1YFSA

The crystal structure of alanyl-trna synthetase in complex with l-alanine
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
457
structure length
448
Chain Sequence
SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Breaking sieve for steric exclusion of a noncognate amino acid from active site of a tRNA synthetase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Alanyl-tRNA synthetase
total genus 158
structure length 448
sequence length 457
chains with identical sequence B
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2005-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1yfsA01
3A5YA 4H2WA 3BJUA 4LNSA 1X54A 4YDQA 3NETA 1H4TA 1LYLA 2E10A 1USYC 2DZ9A 4CH3A 1WNLA 4XU1A 3R07A 3HXUA 5ELOA 2CJAA 4UP8A 4P3PA 1NJ5A 4HWOA 4P3NA 4XU3A 1B7YB 5C53B 1ASZA 3PCOA 4XTWA 2AMCB 3HXVA 3VQXA 3L4GB 2Q7GA 3TEGA 11ASA 1H4VB 3EFRA 4P75A 1G5HA 1EVLA 1NYQA 3A74A 3HXWA 3TEHA 1NJ6A 4YYEA 4YCWA 4XU0A 4P75C 3RF1A 3OD1A 2P5IA 4G84A 3A31A 3LSSA 4YRIA 1HTTA 4CS4A 1QF6A 2FYKA 4TVAA 4O2DA 4YRCA 2Q5IA 2RHQA 5C52B 1JJCB 4XTYA 4YRPA 4CS2A 3DSQA 3QO5A 3REXA 1EOVA 3PZCA 1WLEA 1YB3A 1NYRA 4DPGA 4P71A 4TQFA 1B7YA 5HGQA 2ODRC 2I4LA 4DQ2A 3MF1A 4H2UA 1Z7NA 2HNIA 4YRGA 1SRYA 3P8VA 4P71C 4P73A 4YROA 1L0WA 4YRSA 4WJ3M 1X55A 1B8AA 4TWAA 1H4SA 1EIYB 2EJ9A 3IKLA 2ZZGA 4UPAA 1SETA 3VQWA 2DZCA 2ZTGA 3VQVA 4EO4A 4YRLA 4HWTA 1ATIA 2DEQA 4H2TA 2RHSB 3NENA 1J5WA 3HXYA 4RDXA 2ZT6A 1X2GA 1G51A 1W66A 3I7FA 4P72C 4H2XB 1E1TA 3VQYA 2ZCEA 2I4OA 1PYSB 2ALYA 4XTZA 4RQEA 4Q15A 2ZZEA 1QE0A 3A5ZA 4WJ4A 3QTCA 2CGHA 2E3CA 2EJGA 3RACA 3REUA 4YRTA 4RMFA 4UP7A 3V8JA 3VBBA 2DQ0A 4XEMA 1X2HA 4HWRA 3HFZA 2DJZA 1SESA 1BIAA 2J3MA 3M4PA 1FYFA 2I4NA 2Q7HA 4P73C 1NNHA 1EFWA 4AH6A 2E64A 2DTIA 4G85A 3HRKA 4H2YA 4TTVA 2ARTA 4TVYA 3V7SA 4HWSA 3ICAA 4TQDA 2ZIOA 2DTOA 2G4CA 4YRJA 4OLFA 3V8LA 3M4QA 2Q7EA 5F5WA 1YFRA 1X56A 1BBWA 1HC7A 3HXZA 2CIMA 4X5OA 4CH4A 5ELNA 1Z7MA 2ALYB 1NJ2A 2EWNA 1WQWA 1GGMA 3QO8A 4YCUA 2PMFA 1WYDA 2ZXFA 2C8MA 4P72A 1E1OA 2ZNJA 4YRQA 4P74A 4UP9A 4HA8A 3ERRA 3HFZB 3HY0A 2I4MA 3A7UA 3HTZA 4KQEA 5C51B 2P0LA 3LC0A 2ODRD 4E51A 2EAYA 1NJ1A 4XEOA 4XTVA 2E41A 4K88A 2DDZA 3RL6A 2J3LA 1ADJA 4YRFA 3TEHB 2C7IA 3RKWA 1KMMA 1YGBA 2Q5HA 4H2SA 4OP0A 3PCOB 1E22A 2DKGA 1NJ8A 3L4GA 4BWAA 1USYA 2DXUA 3BFMA 1WQ7A 2AKWA 2XTIA 3IKMB 1JJCA 3RGLA 3UH0A 2QHTA 2DTHA 3L1AA 3CMQA 1KMNA 3G1ZA 5K1PA 1H4QA 2IY5B 4P3OA 4TVWA 4CS3A 4XTXA 3LSQA 3IALA 4YRNA 3L2ZA 4ZTUB 4WI1A 4NCXA 1BBUA 2PMEA 4HVCA 4RQFA 4TVAB 2ARSA 2RHQB 4ZTZB 3IG2A 12ASA 1WPYA 4XU2A 4YCVA 2DXTA 2DVEA 2E1HA 3A7AA 1EIYA 1N9WA 1WU7A 1ASYA 3HRIA 2QHSA 3EFSA 4L87A 4BW9A 3FJPA 4YRMA 1VQZA 1IL2A 2ZINA 2QHVA 4K87A 2EL9A 3QNEA 4WF2A 2AKWB 4H2XA 1KOGA 3A32A 2ZGWA 3RKYA 4P74C 1B70B 4EX5A 1RIQA 2IY5A 4YPFA 3UGQA 3W3SA 4K86A 2ZT5A 2RHSA 3E9IA 3NEMA 3V7RA 3RKXA 3RUXA 4XTUA 2DU5A 4YRKA 1ADYA 1PYSA 2ZT7A 4ZIBA 1C0AA 3NELA 2QHUA 2ZIMA 3KFUA 3MF2A 1EQRA 1YFSA 3UFGA 2ZNIA 1X01A 2CJBA 2ZR3A 2DU7A 3P8YA 2ZT8A 4KR3A 2AMCA 1E24A 1B76A 4YREA 3TUPA 4CH5A 1SERA 2DQ3A 3MEYA 2CJ9A 3RIRA 3HXXA 4H2VA 3WQZA 4HWPA 4CH6A 4YRRA 4KR2A 4H02A 4PHCA 2ZR2A 1EVKA 2ARUA 3HY1A 3A7RA 4Q6GA 3QO7A 3V8KA 4YP0A 3V7CA 1YFTA 1B70A 3P8TA 2ZZFA 5E3IA 3E9HA 1BIBA 2E5AA 4J15A 4PG3A 1G5IA 3HFVA 5KNNA 2EJFA 3UGTA 2E65A 2XGTA 5K1XA 1HXDA
chains in the Genus database with same CATH superfamily
3A5YA 4H2WA 3BJUA 4LNSA 1X54A 4YDQA 3NETA 4LVMA 1H4TA 1LYLA 2E10A 1USYC 2DZ9A 4CH3A 1WNLA 4XU1A 3R07A 3HXUA 5ELOA 2CJAA 4UP8A 4P3PA 1NJ5A 4HWOA 4P3NA 4XU3A 1B7YB 4HT4A 5C53B 1ASZA 3PCOA 4XTWA 2AMCB 3HXVA 3VQXA 3L4GB 2Q7GA 3TEGA 11ASA 1H4VB 3EFRA 4P75A 1G5HA 1EVLA 1NYQA 3A74A 3HXWA 3TEHA 1NJ6A 4YYEA 4YCWA 4XU0A 4P75C 3RF1A 3OD1A 2P5IA 4G84A 2A8EA 3A31A 3LSSA 4YRIA 1HTTA 4CS4A 1QF6A 2FYKA 4TVAA 4O2DA 4YRCA 2Q5IA 2RHQA 5C52B 1JJCB 4XTYA 4YRPA 4CS2A 3DSQA 3QO5A 3REXA 1EOVA 3PZCA 1WLEA 1YB3A 1NYRA 4DPGA 4P71A 4TQFA 1B7YA 5HGQA 2ODRC 2I4LA 4DQ2A 3MF1A 4H2UA 1Z7NA 2HNIA 4YRGA 1SRYA 3P8VA 4P71C 4P73A 4YROA 1L0WA 4YRSA 4WJ3M 1X55A 1B8AA 4TWAA 1H4SA 1EIYB 2EJ9A 3IKLA 2ZZGA 4UPAA 1SETA 3VQWA 2DZCA 2ZTGA 3VQVA 4EO4A 4YRLA 4HWTA 1ATIA 2DEQA 4H2TA 2RHSB 3NENA 1J5WA 3HXYA 4RDXA 2ZT6A 1X2GA 1G51A 1W66A 3I7FA 4P72C 4H2XB 1E1TA 3VQYA 2ZCEA 2I4OA 1PYSB 2ALYA 4XTZA 4RQEA 4Q15A 2ZZEA 1QE0A 3A5ZA 4WJ4A 3QTCA 2CGHA 2E3CA 2EJGA 3RACA 3REUA 4YRTA 4RMFA 4UP7A 3V8JA 3VBBA 2DQ0A 4XEMA 1X2HA 4HWRA 3HFZA 2DJZA 1SESA 1BIAA 2J3MA 3M4PA 1FYFA 2I4NA 4LVKA 2Q7HA 4P73C 1NNHA 1EFWA 4AH6A 2E64A 2DTIA 4G85A 3HRKA 4H2YA 4TTVA 2ARTA 4TVYA 3V7SA 4HWSA 3ICAA 4TQDA 2NS6A 2ZIOA 2DTOA 2G4CA 4YRJA 4OLFA 3V8LA 3M4QA 2Q7EA 5F5WA 1YFRA 1X56A 1BBWA 1HC7A 3HXZA 2CIMA 4X5OA 4CH4A 5ELNA 1Z7MA 2ALYB 1NJ2A 2EWNA 1WQWA 1GGMA 3QO8A 4YCUA 2PMFA 1WYDA 2ZXFA 2C8MA 4P72A 1E1OA 2ZNJA 4YRQA 4P74A 4UP9A 4HA8A 3ERRA 3HFZB 3HY0A 2I4MA 4LVIA 3A7UA 3HTZA 4KQEA 5C51B 2P0LA 3LC0A 2ODRD 4E51A 2EAYA 1NJ1A 4XEOA 4XTVA 2E41A 4K88A 2DDZA 3RL6A 2J3LA 1ADJA 4YRFA 3TEHB 2C7IA 3RKWA 1KMMA 1YGBA 2Q5HA 4H2SA 4OP0A 3PCOB 1E22A 2DKGA 1NJ8A 3L4GA 4BWAA 1USYA 4LVJA 2DXUA 3BFMA 1WQ7A 2AKWA 2XTIA 3IKMB 1JJCA 3RGLA 3UH0A 2QHTA 2DTHA 3L1AA 3CMQA 1KMNA 3G1ZA 5K1PA 1H4QA 2IY5B 4P3OA 4TVWA 4CS3A 4XTXA 3LSQA 3IALA 4YRNA 3L2ZA 4ZTUB 4WI1A 4NCXA 1BBUA 2PMEA 4HVCA 4RQFA 4TVAB 2ARSA 2RHQB 4ZTZB 3IG2A 12ASA 1WPYA 4XU2A 4YCVA 2DXTA 2DVEA 2E1HA 3A7AA 1EIYA 1N9WA 1WU7A 1ASYA 3HRIA 2QHSA 3EFSA 4L87A 4BW9A 3FJPA 4YRMA 1VQZA 1IL2A 2ZINA 2QHVA 4K87A 2EL9A 3QNEA 4WF2A 2AKWB 4H2XA 1KOGA 3A32A 2ZGWA 3RKYA 4P74C 1B70B 4EX5A 1RIQA 2IY5A 4YPFA 3UGQA 3W3SA 4K86A 2ZT5A 2RHSA 3E9IA 3NEMA 3V7RA 3RKXA 3RUXA 4XTUA 2DU5A 4YRKA 1ADYA 1PYSA 2ZT7A 4ZIBA 1C0AA 3NELA 4LVLA 2QHUA 2ZIMA 3KFUA 3MF2A 1EQRA 1YFSA 3UFGA 2ZNIA 1X01A 2CJBA 2ZR3A 2DU7A 3P8YA 2ZT8A 4KR3A 2AMCA 1E24A 1B76A 4YREA 3TUPA 4CH5A 1SERA 2DQ3A 3MEYA 2CJ9A 3RIRA 3HXXA 4H2VA 3WQZA 4HWPA 4CH6A 4YRRA 4KR2A 4H02A 4PHCA 2ZR2A 1EVKA 2ARUA 3HY1A 3A7RA 4Q6GA 3QO7A 3V8KA 4YP0A 3V7CA 1YFTA 1B70A 3P8TA 2ZZFA 5E3IA 3E9HA 1BIBA 2E5AA 4J15A 4PG3A 1G5IA 3HFVA 3MQZA 5KNNA 2EJFA 3UGTA 2E65A 2XGTA 5K1XA 1HXDA
chains in the Genus database with same CATH topology
3A5YA 4H2WA 3BJUA 4LNSA 1X54A 4YDQA 3NETA 4LVMA 1H4TA 1LYLA 2E10A 1USYC 2DZ9A 4CH3A 1WNLA 4XU1A 3R07A 3HXUA 5ELOA 2CJAA 4UP8A 4P3PA 1NJ5A 4HWOA 4P3NA 4XU3A 1B7YB 4HT4A 5C53B 1ASZA 3PCOA 4XTWA 2AMCB 3HXVA 3VQXA 3L4GB 2Q7GA 3TEGA 11ASA 1H4VB 3EFRA 4P75A 1G5HA 1EVLA 1NYQA 3A74A 3HXWA 3TEHA 1NJ6A 4YYEA 4YCWA 4XU0A 4P75C 3RF1A 3OD1A 2P5IA 4G84A 2A8EA 3A31A 3LSSA 4YRIA 1HTTA 4CS4A 1QF6A 2FYKA 4TVAA 4O2DA 4YRCA 2Q5IA 2RHQA 5C52B 1JJCB 4XTYA 4YRPA 4CS2A 3DSQA 3QO5A 3REXA 1EOVA 3PZCA 1WLEA 1YB3A 1NYRA 4DPGA 4P71A 4TQFA 1B7YA 5HGQA 2ODRC 2I4LA 4DQ2A 3MF1A 4H2UA 1Z7NA 2HNIA 4YRGA 1SRYA 3P8VA 4P71C 4P73A 4YROA 1L0WA 4YRSA 4WJ3M 1X55A 1B8AA 4TWAA 1H4SA 1EIYB 2EJ9A 3IKLA 2ZZGA 4UPAA 1SETA 3VQWA 2DZCA 2ZTGA 3VQVA 4EO4A 4YRLA 4HWTA 1ATIA 2DEQA 4H2TA 2RHSB 3NENA 1J5WA 3HXYA 4RDXA 2ZT6A 1X2GA 1G51A 1W66A 3I7FA 4P72C 4H2XB 1E1TA 3VQYA 2ZCEA 2I4OA 1PYSB 2ALYA 4XTZA 4RQEA 4Q15A 2ZZEA 1QE0A 3A5ZA 4WJ4A 3QTCA 2CGHA 2E3CA 2EJGA 3RACA 3REUA 4YRTA 4RMFA 4UP7A 3V8JA 3VBBA 2DQ0A 4XEMA 1X2HA 4HWRA 3HFZA 2DJZA 1SESA 1BIAA 2J3MA 3M4PA 1FYFA 2I4NA 4LVKA 2Q7HA 4P73C 1NNHA 1EFWA 4AH6A 2E64A 2DTIA 4G85A 3HRKA 4H2YA 4TTVA 2ARTA 4TVYA 3V7SA 4HWSA 3ICAA 4TQDA 2NS6A 2ZIOA 2DTOA 2G4CA 4YRJA 4OLFA 3V8LA 3M4QA 2Q7EA 5F5WA 1YFRA 1X56A 1BBWA 1HC7A 3HXZA 2CIMA 4X5OA 4CH4A 5ELNA 1Z7MA 2ALYB 1NJ2A 2EWNA 1WQWA 1GGMA 3QO8A 4YCUA 2PMFA 1WYDA 2ZXFA 2C8MA 4P72A 1E1OA 2ZNJA 4YRQA 4P74A 4UP9A 4HA8A 3ERRA 3HFZB 3HY0A 2I4MA 4LVIA 3A7UA 3HTZA 4KQEA 5C51B 2P0LA 3LC0A 2ODRD 4E51A 2EAYA 1NJ1A 4XEOA 4XTVA 2E41A 4K88A 2DDZA 3RL6A 2J3LA 1ADJA 4YRFA 3TEHB 2C7IA 3RKWA 1KMMA 1YGBA 2Q5HA 4H2SA 4OP0A 3PCOB 1E22A 2DKGA 1NJ8A 3L4GA 4BWAA 1USYA 4LVJA 2DXUA 3BFMA 1WQ7A 2AKWA 2XTIA 3IKMB 1JJCA 3RGLA 3UH0A 2QHTA 2DTHA 3L1AA 3CMQA 1KMNA 3G1ZA 5K1PA 1H4QA 2IY5B 4P3OA 4TVWA 4CS3A 4XTXA 3LSQA 3IALA 4YRNA 3L2ZA 4ZTUB 4WI1A 4NCXA 1BBUA 2PMEA 4HVCA 4RQFA 4TVAB 2ARSA 2RHQB 4ZTZB 3IG2A 12ASA 1WPYA 4XU2A 4YCVA 2DXTA 2DVEA 2E1HA 3A7AA 1EIYA 1N9WA 1WU7A 1ASYA 3HRIA 2QHSA 3EFSA 4L87A 4BW9A 3FJPA 4YRMA 1VQZA 1IL2A 2ZINA 2QHVA 4K87A 2EL9A 3QNEA 4WF2A 2AKWB 4H2XA 1KOGA 3A32A 2ZGWA 3RKYA 4P74C 1B70B 4EX5A 1RIQA 2IY5A 4YPFA 3UGQA 3W3SA 4K86A 2ZT5A 2RHSA 3E9IA 3NEMA 3V7RA 3RKXA 3RUXA 4XTUA 2DU5A 4YRKA 1ADYA 1PYSA 2ZT7A 4ZIBA 1C0AA 3NELA 4LVLA 2QHUA 2ZIMA 3KFUA 3MF2A 1EQRA 1YFSA 3UFGA 2ZNIA 1X01A 2CJBA 2ZR3A 2DU7A 3P8YA 2ZT8A 4KR3A 2AMCA 1E24A 1B76A 4YREA 3TUPA 4CH5A 1SERA 2DQ3A 3MEYA 2CJ9A 3RIRA 3HXXA 4H2VA 3WQZA 4HWPA 4CH6A 4YRRA 4KR2A 4H02A 4PHCA 2ZR2A 1EVKA 2ARUA 3HY1A 3A7RA 4Q6GA 3QO7A 3V8KA 4YP0A 3V7CA 1YFTA 1B70A 3P8TA 2ZZFA 5E3IA 3E9HA 1BIBA 2E5AA 4J15A 4PG3A 1G5IA 3HFVA 3MQZA 5KNNA 2EJFA 3UGTA 2E65A 2XGTA 5K1XA 1HXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A5Y A;  4H2W A;  3BJU A;  4LNS A;  1X54 A;  4YDQ A;  3NET A;  1H4T A;  1LYL A;  2E10 A;  1USY C;  2DZ9 A;  4CH3 A;  1WNL A;  4XU1 A;  3R07 A;  3HXU A;  5ELO A;  2CJA A;  4UP8 A;  4P3P A;  1NJ5 A;  4HWO A;  4P3N A;  4XU3 A;  1B7Y B;  5C53 B;  1ASZ A;  3PCO A;  4XTW A;  2AMC B;  3HXV A;  3VQX A;  3L4G B;  2Q7G A;  3TEG A;  11AS A;  1H4V B;  3EFR A;  4P75 A;  1G5H A;  1EVL A;  1NYQ A;  3A74 A;  3HXW A;  3TEH A;  1NJ6 A;  4YYE A;  4YCW A;  4XU0 A;  4P75 C;  3RF1 A;  3OD1 A;  2P5I A;  4G84 A;  3A31 A;  3LSS A;  4YRI A;  1HTT A;  4CS4 A;  1QF6 A;  2FYK A;  4TVA A;  4O2D A;  4YRC A;  2Q5I A;  2RHQ A;  5C52 B;  1JJC B;  4XTY A;  4YRP A;  4CS2 A;  3DSQ A;  3QO5 A;  3REX A;  1EOV A;  3PZC A;  1WLE A;  1YB3 A;  1NYR A;  4DPG A;  4P71 A;  4TQF A;  1B7Y A;  5HGQ A;  2ODR C;  2I4L A;  4DQ2 A;  3MF1 A;  4H2U A;  1Z7N A;  2HNI A;  4YRG A;  1SRY A;  3P8V A;  4P71 C;  4P73 A;  4YRO A;  1L0W A;  4YRS A;  4WJ3 M;  1X55 A;  1B8A A;  4TWA A;  1H4S A;  1EIY B;  2EJ9 A;  3IKL A;  2ZZG A;  4UPA A;  1SET A;  3VQW A;  2DZC A;  2ZTG A;  3VQV A;  4EO4 A;  4YRL A;  4HWT A;  1ATI A;  2DEQ A;  4H2T A;  2RHS B;  3NEN A;  1J5W A;  3HXY A;  4RDX A;  2ZT6 A;  1X2G A;  1G51 A;  1W66 A;  3I7F A;  4P72 C;  4H2X B;  1E1T A;  3VQY A;  2ZCE A;  2I4O A;  1PYS B;  2ALY A;  4XTZ A;  4RQE A;  4Q15 A;  2ZZE A;  1QE0 A;  3A5Z A;  4WJ4 A;  3QTC A;  2CGH A;  2E3C A;  2EJG A;  3RAC A;  3REU A;  4YRT A;  4RMF A;  4UP7 A;  3V8J A;  3VBB A;  2DQ0 A;  4XEM A;  1X2H A;  4HWR A;  3HFZ A;  2DJZ A;  1SES A;  1BIA A;  2J3M A;  3M4P A;  1FYF A;  2I4N A;  2Q7H A;  4P73 C;  1NNH A;  1EFW A;  4AH6 A;  2E64 A;  2DTI A;  4G85 A;  3HRK A;  4H2Y A;  4TTV A;  2ART A;  4TVY A;  3V7S A;  4HWS A;  3ICA A;  4TQD A;  2ZIO A;  2DTO A;  2G4C A;  4YRJ A;  4OLF A;  3V8L A;  3M4Q A;  2Q7E A;  5F5W A;  1YFR A;  1X56 A;  1BBW A;  1HC7 A;  3HXZ A;  2CIM A;  4X5O A;  4CH4 A;  5ELN A;  1Z7M A;  2ALY B;  1NJ2 A;  2EWN A;  1WQW A;  1GGM A;  3QO8 A;  4YCU A;  2PMF A;  1WYD A;  2ZXF A;  2C8M A;  4P72 A;  1E1O A;  2ZNJ A;  4YRQ A;  4P74 A;  4UP9 A;  4HA8 A;  3ERR A;  3HFZ B;  3HY0 A;  2I4M A;  3A7U A;  3HTZ A;  4KQE A;  5C51 B;  2P0L A;  3LC0 A;  2ODR D;  4E51 A;  2EAY A;  1NJ1 A;  4XEO A;  4XTV A;  2E41 A;  4K88 A;  2DDZ A;  3RL6 A;  2J3L A;  1ADJ A;  4YRF A;  3TEH B;  2C7I A;  3RKW A;  1KMM A;  1YGB A;  2Q5H A;  4H2S A;  4OP0 A;  3PCO B;  1E22 A;  2DKG A;  1NJ8 A;  3L4G A;  4BWA A;  1USY A;  2DXU A;  3BFM A;  1WQ7 A;  2AKW A;  2XTI A;  3IKM B;  1JJC A;  3RGL A;  3UH0 A;  2QHT A;  2DTH A;  3L1A A;  3CMQ A;  1KMN A;  3G1Z A;  5K1P A;  1H4Q A;  2IY5 B;  4P3O A;  4TVW A;  4CS3 A;  4XTX A;  3LSQ A;  3IAL A;  4YRN A;  3L2Z A;  4ZTU B;  4WI1 A;  4NCX A;  1BBU A;  2PME A;  4HVC A;  4RQF A;  4TVA B;  2ARS A;  2RHQ B;  4ZTZ B;  3IG2 A;  12AS A;  1WPY A;  4XU2 A;  4YCV A;  2DXT A;  2DVE A;  2E1H A;  3A7A A;  1EIY A;  1N9W A;  1WU7 A;  1ASY A;  3HRI A;  2QHS A;  3EFS A;  4L87 A;  4BW9 A;  3FJP A;  4YRM A;  1VQZ A;  1IL2 A;  2ZIN A;  2QHV A;  4K87 A;  2EL9 A;  3QNE A;  4WF2 A;  2AKW B;  4H2X A;  1KOG A;  3A32 A;  2ZGW A;  3RKY A;  4P74 C;  1B70 B;  4EX5 A;  1RIQ A;  2IY5 A;  4YPF A;  3UGQ A;  3W3S A;  4K86 A;  2ZT5 A;  2RHS A;  3E9I A;  3NEM A;  3V7R A;  3RKX A;  3RUX A;  4XTU A;  2DU5 A;  4YRK A;  1ADY A;  1PYS A;  2ZT7 A;  4ZIB A;  1C0A A;  3NEL A;  2QHU A;  2ZIM A;  3KFU A;  3MF2 A;  1EQR A;  1YFS A;  3UFG A;  2ZNI A;  1X01 A;  2CJB A;  2ZR3 A;  2DU7 A;  3P8Y A;  2ZT8 A;  4KR3 A;  2AMC A;  1E24 A;  1B76 A;  4YRE A;  3TUP A;  4CH5 A;  1SER A;  2DQ3 A;  3MEY A;  2CJ9 A;  3RIR A;  3HXX A;  4H2V A;  3WQZ A;  4HWP A;  4CH6 A;  4YRR A;  4KR2 A;  4H02 A;  4PHC A;  2ZR2 A;  1EVK A;  2ARU A;  3HY1 A;  3A7R A;  4Q6G A;  3QO7 A;  3V8K A;  4YP0 A;  3V7C A;  1YFT A;  1B70 A;  3P8T A;  2ZZF A;  5E3I A;  3E9H A;  1BIB A;  2E5A A;  4J15 A;  4PG3 A;  1G5I A;  3HFV A;  5KNN A;  2EJF A;  3UGT A;  2E65 A;  2XGT A;  5K1X A;  1HXD A; 
#chains in the Genus database with same CATH topology
 3A5Y A;  4H2W A;  3BJU A;  4LNS A;  1X54 A;  4YDQ A;  3NET A;  4LVM A;  1H4T A;  1LYL A;  2E10 A;  1USY C;  2DZ9 A;  4CH3 A;  1WNL A;  4XU1 A;  3R07 A;  3HXU A;  5ELO A;  2CJA A;  4UP8 A;  4P3P A;  1NJ5 A;  4HWO A;  4P3N A;  4XU3 A;  1B7Y B;  4HT4 A;  5C53 B;  1ASZ A;  3PCO A;  4XTW A;  2AMC B;  3HXV A;  3VQX A;  3L4G B;  2Q7G A;  3TEG A;  11AS A;  1H4V B;  3EFR A;  4P75 A;  1G5H A;  1EVL A;  1NYQ A;  3A74 A;  3HXW A;  3TEH A;  1NJ6 A;  4YYE A;  4YCW A;  4XU0 A;  4P75 C;  3RF1 A;  3OD1 A;  2P5I A;  4G84 A;  2A8E A;  3A31 A;  3LSS A;  4YRI A;  1HTT A;  4CS4 A;  1QF6 A;  2FYK A;  4TVA A;  4O2D A;  4YRC A;  2Q5I A;  2RHQ A;  5C52 B;  1JJC B;  4XTY A;  4YRP A;  4CS2 A;  3DSQ A;  3QO5 A;  3REX A;  1EOV A;  3PZC A;  1WLE A;  1YB3 A;  1NYR A;  4DPG A;  4P71 A;  4TQF A;  1B7Y A;  5HGQ A;  2ODR C;  2I4L A;  4DQ2 A;  3MF1 A;  4H2U A;  1Z7N A;  2HNI A;  4YRG A;  1SRY A;  3P8V A;  4P71 C;  4P73 A;  4YRO A;  1L0W A;  4YRS A;  4WJ3 M;  1X55 A;  1B8A A;  4TWA A;  1H4S A;  1EIY B;  2EJ9 A;  3IKL A;  2ZZG A;  4UPA A;  1SET A;  3VQW A;  2DZC A;  2ZTG A;  3VQV A;  4EO4 A;  4YRL A;  4HWT A;  1ATI A;  2DEQ A;  4H2T A;  2RHS B;  3NEN A;  1J5W A;  3HXY A;  4RDX A;  2ZT6 A;  1X2G A;  1G51 A;  1W66 A;  3I7F A;  4P72 C;  4H2X B;  1E1T A;  3VQY A;  2ZCE A;  2I4O A;  1PYS B;  2ALY A;  4XTZ A;  4RQE A;  4Q15 A;  2ZZE A;  1QE0 A;  3A5Z A;  4WJ4 A;  3QTC A;  2CGH A;  2E3C A;  2EJG A;  3RAC A;  3REU A;  4YRT A;  4RMF A;  4UP7 A;  3V8J A;  3VBB A;  2DQ0 A;  4XEM A;  1X2H A;  4HWR A;  3HFZ A;  2DJZ A;  1SES A;  1BIA A;  2J3M A;  3M4P A;  1FYF A;  2I4N A;  4LVK A;  2Q7H A;  4P73 C;  1NNH A;  1EFW A;  4AH6 A;  2E64 A;  2DTI A;  4G85 A;  3HRK A;  4H2Y A;  4TTV A;  2ART A;  4TVY A;  3V7S A;  4HWS A;  3ICA A;  4TQD A;  2NS6 A;  2ZIO A;  2DTO A;  2G4C A;  4YRJ A;  4OLF A;  3V8L A;  3M4Q A;  2Q7E A;  5F5W A;  1YFR A;  1X56 A;  1BBW A;  1HC7 A;  3HXZ A;  2CIM A;  4X5O A;  4CH4 A;  5ELN A;  1Z7M A;  2ALY B;  1NJ2 A;  2EWN A;  1WQW A;  1GGM A;  3QO8 A;  4YCU A;  2PMF A;  1WYD A;  2ZXF A;  2C8M A;  4P72 A;  1E1O A;  2ZNJ A;  4YRQ A;  4P74 A;  4UP9 A;  4HA8 A;  3ERR A;  3HFZ B;  3HY0 A;  2I4M A;  4LVI A;  3A7U A;  3HTZ A;  4KQE A;  5C51 B;  2P0L A;  3LC0 A;  2ODR D;  4E51 A;  2EAY A;  1NJ1 A;  4XEO A;  4XTV A;  2E41 A;  4K88 A;  2DDZ A;  3RL6 A;  2J3L A;  1ADJ A;  4YRF A;  3TEH B;  2C7I A;  3RKW A;  1KMM A;  1YGB A;  2Q5H A;  4H2S A;  4OP0 A;  3PCO B;  1E22 A;  2DKG A;  1NJ8 A;  3L4G A;  4BWA A;  1USY A;  4LVJ A;  2DXU A;  3BFM A;  1WQ7 A;  2AKW A;  2XTI A;  3IKM B;  1JJC A;  3RGL A;  3UH0 A;  2QHT A;  2DTH A;  3L1A A;  3CMQ A;  1KMN A;  3G1Z A;  5K1P A;  1H4Q A;  2IY5 B;  4P3O A;  4TVW A;  4CS3 A;  4XTX A;  3LSQ A;  3IAL A;  4YRN A;  3L2Z A;  4ZTU B;  4WI1 A;  4NCX A;  1BBU A;  2PME A;  4HVC A;  4RQF A;  4TVA B;  2ARS A;  2RHQ B;  4ZTZ B;  3IG2 A;  12AS A;  1WPY A;  4XU2 A;  4YCV A;  2DXT A;  2DVE A;  2E1H A;  3A7A A;  1EIY A;  1N9W A;  1WU7 A;  1ASY A;  3HRI A;  2QHS A;  3EFS A;  4L87 A;  4BW9 A;  3FJP A;  4YRM A;  1VQZ A;  1IL2 A;  2ZIN A;  2QHV A;  4K87 A;  2EL9 A;  3QNE A;  4WF2 A;  2AKW B;  4H2X A;  1KOG A;  3A32 A;  2ZGW A;  3RKY A;  4P74 C;  1B70 B;  4EX5 A;  1RIQ A;  2IY5 A;  4YPF A;  3UGQ A;  3W3S A;  4K86 A;  2ZT5 A;  2RHS A;  3E9I A;  3NEM A;  3V7R A;  3RKX A;  3RUX A;  4XTU A;  2DU5 A;  4YRK A;  1ADY A;  1PYS A;  2ZT7 A;  4ZIB A;  1C0A A;  3NEL A;  4LVL A;  2QHU A;  2ZIM A;  3KFU A;  3MF2 A;  1EQR A;  1YFS A;  3UFG A;  2ZNI A;  1X01 A;  2CJB A;  2ZR3 A;  2DU7 A;  3P8Y A;  2ZT8 A;  4KR3 A;  2AMC A;  1E24 A;  1B76 A;  4YRE A;  3TUP A;  4CH5 A;  1SER A;  2DQ3 A;  3MEY A;  2CJ9 A;  3RIR A;  3HXX A;  4H2V A;  3WQZ A;  4HWP A;  4CH6 A;  4YRR A;  4KR2 A;  4H02 A;  4PHC A;  2ZR2 A;  1EVK A;  2ARU A;  3HY1 A;  3A7R A;  4Q6G A;  3QO7 A;  3V8K A;  4YP0 A;  3V7C A;  1YFT A;  1B70 A;  3P8T A;  2ZZF A;  5E3I A;  3E9H A;  1BIB A;  2E5A A;  4J15 A;  4PG3 A;  1G5I A;  3HFV A;  3MQZ A;  5KNN A;  2EJF A;  3UGT A;  2E65 A;  2XGT A;  5K1X A;  1HXD A; 
#chains in the Genus database with same CATH homology
 3A5Y A;  4H2W A;  3BJU A;  4LNS A;  1X54 A;  4YDQ A;  3NET A;  4LVM A;  1H4T A;  1LYL A;  2E10 A;  1USY C;  2DZ9 A;  4CH3 A;  1WNL A;  4XU1 A;  3R07 A;  3HXU A;  5ELO A;  2CJA A;  4UP8 A;  4P3P A;  1NJ5 A;  4HWO A;  4P3N A;  4XU3 A;  1B7Y B;  4HT4 A;  5C53 B;  1ASZ A;  3PCO A;  4XTW A;  2AMC B;  3HXV A;  3VQX A;  3L4G B;  2Q7G A;  3TEG A;  11AS A;  1H4V B;  3EFR A;  4P75 A;  1G5H A;  1EVL A;  1NYQ A;  3A74 A;  3HXW A;  3TEH A;  1NJ6 A;  4YYE A;  4YCW A;  4XU0 A;  4P75 C;  3RF1 A;  3OD1 A;  2P5I A;  4G84 A;  2A8E A;  3A31 A;  3LSS A;  4YRI A;  1HTT A;  4CS4 A;  1QF6 A;  2FYK A;  4TVA A;  4O2D A;  4YRC A;  2Q5I A;  2RHQ A;  5C52 B;  1JJC B;  4XTY A;  4YRP A;  4CS2 A;  3DSQ A;  3QO5 A;  3REX A;  1EOV A;  3PZC A;  1WLE A;  1YB3 A;  1NYR A;  4DPG A;  4P71 A;  4TQF A;  1B7Y A;  5HGQ A;  2ODR C;  2I4L A;  4DQ2 A;  3MF1 A;  4H2U A;  1Z7N A;  2HNI A;  4YRG A;  1SRY A;  3P8V A;  4P71 C;  4P73 A;  4YRO A;  1L0W A;  4YRS A;  4WJ3 M;  1X55 A;  1B8A A;  4TWA A;  1H4S A;  1EIY B;  2EJ9 A;  3IKL A;  2ZZG A;  4UPA A;  1SET A;  3VQW A;  2DZC A;  2ZTG A;  3VQV A;  4EO4 A;  4YRL A;  4HWT A;  1ATI A;  2DEQ A;  4H2T A;  2RHS B;  3NEN A;  1J5W A;  3HXY A;  4RDX A;  2ZT6 A;  1X2G A;  1G51 A;  1W66 A;  3I7F A;  4P72 C;  4H2X B;  1E1T A;  3VQY A;  2ZCE A;  2I4O A;  1PYS B;  2ALY A;  4XTZ A;  4RQE A;  4Q15 A;  2ZZE A;  1QE0 A;  3A5Z A;  4WJ4 A;  3QTC A;  2CGH A;  2E3C A;  2EJG A;  3RAC A;  3REU A;  4YRT A;  4RMF A;  4UP7 A;  3V8J A;  3VBB A;  2DQ0 A;  4XEM A;  1X2H A;  4HWR A;  3HFZ A;  2DJZ A;  1SES A;  1BIA A;  2J3M A;  3M4P A;  1FYF A;  2I4N A;  4LVK A;  2Q7H A;  4P73 C;  1NNH A;  1EFW A;  4AH6 A;  2E64 A;  2DTI A;  4G85 A;  3HRK A;  4H2Y A;  4TTV A;  2ART A;  4TVY A;  3V7S A;  4HWS A;  3ICA A;  4TQD A;  2NS6 A;  2ZIO A;  2DTO A;  2G4C A;  4YRJ A;  4OLF A;  3V8L A;  3M4Q A;  2Q7E A;  5F5W A;  1YFR A;  1X56 A;  1BBW A;  1HC7 A;  3HXZ A;  2CIM A;  4X5O A;  4CH4 A;  5ELN A;  1Z7M A;  2ALY B;  1NJ2 A;  2EWN A;  1WQW A;  1GGM A;  3QO8 A;  4YCU A;  2PMF A;  1WYD A;  2ZXF A;  2C8M A;  4P72 A;  1E1O A;  2ZNJ A;  4YRQ A;  4P74 A;  4UP9 A;  4HA8 A;  3ERR A;  3HFZ B;  3HY0 A;  2I4M A;  4LVI A;  3A7U A;  3HTZ A;  4KQE A;  5C51 B;  2P0L A;  3LC0 A;  2ODR D;  4E51 A;  2EAY A;  1NJ1 A;  4XEO A;  4XTV A;  2E41 A;  4K88 A;  2DDZ A;  3RL6 A;  2J3L A;  1ADJ A;  4YRF A;  3TEH B;  2C7I A;  3RKW A;  1KMM A;  1YGB A;  2Q5H A;  4H2S A;  4OP0 A;  3PCO B;  1E22 A;  2DKG A;  1NJ8 A;  3L4G A;  4BWA A;  1USY A;  4LVJ A;  2DXU A;  3BFM A;  1WQ7 A;  2AKW A;  2XTI A;  3IKM B;  1JJC A;  3RGL A;  3UH0 A;  2QHT A;  2DTH A;  3L1A A;  3CMQ A;  1KMN A;  3G1Z A;  5K1P A;  1H4Q A;  2IY5 B;  4P3O A;  4TVW A;  4CS3 A;  4XTX A;  3LSQ A;  3IAL A;  4YRN A;  3L2Z A;  4ZTU B;  4WI1 A;  4NCX A;  1BBU A;  2PME A;  4HVC A;  4RQF A;  4TVA B;  2ARS A;  2RHQ B;  4ZTZ B;  3IG2 A;  12AS A;  1WPY A;  4XU2 A;  4YCV A;  2DXT A;  2DVE A;  2E1H A;  3A7A A;  1EIY A;  1N9W A;  1WU7 A;  1ASY A;  3HRI A;  2QHS A;  3EFS A;  4L87 A;  4BW9 A;  3FJP A;  4YRM A;  1VQZ A;  1IL2 A;  2ZIN A;  2QHV A;  4K87 A;  2EL9 A;  3QNE A;  4WF2 A;  2AKW B;  4H2X A;  1KOG A;  3A32 A;  2ZGW A;  3RKY A;  4P74 C;  1B70 B;  4EX5 A;  1RIQ A;  2IY5 A;  4YPF A;  3UGQ A;  3W3S A;  4K86 A;  2ZT5 A;  2RHS A;  3E9I A;  3NEM A;  3V7R A;  3RKX A;  3RUX A;  4XTU A;  2DU5 A;  4YRK A;  1ADY A;  1PYS A;  2ZT7 A;  4ZIB A;  1C0A A;  3NEL A;  4LVL A;  2QHU A;  2ZIM A;  3KFU A;  3MF2 A;  1EQR A;  1YFS A;  3UFG A;  2ZNI A;  1X01 A;  2CJB A;  2ZR3 A;  2DU7 A;  3P8Y A;  2ZT8 A;  4KR3 A;  2AMC A;  1E24 A;  1B76 A;  4YRE A;  3TUP A;  4CH5 A;  1SER A;  2DQ3 A;  3MEY A;  2CJ9 A;  3RIR A;  3HXX A;  4H2V A;  3WQZ A;  4HWP A;  4CH6 A;  4YRR A;  4KR2 A;  4H02 A;  4PHC A;  2ZR2 A;  1EVK A;  2ARU A;  3HY1 A;  3A7R A;  4Q6G A;  3QO7 A;  3V8K A;  4YP0 A;  3V7C A;  1YFT A;  1B70 A;  3P8T A;  2ZZF A;  5E3I A;  3E9H A;  1BIB A;  2E5A A;  4J15 A;  4PG3 A;  1G5I A;  3HFV A;  3MQZ A;  5KNN A;  2EJF A;  3UGT A;  2E65 A;  2XGT A;  5K1X A;  1HXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...