1YFTA

The crystal structure of the catalytic fragment of alanyl-trna synthetase in complex wtih glycine
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
457
structure length
448
Chain Sequence
SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Breaking sieve for steric exclusion of a noncognate amino acid from active site of a tRNA synthetase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Alanyl-tRNA synthetase
total genus 151
structure length 448
sequence length 457
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2005-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1yftA01
2EJFA 4XTWA 1NJ5A 4XEOA 4YRLA 2E10A 2QHSA 4H2XB 4XEMA 4P72A 3REXA 5C51B 3FJPA 4YRQA 1B7YB 2Q5IA 2J3MA 3HXZA 5E3IA 11ASA 2EL9A 3L2ZA 4XTZA 3HRKA 1E24A 2IY5A 4XTYA 2ZR3A 3P8TA 2E1HA 1E22A 1HTTA 1NJ8A 1EFWA 3ERRA 2PMFA 4P75C 2ZTGA 3RACA 3RKXA 2RHSB 2ZNIA 1NJ6A 4E51A 1PYSB 3V8LA 4YRJA 3RKWA 4AH6A 1G5IA 2XTIA 3E9HA 4WI1A 2ZIMA 5K1PA 1EIYB 3NEMA 3TEHA 4BWAA 5ELNA 4K86A 2CJAA 1USYA 1YFTA 4TVAA 1N9WA 4CH6A 3RF1A 5K1XA 5ELOA 4H2YA 3CMQA 4P73A 3VQXA 3HXUA 4CH4A 2DXTA 4WJ3M 1NJ2A 3PCOB 1BBUA 2E65A 4DQ2A 3HRIA 2ZIOA 1EVKA 4YYEA 3NENA 2FYKA 2ZCEA 4YRTA 2RHQA 3IG2A 2ARTA 2I4OA 2EWNA 1WQ7A 1YB3A 4H2WA 4XU1A 3M4PA 3REUA 2DZCA 1HC7A 3L4GB 4OP0A 1JJCB 2AMCB 3WQZA 3LC0A 2EAYA 3R07A 4P72C 1YFSA 4YRCA 2DVEA 3W3SA 4YRFA 4WF2A 3KFUA 2I4NA 3HY1A 3G1ZA 3MEYA 3UFGA 3NETA 3A32A 1X56A 3L4GA 4CS4A 4ZTUB 1SETA 2DJZA 4PG3A 4YROA 3P8YA 2E3CA 2DDZA 1WYDA 4NCXA 2C8MA 3UH0A 3A5ZA 3HXXA 3UGQA 2PMEA 4XTXA 1G5HA 1YFRA 1QE0A 1BIBA 4TQDA 1YGBA 4O2DA 1WQWA 2ZT7A 2RHQB 1Z7MA 4K87A 2XGTA 2ZZFA 12ASA 3PZCA 3L1AA 4CH5A 1KOGA 3VBBA 3QO7A 3VQYA 2ODRC 3IKMB 3PCOA 4OLFA 4CS3A 2CIMA 4K88A 4P74C 3MF1A 2Q7EA 3HTZA 1NJ1A 5F5WA 2AKWB 2P5IA 2ARUA 4YCUA 2ZNJA 4HWTA 3TUPA 1E1TA 1NYQA 1SESA 1NNHA 1JJCA 1B76A 1SRYA 2C7IA 4ZTZB 1EOVA 4YRSA 3DSQA 1ATIA 4YCVA 3VQWA 2EJ9A 1EQRA 2ZINA 4KR3A 3A7RA 2DXUA 1ADYA 1PYSA 4EO4A 4HA8A 4XTUA 2RHSA 4CS2A 4HVCA 4XU3A 4YRKA 3HFZB 3I7FA 5HGQA 2ODRD 1W66A 3LSQA 1VQZA 4YREA 2Q7GA 2CJBA 2ARSA 1RIQA 3E9IA 1WNLA 4Q15A 4XU0A 3RIRA 2AKWA 3MF2A 3V8KA 3M4QA 2G4CA 4KQEA 2J3LA 1B8AA 1X54A 2DTOA 3HXWA 2DTIA 2DKGA 4KR2A 3RKYA 3HFVA 3TEHB 2QHVA 4X5OA 4YDQA 2ZR2A 3BJUA 4P3PA 1J5WA 1KMNA 4CH3A 1X2GA 1X01A 2ZZEA 3QNEA 1WU7A 2QHTA 4HWRA 2E5AA 4XU2A 4TTVA 4G85A 4HWOA 4P3NA 4EX5A 5C52B 4J15A 2ZXFA 3LSSA 4TQFA 2ALYB 3A7UA 2DU7A 3QO5A 3UGTA 3RUXA 1X2HA 1E1OA 3HY0A 4YPFA 2CGHA 3NELA 1GGMA 3V8JA 1NYRA 4P74A 1B70B 4YRIA 1B7YA 2ALYA 2E64A 2AMCA 1QF6A 2DZ9A 1IL2A 1H4VB 1L0WA 4HWPA 4UPAA 3QO8A 3A7AA 3BFMA 1WPYA 2I4MA 4H2UA 3IALA 1BBWA 4UP7A 3ICAA 3OD1A 4H2SA 3P8VA 2DQ3A 1H4SA 3HXVA 2CJ9A 4H02A 4RQFA 2DQ0A 3TEGA 4YRMA 4RDXA 1ADJA 3QTCA 3EFSA 4ZIBA 4RQEA 4YP0A 5KNNA 4TVWA 2ZT8A 2ZGWA 4RMFA 4BW9A 4XTVA 3V7CA 1WLEA 4Q6GA 4YRNA 2ZT6A 3A31A 4UP8A 4YRPA 3A5YA 2E41A 4TVAB 2DEQA 4TVYA 2DTHA 4WJ4A 4L87A 2DU5A 1SERA 3HFZA 1ASYA 3HXYA 4G84A 3IKLA 2Q7HA 4DPGA 1EIYA 1C0AA 4HWSA 1ASZA 4TWAA 4UP9A 3RGLA 1FYFA 1KMMA 1Z7NA 2HNIA 1BIAA 2Q5HA 1X55A 3V7RA 5C53B 1G51A 2EJGA 1B70A 3VQVA 4P75A 4P73C 4P3OA 4YCWA 3RL6A 2IY5B 2I4LA 1USYC 1H4TA 2ZT5A 4LNSA 1EVLA 3A74A 1HXDA 3EFRA 4YRRA 4H2XA 4P71C 2ZZGA 4YRGA 4H2VA 2P0LA 1LYLA 4PHCA 4P71A 4H2TA 3V7SA 1H4QA 2QHUA
chains in the Genus database with same CATH superfamily
2EJFA 4XTWA 1NJ5A 4XEOA 4YRLA 2E10A 2QHSA 4LVIA 4H2XB 4XEMA 4P72A 3REXA 5C51B 3FJPA 4YRQA 1B7YB 2Q5IA 2J3MA 3HXZA 5E3IA 11ASA 2EL9A 3L2ZA 4XTZA 3HRKA 1E24A 2IY5A 4XTYA 2ZR3A 3P8TA 2E1HA 1E22A 1HTTA 1NJ8A 1EFWA 3ERRA 2PMFA 4P75C 2ZTGA 3RACA 3RKXA 2RHSB 2ZNIA 1NJ6A 4E51A 1PYSB 3V8LA 4YRJA 3RKWA 4AH6A 1G5IA 2XTIA 3E9HA 4WI1A 2ZIMA 5K1PA 1EIYB 3NEMA 3TEHA 4BWAA 5ELNA 4K86A 2CJAA 1USYA 1YFTA 4TVAA 1N9WA 4CH6A 3RF1A 5K1XA 5ELOA 4H2YA 3CMQA 4P73A 3VQXA 3HXUA 4CH4A 2DXTA 4WJ3M 1NJ2A 3PCOB 1BBUA 2E65A 4DQ2A 3HRIA 2ZIOA 1EVKA 4YYEA 3NENA 2FYKA 2ZCEA 4YRTA 2RHQA 3IG2A 2ARTA 2I4OA 2EWNA 1WQ7A 1YB3A 4H2WA 4XU1A 3M4PA 3REUA 2DZCA 1HC7A 3L4GB 4OP0A 1JJCB 2AMCB 3WQZA 3LC0A 2EAYA 3R07A 4P72C 1YFSA 4YRCA 2DVEA 3W3SA 4YRFA 4WF2A 3KFUA 2I4NA 3HY1A 3G1ZA 3MEYA 3UFGA 3NETA 3A32A 1X56A 3L4GA 4CS4A 4ZTUB 1SETA 2DJZA 4PG3A 4YROA 3P8YA 2E3CA 2DDZA 1WYDA 4NCXA 2C8MA 3UH0A 3A5ZA 3HXXA 3UGQA 2PMEA 4XTXA 1G5HA 1YFRA 1QE0A 1BIBA 4TQDA 1YGBA 4O2DA 1WQWA 2ZT7A 2RHQB 1Z7MA 4K87A 2XGTA 2ZZFA 12ASA 3PZCA 3L1AA 4CH5A 1KOGA 3VBBA 3QO7A 3VQYA 2ODRC 3IKMB 3PCOA 4OLFA 4CS3A 2CIMA 4K88A 4P74C 3MF1A 2Q7EA 3HTZA 1NJ1A 5F5WA 2AKWB 2P5IA 2ARUA 4YCUA 2ZNJA 4HWTA 3TUPA 1E1TA 1NYQA 1SESA 1NNHA 1JJCA 1B76A 1SRYA 2C7IA 4ZTZB 1EOVA 4YRSA 3DSQA 1ATIA 4YCVA 3VQWA 2EJ9A 1EQRA 2ZINA 4KR3A 3A7RA 2DXUA 1ADYA 1PYSA 4EO4A 4HA8A 4XTUA 2RHSA 4CS2A 4HVCA 4XU3A 4YRKA 3HFZB 3I7FA 4LVMA 5HGQA 2ODRD 1W66A 3LSQA 4LVLA 1VQZA 4YREA 2Q7GA 2CJBA 2ARSA 1RIQA 3E9IA 1WNLA 4Q15A 4XU0A 3RIRA 2AKWA 3MF2A 3V8KA 3M4QA 2G4CA 4KQEA 2J3LA 1B8AA 1X54A 2DTOA 3HXWA 2DTIA 2DKGA 4KR2A 3RKYA 3HFVA 3TEHB 2QHVA 4X5OA 4YDQA 2ZR2A 3BJUA 4P3PA 1J5WA 1KMNA 4CH3A 1X2GA 1X01A 2ZZEA 3QNEA 1WU7A 2QHTA 4HWRA 2E5AA 4XU2A 4TTVA 4G85A 4HWOA 4P3NA 4EX5A 5C52B 4J15A 2ZXFA 3LSSA 4TQFA 2ALYB 3A7UA 2DU7A 3QO5A 3UGTA 3RUXA 1X2HA 1E1OA 3HY0A 4YPFA 2CGHA 3NELA 1GGMA 3MQZA 3V8JA 1NYRA 4P74A 1B70B 4YRIA 1B7YA 2ALYA 2E64A 2AMCA 1QF6A 2DZ9A 1IL2A 1H4VB 1L0WA 4HWPA 4UPAA 3QO8A 3A7AA 3BFMA 1WPYA 2I4MA 4H2UA 3IALA 1BBWA 4UP7A 3ICAA 3OD1A 4H2SA 3P8VA 2DQ3A 1H4SA 3HXVA 2CJ9A 4H02A 4RQFA 2DQ0A 3TEGA 4YRMA 4RDXA 1ADJA 3QTCA 2A8EA 3EFSA 4ZIBA 4RQEA 4YP0A 5KNNA 4TVWA 2ZT8A 2ZGWA 4LVKA 4RMFA 4BW9A 4XTVA 3V7CA 1WLEA 4Q6GA 4YRNA 2ZT6A 3A31A 4UP8A 4YRPA 3A5YA 2E41A 4TVAB 2DEQA 4TVYA 2DTHA 4WJ4A 4L87A 2DU5A 1SERA 3HFZA 1ASYA 3HXYA 4G84A 3IKLA 2Q7HA 4DPGA 1EIYA 1C0AA 4HWSA 1ASZA 4TWAA 4UP9A 3RGLA 1FYFA 1KMMA 1Z7NA 2HNIA 1BIAA 2Q5HA 1X55A 3V7RA 5C53B 1G51A 2EJGA 1B70A 3VQVA 4P75A 4P73C 4P3OA 4YCWA 3RL6A 2IY5B 2I4LA 1USYC 4LVJA 4HT4A 1H4TA 2ZT5A 4LNSA 1EVLA 3A74A 2NS6A 1HXDA 3EFRA 4YRRA 4H2XA 4P71C 2ZZGA 4YRGA 4H2VA 2P0LA 1LYLA 4PHCA 4P71A 4H2TA 3V7SA 1H4QA 2QHUA
chains in the Genus database with same CATH topology
2EJFA 4XTWA 1NJ5A 4XEOA 4YRLA 2E10A 2QHSA 4LVIA 4H2XB 4XEMA 4P72A 3REXA 5C51B 3FJPA 4YRQA 1B7YB 2Q5IA 2J3MA 3HXZA 5E3IA 11ASA 2EL9A 3L2ZA 4XTZA 3HRKA 1E24A 2IY5A 4XTYA 2ZR3A 3P8TA 2E1HA 1E22A 1HTTA 1NJ8A 1EFWA 3ERRA 2PMFA 4P75C 2ZTGA 3RACA 3RKXA 2RHSB 2ZNIA 1NJ6A 4E51A 1PYSB 3V8LA 4YRJA 3RKWA 4AH6A 1G5IA 2XTIA 3E9HA 4WI1A 2ZIMA 5K1PA 1EIYB 3NEMA 3TEHA 4BWAA 5ELNA 4K86A 2CJAA 1USYA 1YFTA 4TVAA 1N9WA 4CH6A 3RF1A 5K1XA 5ELOA 4H2YA 3CMQA 4P73A 3VQXA 3HXUA 4CH4A 2DXTA 4WJ3M 1NJ2A 3PCOB 1BBUA 2E65A 4DQ2A 3HRIA 2ZIOA 1EVKA 4YYEA 3NENA 2FYKA 2ZCEA 4YRTA 2RHQA 3IG2A 2ARTA 2I4OA 2EWNA 1WQ7A 1YB3A 4H2WA 4XU1A 3M4PA 3REUA 2DZCA 1HC7A 3L4GB 4OP0A 1JJCB 2AMCB 3WQZA 3LC0A 2EAYA 3R07A 4P72C 1YFSA 4YRCA 2DVEA 3W3SA 4YRFA 4WF2A 3KFUA 2I4NA 3HY1A 3G1ZA 3MEYA 3UFGA 3NETA 3A32A 1X56A 3L4GA 4CS4A 4ZTUB 1SETA 2DJZA 4PG3A 4YROA 3P8YA 2E3CA 2DDZA 1WYDA 4NCXA 2C8MA 3UH0A 3A5ZA 3HXXA 3UGQA 2PMEA 4XTXA 1G5HA 1YFRA 1QE0A 1BIBA 4TQDA 1YGBA 4O2DA 1WQWA 2ZT7A 2RHQB 1Z7MA 4K87A 2XGTA 2ZZFA 12ASA 3PZCA 3L1AA 4CH5A 1KOGA 3VBBA 3QO7A 3VQYA 2ODRC 3IKMB 3PCOA 4OLFA 4CS3A 2CIMA 4K88A 4P74C 3MF1A 2Q7EA 3HTZA 1NJ1A 5F5WA 2AKWB 2P5IA 2ARUA 4YCUA 2ZNJA 4HWTA 3TUPA 1E1TA 1NYQA 1SESA 1NNHA 1JJCA 1B76A 1SRYA 2C7IA 4ZTZB 1EOVA 4YRSA 3DSQA 1ATIA 4YCVA 3VQWA 2EJ9A 1EQRA 2ZINA 4KR3A 3A7RA 2DXUA 1ADYA 1PYSA 4EO4A 4HA8A 4XTUA 2RHSA 4CS2A 4HVCA 4XU3A 4YRKA 3HFZB 3I7FA 4LVMA 5HGQA 2ODRD 1W66A 3LSQA 4LVLA 1VQZA 4YREA 2Q7GA 2CJBA 2ARSA 1RIQA 3E9IA 1WNLA 4Q15A 4XU0A 3RIRA 2AKWA 3MF2A 3V8KA 3M4QA 2G4CA 4KQEA 2J3LA 1B8AA 1X54A 2DTOA 3HXWA 2DTIA 2DKGA 4KR2A 3RKYA 3HFVA 3TEHB 2QHVA 4X5OA 4YDQA 2ZR2A 3BJUA 4P3PA 1J5WA 1KMNA 4CH3A 1X2GA 1X01A 2ZZEA 3QNEA 1WU7A 2QHTA 4HWRA 2E5AA 4XU2A 4TTVA 4G85A 4HWOA 4P3NA 4EX5A 5C52B 4J15A 2ZXFA 3LSSA 4TQFA 2ALYB 3A7UA 2DU7A 3QO5A 3UGTA 3RUXA 1X2HA 1E1OA 3HY0A 4YPFA 2CGHA 3NELA 1GGMA 3MQZA 3V8JA 1NYRA 4P74A 1B70B 4YRIA 1B7YA 2ALYA 2E64A 2AMCA 1QF6A 2DZ9A 1IL2A 1H4VB 1L0WA 4HWPA 4UPAA 3QO8A 3A7AA 3BFMA 1WPYA 2I4MA 4H2UA 3IALA 1BBWA 4UP7A 3ICAA 3OD1A 4H2SA 3P8VA 2DQ3A 1H4SA 3HXVA 2CJ9A 4H02A 4RQFA 2DQ0A 3TEGA 4YRMA 4RDXA 1ADJA 3QTCA 2A8EA 3EFSA 4ZIBA 4RQEA 4YP0A 5KNNA 4TVWA 2ZT8A 2ZGWA 4LVKA 4RMFA 4BW9A 4XTVA 3V7CA 1WLEA 4Q6GA 4YRNA 2ZT6A 3A31A 4UP8A 4YRPA 3A5YA 2E41A 4TVAB 2DEQA 4TVYA 2DTHA 4WJ4A 4L87A 2DU5A 1SERA 3HFZA 1ASYA 3HXYA 4G84A 3IKLA 2Q7HA 4DPGA 1EIYA 1C0AA 4HWSA 1ASZA 4TWAA 4UP9A 3RGLA 1FYFA 1KMMA 1Z7NA 2HNIA 1BIAA 2Q5HA 1X55A 3V7RA 5C53B 1G51A 2EJGA 1B70A 3VQVA 4P75A 4P73C 4P3OA 4YCWA 3RL6A 2IY5B 2I4LA 1USYC 4LVJA 4HT4A 1H4TA 2ZT5A 4LNSA 1EVLA 3A74A 2NS6A 1HXDA 3EFRA 4YRRA 4H2XA 4P71C 2ZZGA 4YRGA 4H2VA 2P0LA 1LYLA 4PHCA 4P71A 4H2TA 3V7SA 1H4QA 2QHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJF A;  4XTW A;  1NJ5 A;  4XEO A;  4YRL A;  2E10 A;  2QHS A;  4H2X B;  4XEM A;  4P72 A;  3REX A;  5C51 B;  3FJP A;  4YRQ A;  1B7Y B;  2Q5I A;  2J3M A;  3HXZ A;  5E3I A;  11AS A;  2EL9 A;  3L2Z A;  4XTZ A;  3HRK A;  1E24 A;  2IY5 A;  4XTY A;  2ZR3 A;  3P8T A;  2E1H A;  1E22 A;  1HTT A;  1NJ8 A;  1EFW A;  3ERR A;  2PMF A;  4P75 C;  2ZTG A;  3RAC A;  3RKX A;  2RHS B;  2ZNI A;  1NJ6 A;  4E51 A;  1PYS B;  3V8L A;  4YRJ A;  3RKW A;  4AH6 A;  1G5I A;  2XTI A;  3E9H A;  4WI1 A;  2ZIM A;  5K1P A;  1EIY B;  3NEM A;  3TEH A;  4BWA A;  5ELN A;  4K86 A;  2CJA A;  1USY A;  1YFT A;  4TVA A;  1N9W A;  4CH6 A;  3RF1 A;  5K1X A;  5ELO A;  4H2Y A;  3CMQ A;  4P73 A;  3VQX A;  3HXU A;  4CH4 A;  2DXT A;  4WJ3 M;  1NJ2 A;  3PCO B;  1BBU A;  2E65 A;  4DQ2 A;  3HRI A;  2ZIO A;  1EVK A;  4YYE A;  3NEN A;  2FYK A;  2ZCE A;  4YRT A;  2RHQ A;  3IG2 A;  2ART A;  2I4O A;  2EWN A;  1WQ7 A;  1YB3 A;  4H2W A;  4XU1 A;  3M4P A;  3REU A;  2DZC A;  1HC7 A;  3L4G B;  4OP0 A;  1JJC B;  2AMC B;  3WQZ A;  3LC0 A;  2EAY A;  3R07 A;  4P72 C;  1YFS A;  4YRC A;  2DVE A;  3W3S A;  4YRF A;  4WF2 A;  3KFU A;  2I4N A;  3HY1 A;  3G1Z A;  3MEY A;  3UFG A;  3NET A;  3A32 A;  1X56 A;  3L4G A;  4CS4 A;  4ZTU B;  1SET A;  2DJZ A;  4PG3 A;  4YRO A;  3P8Y A;  2E3C A;  2DDZ A;  1WYD A;  4NCX A;  2C8M A;  3UH0 A;  3A5Z A;  3HXX A;  3UGQ A;  2PME A;  4XTX A;  1G5H A;  1YFR A;  1QE0 A;  1BIB A;  4TQD A;  1YGB A;  4O2D A;  1WQW A;  2ZT7 A;  2RHQ B;  1Z7M A;  4K87 A;  2XGT A;  2ZZF A;  12AS A;  3PZC A;  3L1A A;  4CH5 A;  1KOG A;  3VBB A;  3QO7 A;  3VQY A;  2ODR C;  3IKM B;  3PCO A;  4OLF A;  4CS3 A;  2CIM A;  4K88 A;  4P74 C;  3MF1 A;  2Q7E A;  3HTZ A;  1NJ1 A;  5F5W A;  2AKW B;  2P5I A;  2ARU A;  4YCU A;  2ZNJ A;  4HWT A;  3TUP A;  1E1T A;  1NYQ A;  1SES A;  1NNH A;  1JJC A;  1B76 A;  1SRY A;  2C7I A;  4ZTZ B;  1EOV A;  4YRS A;  3DSQ A;  1ATI A;  4YCV A;  3VQW A;  2EJ9 A;  1EQR A;  2ZIN A;  4KR3 A;  3A7R A;  2DXU A;  1ADY A;  1PYS A;  4EO4 A;  4HA8 A;  4XTU A;  2RHS A;  4CS2 A;  4HVC A;  4XU3 A;  4YRK A;  3HFZ B;  3I7F A;  5HGQ A;  2ODR D;  1W66 A;  3LSQ A;  1VQZ A;  4YRE A;  2Q7G A;  2CJB A;  2ARS A;  1RIQ A;  3E9I A;  1WNL A;  4Q15 A;  4XU0 A;  3RIR A;  2AKW A;  3MF2 A;  3V8K A;  3M4Q A;  2G4C A;  4KQE A;  2J3L A;  1B8A A;  1X54 A;  2DTO A;  3HXW A;  2DTI A;  2DKG A;  4KR2 A;  3RKY A;  3HFV A;  3TEH B;  2QHV A;  4X5O A;  4YDQ A;  2ZR2 A;  3BJU A;  4P3P A;  1J5W A;  1KMN A;  4CH3 A;  1X2G A;  1X01 A;  2ZZE A;  3QNE A;  1WU7 A;  2QHT A;  4HWR A;  2E5A A;  4XU2 A;  4TTV A;  4G85 A;  4HWO A;  4P3N A;  4EX5 A;  5C52 B;  4J15 A;  2ZXF A;  3LSS A;  4TQF A;  2ALY B;  3A7U A;  2DU7 A;  3QO5 A;  3UGT A;  3RUX A;  1X2H A;  1E1O A;  3HY0 A;  4YPF A;  2CGH A;  3NEL A;  1GGM A;  3V8J A;  1NYR A;  4P74 A;  1B70 B;  4YRI A;  1B7Y A;  2ALY A;  2E64 A;  2AMC A;  1QF6 A;  2DZ9 A;  1IL2 A;  1H4V B;  1L0W A;  4HWP A;  4UPA A;  3QO8 A;  3A7A A;  3BFM A;  1WPY A;  2I4M A;  4H2U A;  3IAL A;  1BBW A;  4UP7 A;  3ICA A;  3OD1 A;  4H2S A;  3P8V A;  2DQ3 A;  1H4S A;  3HXV A;  2CJ9 A;  4H02 A;  4RQF A;  2DQ0 A;  3TEG A;  4YRM A;  4RDX A;  1ADJ A;  3QTC A;  3EFS A;  4ZIB A;  4RQE A;  4YP0 A;  5KNN A;  4TVW A;  2ZT8 A;  2ZGW A;  4RMF A;  4BW9 A;  4XTV A;  3V7C A;  1WLE A;  4Q6G A;  4YRN A;  2ZT6 A;  3A31 A;  4UP8 A;  4YRP A;  3A5Y A;  2E41 A;  4TVA B;  2DEQ A;  4TVY A;  2DTH A;  4WJ4 A;  4L87 A;  2DU5 A;  1SER A;  3HFZ A;  1ASY A;  3HXY A;  4G84 A;  3IKL A;  2Q7H A;  4DPG A;  1EIY A;  1C0A A;  4HWS A;  1ASZ A;  4TWA A;  4UP9 A;  3RGL A;  1FYF A;  1KMM A;  1Z7N A;  2HNI A;  1BIA A;  2Q5H A;  1X55 A;  3V7R A;  5C53 B;  1G51 A;  2EJG A;  1B70 A;  3VQV A;  4P75 A;  4P73 C;  4P3O A;  4YCW A;  3RL6 A;  2IY5 B;  2I4L A;  1USY C;  1H4T A;  2ZT5 A;  4LNS A;  1EVL A;  3A74 A;  1HXD A;  3EFR A;  4YRR A;  4H2X A;  4P71 C;  2ZZG A;  4YRG A;  4H2V A;  2P0L A;  1LYL A;  4PHC A;  4P71 A;  4H2T A;  3V7S A;  1H4Q A;  2QHU A; 
#chains in the Genus database with same CATH topology
 2EJF A;  4XTW A;  1NJ5 A;  4XEO A;  4YRL A;  2E10 A;  2QHS A;  4LVI A;  4H2X B;  4XEM A;  4P72 A;  3REX A;  5C51 B;  3FJP A;  4YRQ A;  1B7Y B;  2Q5I A;  2J3M A;  3HXZ A;  5E3I A;  11AS A;  2EL9 A;  3L2Z A;  4XTZ A;  3HRK A;  1E24 A;  2IY5 A;  4XTY A;  2ZR3 A;  3P8T A;  2E1H A;  1E22 A;  1HTT A;  1NJ8 A;  1EFW A;  3ERR A;  2PMF A;  4P75 C;  2ZTG A;  3RAC A;  3RKX A;  2RHS B;  2ZNI A;  1NJ6 A;  4E51 A;  1PYS B;  3V8L A;  4YRJ A;  3RKW A;  4AH6 A;  1G5I A;  2XTI A;  3E9H A;  4WI1 A;  2ZIM A;  5K1P A;  1EIY B;  3NEM A;  3TEH A;  4BWA A;  5ELN A;  4K86 A;  2CJA A;  1USY A;  1YFT A;  4TVA A;  1N9W A;  4CH6 A;  3RF1 A;  5K1X A;  5ELO A;  4H2Y A;  3CMQ A;  4P73 A;  3VQX A;  3HXU A;  4CH4 A;  2DXT A;  4WJ3 M;  1NJ2 A;  3PCO B;  1BBU A;  2E65 A;  4DQ2 A;  3HRI A;  2ZIO A;  1EVK A;  4YYE A;  3NEN A;  2FYK A;  2ZCE A;  4YRT A;  2RHQ A;  3IG2 A;  2ART A;  2I4O A;  2EWN A;  1WQ7 A;  1YB3 A;  4H2W A;  4XU1 A;  3M4P A;  3REU A;  2DZC A;  1HC7 A;  3L4G B;  4OP0 A;  1JJC B;  2AMC B;  3WQZ A;  3LC0 A;  2EAY A;  3R07 A;  4P72 C;  1YFS A;  4YRC A;  2DVE A;  3W3S A;  4YRF A;  4WF2 A;  3KFU A;  2I4N A;  3HY1 A;  3G1Z A;  3MEY A;  3UFG A;  3NET A;  3A32 A;  1X56 A;  3L4G A;  4CS4 A;  4ZTU B;  1SET A;  2DJZ A;  4PG3 A;  4YRO A;  3P8Y A;  2E3C A;  2DDZ A;  1WYD A;  4NCX A;  2C8M A;  3UH0 A;  3A5Z A;  3HXX A;  3UGQ A;  2PME A;  4XTX A;  1G5H A;  1YFR A;  1QE0 A;  1BIB A;  4TQD A;  1YGB A;  4O2D A;  1WQW A;  2ZT7 A;  2RHQ B;  1Z7M A;  4K87 A;  2XGT A;  2ZZF A;  12AS A;  3PZC A;  3L1A A;  4CH5 A;  1KOG A;  3VBB A;  3QO7 A;  3VQY A;  2ODR C;  3IKM B;  3PCO A;  4OLF A;  4CS3 A;  2CIM A;  4K88 A;  4P74 C;  3MF1 A;  2Q7E A;  3HTZ A;  1NJ1 A;  5F5W A;  2AKW B;  2P5I A;  2ARU A;  4YCU A;  2ZNJ A;  4HWT A;  3TUP A;  1E1T A;  1NYQ A;  1SES A;  1NNH A;  1JJC A;  1B76 A;  1SRY A;  2C7I A;  4ZTZ B;  1EOV A;  4YRS A;  3DSQ A;  1ATI A;  4YCV A;  3VQW A;  2EJ9 A;  1EQR A;  2ZIN A;  4KR3 A;  3A7R A;  2DXU A;  1ADY A;  1PYS A;  4EO4 A;  4HA8 A;  4XTU A;  2RHS A;  4CS2 A;  4HVC A;  4XU3 A;  4YRK A;  3HFZ B;  3I7F A;  4LVM A;  5HGQ A;  2ODR D;  1W66 A;  3LSQ A;  4LVL A;  1VQZ A;  4YRE A;  2Q7G A;  2CJB A;  2ARS A;  1RIQ A;  3E9I A;  1WNL A;  4Q15 A;  4XU0 A;  3RIR A;  2AKW A;  3MF2 A;  3V8K A;  3M4Q A;  2G4C A;  4KQE A;  2J3L A;  1B8A A;  1X54 A;  2DTO A;  3HXW A;  2DTI A;  2DKG A;  4KR2 A;  3RKY A;  3HFV A;  3TEH B;  2QHV A;  4X5O A;  4YDQ A;  2ZR2 A;  3BJU A;  4P3P A;  1J5W A;  1KMN A;  4CH3 A;  1X2G A;  1X01 A;  2ZZE A;  3QNE A;  1WU7 A;  2QHT A;  4HWR A;  2E5A A;  4XU2 A;  4TTV A;  4G85 A;  4HWO A;  4P3N A;  4EX5 A;  5C52 B;  4J15 A;  2ZXF A;  3LSS A;  4TQF A;  2ALY B;  3A7U A;  2DU7 A;  3QO5 A;  3UGT A;  3RUX A;  1X2H A;  1E1O A;  3HY0 A;  4YPF A;  2CGH A;  3NEL A;  1GGM A;  3MQZ A;  3V8J A;  1NYR A;  4P74 A;  1B70 B;  4YRI A;  1B7Y A;  2ALY A;  2E64 A;  2AMC A;  1QF6 A;  2DZ9 A;  1IL2 A;  1H4V B;  1L0W A;  4HWP A;  4UPA A;  3QO8 A;  3A7A A;  3BFM A;  1WPY A;  2I4M A;  4H2U A;  3IAL A;  1BBW A;  4UP7 A;  3ICA A;  3OD1 A;  4H2S A;  3P8V A;  2DQ3 A;  1H4S A;  3HXV A;  2CJ9 A;  4H02 A;  4RQF A;  2DQ0 A;  3TEG A;  4YRM A;  4RDX A;  1ADJ A;  3QTC A;  2A8E A;  3EFS A;  4ZIB A;  4RQE A;  4YP0 A;  5KNN A;  4TVW A;  2ZT8 A;  2ZGW A;  4LVK A;  4RMF A;  4BW9 A;  4XTV A;  3V7C A;  1WLE A;  4Q6G A;  4YRN A;  2ZT6 A;  3A31 A;  4UP8 A;  4YRP A;  3A5Y A;  2E41 A;  4TVA B;  2DEQ A;  4TVY A;  2DTH A;  4WJ4 A;  4L87 A;  2DU5 A;  1SER A;  3HFZ A;  1ASY A;  3HXY A;  4G84 A;  3IKL A;  2Q7H A;  4DPG A;  1EIY A;  1C0A A;  4HWS A;  1ASZ A;  4TWA A;  4UP9 A;  3RGL A;  1FYF A;  1KMM A;  1Z7N A;  2HNI A;  1BIA A;  2Q5H A;  1X55 A;  3V7R A;  5C53 B;  1G51 A;  2EJG A;  1B70 A;  3VQV A;  4P75 A;  4P73 C;  4P3O A;  4YCW A;  3RL6 A;  2IY5 B;  2I4L A;  1USY C;  4LVJ A;  4HT4 A;  1H4T A;  2ZT5 A;  4LNS A;  1EVL A;  3A74 A;  2NS6 A;  1HXD A;  3EFR A;  4YRR A;  4H2X A;  4P71 C;  2ZZG A;  4YRG A;  4H2V A;  2P0L A;  1LYL A;  4PHC A;  4P71 A;  4H2T A;  3V7S A;  1H4Q A;  2QHU A; 
#chains in the Genus database with same CATH homology
 2EJF A;  4XTW A;  1NJ5 A;  4XEO A;  4YRL A;  2E10 A;  2QHS A;  4LVI A;  4H2X B;  4XEM A;  4P72 A;  3REX A;  5C51 B;  3FJP A;  4YRQ A;  1B7Y B;  2Q5I A;  2J3M A;  3HXZ A;  5E3I A;  11AS A;  2EL9 A;  3L2Z A;  4XTZ A;  3HRK A;  1E24 A;  2IY5 A;  4XTY A;  2ZR3 A;  3P8T A;  2E1H A;  1E22 A;  1HTT A;  1NJ8 A;  1EFW A;  3ERR A;  2PMF A;  4P75 C;  2ZTG A;  3RAC A;  3RKX A;  2RHS B;  2ZNI A;  1NJ6 A;  4E51 A;  1PYS B;  3V8L A;  4YRJ A;  3RKW A;  4AH6 A;  1G5I A;  2XTI A;  3E9H A;  4WI1 A;  2ZIM A;  5K1P A;  1EIY B;  3NEM A;  3TEH A;  4BWA A;  5ELN A;  4K86 A;  2CJA A;  1USY A;  1YFT A;  4TVA A;  1N9W A;  4CH6 A;  3RF1 A;  5K1X A;  5ELO A;  4H2Y A;  3CMQ A;  4P73 A;  3VQX A;  3HXU A;  4CH4 A;  2DXT A;  4WJ3 M;  1NJ2 A;  3PCO B;  1BBU A;  2E65 A;  4DQ2 A;  3HRI A;  2ZIO A;  1EVK A;  4YYE A;  3NEN A;  2FYK A;  2ZCE A;  4YRT A;  2RHQ A;  3IG2 A;  2ART A;  2I4O A;  2EWN A;  1WQ7 A;  1YB3 A;  4H2W A;  4XU1 A;  3M4P A;  3REU A;  2DZC A;  1HC7 A;  3L4G B;  4OP0 A;  1JJC B;  2AMC B;  3WQZ A;  3LC0 A;  2EAY A;  3R07 A;  4P72 C;  1YFS A;  4YRC A;  2DVE A;  3W3S A;  4YRF A;  4WF2 A;  3KFU A;  2I4N A;  3HY1 A;  3G1Z A;  3MEY A;  3UFG A;  3NET A;  3A32 A;  1X56 A;  3L4G A;  4CS4 A;  4ZTU B;  1SET A;  2DJZ A;  4PG3 A;  4YRO A;  3P8Y A;  2E3C A;  2DDZ A;  1WYD A;  4NCX A;  2C8M A;  3UH0 A;  3A5Z A;  3HXX A;  3UGQ A;  2PME A;  4XTX A;  1G5H A;  1YFR A;  1QE0 A;  1BIB A;  4TQD A;  1YGB A;  4O2D A;  1WQW A;  2ZT7 A;  2RHQ B;  1Z7M A;  4K87 A;  2XGT A;  2ZZF A;  12AS A;  3PZC A;  3L1A A;  4CH5 A;  1KOG A;  3VBB A;  3QO7 A;  3VQY A;  2ODR C;  3IKM B;  3PCO A;  4OLF A;  4CS3 A;  2CIM A;  4K88 A;  4P74 C;  3MF1 A;  2Q7E A;  3HTZ A;  1NJ1 A;  5F5W A;  2AKW B;  2P5I A;  2ARU A;  4YCU A;  2ZNJ A;  4HWT A;  3TUP A;  1E1T A;  1NYQ A;  1SES A;  1NNH A;  1JJC A;  1B76 A;  1SRY A;  2C7I A;  4ZTZ B;  1EOV A;  4YRS A;  3DSQ A;  1ATI A;  4YCV A;  3VQW A;  2EJ9 A;  1EQR A;  2ZIN A;  4KR3 A;  3A7R A;  2DXU A;  1ADY A;  1PYS A;  4EO4 A;  4HA8 A;  4XTU A;  2RHS A;  4CS2 A;  4HVC A;  4XU3 A;  4YRK A;  3HFZ B;  3I7F A;  4LVM A;  5HGQ A;  2ODR D;  1W66 A;  3LSQ A;  4LVL A;  1VQZ A;  4YRE A;  2Q7G A;  2CJB A;  2ARS A;  1RIQ A;  3E9I A;  1WNL A;  4Q15 A;  4XU0 A;  3RIR A;  2AKW A;  3MF2 A;  3V8K A;  3M4Q A;  2G4C A;  4KQE A;  2J3L A;  1B8A A;  1X54 A;  2DTO A;  3HXW A;  2DTI A;  2DKG A;  4KR2 A;  3RKY A;  3HFV A;  3TEH B;  2QHV A;  4X5O A;  4YDQ A;  2ZR2 A;  3BJU A;  4P3P A;  1J5W A;  1KMN A;  4CH3 A;  1X2G A;  1X01 A;  2ZZE A;  3QNE A;  1WU7 A;  2QHT A;  4HWR A;  2E5A A;  4XU2 A;  4TTV A;  4G85 A;  4HWO A;  4P3N A;  4EX5 A;  5C52 B;  4J15 A;  2ZXF A;  3LSS A;  4TQF A;  2ALY B;  3A7U A;  2DU7 A;  3QO5 A;  3UGT A;  3RUX A;  1X2H A;  1E1O A;  3HY0 A;  4YPF A;  2CGH A;  3NEL A;  1GGM A;  3MQZ A;  3V8J A;  1NYR A;  4P74 A;  1B70 B;  4YRI A;  1B7Y A;  2ALY A;  2E64 A;  2AMC A;  1QF6 A;  2DZ9 A;  1IL2 A;  1H4V B;  1L0W A;  4HWP A;  4UPA A;  3QO8 A;  3A7A A;  3BFM A;  1WPY A;  2I4M A;  4H2U A;  3IAL A;  1BBW A;  4UP7 A;  3ICA A;  3OD1 A;  4H2S A;  3P8V A;  2DQ3 A;  1H4S A;  3HXV A;  2CJ9 A;  4H02 A;  4RQF A;  2DQ0 A;  3TEG A;  4YRM A;  4RDX A;  1ADJ A;  3QTC A;  2A8E A;  3EFS A;  4ZIB A;  4RQE A;  4YP0 A;  5KNN A;  4TVW A;  2ZT8 A;  2ZGW A;  4LVK A;  4RMF A;  4BW9 A;  4XTV A;  3V7C A;  1WLE A;  4Q6G A;  4YRN A;  2ZT6 A;  3A31 A;  4UP8 A;  4YRP A;  3A5Y A;  2E41 A;  4TVA B;  2DEQ A;  4TVY A;  2DTH A;  4WJ4 A;  4L87 A;  2DU5 A;  1SER A;  3HFZ A;  1ASY A;  3HXY A;  4G84 A;  3IKL A;  2Q7H A;  4DPG A;  1EIY A;  1C0A A;  4HWS A;  1ASZ A;  4TWA A;  4UP9 A;  3RGL A;  1FYF A;  1KMM A;  1Z7N A;  2HNI A;  1BIA A;  2Q5H A;  1X55 A;  3V7R A;  5C53 B;  1G51 A;  2EJG A;  1B70 A;  3VQV A;  4P75 A;  4P73 C;  4P3O A;  4YCW A;  3RL6 A;  2IY5 B;  2I4L A;  1USY C;  4LVJ A;  4HT4 A;  1H4T A;  2ZT5 A;  4LNS A;  1EVL A;  3A74 A;  2NS6 A;  1HXD A;  3EFR A;  4YRR A;  4H2X A;  4P71 C;  2ZZG A;  4YRG A;  4H2V A;  2P0L A;  1LYL A;  4PHC A;  4P71 A;  4H2T A;  3V7S A;  1H4Q A;  2QHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...