A;  1VQZ A;  5F5W A;  4HWS A;  3NEL A;  4TQF A;  4YRF A;  2HNI A;  4YPF A;  1HC7 A;  2A8E A;  2ZGW A;  3BJU A;  5C53 B;  1ADJ A;  4RMF A;  1EVK A;  2ZZG A;  4Q6G A;  4LVK A;  2RHS B;  3UFG A;  2ZZF A;  4LVM A;  1NJ2 A;  1WQ7 A;  4ZIB A;  2E10 A;  3OD1 A;  3HXW A;  3M4P A;  1NJ1 A;  3KFU A;  4XEM A;  3QO8 A;  4KQE A;  2ODR C;  3VQX A;  3A7R A;  1SET A;  3HFV A;  4HA8 A;  4XU1 A;  4LVL A;  4Q15 A;  4P71 C;  2DKG A;  2DQ0 A;  3R07 A;  3HXU A;  4HWP A;  1EFW A;  4UP7 A;  2EJG A;  4K88 A;  4J15 A;  1X54 A;  1Z7M A;  3A7A A;  4OP0 A;  3IAL A;  2C8M A;  3A7U A;  2PMF A;  3L1A A;  1WYD A;  4TVA A;  4H2W A;  4G84 A;  4LVJ A;  3I7F A;  4P3N A;  1ASZ A;  4YRR A;  3MQZ A;  1KMM A;  4UP8 A;  4TQD A;  2RHS A;  4L87 A;  4H2T A;  3QO7 A;  4P71 A;  3ERR A;  4YRQ A;  1JJC A;  4YRP A;  1J5W A;  2P5I A;  2DTO A;  1E1T A;  4YCW A;  1NNH A;  2E3C A;  4P75 A;  3UGT A;  4PG3 A;  2ZT6 A;  4H2X B;  4YRN A;  1E22 A;  1G51 A;  2XGT A;  3M4Q A;  3LSS A;  4ZTZ B;  1WQW A;  3NEM A;  2ALY B;  3RAC A;  4YP0 A;  4ZTU B;  4P3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...