1YFSA

The crystal structure of alanyl-trna synthetase in complex with l-alanine
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
457
structure length
448
Chain Sequence
b'SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanyl-tRNA synthetase
molecule tags Ligase
source organism Aquifex aeolicus
publication title Breaking sieve for steric exclusion of a noncognate amino acid from active site of a tRNA synthetase.
pubmed doi rcsb
total genus 158
structure length 448
sequence length 457
chains with identical sequence B
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2005-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1yfsA01
2DEQA 4EO4A 4WJ3M 2PMFA 4YPFA 1EIYA 3V7SA 1E1TA 2E10A 2Q7GA 1G5HA 1NJ5A 2CJAA 2ZIOA 2DTIA 3LSQA 3P8VA 2QHTA 4H2TA 2ZT6A 3BFMA 2ZNIA 2ODRC 1NYRA 3TEHB 4P71A 1EOVA 1WQ7A 3IALA 2DVEA 5C51B 1KMNA 4LNSA 1NJ6A 3A32A 3G1ZA 2CJBA 2ZNJA 2J3MA 1EIYB 1WU7A 3IKMB 2ZT8A 3P8TA 3V8LA 2DTHA 4BW9A 3VQWA 2ZR2A 3A31A 1X54A 2DDZA 2ZZFA 4TVAB 4TWAA 1Z7NA 3HY0A 4H02A 4KR2A 4CS2A 3TEHA 3HRIA 1EFWA 2AMCA 2P5IA 2RHQB 1ASZA 1H4VB 1X2GA 3CMQA 4YRIA 3HXWA 2ZT5A 1H4TA 1H4SA 4HWRA 3E9HA 11ASA 2QHSA 4ZTZB 2ARUA 1PYSB 2DTOA 2C7IA 4HWSA 4XTWA 2HNIA 3P8YA 4P73C 1VQZA 4HWPA 3V8KA 1BBUA 3RACA 4CH6A 4YCUA 3RKWA 3REXA 4XTZA 4XU3A 5F5WA 4P74A 4XU2A 4P3NA 4H2VA 1HTTA 1B7YB 1YFSA 2E64A 3HXVA 3RUXA 1B7YA 4WF2A 2ZINA 4G85A 4H2XB 3I7FA 3DSQA 1HC7A 2QHUA 1N9WA 3A7UA 4YYEA 1ASYA 4UP8A 2DQ3A 3MEYA 2ZZGA 2I4LA 4BWAA 3VQVA 4TTVA 4YCWA 3VBBA 3QNEA 4TVAA 4P75A 2Q7EA 1G5IA 4RQEA 1QF6A 2IY5B 3R07A 2E5AA 2RHQA 1J5WA 4XTVA 2Q5HA 1W66A 2DU7A 1FYFA 4RQFA 2I4NA 4YROA 1YFRA 2EJ9A 4P73A 2DKGA 4NCXA 3RIRA 4P71C 3HXUA 2ZCEA 4HA8A 2ARTA 4K88A 1IL2A 2ZR3A 4DPGA 3V7CA 1X55A 3A74A 3NETA 1HXDA 3HTZA 4CH4A 4YP0A 3HFZB 4K87A 4YRSA 4P72C 4P75C 2I4OA 4CS4A 2CGHA 2PMEA 4H2XA 4P3OA 5ELNA 1B70A 2CJ9A 3KFUA 3EFSA 3RKYA 4H2YA 4P3PA 4XTUA 3MF2A 4H2UA 4HWOA 3A5YA 3IKLA 3HRKA 3VQYA 2EJFA 2IY5A 1YGBA 1YB3A 1BBWA 3HFZA 2RHSA 3LSSA 3L4GB 4WJ4A 5K1PA 4J15A 3VQXA 4YRMA 1WYDA 2ALYA 1B70B 1NYQA 4KR3A 4XU0A 1RIQA 2XTIA 1X01A 3QO7A 2XGTA 3NENA 1X2HA 4OP0A 5K1XA 3M4PA 4WI1A 4G84A 1YFTA 3MF1A 2ZGWA 1SRYA 4O2DA 3PCOB 1WPYA 2DQ0A 2DZ9A 3UFGA 4PG3A 4P72A 4UPAA 4UP7A 2DXUA 4HVCA 4YRLA 3W3SA 4RMFA 3UGQA 3TUPA 4KQEA 3QO5A 2ALYB 4UP9A 1X56A 3HXZA 4XTYA 3UGTA 3ICAA 4YRKA 1NJ2A 2ZXFA 3UH0A 4HWTA 1WLEA 4YRPA 4YRNA 1SESA 2P0LA 2ZTGA 2AKWB 4XEOA 2ARSA 3E9IA 5E3IA 2AKWA 4YRGA 3V7RA 1ADJA 3OD1A 3L4GA 3RL6A 2Q7HA 3TEGA 1QE0A 3NELA 1EVKA 1EQRA 5ELOA 4YRCA 4Q15A 1L0WA 4H2SA 2DU5A 1G51A 3EFRA 2ODRD 3PZCA 1ADYA 2CIMA 2J3LA 2EWNA 1Z7MA 2DJZA 1NJ1A 1SERA 2G4CA 1KOGA 1JJCA 2QHVA 4YDQA 3IG2A 3HY1A 2DXTA 1JJCB 4YRTA 1EVLA 2RHSB 3QTCA 1B76A 4H2WA 2DZCA 3REUA 4YRRA 1E22A 2ZT7A 4ZIBA 4PHCA 5C53B 3FJPA 3PCOA 3M4QA 4YRQA 3A7AA 2EL9A 3WQZA 1BIAA 2E1HA 1USYA 3ERRA 4L87A 12ASA 1WQWA 2FYKA 4ZTUB 4CS3A 3RF1A 3NEMA 4YCVA 4CH5A 1E24A 1BIBA 3A7RA 3L1AA 2AMCB 2E65A 3QO8A 1H4QA 1E1OA 5HGQA 4RDXA 4TVYA 2C8MA 1SETA 4Q6GA 3HXXA 1PYSA 4TQFA 5KNNA 2E41A 4TQDA 1LYLA 4XTXA 2ZIMA 3BJUA 4AH6A 4K86A 4XEMA 1C0AA 2EAYA 4E51A 1NJ8A 5C52B 2Q5IA 4DQ2A 4P74C 4YREA 3A5ZA 4CH3A 3RKXA 1ATIA 1B8AA 4YRFA 3HFVA 1USYC 4XU1A 2I4MA 4X5OA 2EJGA 3LC0A 4EX5A 1WNLA 2ZZEA 3V8JA 2E3CA 1KMMA 4OLFA 4TVWA 3RGLA 3HXYA 3L2ZA 1GGMA 1NNHA 4YRJA
chains in the Genus database with same CATH superfamily
2DEQA 4EO4A 4WJ3M 2PMFA 4YPFA 1EIYA 3V7SA 1E1TA 2E10A 2Q7GA 1G5HA 1NJ5A 2CJAA 2ZIOA 2DTIA 3LSQA 3P8VA 2QHTA 4H2TA 2ZT6A 3BFMA 2ZNIA 2ODRC 1NYRA 3TEHB 4P71A 1EOVA 1WQ7A 3IALA 2DVEA 5C51B 1KMNA 4LNSA 1NJ6A 3A32A 3G1ZA 2CJBA 2ZNJA 2J3MA 1EIYB 1WU7A 3IKMB 2ZT8A 3P8TA 3V8LA 2DTHA 4BW9A 3VQWA 2ZR2A 3A31A 1X54A 2DDZA 2ZZFA 4TVAB 4TWAA 1Z7NA 3HY0A 4H02A 4KR2A 4CS2A 3TEHA 3HRIA 1EFWA 2AMCA 2P5IA 2RHQB 1ASZA 1H4VB 1X2GA 3CMQA 4YRIA 3HXWA 2ZT5A 1H4TA 1H4SA 4HWRA 3E9HA 11ASA 2QHSA 4ZTZB 2ARUA 1PYSB 2DTOA 2C7IA 4LVLA 4HWSA 4XTWA 2HNIA 3P8YA 4P73C 1VQZA 4HWPA 3V8KA 1BBUA 3RACA 4CH6A 4YCUA 3RKWA 3REXA 4XTZA 4XU3A 5F5WA 4P74A 4XU2A 4P3NA 4H2VA 1HTTA 1B7YB 1YFSA 2E64A 3HXVA 3RUXA 1B7YA 4WF2A 2ZINA 4G85A 4H2XB 3I7FA 3DSQA 1HC7A 2QHUA 1N9WA 3A7UA 4YYEA 1ASYA 4UP8A 2DQ3A 3MEYA 2ZZGA 2I4LA 4BWAA 3VQVA 4TTVA 4YCWA 3VBBA 3QNEA 4TVAA 4P75A 2Q7EA 1G5IA 4RQEA 1QF6A 2IY5B 3R07A 2E5AA 2RHQA 1J5WA 4XTVA 2Q5HA 1W66A 2DU7A 1FYFA 2A8EA 4RQFA 2I4NA 4YROA 1YFRA 2EJ9A 4P73A 2DKGA 4NCXA 3RIRA 4P71C 3HXUA 2ZCEA 4HA8A 2ARTA 4K88A 1IL2A 2ZR3A 4DPGA 3V7CA 1X55A 3A74A 3NETA 4LVIA 1HXDA 3HTZA 4CH4A 4YP0A 3HFZB 4K87A 2NS6A 4YRSA 4P72C 4P75C 2I4OA 4CS4A 2CGHA 2PMEA 4H2XA 4P3OA 5ELNA 1B70A 2CJ9A 3KFUA 3EFSA 3RKYA 4H2YA 4P3PA 4XTUA 3MF2A 4H2UA 4HWOA 3A5YA 3IKLA 3HRKA 3VQYA 4LVMA 2EJFA 2IY5A 1YGBA 1YB3A 1BBWA 3HFZA 2RHSA 3LSSA 3L4GB 4WJ4A 5K1PA 4J15A 3VQXA 4YRMA 1WYDA 2ALYA 1B70B 1NYQA 4KR3A 4XU0A 1RIQA 2XTIA 1X01A 3QO7A 2XGTA 3NENA 1X2HA 4OP0A 5K1XA 3M4PA 4WI1A 4G84A 1YFTA 3MF1A 2ZGWA 1SRYA 4O2DA 3PCOB 1WPYA 2DQ0A 2DZ9A 3UFGA 4PG3A 4P72A 4UPAA 4UP7A 2DXUA 4HVCA 4YRLA 3W3SA 4RMFA 3UGQA 3TUPA 4KQEA 3QO5A 2ALYB 4UP9A 1X56A 3HXZA 4XTYA 3UGTA 3ICAA 4YRKA 1NJ2A 2ZXFA 3UH0A 4HWTA 1WLEA 4YRPA 4YRNA 1SESA 2P0LA 2ZTGA 2AKWB 4XEOA 2ARSA 3E9IA 5E3IA 2AKWA 4YRGA 3V7RA 1ADJA 3OD1A 3L4GA 3RL6A 2Q7HA 3TEGA 1QE0A 3NELA 1EVKA 4LVKA 1EQRA 5ELOA 4YRCA 4Q15A 1L0WA 4H2SA 2DU5A 1G51A 3EFRA 2ODRD 3PZCA 1ADYA 2CIMA 2J3LA 2EWNA 1Z7MA 2DJZA 1NJ1A 1SERA 2G4CA 1KOGA 1JJCA 2QHVA 4YDQA 3IG2A 3HY1A 2DXTA 1JJCB 4YRTA 1EVLA 2RHSB 3QTCA 1B76A 4H2WA 2DZCA 3REUA 4YRRA 1E22A 2ZT7A 4ZIBA 4PHCA 5C53B 3FJPA 3PCOA 3M4QA 4HT4A 4YRQA 3A7AA 2EL9A 3WQZA 1BIAA 2E1HA 1USYA 3ERRA 4L87A 12ASA 1WQWA 2FYKA 4ZTUB 4CS3A 3RF1A 3NEMA 4YCVA 4CH5A 1E24A 1BIBA 3A7RA 3L1AA 2AMCB 2E65A 3QO8A 1H4QA 1E1OA 5HGQA 4RDXA 4TVYA 2C8MA 1SETA 4Q6GA 3HXXA 1PYSA 4TQFA 5KNNA 2E41A 4TQDA 1LYLA 4XTXA 2ZIMA 3BJUA 4AH6A 4K86A 4XEMA 1C0AA 2EAYA 4E51A 1NJ8A 5C52B 2Q5IA 3MQZA 4DQ2A 4P74C 4YREA 3A5ZA 4CH3A 3RKXA 1ATIA 1B8AA 4YRFA 3HFVA 1USYC 4XU1A 2I4MA 4X5OA 2EJGA 3LC0A 4EX5A 1WNLA 2ZZEA 3V8JA 2E3CA 1KMMA 4OLFA 4TVWA 3RGLA 3HXYA 3L2ZA 1GGMA 1NNHA 4LVJA 4YRJA
chains in the Genus database with same CATH topology
2DEQA 4EO4A 4WJ3M 2PMFA 4YPFA 1EIYA 3V7SA 1E1TA 2E10A 2Q7GA 1G5HA 1NJ5A 2CJAA 2ZIOA 2DTIA 3LSQA 3P8VA 2QHTA 4H2TA 2ZT6A 3BFMA 2ZNIA 2ODRC 1NYRA 3TEHB 4P71A 1EOVA 1WQ7A 3IALA 2DVEA 5C51B 1KMNA 4LNSA 1NJ6A 3A32A 3G1ZA 2CJBA 2ZNJA 2J3MA 1EIYB 1WU7A 3IKMB 2ZT8A 3P8TA 3V8LA 2DTHA 4BW9A 3VQWA 2ZR2A 3A31A 1X54A 2DDZA 2ZZFA 4TVAB 4TWAA 1Z7NA 3HY0A 4H02A 4KR2A 4CS2A 3TEHA 3HRIA 1EFWA 2AMCA 2P5IA 2RHQB 1ASZA 1H4VB 1X2GA 3CMQA 4YRIA 3HXWA 2ZT5A 1H4TA 1H4SA 4HWRA 3E9HA 11ASA 2QHSA 4ZTZB 2ARUA 1PYSB 2DTOA 2C7IA 4LVLA 4HWSA 4XTWA 2HNIA 3P8YA 4P73C 1VQZA 4HWPA 3V8KA 1BBUA 3RACA 4CH6A 4YCUA 3RKWA 3REXA 4XTZA 4XU3A 5F5WA 4P74A 4XU2A 4P3NA 4H2VA 1HTTA 1B7YB 1YFSA 2E64A 3HXVA 3RUXA 1B7YA 4WF2A 2ZINA 4G85A 4H2XB 3I7FA 3DSQA 1HC7A 2QHUA 1N9WA 3A7UA 4YYEA 1ASYA 4UP8A 2DQ3A 3MEYA 2ZZGA 2I4LA 4BWAA 3VQVA 4TTVA 4YCWA 3VBBA 3QNEA 4TVAA 4P75A 2Q7EA 1G5IA 4RQEA 1QF6A 2IY5B 3R07A 2E5AA 2RHQA 1J5WA 4XTVA 2Q5HA 1W66A 2DU7A 1FYFA 2A8EA 4RQFA 2I4NA 4YROA 1YFRA 2EJ9A 4P73A 2DKGA 4NCXA 3RIRA 4P71C 3HXUA 2ZCEA 4HA8A 2ARTA 4K88A 1IL2A 2ZR3A 4DPGA 3V7CA 1X55A 3A74A 3NETA 4LVIA 1HXDA 3HTZA 4CH4A 4YP0A 3HFZB 4K87A 2NS6A 4YRSA 4P72C 4P75C 2I4OA 4CS4A 2CGHA 2PMEA 4H2XA 4P3OA 5ELNA 1B70A 2CJ9A 3KFUA 3EFSA 3RKYA 4H2YA 4P3PA 4XTUA 3MF2A 4H2UA 4HWOA 3A5YA 3IKLA 3HRKA 3VQYA 4LVMA 2EJFA 2IY5A 1YGBA 1YB3A 1BBWA 3HFZA 2RHSA 3LSSA 3L4GB 4WJ4A 5K1PA 4J15A 3VQXA 4YRMA 1WYDA 2ALYA 1B70B 1NYQA 4KR3A 4XU0A 1RIQA 2XTIA 1X01A 3QO7A 2XGTA 3NENA 1X2HA 4OP0A 5K1XA 3M4PA 4WI1A 4G84A 1YFTA 3MF1A 2ZGWA 1SRYA 4O2DA 3PCOB 1WPYA 2DQ0A 2DZ9A 3UFGA 4PG3A 4P72A 4UPAA 4UP7A 2DXUA 4HVCA 4YRLA 3W3SA 4RMFA 3UGQA 3TUPA 4KQEA 3QO5A 2ALYB 4UP9A 1X56A 3HXZA 4XTYA 3UGTA 3ICAA 4YRKA 1NJ2A 2ZXFA 3UH0A 4HWTA 1WLEA 4YRPA 4YRNA 1SESA 2P0LA 2ZTGA 2AKWB 4XEOA 2ARSA 3E9IA 5E3IA 2AKWA 4YRGA 3V7RA 1ADJA 3OD1A 3L4GA 3RL6A 2Q7HA 3TEGA 1QE0A 3NELA 1EVKA 4LVKA 1EQRA 5ELOA 4YRCA 4Q15A 1L0WA 4H2SA 2DU5A 1G51A 3EFRA 2ODRD 3PZCA 1ADYA 2CIMA 2J3LA 2EWNA 1Z7MA 2DJZA 1NJ1A 1SERA 2G4CA 1KOGA 1JJCA 2QHVA 4YDQA 3IG2A 3HY1A 2DXTA 1JJCB 4YRTA 1EVLA 2RHSB 3QTCA 1B76A 4H2WA 2DZCA 3REUA 4YRRA 1E22A 2ZT7A 4ZIBA 4PHCA 5C53B 3FJPA 3PCOA 3M4QA 4HT4A 4YRQA 3A7AA 2EL9A 3WQZA 1BIAA 2E1HA 1USYA 3ERRA 4L87A 12ASA 1WQWA 2FYKA 4ZTUB 4CS3A 3RF1A 3NEMA 4YCVA 4CH5A 1E24A 1BIBA 3A7RA 3L1AA 2AMCB 2E65A 3QO8A 1H4QA 1E1OA 5HGQA 4RDXA 4TVYA 2C8MA 1SETA 4Q6GA 3HXXA 1PYSA 4TQFA 5KNNA 2E41A 4TQDA 1LYLA 4XTXA 2ZIMA 3BJUA 4AH6A 4K86A 4XEMA 1C0AA 2EAYA 4E51A 1NJ8A 5C52B 2Q5IA 3MQZA 4DQ2A 4P74C 4YREA 3A5ZA 4CH3A 3RKXA 1ATIA 1B8AA 4YRFA 3HFVA 1USYC 4XU1A 2I4MA 4X5OA 2EJGA 3LC0A 4EX5A 1WNLA 2ZZEA 3V8JA 2E3CA 1KMMA 4OLFA 4TVWA 3RGLA 3HXYA 3L2ZA 1GGMA 1NNHA 4LVJA 4YRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DEQ A;  4EO4 A;  4WJ3 M;  2PMF A;  4YPF A;  1EIY A;  3V7S A;  1E1T A;  2E10 A;  2Q7G A;  1G5H A;  1NJ5 A;  2CJA A;  2ZIO A;  2DTI A;  3LSQ A;  3P8V A;  2QHT A;  4H2T A;  2ZT6 A;  3BFM A;  2ZNI A;  2ODR C;  1NYR A;  3TEH B;  4P71 A;  1EOV A;  1WQ7 A;  3IAL A;  2DVE A;  5C51 B;  1KMN A;  4LNS A;  1NJ6 A;  3A32 A;  3G1Z A;  2CJB A;  2ZNJ A;  2J3M A;  1EIY B;  1WU7 A;  3IKM B;  2ZT8 A;  3P8T A;  3V8L A;  2DTH A;  4BW9 A;  3VQW A;  2ZR2 A;  3A31 A;  1X54 A;  2DDZ A;  2ZZF A;  4TVA B;  4TWA A;  1Z7N A;  3HY0 A;  4H02 A;  4KR2 A;  4CS2 A;  3TEH A;  3HRI A;  1EFW A;  2AMC A;  2P5I A;  2RHQ B;  1ASZ A;  1H4V B;  1X2G A;  3CMQ A;  4YRI A;  3HXW A;  2ZT5 A;  1H4T A;  1H4S A;  4HWR A;  3E9H A;  11AS A;  2QHS A;  4ZTZ B;  2ARU A;  1PYS B;  2DTO A;  2C7I A;  4HWS A;  4XTW A;  2HNI A;  3P8Y A;  4P73 C;  1VQZ A;  4HWP A;  3V8K A;  1BBU A;  3RAC A;  4CH6 A;  4YCU A;  3RKW A;  3REX A;  4XTZ A;  4XU3 A;  5F5W A;  4P74 A;  4XU2 A;  4P3N A;  4H2V A;  1HTT A;  1B7Y B;  1YFS A;  2E64 A;  3HXV A;  3RUX A;  1B7Y A;  4WF2 A;  2ZIN A;  4G85 A;  4H2X B;  3I7F A;  3DSQ A;  1HC7 A;  2QHU A;  1N9W A;  3A7U A;  4YYE A;  1ASY A;  4UP8 A;  2DQ3 A;  3MEY A;  2ZZG A;  2I4L A;  4BWA A;  3VQV A;  4TTV A;  4YCW A;  3VBB A;  3QNE A;  4TVA A;  4P75 A;  2Q7E A;  1G5I A;  4RQE A;  1QF6 A;  2IY5 B;  3R07 A;  2E5A A;  2RHQ A;  1J5W A;  4XTV A;  2Q5H A;  1W66 A;  2DU7 A;  1FYF A;  4RQF A;  2I4N A;  4YRO A;  1YFR A;  2EJ9 A;  4P73 A;  2DKG A;  4NCX A;  3RIR A;  4P71 C;  3HXU A;  2ZCE A;  4HA8 A;  2ART A;  4K88 A;  1IL2 A;  2ZR3 A;  4DPG A;  3V7C A;  1X55 A;  3A74 A;  3NET A;  1HXD A;  3HTZ A;  4CH4 A;  4YP0 A;  3HFZ B;  4K87 A;  4YRS A;  4P72 C;  4P75 C;  2I4O A;  4CS4 A;  2CGH A;  2PME A;  4H2X A;  4P3O A;  5ELN A;  1B70 A;  2CJ9 A;  3KFU A;  3EFS A;  3RKY A;  4H2Y A;  4P3P A;  4XTU A;  3MF2 A;  4H2U A;  4HWO A;  3A5Y A;  3IKL A;  3HRK A;  3VQY A;  2EJF A;  2IY5 A;  1YGB A;  1YB3 A;  1BBW A;  3HFZ A;  2RHS A;  3LSS A;  3L4G B;  4WJ4 A;  5K1P A;  4J15 A;  3VQX A;  4YRM A;  1WYD A;  2ALY A;  1B70 B;  1NYQ A;  4KR3 A;  4XU0 A;  1RIQ A;  2XTI A;  1X01 A;  3QO7 A;  2XGT A;  3NEN A;  1X2H A;  4OP0 A;  5K1X A;  3M4P A;  4WI1 A;  4G84 A;  1YFT A;  3MF1 A;  2ZGW A;  1SRY A;  4O2D A;  3PCO B;  1WPY A;  2DQ0 A;  2DZ9 A;  3UFG A;  4PG3 A;  4P72 A;  4UPA A;  4UP7 A;  2DXU A;  4HVC A;  4YRL A;  3W3S A;  4RMF A;  3UGQ A;  3TUP A;  4KQE A;  3QO5 A;  2ALY B;  4UP9 A;  1X56 A;  3HXZ A;  4XTY A;  3UGT A;  3ICA A;  4YRK A;  1NJ2 A;  2ZXF A;  3UH0 A;  4HWT A;  1WLE A;  4YRP A;  4YRN A;  1SES A;  2P0L A;  2ZTG A;  2AKW B;  4XEO A;  2ARS A;  3E9I A;  5E3I A;  2AKW A;  4YRG A;  3V7R A;  1ADJ A;  3OD1 A;  3L4G A;  3RL6 A;  2Q7H A;  3TEG A;  1QE0 A;  3NEL A;  1EVK A;  1EQR A;  5ELO A;  4YRC A;  4Q15 A;  1L0W A;  4H2S A;  2DU5 A;  1G51 A;  3EFR A;  2ODR D;  3PZC A;  1ADY A;  2CIM A;  2J3L A;  2EWN A;  1Z7M A;  2DJZ A;  1NJ1 A;  1SER A;  2G4C A;  1KOG A;  1JJC A;  2QHV A;  4YDQ A;  3IG2 A;  3HY1 A;  2DXT A;  1JJC B;  4YRT A;  1EVL A;  2RHS B;  3QTC A;  1B76 A;  4H2W A;  2DZC A;  3REU A;  4YRR A;  1E22 A;  2ZT7 A;  4ZIB A;  4PHC A;  5C53 B;  3FJP A;  3PCO A;  3M4Q A;  4YRQ A;  3A7A A;  2EL9 A;  3WQZ A;  1BIA A;  2E1H A;  1USY A;  3ERR A;  4L87 A;  12AS A;  1WQW A;  2FYK A;  4ZTU B;  4CS3 A;  3RF1 A;  3NEM A;  4YCV A;  4CH5 A;  1E24 A;  1BIB A;  3A7R A;  3L1A A;  2AMC B;  2E65 A;  3QO8 A;  1H4Q A;  1E1O A;  5HGQ A;  4RDX A;  4TVY A;  2C8M A;  1SET A;  4Q6G A;  3HXX A;  1PYS A;  4TQF A;  5KNN A;  2E41 A;  4TQD A;  1LYL A;  4XTX A;  2ZIM A;  3BJU A;  4AH6 A;  4K86 A;  4XEM A;  1C0A A;  2EAY A;  4E51 A;  1NJ8 A;  5C52 B;  2Q5I A;  4DQ2 A;  4P74 C;  4YRE A;  3A5Z A;  4CH3 A;  3RKX A;  1ATI A;  1B8A A;  4YRF A;  3HFV A;  1USY C;  4XU1 A;  2I4M A;  4X5O A;  2EJG A;  3LC0 A;  4EX5 A;  1WNL A;  2ZZE A;  3V8J A;  2E3C A;  1KMM A;  4OLF A;  4TVW A;  3RGL A;  3HXY A;  3L2Z A;  1GGM A;  1NNH A;  4YRJ A; 
#chains in the Genus database with same CATH topology
 2DEQ A;  4EO4 A;  4WJ3 M;  2PMF A;  4YPF A;  1EIY A;  3V7S A;  1E1T A;  2E10 A;  2Q7G A;  1G5H A;  1NJ5 A;  2CJA A;  2ZIO A;  2DTI A;  3LSQ A;  3P8V A;  2QHT A;  4H2T A;  2ZT6 A;  3BFM A;  2ZNI A;  2ODR C;  1NYR A;  3TEH B;  4P71 A;  1EOV A;  1WQ7 A;  3IAL A;  2DVE A;  5C51 B;  1KMN A;  4LNS A;  1NJ6 A;  3A32 A;  3G1Z A;  2CJB A;  2ZNJ A;  2J3M A;  1EIY B;  1WU7 A;  3IKM B;  2ZT8 A;  3P8T A;  3V8L A;  2DTH A;  4BW9 A;  3VQW A;  2ZR2 A;  3A31 A;  1X54 A;  2DDZ A;  2ZZF A;  4TVA B;  4TWA A;  1Z7N A;  3HY0 A;  4H02 A;  4KR2 A;  4CS2 A;  3TEH A;  3HRI A;  1EFW A;  2AMC A;  2P5I A;  2RHQ B;  1ASZ A;  1H4V B;  1X2G A;  3CMQ A;  4YRI A;  3HXW A;  2ZT5 A;  1H4T A;  1H4S A;  4HWR A;  3E9H A;  11AS A;  2QHS A;  4ZTZ B;  2ARU A;  1PYS B;  2DTO A;  2C7I A;  4LVL A;  4HWS A;  4XTW A;  2HNI A;  3P8Y A;  4P73 C;  1VQZ A;  4HWP A;  3V8K A;  1BBU A;  3RAC A;  4CH6 A;  4YCU A;  3RKW A;  3REX A;  4XTZ A;  4XU3 A;  5F5W A;  4P74 A;  4XU2 A;  4P3N A;  4H2V A;  1HTT A;  1B7Y B;  1YFS A;  2E64 A;  3HXV A;  3RUX A;  1B7Y A;  4WF2 A;  2ZIN A;  4G85 A;  4H2X B;  3I7F A;  3DSQ A;  1HC7 A;  2QHU A;  1N9W A;  3A7U A;  4YYE A;  1ASY A;  4UP8 A;  2DQ3 A;  3MEY A;  2ZZG A;  2I4L A;  4BWA A;  3VQV A;  4TTV A;  4YCW A;  3VBB A;  3QNE A;  4TVA A;  4P75 A;  2Q7E A;  1G5I A;  4RQE A;  1QF6 A;  2IY5 B;  3R07 A;  2E5A A;  2RHQ A;  1J5W A;  4XTV A;  2Q5H A;  1W66 A;  2DU7 A;  1FYF A;  2A8E A;  4RQF A;  2I4N A;  4YRO A;  1YFR A;  2EJ9 A;  4P73 A;  2DKG A;  4NCX A;  3RIR A;  4P71 C;  3HXU A;  2ZCE A;  4HA8 A;  2ART A;  4K88 A;  1IL2 A;  2ZR3 A;  4DPG A;  3V7C A;  1X55 A;  3A74 A;  3NET A;  4LVI A;  1HXD A;  3HTZ A;  4CH4 A;  4YP0 A;  3HFZ B;  4K87 A;  2NS6 A;  4YRS A;  4P72 C;  4P75 C;  2I4O A;  4CS4 A;  2CGH A;  2PME A;  4H2X A;  4P3O A;  5ELN A;  1B70 A;  2CJ9 A;  3KFU A;  3EFS A;  3RKY A;  4H2Y A;  4P3P A;  4XTU A;  3MF2 A;  4H2U A;  4HWO A;  3A5Y A;  3IKL A;  3HRK A;  3VQY A;  4LVM A;  2EJF A;  2IY5 A;  1YGB A;  1YB3 A;  1BBW A;  3HFZ A;  2RHS A;  3LSS A;  3L4G B;  4WJ4 A;  5K1P A;  4J15 A;  3VQX A;  4YRM A;  1WYD A;  2ALY A;  1B70 B;  1NYQ A;  4KR3 A;  4XU0 A;  1RIQ A;  2XTI A;  1X01 A;  3QO7 A;  2XGT A;  3NEN A;  1X2H A;  4OP0 A;  5K1X A;  3M4P A;  4WI1 A;  4G84 A;  1YFT A;  3MF1 A;  2ZGW A;  1SRY A;  4O2D A;  3PCO B;  1WPY A;  2DQ0 A;  2DZ9 A;  3UFG A;  4PG3 A;  4P72 A;  4UPA A;  4UP7 A;  2DXU A;  4HVC A;  4YRL A;  3W3S A;  4RMF A;  3UGQ A;  3TUP A;  4KQE A;  3QO5 A;  2ALY B;  4UP9 A;  1X56 A;  3HXZ A;  4XTY A;  3UGT A;  3ICA A;  4YRK A;  1NJ2 A;  2ZXF A;  3UH0 A;  4HWT A;  1WLE A;  4YRP A;  4YRN A;  1SES A;  2P0L A;  2ZTG A;  2AKW B;  4XEO A;  2ARS A;  3E9I A;  5E3I A;  2AKW A;  4YRG A;  3V7R A;  1ADJ A;  3OD1 A;  3L4G A;  3RL6 A;  2Q7H A;  3TEG A;  1QE0 A;  3NEL A;  1EVK A;  4LVK A;  1EQR A;  5ELO A;  4YRC A;  4Q15 A;  1L0W A;  4H2S A;  2DU5 A;  1G51 A;  3EFR A;  2ODR D;  3PZC A;  1ADY A;  2CIM A;  2J3L A;  2EWN A;  1Z7M A;  2DJZ A;  1NJ1 A;  1SER A;  2G4C A;  1KOG A;  1JJC A;  2QHV A;  4YDQ A;  3IG2 A;  3HY1 A;  2DXT A;  1JJC B;  4YRT A;  1EVL A;  2RHS B;  3QTC A;  1B76 A;  4H2W A;  2DZC A;  3REU A;  4YRR A;  1E22 A;  2ZT7 A;  4ZIB A;  4PHC A;  5C53 B;  3FJP A;  3PCO A;  3M4Q A;  4HT4 A;  4YRQ A;  3A7A A;  2EL9 A;  3WQZ A;  1BIA A;  2E1H A;  1USY A;  3ERR A;  4L87 A;  12AS A;  1WQW A;  2FYK A;  4ZTU B;  4CS3 A;  3RF1 A;  3NEM A;  4YCV A;  4CH5 A;  1E24 A;  1BIB A;  3A7R A;  3L1A A;  2AMC B;  2E65 A;  3QO8 A;  1H4Q A;  1E1O A;  5HGQ A;  4RDX A;  4TVY A;  2C8M A;  1SET A;  4Q6G A;  3HXX A;  1PYS A;  4TQF A;  5KNN A;  2E41 A;  4TQD A;  1LYL A;  4XTX A;  2ZIM A;  3BJU A;  4AH6 A;  4K86 A;  4XEM A;  1C0A A;  2EAY A;  4E51 A;  1NJ8 A;  5C52 B;  2Q5I A;  3MQZ A;  4DQ2 A;  4P74 C;  4YRE A;  3A5Z A;  4CH3 A;  3RKX A;  1ATI A;  1B8A A;  4YRF A;  3HFV A;  1USY C;  4XU1 A;  2I4M A;  4X5O A;  2EJG A;  3LC0 A;  4EX5 A;  1WNL A;  2ZZE A;  3V8J A;  2E3C A;  1KMM A;  4OLF A;  4TVW A;  3RGL A;  3HXY A;  3L2Z A;  1GGM A;  1NNH A;  4LVJ A;  4YRJ A; 
#chains in the Genus database with same CATH homology
 2DEQ A;  4EO4 A;  4WJ3 M;  2PMF A;  4YPF A;  1EIY A;  3V7S A;  1E1T A;  2E10 A;  2Q7G A;  1G5H A;  1NJ5 A;  2CJA A;  2ZIO A;  2DTI A;  3LSQ A;  3P8V A;  2QHT A;  4H2T A;  2ZT6 A;  3BFM A;  2ZNI A;  2ODR C;  1NYR A;  3TEH B;  4P71 A;  1EOV A;  1WQ7 A;  3IAL A;  2DVE A;  5C51 B;  1KMN A;  4LNS A;  1NJ6 A;  3A32 A;  3G1Z A;  2CJB A;  2ZNJ A;  2J3M A;  1EIY B;  1WU7 A;  3IKM B;  2ZT8 A;  3P8T A;  3V8L A;  2DTH A;  4BW9 A;  3VQW A;  2ZR2 A;  3A31 A;  1X54 A;  2DDZ A;  2ZZF A;  4TVA B;  4TWA A;  1Z7N A;  3HY0 A;  4H02 A;  4KR2 A;  4CS2 A;  3TEH A;  3HRI A;  1EFW A;  2AMC A;  2P5I A;  2RHQ B;  1ASZ A;  1H4V B;  1X2G A;  3CMQ A;  4YRI A;  3HXW A;  2ZT5 A;  1H4T A;  1H4S A;  4HWR A;  3E9H A;  11AS A;  2QHS A;  4ZTZ B;  2ARU A;  1PYS B;  2DTO A;  2C7I A;  4LVL A;  4HWS A;  4XTW A;  2HNI A;  3P8Y A;  4P73 C;  1VQZ A;  4HWP A;  3V8K A;  1BBU A;  3RAC A;  4CH6 A;  4YCU A;  3RKW A;  3REX A;  4XTZ A;  4XU3 A;  5F5W A;  4P74 A;  4XU2 A;  4P3N A;  4H2V A;  1HTT A;  1B7Y B;  1YFS A;  2E64 A;  3HXV A;  3RUX A;  1B7Y A;  4WF2 A;  2ZIN A;  4G85 A;  4H2X B;  3I7F A;  3DSQ A;  1HC7 A;  2QHU A;  1N9W A;  3A7U A;  4YYE A;  1ASY A;  4UP8 A;  2DQ3 A;  3MEY A;  2ZZG A;  2I4L A;  4BWA A;  3VQV A;  4TTV A;  4YCW A;  3VBB A;  3QNE A;  4TVA A;  4P75 A;  2Q7E A;  1G5I A;  4RQE A;  1QF6 A;  2IY5 B;  3R07 A;  2E5A A;  2RHQ A;  1J5W A;  4XTV A;  2Q5H A;  1W66 A;  2DU7 A;  1FYF A;  2A8E A;  4RQF A;  2I4N A;  4YRO A;  1YFR A;  2EJ9 A;  4P73 A;  2DKG A;  4NCX A;  3RIR A;  4P71 C;  3HXU A;  2ZCE A;  4HA8 A;  2ART A;  4K88 A;  1IL2 A;  2ZR3 A;  4DPG A;  3V7C A;  1X55 A;  3A74 A;  3NET A;  4LVI A;  1HXD A;  3HTZ A;  4CH4 A;  4YP0 A;  3HFZ B;  4K87 A;  2NS6 A;  4YRS A;  4P72 C;  4P75 C;  2I4O A;  4CS4 A;  2CGH A;  2PME A;  4H2X A;  4P3O A;  5ELN A;  1B70 A;  2CJ9 A;  3KFU A;  3EFS A;  3RKY A;  4H2Y A;  4P3P A;  4XTU A;  3MF2 A;  4H2U A;  4HWO A;  3A5Y A;  3IKL A;  3HRK A;  3VQY A;  4LVM A;  2EJF A;  2IY5 A;  1YGB A;  1YB3 A;  1BBW A;  3HFZ A;  2RHS A;  3LSS A;  3L4G B;  4WJ4 A;  5K1P A;  4J15 A;  3VQX A;  4YRM A;  1WYD A;  2ALY A;  1B70 B;  1NYQ A;  4KR3 A;  4XU0 A;  1RIQ A;  2XTI A;  1X01 A;  3QO7 A;  2XGT A;  3NEN A;  1X2H A;  4OP0 A;  5K1X A;  3M4P A;  4WI1 A;  4G84 A;  1YFT A;  3MF1 A;  2ZGW A;  1SRY A;  4O2D A;  3PCO B;  1WPY A;  2DQ0 A;  2DZ9 A;  3UFG A;  4PG3 A;  4P72 A;  4UPA A;  4UP7 A;  2DXU A;  4HVC A;  4YRL A;  3W3S A;  4RMF A;  3UGQ A;  3TUP A;  4KQE A;  3QO5 A;  2ALY B;  4UP9 A;  1X56 A;  3HXZ A;  4XTY A;  3UGT A;  3ICA A;  4YRK A;  1NJ2 A;  2ZXF A;  3UH0 A;  4HWT A;  1WLE A;  4YRP A;  4YRN A;  1SES A;  2P0L A;  2ZTG A;  2AKW B;  4XEO A;  2ARS A;  3E9I A;  5E3I A;  2AKW A;  4YRG A;  3V7R A;  1ADJ A;  3OD1 A;  3L4G A;  3RL6 A;  2Q7H A;  3TEG A;  1QE0 A;  3NEL A;  1EVK A;  4LVK A;  1EQR A;  5ELO A;  4YRC A;  4Q15 A;  1L0W A;  4H2S A;  2DU5 A;  1G51 A;  3EFR A;  2ODR D;  3PZC A;  1ADY A;  2CIM A;  2J3L A;  2EWN A;  1Z7M A;  2DJZ A;  1NJ1 A;  1SER A;  2G4C A;  1KOG A;  1JJC A;  2QHV A;  4YDQ A;  3IG2 A;  3HY1 A;  2DXT A;  1JJC B;  4YRT A;  1EVL A;  2RHS B;  3QTC A;  1B76 A;  4H2W A;  2DZC A;  3REU A;  4YRR A;  1E22 A;  2ZT7 A;  4ZIB A;  4PHC A;  5C53 B;  3FJP A;  3PCO A;  3M4Q A;  4HT4 A;  4YRQ A;  3A7A A;  2EL9 A;  3WQZ A;  1BIA A;  2E1H A;  1USY A;  3ERR A;  4L87 A;  12AS A;  1WQW A;  2FYK A;  4ZTU B;  4CS3 A;  3RF1 A;  3NEM A;  4YCV A;  4CH5 A;  1E24 A;  1BIB A;  3A7R A;  3L1A A;  2AMC B;  2E65 A;  3QO8 A;  1H4Q A;  1E1O A;  5HGQ A;  4RDX A;  4TVY A;  2C8M A;  1SET A;  4Q6G A;  3HXX A;  1PYS A;  4TQF A;  5KNN A;  2E41 A;  4TQD A;  1LYL A;  4XTX A;  2ZIM A;  3BJU A;  4AH6 A;  4K86 A;  4XEM A;  1C0A A;  2EAY A;  4E51 A;  1NJ8 A;  5C52 B;  2Q5I A;  3MQZ A;  4DQ2 A;  4P74 C;  4YRE A;  3A5Z A;  4CH3 A;  3RKX A;  1ATI A;  1B8A A;  4YRF A;  3HFV A;  1USY C;  4XU1 A;  2I4M A;  4X5O A;  2EJG A;  3LC0 A;  4EX5 A;  1WNL A;  2ZZE A;  3V8J A;  2E3C A;  1KMM A;  4OLF A;  4TVW A;  3RGL A;  3HXY A;  3L2Z A;  1GGM A;  1NNH A;  4LVJ A;  4YRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...