1YFSA

The crystal structure of alanyl-trna synthetase in complex with l-alanine
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
457
structure length
448
Chain Sequence
SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Breaking sieve for steric exclusion of a noncognate amino acid from active site of a tRNA synthetase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Alanyl-tRNA synthetase
total genus 158
structure length 448
sequence length 457
chains with identical sequence B
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2005-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1yfsA01
3L4GA 3V7SA 2DJZA 4YRIA 4HWTA 4YCUA 4CH6A 4XTWA 4P3OA 1X01A 1BBWA 3RL6A 1WQ7A 4DQ2A 2RHQB 3L4GB 4CH5A 4CS4A 1C0AA 2RHSB 4OLFA 4P74A 2ARSA 3W3SA 3TEGA 4K88A 5K1XA 4UP8A 4P3PA 1B76A 3RKXA 3L2ZA 2EWNA 2I4OA 1NNHA 2ZNJA 4YP0A 2EL9A 4OP0A 4ZTZB 3E9IA 1HTTA 1EVKA 2DXTA 3LC0A 2E65A 2ZNIA 1X55A 4P75C 4P75A 4HWPA 4H2XB 4P71C 4K86A 2FYKA 1YFRA 1GGMA 2ZR3A 3RACA 3VQXA 1VQZA 2CJ9A 3P8TA 1EOVA 3VQWA 3HXWA 4KR2A 4XU2A 4YROA 4YYEA 2ZINA 3IALA 4NCXA 2QHTA 3KFUA 3FJPA 3NENA 1E22A 4YRTA 1G51A 4TVAA 2Q5IA 2ZZFA 4AH6A 4RQEA 4ZTUB 1B7YB 3IG2A 1Z7NA 2DEQA 2AKWA 3A5YA 3NETA 3RKWA 4HWRA 1WU7A 4RQFA 1YFTA 4P72C 4PG3A 3P8VA 4P73A 4P73C 1YB3A 2Q7GA 3V7CA 3VQYA 5C52B 4EO4A 3L1AA 2CJBA 1PYSB 4H2VA 1ATIA 1E1TA 2DXUA 1USYC 2RHSA 5KNNA 3P8YA 3M4QA 3ICAA 3LSQA 1EQRA 3UGQA 5E3IA 1HC7A 2DU7A 4CH4A 3QTCA 2XTIA 2ZGWA 3V8LA 4HA8A 1B7YA 1B70B 2DTOA 3BFMA 1EIYB 3RKYA 2IY5B 4CS2A 3RGLA 1B70A 1Z7MA 2J3MA 2QHVA 3A74A 4UP9A 4EX5A 1NJ8A 2ZT5A 3V7RA 1EVLA 2E5AA 3MF2A 2Q7EA 2E10A 1SESA 2ALYB 4L87A 5K1PA 3UH0A 2PMEA 2EJGA 4H02A 3A7UA 2PMFA 4CS3A 3A7AA 1YGBA 3HXXA 4YRGA 4P74C 4XTXA 2C7IA 3TEHB 1J5WA 3HY0A 1H4VB 2ZR2A 3HXUA 3OD1A 4Q15A 4XU0A 2P5IA 3G1ZA 1WNLA 4XTVA 4P71A 3ERRA 1ASYA 1E1OA 2EJFA 2ZIOA 3MF1A 3LSSA 2AMCB 1LYLA 4ZIBA 4YREA 5C53B 2ZT6A 3HFZB 2ZIMA 4UP7A 3V8JA 4RMFA 3PCOA 3EFSA 3A31A 5C51B 3QO5A 1X2HA 1BBUA 1SERA 4XTZA 2QHSA 2ARTA 1RIQA 2C8MA 2EAYA 2I4MA 3TUPA 4YDQA 2ZTGA 2CIMA 3R07A 2DDZA 2DZ9A 4YCVA 2ARUA 2ZCEA 4X5OA 4YRQA 2DQ3A 3A5ZA 4BW9A 2E64A 1NJ6A 1NYQA 2I4NA 4YCWA 2ZT7A 4YRMA 4XU1A 4BWAA 3M4PA 4WJ4A 3REUA 2DU5A 4YRKA 4J15A 4PHCA 2Q5HA 3RF1A 4CH3A 3E9HA 4YRFA 4TQDA 2ZZGA 1JJCA 3QNEA 2DTIA 1QE0A 1H4QA 3HXVA 1YFSA 3PCOB 4H2WA 4TTVA 4P3NA 1NJ1A 3HFZA 3IKMB 3UFGA 2ZXFA 2QHUA 1IL2A 4YRRA 1EFWA 4O2DA 3A7RA 4KR3A 3I7FA 4XTYA 5ELNA 3BJUA 2EJ9A 2I4LA 1FYFA 4TWAA 3RIRA 5HGQA 1G5IA 12ASA 3PZCA 1L0WA 2G4CA 2ODRD 3HFVA 1BIBA 1WQWA 4WF2A 1ADJA 4H2TA 5F5WA 3DSQA 3EFRA 1WYDA 1KOGA 4YRCA 1USYA 4YPFA 4YRSA 2ALYA 2J3LA 4H2XA 1KMNA 4XU3A 2AKWB 1SETA 2P0LA 1B8AA 3V8KA 1H4SA 2ODRC 3IKLA 2E41A 3HY1A 2DKGA 4YRLA 3NEMA 11ASA 2XGTA 1EIYA 1NJ2A 4TVYA 4KQEA 3HRIA 4XEMA 1NYRA 3CMQA 3QO7A 2CGHA 2DQ0A 3HTZA 4WJ3M 2RHQA 3UGTA 3HXZA 3HXYA 1JJCB 4TQFA 3NELA 4HWSA 3QO8A 4TVWA 2ZT8A 4HVCA 4G85A 3TEHA 4UPAA 4YRNA 1X54A 1HXDA 4DPGA 1ASZA 4YRPA 2DZCA 4H2UA 4H2YA 1N9WA 1PYSA 3WQZA 1BIAA 2ZZEA 1E24A 3VQVA 3VBBA 1SRYA 5ELOA 3MEYA 4RDXA 1X56A 4TVAB 1X2GA 1KMMA 2DVEA 4XTUA 3REXA 2Q7HA 1ADYA 1G5HA 1W66A 4HWOA 4E51A 3A32A 2DTHA 2E3CA 1WLEA 4LNSA 4YRJA 1WPYA 2E1HA 4K87A 1QF6A 3HRKA 4P72A 4H2SA 4Q6GA 4WI1A 2CJAA 4G84A 2AMCA 4XEOA 2HNIA 1NJ5A 1H4TA 3RUXA 2IY5A
chains in the Genus database with same CATH superfamily
3L4GA 3V7SA 2DJZA 4YRIA 4HWTA 4YCUA 4CH6A 4XTWA 4P3OA 1X01A 1BBWA 3RL6A 1WQ7A 4DQ2A 2RHQB 3L4GB 4CH5A 4CS4A 1C0AA 4HT4A 2RHSB 4OLFA 4P74A 2ARSA 3W3SA 3TEGA 4K88A 5K1XA 4UP8A 4P3PA 1B76A 3RKXA 3L2ZA 2EWNA 2I4OA 1NNHA 2ZNJA 4YP0A 2EL9A 4OP0A 4ZTZB 3E9IA 1HTTA 1EVKA 2DXTA 3LC0A 2E65A 2ZNIA 1X55A 4P75C 4P75A 4HWPA 4H2XB 4P71C 4K86A 2FYKA 1YFRA 1GGMA 2ZR3A 3RACA 3VQXA 1VQZA 2CJ9A 3P8TA 1EOVA 3VQWA 3HXWA 4KR2A 4XU2A 4YROA 4YYEA 2ZINA 3IALA 4NCXA 2QHTA 3KFUA 3FJPA 3NENA 1E22A 4YRTA 1G51A 4TVAA 2Q5IA 2ZZFA 4AH6A 4RQEA 4ZTUB 1B7YB 3IG2A 1Z7NA 2DEQA 2AKWA 3A5YA 3NETA 3RKWA 4HWRA 1WU7A 4RQFA 1YFTA 4P72C 4PG3A 3P8VA 4P73A 4P73C 1YB3A 2Q7GA 3V7CA 3VQYA 5C52B 4EO4A 3L1AA 2CJBA 1PYSB 4H2VA 1ATIA 1E1TA 2DXUA 1USYC 2RHSA 5KNNA 3P8YA 3M4QA 3ICAA 3LSQA 1EQRA 3UGQA 5E3IA 1HC7A 2DU7A 4CH4A 3QTCA 2XTIA 2ZGWA 3V8LA 4HA8A 1B7YA 1B70B 2DTOA 3BFMA 1EIYB 3RKYA 2IY5B 4CS2A 3RGLA 1B70A 1Z7MA 2J3MA 2QHVA 3A74A 4UP9A 4EX5A 1NJ8A 2ZT5A 3V7RA 1EVLA 2E5AA 3MF2A 2Q7EA 2E10A 1SESA 2ALYB 4L87A 5K1PA 3UH0A 2PMEA 2EJGA 4H02A 2NS6A 3A7UA 2PMFA 4CS3A 3A7AA 1YGBA 3HXXA 4YRGA 4P74C 4XTXA 2C7IA 3TEHB 1J5WA 3HY0A 1H4VB 2ZR2A 3HXUA 3OD1A 4Q15A 4XU0A 2P5IA 3G1ZA 1WNLA 4XTVA 4P71A 3ERRA 1ASYA 1E1OA 2EJFA 2ZIOA 3MF1A 3LSSA 2AMCB 1LYLA 4ZIBA 4YREA 5C53B 2ZT6A 3HFZB 2ZIMA 4UP7A 3V8JA 4RMFA 3PCOA 3EFSA 3A31A 5C51B 3QO5A 1X2HA 1BBUA 1SERA 4XTZA 2QHSA 2ARTA 1RIQA 2C8MA 2EAYA 2I4MA 3TUPA 4YDQA 2ZTGA 2CIMA 3R07A 2DDZA 2DZ9A 4YCVA 2ARUA 2ZCEA 4X5OA 4YRQA 2DQ3A 3A5ZA 4BW9A 2E64A 1NJ6A 1NYQA 2I4NA 4YCWA 2ZT7A 4YRMA 4XU1A 4BWAA 3M4PA 4WJ4A 3REUA 2DU5A 4YRKA 4J15A 4PHCA 2Q5HA 3RF1A 4CH3A 3E9HA 4YRFA 4TQDA 2ZZGA 1JJCA 3QNEA 2DTIA 1QE0A 1H4QA 3HXVA 1YFSA 3PCOB 4H2WA 4TTVA 4P3NA 1NJ1A 3HFZA 3IKMB 3UFGA 2ZXFA 2QHUA 1IL2A 4YRRA 1EFWA 4O2DA 3A7RA 4KR3A 3I7FA 4XTYA 5ELNA 3BJUA 2EJ9A 2I4LA 1FYFA 4TWAA 3RIRA 5HGQA 1G5IA 12ASA 3PZCA 1L0WA 2G4CA 2ODRD 3HFVA 1BIBA 1WQWA 4LVLA 4WF2A 1ADJA 4H2TA 5F5WA 3DSQA 3EFRA 1WYDA 1KOGA 4YRCA 1USYA 4YPFA 4YRSA 2ALYA 2J3LA 4H2XA 4LVKA 1KMNA 4XU3A 2AKWB 1SETA 2P0LA 1B8AA 3V8KA 1H4SA 2ODRC 3IKLA 2E41A 3HY1A 2DKGA 4YRLA 3NEMA 11ASA 2XGTA 1EIYA 1NJ2A 4TVYA 4KQEA 3HRIA 4XEMA 1NYRA 3CMQA 4LVMA 3QO7A 2CGHA 2DQ0A 3HTZA 4WJ3M 2RHQA 3UGTA 3HXZA 3HXYA 1JJCB 4TQFA 3NELA 4HWSA 3QO8A 4TVWA 2ZT8A 4HVCA 4G85A 3TEHA 4UPAA 4YRNA 1X54A 1HXDA 4DPGA 1ASZA 4YRPA 2DZCA 4H2UA 4H2YA 4LVJA 1N9WA 1PYSA 3WQZA 1BIAA 2ZZEA 1E24A 3VQVA 3VBBA 1SRYA 5ELOA 3MEYA 4RDXA 3MQZA 1X56A 4TVAB 1X2GA 1KMMA 2DVEA 4XTUA 3REXA 4LVIA 2Q7HA 1ADYA 1G5HA 1W66A 2A8EA 4HWOA 4E51A 3A32A 2DTHA 2E3CA 1WLEA 4LNSA 4YRJA 1WPYA 2E1HA 4K87A 1QF6A 3HRKA 4P72A 4H2SA 4Q6GA 4WI1A 2CJAA 4G84A 2AMCA 4XEOA 2HNIA 1NJ5A 1H4TA 3RUXA 2IY5A
chains in the Genus database with same CATH topology
3L4GA 3V7SA 2DJZA 4YRIA 4HWTA 4YCUA 4CH6A 4XTWA 4P3OA 1X01A 1BBWA 3RL6A 1WQ7A 4DQ2A 2RHQB 3L4GB 4CH5A 4CS4A 1C0AA 4HT4A 2RHSB 4OLFA 4P74A 2ARSA 3W3SA 3TEGA 4K88A 5K1XA 4UP8A 4P3PA 1B76A 3RKXA 3L2ZA 2EWNA 2I4OA 1NNHA 2ZNJA 4YP0A 2EL9A 4OP0A 4ZTZB 3E9IA 1HTTA 1EVKA 2DXTA 3LC0A 2E65A 2ZNIA 1X55A 4P75C 4P75A 4HWPA 4H2XB 4P71C 4K86A 2FYKA 1YFRA 1GGMA 2ZR3A 3RACA 3VQXA 1VQZA 2CJ9A 3P8TA 1EOVA 3VQWA 3HXWA 4KR2A 4XU2A 4YROA 4YYEA 2ZINA 3IALA 4NCXA 2QHTA 3KFUA 3FJPA 3NENA 1E22A 4YRTA 1G51A 4TVAA 2Q5IA 2ZZFA 4AH6A 4RQEA 4ZTUB 1B7YB 3IG2A 1Z7NA 2DEQA 2AKWA 3A5YA 3NETA 3RKWA 4HWRA 1WU7A 4RQFA 1YFTA 4P72C 4PG3A 3P8VA 4P73A 4P73C 1YB3A 2Q7GA 3V7CA 3VQYA 5C52B 4EO4A 3L1AA 2CJBA 1PYSB 4H2VA 1ATIA 1E1TA 2DXUA 1USYC 2RHSA 5KNNA 3P8YA 3M4QA 3ICAA 3LSQA 1EQRA 3UGQA 5E3IA 1HC7A 2DU7A 4CH4A 3QTCA 2XTIA 2ZGWA 3V8LA 4HA8A 1B7YA 1B70B 2DTOA 3BFMA 1EIYB 3RKYA 2IY5B 4CS2A 3RGLA 1B70A 1Z7MA 2J3MA 2QHVA 3A74A 4UP9A 4EX5A 1NJ8A 2ZT5A 3V7RA 1EVLA 2E5AA 3MF2A 2Q7EA 2E10A 1SESA 2ALYB 4L87A 5K1PA 3UH0A 2PMEA 2EJGA 4H02A 2NS6A 3A7UA 2PMFA 4CS3A 3A7AA 1YGBA 3HXXA 4YRGA 4P74C 4XTXA 2C7IA 3TEHB 1J5WA 3HY0A 1H4VB 2ZR2A 3HXUA 3OD1A 4Q15A 4XU0A 2P5IA 3G1ZA 1WNLA 4XTVA 4P71A 3ERRA 1ASYA 1E1OA 2EJFA 2ZIOA 3MF1A 3LSSA 2AMCB 1LYLA 4ZIBA 4YREA 5C53B 2ZT6A 3HFZB 2ZIMA 4UP7A 3V8JA 4RMFA 3PCOA 3EFSA 3A31A 5C51B 3QO5A 1X2HA 1BBUA 1SERA 4XTZA 2QHSA 2ARTA 1RIQA 2C8MA 2EAYA 2I4MA 3TUPA 4YDQA 2ZTGA 2CIMA 3R07A 2DDZA 2DZ9A 4YCVA 2ARUA 2ZCEA 4X5OA 4YRQA 2DQ3A 3A5ZA 4BW9A 2E64A 1NJ6A 1NYQA 2I4NA 4YCWA 2ZT7A 4YRMA 4XU1A 4BWAA 3M4PA 4WJ4A 3REUA 2DU5A 4YRKA 4J15A 4PHCA 2Q5HA 3RF1A 4CH3A 3E9HA 4YRFA 4TQDA 2ZZGA 1JJCA 3QNEA 2DTIA 1QE0A 1H4QA 3HXVA 1YFSA 3PCOB 4H2WA 4TTVA 4P3NA 1NJ1A 3HFZA 3IKMB 3UFGA 2ZXFA 2QHUA 1IL2A 4YRRA 1EFWA 4O2DA 3A7RA 4KR3A 3I7FA 4XTYA 5ELNA 3BJUA 2EJ9A 2I4LA 1FYFA 4TWAA 3RIRA 5HGQA 1G5IA 12ASA 3PZCA 1L0WA 2G4CA 2ODRD 3HFVA 1BIBA 1WQWA 4LVLA 4WF2A 1ADJA 4H2TA 5F5WA 3DSQA 3EFRA 1WYDA 1KOGA 4YRCA 1USYA 4YPFA 4YRSA 2ALYA 2J3LA 4H2XA 4LVKA 1KMNA 4XU3A 2AKWB 1SETA 2P0LA 1B8AA 3V8KA 1H4SA 2ODRC 3IKLA 2E41A 3HY1A 2DKGA 4YRLA 3NEMA 11ASA 2XGTA 1EIYA 1NJ2A 4TVYA 4KQEA 3HRIA 4XEMA 1NYRA 3CMQA 4LVMA 3QO7A 2CGHA 2DQ0A 3HTZA 4WJ3M 2RHQA 3UGTA 3HXZA 3HXYA 1JJCB 4TQFA 3NELA 4HWSA 3QO8A 4TVWA 2ZT8A 4HVCA 4G85A 3TEHA 4UPAA 4YRNA 1X54A 1HXDA 4DPGA 1ASZA 4YRPA 2DZCA 4H2UA 4H2YA 4LVJA 1N9WA 1PYSA 3WQZA 1BIAA 2ZZEA 1E24A 3VQVA 3VBBA 1SRYA 5ELOA 3MEYA 4RDXA 3MQZA 1X56A 4TVAB 1X2GA 1KMMA 2DVEA 4XTUA 3REXA 4LVIA 2Q7HA 1ADYA 1G5HA 1W66A 2A8EA 4HWOA 4E51A 3A32A 2DTHA 2E3CA 1WLEA 4LNSA 4YRJA 1WPYA 2E1HA 4K87A 1QF6A 3HRKA 4P72A 4H2SA 4Q6GA 4WI1A 2CJAA 4G84A 2AMCA 4XEOA 2HNIA 1NJ5A 1H4TA 3RUXA 2IY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4G A;  3V7S A;  2DJZ A;  4YRI A;  4HWT A;  4YCU A;  4CH6 A;  4XTW A;  4P3O A;  1X01 A;  1BBW A;  3RL6 A;  1WQ7 A;  4DQ2 A;  2RHQ B;  3L4G B;  4CH5 A;  4CS4 A;  1C0A A;  2RHS B;  4OLF A;  4P74 A;  2ARS A;  3W3S A;  3TEG A;  4K88 A;  5K1X A;  4UP8 A;  4P3P A;  1B76 A;  3RKX A;  3L2Z A;  2EWN A;  2I4O A;  1NNH A;  2ZNJ A;  4YP0 A;  2EL9 A;  4OP0 A;  4ZTZ B;  3E9I A;  1HTT A;  1EVK A;  2DXT A;  3LC0 A;  2E65 A;  2ZNI A;  1X55 A;  4P75 C;  4P75 A;  4HWP A;  4H2X B;  4P71 C;  4K86 A;  2FYK A;  1YFR A;  1GGM A;  2ZR3 A;  3RAC A;  3VQX A;  1VQZ A;  2CJ9 A;  3P8T A;  1EOV A;  3VQW A;  3HXW A;  4KR2 A;  4XU2 A;  4YRO A;  4YYE A;  2ZIN A;  3IAL A;  4NCX A;  2QHT A;  3KFU A;  3FJP A;  3NEN A;  1E22 A;  4YRT A;  1G51 A;  4TVA A;  2Q5I A;  2ZZF A;  4AH6 A;  4RQE A;  4ZTU B;  1B7Y B;  3IG2 A;  1Z7N A;  2DEQ A;  2AKW A;  3A5Y A;  3NET A;  3RKW A;  4HWR A;  1WU7 A;  4RQF A;  1YFT A;  4P72 C;  4PG3 A;  3P8V A;  4P73 A;  4P73 C;  1YB3 A;  2Q7G A;  3V7C A;  3VQY A;  5C52 B;  4EO4 A;  3L1A A;  2CJB A;  1PYS B;  4H2V A;  1ATI A;  1E1T A;  2DXU A;  1USY C;  2RHS A;  5KNN A;  3P8Y A;  3M4Q A;  3ICA A;  3LSQ A;  1EQR A;  3UGQ A;  5E3I A;  1HC7 A;  2DU7 A;  4CH4 A;  3QTC A;  2XTI A;  2ZGW A;  3V8L A;  4HA8 A;  1B7Y A;  1B70 B;  2DTO A;  3BFM A;  1EIY B;  3RKY A;  2IY5 B;  4CS2 A;  3RGL A;  1B70 A;  1Z7M A;  2J3M A;  2QHV A;  3A74 A;  4UP9 A;  4EX5 A;  1NJ8 A;  2ZT5 A;  3V7R A;  1EVL A;  2E5A A;  3MF2 A;  2Q7E A;  2E10 A;  1SES A;  2ALY B;  4L87 A;  5K1P A;  3UH0 A;  2PME A;  2EJG A;  4H02 A;  3A7U A;  2PMF A;  4CS3 A;  3A7A A;  1YGB A;  3HXX A;  4YRG A;  4P74 C;  4XTX A;  2C7I A;  3TEH B;  1J5W A;  3HY0 A;  1H4V B;  2ZR2 A;  3HXU A;  3OD1 A;  4Q15 A;  4XU0 A;  2P5I A;  3G1Z A;  1WNL A;  4XTV A;  4P71 A;  3ERR A;  1ASY A;  1E1O A;  2EJF A;  2ZIO A;  3MF1 A;  3LSS A;  2AMC B;  1LYL A;  4ZIB A;  4YRE A;  5C53 B;  2ZT6 A;  3HFZ B;  2ZIM A;  4UP7 A;  3V8J A;  4RMF A;  3PCO A;  3EFS A;  3A31 A;  5C51 B;  3QO5 A;  1X2H A;  1BBU A;  1SER A;  4XTZ A;  2QHS A;  2ART A;  1RIQ A;  2C8M A;  2EAY A;  2I4M A;  3TUP A;  4YDQ A;  2ZTG A;  2CIM A;  3R07 A;  2DDZ A;  2DZ9 A;  4YCV A;  2ARU A;  2ZCE A;  4X5O A;  4YRQ A;  2DQ3 A;  3A5Z A;  4BW9 A;  2E64 A;  1NJ6 A;  1NYQ A;  2I4N A;  4YCW A;  2ZT7 A;  4YRM A;  4XU1 A;  4BWA A;  3M4P A;  4WJ4 A;  3REU A;  2DU5 A;  4YRK A;  4J15 A;  4PHC A;  2Q5H A;  3RF1 A;  4CH3 A;  3E9H A;  4YRF A;  4TQD A;  2ZZG A;  1JJC A;  3QNE A;  2DTI A;  1QE0 A;  1H4Q A;  3HXV A;  1YFS A;  3PCO B;  4H2W A;  4TTV A;  4P3N A;  1NJ1 A;  3HFZ A;  3IKM B;  3UFG A;  2ZXF A;  2QHU A;  1IL2 A;  4YRR A;  1EFW A;  4O2D A;  3A7R A;  4KR3 A;  3I7F A;  4XTY A;  5ELN A;  3BJU A;  2EJ9 A;  2I4L A;  1FYF A;  4TWA A;  3RIR A;  5HGQ A;  1G5I A;  12AS A;  3PZC A;  1L0W A;  2G4C A;  2ODR D;  3HFV A;  1BIB A;  1WQW A;  4WF2 A;  1ADJ A;  4H2T A;  5F5W A;  3DSQ A;  3EFR A;  1WYD A;  1KOG A;  4YRC A;  1USY A;  4YPF A;  4YRS A;  2ALY A;  2J3L A;  4H2X A;  1KMN A;  4XU3 A;  2AKW B;  1SET A;  2P0L A;  1B8A A;  3V8K A;  1H4S A;  2ODR C;  3IKL A;  2E41 A;  3HY1 A;  2DKG A;  4YRL A;  3NEM A;  11AS A;  2XGT A;  1EIY A;  1NJ2 A;  4TVY A;  4KQE A;  3HRI A;  4XEM A;  1NYR A;  3CMQ A;  3QO7 A;  2CGH A;  2DQ0 A;  3HTZ A;  4WJ3 M;  2RHQ A;  3UGT A;  3HXZ A;  3HXY A;  1JJC B;  4TQF A;  3NEL A;  4HWS A;  3QO8 A;  4TVW A;  2ZT8 A;  4HVC A;  4G85 A;  3TEH A;  4UPA A;  4YRN A;  1X54 A;  1HXD A;  4DPG A;  1ASZ A;  4YRP A;  2DZC A;  4H2U A;  4H2Y A;  1N9W A;  1PYS A;  3WQZ A;  1BIA A;  2ZZE A;  1E24 A;  3VQV A;  3VBB A;  1SRY A;  5ELO A;  3MEY A;  4RDX A;  1X56 A;  4TVA B;  1X2G A;  1KMM A;  2DVE A;  4XTU A;  3REX A;  2Q7H A;  1ADY A;  1G5H A;  1W66 A;  4HWO A;  4E51 A;  3A32 A;  2DTH A;  2E3C A;  1WLE A;  4LNS A;  4YRJ A;  1WPY A;  2E1H A;  4K87 A;  1QF6 A;  3HRK A;  4P72 A;  4H2S A;  4Q6G A;  4WI1 A;  2CJA A;  4G84 A;  2AMC A;  4XEO A;  2HNI A;  1NJ5 A;  1H4T A;  3RUX A;  2IY5 A; 
#chains in the Genus database with same CATH topology
 3L4G A;  3V7S A;  2DJZ A;  4YRI A;  4HWT A;  4YCU A;  4CH6 A;  4XTW A;  4P3O A;  1X01 A;  1BBW A;  3RL6 A;  1WQ7 A;  4DQ2 A;  2RHQ B;  3L4G B;  4CH5 A;  4CS4 A;  1C0A A;  4HT4 A;  2RHS B;  4OLF A;  4P74 A;  2ARS A;  3W3S A;  3TEG A;  4K88 A;  5K1X A;  4UP8 A;  4P3P A;  1B76 A;  3RKX A;  3L2Z A;  2EWN A;  2I4O A;  1NNH A;  2ZNJ A;  4YP0 A;  2EL9 A;  4OP0 A;  4ZTZ B;  3E9I A;  1HTT A;  1EVK A;  2DXT A;  3LC0 A;  2E65 A;  2ZNI A;  1X55 A;  4P75 C;  4P75 A;  4HWP A;  4H2X B;  4P71 C;  4K86 A;  2FYK A;  1YFR A;  1GGM A;  2ZR3 A;  3RAC A;  3VQX A;  1VQZ A;  2CJ9 A;  3P8T A;  1EOV A;  3VQW A;  3HXW A;  4KR2 A;  4XU2 A;  4YRO A;  4YYE A;  2ZIN A;  3IAL A;  4NCX A;  2QHT A;  3KFU A;  3FJP A;  3NEN A;  1E22 A;  4YRT A;  1G51 A;  4TVA A;  2Q5I A;  2ZZF A;  4AH6 A;  4RQE A;  4ZTU B;  1B7Y B;  3IG2 A;  1Z7N A;  2DEQ A;  2AKW A;  3A5Y A;  3NET A;  3RKW A;  4HWR A;  1WU7 A;  4RQF A;  1YFT A;  4P72 C;  4PG3 A;  3P8V A;  4P73 A;  4P73 C;  1YB3 A;  2Q7G A;  3V7C A;  3VQY A;  5C52 B;  4EO4 A;  3L1A A;  2CJB A;  1PYS B;  4H2V A;  1ATI A;  1E1T A;  2DXU A;  1USY C;  2RHS A;  5KNN A;  3P8Y A;  3M4Q A;  3ICA A;  3LSQ A;  1EQR A;  3UGQ A;  5E3I A;  1HC7 A;  2DU7 A;  4CH4 A;  3QTC A;  2XTI A;  2ZGW A;  3V8L A;  4HA8 A;  1B7Y A;  1B70 B;  2DTO A;  3BFM A;  1EIY B;  3RKY A;  2IY5 B;  4CS2 A;  3RGL A;  1B70 A;  1Z7M A;  2J3M A;  2QHV A;  3A74 A;  4UP9 A;  4EX5 A;  1NJ8 A;  2ZT5 A;  3V7R A;  1EVL A;  2E5A A;  3MF2 A;  2Q7E A;  2E10 A;  1SES A;  2ALY B;  4L87 A;  5K1P A;  3UH0 A;  2PME A;  2EJG A;  4H02 A;  2NS6 A;  3A7U A;  2PMF A;  4CS3 A;  3A7A A;  1YGB A;  3HXX A;  4YRG A;  4P74 C;  4XTX A;  2C7I A;  3TEH B;  1J5W A;  3HY0 A;  1H4V B;  2ZR2 A;  3HXU A;  3OD1 A;  4Q15 A;  4XU0 A;  2P5I A;  3G1Z A;  1WNL A;  4XTV A;  4P71 A;  3ERR A;  1ASY A;  1E1O A;  2EJF A;  2ZIO A;  3MF1 A;  3LSS A;  2AMC B;  1LYL A;  4ZIB A;  4YRE A;  5C53 B;  2ZT6 A;  3HFZ B;  2ZIM A;  4UP7 A;  3V8J A;  4RMF A;  3PCO A;  3EFS A;  3A31 A;  5C51 B;  3QO5 A;  1X2H A;  1BBU A;  1SER A;  4XTZ A;  2QHS A;  2ART A;  1RIQ A;  2C8M A;  2EAY A;  2I4M A;  3TUP A;  4YDQ A;  2ZTG A;  2CIM A;  3R07 A;  2DDZ A;  2DZ9 A;  4YCV A;  2ARU A;  2ZCE A;  4X5O A;  4YRQ A;  2DQ3 A;  3A5Z A;  4BW9 A;  2E64 A;  1NJ6 A;  1NYQ A;  2I4N A;  4YCW A;  2ZT7 A;  4YRM A;  4XU1 A;  4BWA A;  3M4P A;  4WJ4 A;  3REU A;  2DU5 A;  4YRK A;  4J15 A;  4PHC A;  2Q5H A;  3RF1 A;  4CH3 A;  3E9H A;  4YRF A;  4TQD A;  2ZZG A;  1JJC A;  3QNE A;  2DTI A;  1QE0 A;  1H4Q A;  3HXV A;  1YFS A;  3PCO B;  4H2W A;  4TTV A;  4P3N A;  1NJ1 A;  3HFZ A;  3IKM B;  3UFG A;  2ZXF A;  2QHU A;  1IL2 A;  4YRR A;  1EFW A;  4O2D A;  3A7R A;  4KR3 A;  3I7F A;  4XTY A;  5ELN A;  3BJU A;  2EJ9 A;  2I4L A;  1FYF A;  4TWA A;  3RIR A;  5HGQ A;  1G5I A;  12AS A;  3PZC A;  1L0W A;  2G4C A;  2ODR D;  3HFV A;  1BIB A;  1WQW A;  4LVL A;  4WF2 A;  1ADJ A;  4H2T A;  5F5W A;  3DSQ A;  3EFR A;  1WYD A;  1KOG A;  4YRC A;  1USY A;  4YPF A;  4YRS A;  2ALY A;  2J3L A;  4H2X A;  4LVK A;  1KMN A;  4XU3 A;  2AKW B;  1SET A;  2P0L A;  1B8A A;  3V8K A;  1H4S A;  2ODR C;  3IKL A;  2E41 A;  3HY1 A;  2DKG A;  4YRL A;  3NEM A;  11AS A;  2XGT A;  1EIY A;  1NJ2 A;  4TVY A;  4KQE A;  3HRI A;  4XEM A;  1NYR A;  3CMQ A;  4LVM A;  3QO7 A;  2CGH A;  2DQ0 A;  3HTZ A;  4WJ3 M;  2RHQ A;  3UGT A;  3HXZ A;  3HXY A;  1JJC B;  4TQF A;  3NEL A;  4HWS A;  3QO8 A;  4TVW A;  2ZT8 A;  4HVC A;  4G85 A;  3TEH A;  4UPA A;  4YRN A;  1X54 A;  1HXD A;  4DPG A;  1ASZ A;  4YRP A;  2DZC A;  4H2U A;  4H2Y A;  4LVJ A;  1N9W A;  1PYS A;  3WQZ A;  1BIA A;  2ZZE A;  1E24 A;  3VQV A;  3VBB A;  1SRY A;  5ELO A;  3MEY A;  4RDX A;  3MQZ A;  1X56 A;  4TVA B;  1X2G A;  1KMM A;  2DVE A;  4XTU A;  3REX A;  4LVI A;  2Q7H A;  1ADY A;  1G5H A;  1W66 A;  2A8E A;  4HWO A;  4E51 A;  3A32 A;  2DTH A;  2E3C A;  1WLE A;  4LNS A;  4YRJ A;  1WPY A;  2E1H A;  4K87 A;  1QF6 A;  3HRK A;  4P72 A;  4H2S A;  4Q6G A;  4WI1 A;  2CJA A;  4G84 A;  2AMC A;  4XEO A;  2HNI A;  1NJ5 A;  1H4T A;  3RUX A;  2IY5 A; 
#chains in the Genus database with same CATH homology
 3L4G A;  3V7S A;  2DJZ A;  4YRI A;  4HWT A;  4YCU A;  4CH6 A;  4XTW A;  4P3O A;  1X01 A;  1BBW A;  3RL6 A;  1WQ7 A;  4DQ2 A;  2RHQ B;  3L4G B;  4CH5 A;  4CS4 A;  1C0A A;  4HT4 A;  2RHS B;  4OLF A;  4P74 A;  2ARS A;  3W3S A;  3TEG A;  4K88 A;  5K1X A;  4UP8 A;  4P3P A;  1B76 A;  3RKX A;  3L2Z A;  2EWN A;  2I4O A;  1NNH A;  2ZNJ A;  4YP0 A;  2EL9 A;  4OP0 A;  4ZTZ B;  3E9I A;  1HTT A;  1EVK A;  2DXT A;  3LC0 A;  2E65 A;  2ZNI A;  1X55 A;  4P75 C;  4P75 A;  4HWP A;  4H2X B;  4P71 C;  4K86 A;  2FYK A;  1YFR A;  1GGM A;  2ZR3 A;  3RAC A;  3VQX A;  1VQZ A;  2CJ9 A;  3P8T A;  1EOV A;  3VQW A;  3HXW A;  4KR2 A;  4XU2 A;  4YRO A;  4YYE A;  2ZIN A;  3IAL A;  4NCX A;  2QHT A;  3KFU A;  3FJP A;  3NEN A;  1E22 A;  4YRT A;  1G51 A;  4TVA A;  2Q5I A;  2ZZF A;  4AH6 A;  4RQE A;  4ZTU B;  1B7Y B;  3IG2 A;  1Z7N A;  2DEQ A;  2AKW A;  3A5Y A;  3NET A;  3RKW A;  4HWR A;  1WU7 A;  4RQF A;  1YFT A;  4P72 C;  4PG3 A;  3P8V A;  4P73 A;  4P73 C;  1YB3 A;  2Q7G A;  3V7C A;  3VQY A;  5C52 B;  4EO4 A;  3L1A A;  2CJB A;  1PYS B;  4H2V A;  1ATI A;  1E1T A;  2DXU A;  1USY C;  2RHS A;  5KNN A;  3P8Y A;  3M4Q A;  3ICA A;  3LSQ A;  1EQR A;  3UGQ A;  5E3I A;  1HC7 A;  2DU7 A;  4CH4 A;  3QTC A;  2XTI A;  2ZGW A;  3V8L A;  4HA8 A;  1B7Y A;  1B70 B;  2DTO A;  3BFM A;  1EIY B;  3RKY A;  2IY5 B;  4CS2 A;  3RGL A;  1B70 A;  1Z7M A;  2J3M A;  2QHV A;  3A74 A;  4UP9 A;  4EX5 A;  1NJ8 A;  2ZT5 A;  3V7R A;  1EVL A;  2E5A A;  3MF2 A;  2Q7E A;  2E10 A;  1SES A;  2ALY B;  4L87 A;  5K1P A;  3UH0 A;  2PME A;  2EJG A;  4H02 A;  2NS6 A;  3A7U A;  2PMF A;  4CS3 A;  3A7A A;  1YGB A;  3HXX A;  4YRG A;  4P74 C;  4XTX A;  2C7I A;  3TEH B;  1J5W A;  3HY0 A;  1H4V B;  2ZR2 A;  3HXU A;  3OD1 A;  4Q15 A;  4XU0 A;  2P5I A;  3G1Z A;  1WNL A;  4XTV A;  4P71 A;  3ERR A;  1ASY A;  1E1O A;  2EJF A;  2ZIO A;  3MF1 A;  3LSS A;  2AMC B;  1LYL A;  4ZIB A;  4YRE A;  5C53 B;  2ZT6 A;  3HFZ B;  2ZIM A;  4UP7 A;  3V8J A;  4RMF A;  3PCO A;  3EFS A;  3A31 A;  5C51 B;  3QO5 A;  1X2H A;  1BBU A;  1SER A;  4XTZ A;  2QHS A;  2ART A;  1RIQ A;  2C8M A;  2EAY A;  2I4M A;  3TUP A;  4YDQ A;  2ZTG A;  2CIM A;  3R07 A;  2DDZ A;  2DZ9 A;  4YCV A;  2ARU A;  2ZCE A;  4X5O A;  4YRQ A;  2DQ3 A;  3A5Z A;  4BW9 A;  2E64 A;  1NJ6 A;  1NYQ A;  2I4N A;  4YCW A;  2ZT7 A;  4YRM A;  4XU1 A;  4BWA A;  3M4P A;  4WJ4 A;  3REU A;  2DU5 A;  4YRK A;  4J15 A;  4PHC A;  2Q5H A;  3RF1 A;  4CH3 A;  3E9H A;  4YRF A;  4TQD A;  2ZZG A;  1JJC A;  3QNE A;  2DTI A;  1QE0 A;  1H4Q A;  3HXV A;  1YFS A;  3PCO B;  4H2W A;  4TTV A;  4P3N A;  1NJ1 A;  3HFZ A;  3IKM B;  3UFG A;  2ZXF A;  2QHU A;  1IL2 A;  4YRR A;  1EFW A;  4O2D A;  3A7R A;  4KR3 A;  3I7F A;  4XTY A;  5ELN A;  3BJU A;  2EJ9 A;  2I4L A;  1FYF A;  4TWA A;  3RIR A;  5HGQ A;  1G5I A;  12AS A;  3PZC A;  1L0W A;  2G4C A;  2ODR D;  3HFV A;  1BIB A;  1WQW A;  4LVL A;  4WF2 A;  1ADJ A;  4H2T A;  5F5W A;  3DSQ A;  3EFR A;  1WYD A;  1KOG A;  4YRC A;  1USY A;  4YPF A;  4YRS A;  2ALY A;  2J3L A;  4H2X A;  4LVK A;  1KMN A;  4XU3 A;  2AKW B;  1SET A;  2P0L A;  1B8A A;  3V8K A;  1H4S A;  2ODR C;  3IKL A;  2E41 A;  3HY1 A;  2DKG A;  4YRL A;  3NEM A;  11AS A;  2XGT A;  1EIY A;  1NJ2 A;  4TVY A;  4KQE A;  3HRI A;  4XEM A;  1NYR A;  3CMQ A;  4LVM A;  3QO7 A;  2CGH A;  2DQ0 A;  3HTZ A;  4WJ3 M;  2RHQ A;  3UGT A;  3HXZ A;  3HXY A;  1JJC B;  4TQF A;  3NEL A;  4HWS A;  3QO8 A;  4TVW A;  2ZT8 A;  4HVC A;  4G85 A;  3TEH A;  4UPA A;  4YRN A;  1X54 A;  1HXD A;  4DPG A;  1ASZ A;  4YRP A;  2DZC A;  4H2U A;  4H2Y A;  4LVJ A;  1N9W A;  1PYS A;  3WQZ A;  1BIA A;  2ZZE A;  1E24 A;  3VQV A;  3VBB A;  1SRY A;  5ELO A;  3MEY A;  4RDX A;  3MQZ A;  1X56 A;  4TVA B;  1X2G A;  1KMM A;  2DVE A;  4XTU A;  3REX A;  4LVI A;  2Q7H A;  1ADY A;  1G5H A;  1W66 A;  2A8E A;  4HWO A;  4E51 A;  3A32 A;  2DTH A;  2E3C A;  1WLE A;  4LNS A;  4YRJ A;  1WPY A;  2E1H A;  4K87 A;  1QF6 A;  3HRK A;  4P72 A;  4H2S A;  4Q6G A;  4WI1 A;  2CJA A;  4G84 A;  2AMC A;  4XEO A;  2HNI A;  1NJ5 A;  1H4T A;  3RUX A;  2IY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...