1YFTA

The crystal structure of the catalytic fragment of alanyl-trna synthetase in complex wtih glycine
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
457
structure length
448
Chain Sequence
b'SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanyl-tRNA synthetase
molecule tags Ligase
source organism Aquifex aeolicus
publication title Breaking sieve for steric exclusion of a noncognate amino acid from active site of a tRNA synthetase.
pubmed doi rcsb
total genus 151
structure length 448
sequence length 457
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2005-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1yftA01
3V7CA 4EX5A 2DTOA 2ZIMA 4TVYA 4XTWA 4UP7A 2E5AA 2P5IA 3MF2A 1WU7A 3BFMA 3A5ZA 3G1ZA 3NETA 3R07A 4YDQA 3IALA 3HTZA 4HWSA 4P73C 3TEHB 1KMMA 4CH3A 2EWNA 1YB3A 2DEQA 3RKWA 3REUA 4P72A 1WLEA 1QF6A 2AMCA 4YYEA 5KNNA 1N9WA 1G51A 4TVAB 3RKYA 3A32A 4KR2A 2IY5A 4BWAA 2ZNIA 4CS4A 2P0LA 3HXZA 1C0AA 2I4LA 2EL9A 3UGQA 3P8VA 2DDZA 1SETA 3KFUA 2E64A 2RHQA 3HXXA 4L87A 1EIYB 1X2GA 3V7SA 1ASYA 2Q5IA 4H2VA 2ZR3A 4XU0A 3QO7A 3REXA 4H2TA 4RQFA 4HVCA 1B8AA 1X55A 2DU7A 3WQZA 1JJCB 1IL2A 2CJAA 2DQ3A 4XTYA 2CJBA 4XU3A 4YRLA 4H02A 3A7UA 3UH0A 3HXYA 4YCVA 4TQDA 1EVLA 3TEGA 2EJGA 2RHSB 3MEYA 1KMNA 4XTZA 2ODRC 3L2ZA 1SRYA 1ADJA 1BIAA 1E1TA 4OP0A 1KOGA 3RKXA 3VQXA 1NJ5A 4YRNA 2J3LA 3V7RA 1X54A 1EFWA 4CH5A 4HWPA 3I7FA 3E9IA 2QHVA 1X2HA 2Q5HA 1NNHA 2ALYA 3FJPA 4HWOA 4UPAA 1W66A 1SESA 2ZINA 3A5YA 2ZZEA 3M4PA 1WPYA 3L1AA 4XTUA 1NJ2A 3HFVA 4EO4A 4H2WA 2I4MA 1Z7NA 2DKGA 2Q7HA 4YCUA 4HWRA 1NJ1A 2DTHA 1LYLA 3DSQA 4P74A 3LC0A 4J15A 3RACA 4H2UA 4H2SA 1X01A 1B70A 1NYQA 4TVWA 1WQWA 2ZXFA 2FYKA 3HXWA 5E3IA 3HRKA 4YRIA 2DQ0A 1ADYA 3QNEA 3TEHA 2ARUA 1RIQA 2DU5A 2QHTA 3TUPA 4RMFA 1USYC 3QO8A 2ZT7A 5ELNA 3CMQA 5C52B 4K86A 2E3CA 3A31A 4XEMA 2PMEA 2ZTGA 4K88A 5C53B 2ZT5A 1L0WA 4OLFA 3V8JA 2Q7EA 3LSQA 4BW9A 1JJCA 1BIBA 4RQEA 4H2XA 4Q6GA 4RDXA 4LNSA 4CS3A 4PHCA 4H2YA 4P3NA 4WI1A 3RF1A 4TQFA 1H4SA 4YRKA 2J3MA 1EIYA 4CH6A 1B7YB 3UFGA 1X56A 3EFSA 2ZZFA 3HXVA 4DQ2A 4P75A 1EVKA 4YRMA 4XU1A 1H4QA 1WYDA 4G84A 4YPFA 2RHQB 3NELA 1G5IA 1B76A 1NYRA 1ASZA 3LSSA 2QHSA 1SERA 4TTVA 2CGHA 1B7YA 1FYFA 4X5OA 5C51B 11ASA 3NEMA 4DPGA 3A74A 2ARSA 4E51A 1NJ8A 1HC7A 3UGTA 4CS2A 5K1XA 4YRFA 1Z7MA 4P71A 4WJ3M 1EQRA 1BBWA 4Q15A 4YREA 2ZNJA 2ARTA 4KR3A 3HFZB 4P71C 4P3OA 3ICAA 2ALYB 4HWTA 4XU2A 2CIMA 3HXUA 4P73A 4UP9A 3QTCA 3M4QA 3IKLA 1WQ7A 1VQZA 2C8MA 2IY5B 2DXTA 1GGMA 3HY1A 3V8LA 2AKWB 5HGQA 2ZZGA 2E10A 1ATIA 1PYSA 2DJZA 4YROA 2EJFA 3P8YA 4AH6A 3HY0A 2I4OA 2Q7GA 4YRSA 5K1PA 4YRJA 3W3SA 3OD1A 2DXUA 3RIRA 2E41A 1E22A 4O2DA 2DZCA 1PYSB 3PCOA 3NENA 3VQYA 4WJ4A 2XGTA 1USYA 2ZT8A 4KQEA 3P8TA 3RL6A 1YFRA 1NJ6A 2I4NA 2DVEA 3PCOB 4NCXA 3ERRA 1B70B 4YRPA 3RUXA 4P75C 2RHSA 4YP0A 2QHUA 2E1HA 1G5HA 3BJUA 4P3PA 1H4VB 4ZTZB 1H4TA 4TWAA 1E24A 1HXDA 1QE0A 2DTIA 3QO5A 4K87A 5ELOA 1YFSA 1J5WA 3VBBA 2ZT6A 4YRRA 12ASA 4YCWA 3IKMB 2C7IA 4YRGA 4TVAA 2AMCB 4P72C 1EOVA 2E65A 4XTVA 4XTXA 3VQVA 2ZCEA 2ODRD 2ZGWA 1HTTA 4UP8A 2HNIA 1WNLA 4G85A 4PG3A 4WF2A 4HA8A 3V8KA 3HRIA 3MF1A 4XEOA 2XTIA 4YRTA 2CJ9A 4ZTUB 3IG2A 3EFRA 1BBUA 2EAYA 3E9HA 2AKWA 3L4GA 2G4CA 2PMFA 1YGBA 4YRQA 4ZIBA 4CH4A 3VQWA 3A7AA 1YFTA 2ZR2A 2DZ9A 4P74C 2ZIOA 1E1OA 3HFZA 3PZCA 4YRCA 3RGLA 3L4GB 5F5WA 2EJ9A 3A7RA 4H2XB
chains in the Genus database with same CATH superfamily
3V7CA 4EX5A 2DTOA 2ZIMA 4TVYA 4XTWA 4UP7A 2E5AA 2P5IA 3MF2A 1WU7A 3BFMA 3A5ZA 3G1ZA 3NETA 3R07A 4YDQA 3IALA 3HTZA 4HWSA 4P73C 3TEHB 1KMMA 4CH3A 2EWNA 1YB3A 2DEQA 3RKWA 3REUA 4P72A 1WLEA 1QF6A 2AMCA 4YYEA 5KNNA 1N9WA 1G51A 4TVAB 3RKYA 3A32A 4KR2A 2IY5A 4BWAA 2ZNIA 4CS4A 2P0LA 3HXZA 1C0AA 2I4LA 2EL9A 3UGQA 3P8VA 2DDZA 1SETA 3KFUA 2E64A 2RHQA 3HXXA 4L87A 1EIYB 1X2GA 3V7SA 1ASYA 2Q5IA 4H2VA 2ZR3A 4XU0A 3QO7A 3REXA 4H2TA 4RQFA 4HVCA 1B8AA 1X55A 2DU7A 3WQZA 1JJCB 1IL2A 4LVJA 4LVKA 2CJAA 2DQ3A 4XTYA 2CJBA 4XU3A 4YRLA 4H02A 3A7UA 3UH0A 3HXYA 4YCVA 4TQDA 1EVLA 3TEGA 2EJGA 2RHSB 3MEYA 1KMNA 4XTZA 2ODRC 3L2ZA 1SRYA 1ADJA 1BIAA 1E1TA 4OP0A 1KOGA 3RKXA 3VQXA 1NJ5A 4YRNA 2J3LA 3V7RA 1X54A 1EFWA 4CH5A 4HWPA 3I7FA 3E9IA 2QHVA 1X2HA 2Q5HA 1NNHA 2ALYA 3FJPA 4HWOA 4UPAA 1W66A 1SESA 2ZINA 3A5YA 2ZZEA 3M4PA 1WPYA 3L1AA 4XTUA 1NJ2A 3HFVA 4EO4A 4H2WA 2I4MA 1Z7NA 2DKGA 2Q7HA 4YCUA 4HWRA 1NJ1A 2DTHA 1LYLA 3DSQA 4P74A 3LC0A 4J15A 3RACA 4H2UA 4H2SA 1X01A 1B70A 1NYQA 4TVWA 1WQWA 2ZXFA 2FYKA 3HXWA 5E3IA 3HRKA 4YRIA 2DQ0A 4HT4A 1ADYA 3QNEA 3TEHA 2ARUA 1RIQA 2DU5A 2QHTA 3TUPA 4RMFA 1USYC 3QO8A 2ZT7A 5ELNA 3CMQA 5C52B 4K86A 2E3CA 3A31A 4XEMA 2PMEA 2ZTGA 4K88A 5C53B 2ZT5A 1L0WA 4OLFA 3V8JA 2Q7EA 3LSQA 4BW9A 1JJCA 1BIBA 4RQEA 4H2XA 4Q6GA 4RDXA 4LNSA 4CS3A 4PHCA 4H2YA 4P3NA 4WI1A 3RF1A 4TQFA 1H4SA 4YRKA 2J3MA 1EIYA 4CH6A 1B7YB 3UFGA 1X56A 3EFSA 2ZZFA 3HXVA 4DQ2A 4P75A 1EVKA 4YRMA 4XU1A 1H4QA 1WYDA 4G84A 4YPFA 2RHQB 3NELA 1G5IA 1B76A 1NYRA 1ASZA 3LSSA 2QHSA 1SERA 4TTVA 2CGHA 1B7YA 1FYFA 4X5OA 5C51B 11ASA 3NEMA 4DPGA 3A74A 2ARSA 4E51A 1NJ8A 1HC7A 3UGTA 4CS2A 5K1XA 4YRFA 1Z7MA 4P71A 4WJ3M 1EQRA 1BBWA 4LVIA 4Q15A 4LVMA 4YREA 2ZNJA 2ARTA 4KR3A 3HFZB 4P71C 4P3OA 3ICAA 2ALYB 4HWTA 4XU2A 2CIMA 3HXUA 4P73A 4UP9A 3QTCA 3M4QA 3IKLA 1WQ7A 1VQZA 2C8MA 2IY5B 2DXTA 1GGMA 3HY1A 3V8LA 2AKWB 5HGQA 2ZZGA 2E10A 1ATIA 1PYSA 2DJZA 4YROA 2EJFA 3P8YA 4AH6A 3HY0A 2I4OA 2Q7GA 4YRSA 5K1PA 4YRJA 3W3SA 3OD1A 2DXUA 3RIRA 2E41A 1E22A 4O2DA 2DZCA 1PYSB 3PCOA 3NENA 3VQYA 4WJ4A 2XGTA 3MQZA 1USYA 2ZT8A 4KQEA 3P8TA 3RL6A 1YFRA 1NJ6A 2I4NA 2DVEA 3PCOB 4NCXA 3ERRA 1B70B 4YRPA 3RUXA 4P75C 2RHSA 4YP0A 2QHUA 2E1HA 1G5HA 3BJUA 4LVLA 4P3PA 1H4VB 4ZTZB 1H4TA 4TWAA 1E24A 1HXDA 1QE0A 2DTIA 3QO5A 4K87A 5ELOA 1YFSA 1J5WA 3VBBA 2ZT6A 4YRRA 12ASA 4YCWA 3IKMB 2C7IA 4YRGA 4TVAA 2AMCB 4P72C 1EOVA 2E65A 4XTVA 4XTXA 3VQVA 2ZCEA 2ODRD 2ZGWA 1HTTA 4UP8A 2HNIA 1WNLA 4G85A 4PG3A 2NS6A 4WF2A 4HA8A 3V8KA 3HRIA 2A8EA 3MF1A 4XEOA 2XTIA 4YRTA 2CJ9A 4ZTUB 3IG2A 3EFRA 1BBUA 2EAYA 3E9HA 2AKWA 3L4GA 2G4CA 2PMFA 1YGBA 4YRQA 4ZIBA 4CH4A 3VQWA 3A7AA 1YFTA 2ZR2A 2DZ9A 4P74C 2ZIOA 1E1OA 3HFZA 3PZCA 4YRCA 3RGLA 3L4GB 5F5WA 2EJ9A 3A7RA 4H2XB
chains in the Genus database with same CATH topology
3V7CA 4EX5A 2DTOA 2ZIMA 4TVYA 4XTWA 4UP7A 2E5AA 2P5IA 3MF2A 1WU7A 3BFMA 3A5ZA 3G1ZA 3NETA 3R07A 4YDQA 3IALA 3HTZA 4HWSA 4P73C 3TEHB 1KMMA 4CH3A 2EWNA 1YB3A 2DEQA 3RKWA 3REUA 4P72A 1WLEA 1QF6A 2AMCA 4YYEA 5KNNA 1N9WA 1G51A 4TVAB 3RKYA 3A32A 4KR2A 2IY5A 4BWAA 2ZNIA 4CS4A 2P0LA 3HXZA 1C0AA 2I4LA 2EL9A 3UGQA 3P8VA 2DDZA 1SETA 3KFUA 2E64A 2RHQA 3HXXA 4L87A 1EIYB 1X2GA 3V7SA 1ASYA 2Q5IA 4H2VA 2ZR3A 4XU0A 3QO7A 3REXA 4H2TA 4RQFA 4HVCA 1B8AA 1X55A 2DU7A 3WQZA 1JJCB 1IL2A 4LVJA 4LVKA 2CJAA 2DQ3A 4XTYA 2CJBA 4XU3A 4YRLA 4H02A 3A7UA 3UH0A 3HXYA 4YCVA 4TQDA 1EVLA 3TEGA 2EJGA 2RHSB 3MEYA 1KMNA 4XTZA 2ODRC 3L2ZA 1SRYA 1ADJA 1BIAA 1E1TA 4OP0A 1KOGA 3RKXA 3VQXA 1NJ5A 4YRNA 2J3LA 3V7RA 1X54A 1EFWA 4CH5A 4HWPA 3I7FA 3E9IA 2QHVA 1X2HA 2Q5HA 1NNHA 2ALYA 3FJPA 4HWOA 4UPAA 1W66A 1SESA 2ZINA 3A5YA 2ZZEA 3M4PA 1WPYA 3L1AA 4XTUA 1NJ2A 3HFVA 4EO4A 4H2WA 2I4MA 1Z7NA 2DKGA 2Q7HA 4YCUA 4HWRA 1NJ1A 2DTHA 1LYLA 3DSQA 4P74A 3LC0A 4J15A 3RACA 4H2UA 4H2SA 1X01A 1B70A 1NYQA 4TVWA 1WQWA 2ZXFA 2FYKA 3HXWA 5E3IA 3HRKA 4YRIA 2DQ0A 4HT4A 1ADYA 3QNEA 3TEHA 2ARUA 1RIQA 2DU5A 2QHTA 3TUPA 4RMFA 1USYC 3QO8A 2ZT7A 5ELNA 3CMQA 5C52B 4K86A 2E3CA 3A31A 4XEMA 2PMEA 2ZTGA 4K88A 5C53B 2ZT5A 1L0WA 4OLFA 3V8JA 2Q7EA 3LSQA 4BW9A 1JJCA 1BIBA 4RQEA 4H2XA 4Q6GA 4RDXA 4LNSA 4CS3A 4PHCA 4H2YA 4P3NA 4WI1A 3RF1A 4TQFA 1H4SA 4YRKA 2J3MA 1EIYA 4CH6A 1B7YB 3UFGA 1X56A 3EFSA 2ZZFA 3HXVA 4DQ2A 4P75A 1EVKA 4YRMA 4XU1A 1H4QA 1WYDA 4G84A 4YPFA 2RHQB 3NELA 1G5IA 1B76A 1NYRA 1ASZA 3LSSA 2QHSA 1SERA 4TTVA 2CGHA 1B7YA 1FYFA 4X5OA 5C51B 11ASA 3NEMA 4DPGA 3A74A 2ARSA 4E51A 1NJ8A 1HC7A 3UGTA 4CS2A 5K1XA 4YRFA 1Z7MA 4P71A 4WJ3M 1EQRA 1BBWA 4LVIA 4Q15A 4LVMA 4YREA 2ZNJA 2ARTA 4KR3A 3HFZB 4P71C 4P3OA 3ICAA 2ALYB 4HWTA 4XU2A 2CIMA 3HXUA 4P73A 4UP9A 3QTCA 3M4QA 3IKLA 1WQ7A 1VQZA 2C8MA 2IY5B 2DXTA 1GGMA 3HY1A 3V8LA 2AKWB 5HGQA 2ZZGA 2E10A 1ATIA 1PYSA 2DJZA 4YROA 2EJFA 3P8YA 4AH6A 3HY0A 2I4OA 2Q7GA 4YRSA 5K1PA 4YRJA 3W3SA 3OD1A 2DXUA 3RIRA 2E41A 1E22A 4O2DA 2DZCA 1PYSB 3PCOA 3NENA 3VQYA 4WJ4A 2XGTA 3MQZA 1USYA 2ZT8A 4KQEA 3P8TA 3RL6A 1YFRA 1NJ6A 2I4NA 2DVEA 3PCOB 4NCXA 3ERRA 1B70B 4YRPA 3RUXA 4P75C 2RHSA 4YP0A 2QHUA 2E1HA 1G5HA 3BJUA 4LVLA 4P3PA 1H4VB 4ZTZB 1H4TA 4TWAA 1E24A 1HXDA 1QE0A 2DTIA 3QO5A 4K87A 5ELOA 1YFSA 1J5WA 3VBBA 2ZT6A 4YRRA 12ASA 4YCWA 3IKMB 2C7IA 4YRGA 4TVAA 2AMCB 4P72C 1EOVA 2E65A 4XTVA 4XTXA 3VQVA 2ZCEA 2ODRD 2ZGWA 1HTTA 4UP8A 2HNIA 1WNLA 4G85A 4PG3A 2NS6A 4WF2A 4HA8A 3V8KA 3HRIA 2A8EA 3MF1A 4XEOA 2XTIA 4YRTA 2CJ9A 4ZTUB 3IG2A 3EFRA 1BBUA 2EAYA 3E9HA 2AKWA 3L4GA 2G4CA 2PMFA 1YGBA 4YRQA 4ZIBA 4CH4A 3VQWA 3A7AA 1YFTA 2ZR2A 2DZ9A 4P74C 2ZIOA 1E1OA 3HFZA 3PZCA 4YRCA 3RGLA 3L4GB 5F5WA 2EJ9A 3A7RA 4H2XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7C A;  4EX5 A;  2DTO A;  2ZIM A;  4TVY A;  4XTW A;  4UP7 A;  2E5A A;  2P5I A;  3MF2 A;  1WU7 A;  3BFM A;  3A5Z A;  3G1Z A;  3NET A;  3R07 A;  4YDQ A;  3IAL A;  3HTZ A;  4HWS A;  4P73 C;  3TEH B;  1KMM A;  4CH3 A;  2EWN A;  1YB3 A;  2DEQ A;  3RKW A;  3REU A;  4P72 A;  1WLE A;  1QF6 A;  2AMC A;  4YYE A;  5KNN A;  1N9W A;  1G51 A;  4TVA B;  3RKY A;  3A32 A;  4KR2 A;  2IY5 A;  4BWA A;  2ZNI A;  4CS4 A;  2P0L A;  3HXZ A;  1C0A A;  2I4L A;  2EL9 A;  3UGQ A;  3P8V A;  2DDZ A;  1SET A;  3KFU A;  2E64 A;  2RHQ A;  3HXX A;  4L87 A;  1EIY B;  1X2G A;  3V7S A;  1ASY A;  2Q5I A;  4H2V A;  2ZR3 A;  4XU0 A;  3QO7 A;  3REX A;  4H2T A;  4RQF A;  4HVC A;  1B8A A;  1X55 A;  2DU7 A;  3WQZ A;  1JJC B;  1IL2 A;  2CJA A;  2DQ3 A;  4XTY A;  2CJB A;  4XU3 A;  4YRL A;  4H02 A;  3A7U A;  3UH0 A;  3HXY A;  4YCV A;  4TQD A;  1EVL A;  3TEG A;  2EJG A;  2RHS B;  3MEY A;  1KMN A;  4XTZ A;  2ODR C;  3L2Z A;  1SRY A;  1ADJ A;  1BIA A;  1E1T A;  4OP0 A;  1KOG A;  3RKX A;  3VQX A;  1NJ5 A;  4YRN A;  2J3L A;  3V7R A;  1X54 A;  1EFW A;  4CH5 A;  4HWP A;  3I7F A;  3E9I A;  2QHV A;  1X2H A;  2Q5H A;  1NNH A;  2ALY A;  3FJP A;  4HWO A;  4UPA A;  1W66 A;  1SES A;  2ZIN A;  3A5Y A;  2ZZE A;  3M4P A;  1WPY A;  3L1A A;  4XTU A;  1NJ2 A;  3HFV A;  4EO4 A;  4H2W A;  2I4M A;  1Z7N A;  2DKG A;  2Q7H A;  4YCU A;  4HWR A;  1NJ1 A;  2DTH A;  1LYL A;  3DSQ A;  4P74 A;  3LC0 A;  4J15 A;  3RAC A;  4H2U A;  4H2S A;  1X01 A;  1B70 A;  1NYQ A;  4TVW A;  1WQW A;  2ZXF A;  2FYK A;  3HXW A;  5E3I A;  3HRK A;  4YRI A;  2DQ0 A;  1ADY A;  3QNE A;  3TEH A;  2ARU A;  1RIQ A;  2DU5 A;  2QHT A;  3TUP A;  4RMF A;  1USY C;  3QO8 A;  2ZT7 A;  5ELN A;  3CMQ A;  5C52 B;  4K86 A;  2E3C A;  3A31 A;  4XEM A;  2PME A;  2ZTG A;  4K88 A;  5C53 B;  2ZT5 A;  1L0W A;  4OLF A;  3V8J A;  2Q7E A;  3LSQ A;  4BW9 A;  1JJC A;  1BIB A;  4RQE A;  4H2X A;  4Q6G A;  4RDX A;  4LNS A;  4CS3 A;  4PHC A;  4H2Y A;  4P3N A;  4WI1 A;  3RF1 A;  4TQF A;  1H4S A;  4YRK A;  2J3M A;  1EIY A;  4CH6 A;  1B7Y B;  3UFG A;  1X56 A;  3EFS A;  2ZZF A;  3HXV A;  4DQ2 A;  4P75 A;  1EVK A;  4YRM A;  4XU1 A;  1H4Q A;  1WYD A;  4G84 A;  4YPF A;  2RHQ B;  3NEL A;  1G5I A;  1B76 A;  1NYR A;  1ASZ A;  3LSS A;  2QHS A;  1SER A;  4TTV A;  2CGH A;  1B7Y A;  1FYF A;  4X5O A;  5C51 B;  11AS A;  3NEM A;  4DPG A;  3A74 A;  2ARS A;  4E51 A;  1NJ8 A;  1HC7 A;  3UGT A;  4CS2 A;  5K1X A;  4YRF A;  1Z7M A;  4P71 A;  4WJ3 M;  1EQR A;  1BBW A;  4Q15 A;  4YRE A;  2ZNJ A;  2ART A;  4KR3 A;  3HFZ B;  4P71 C;  4P3O A;  3ICA A;  2ALY B;  4HWT A;  4XU2 A;  2CIM A;  3HXU A;  4P73 A;  4UP9 A;  3QTC A;  3M4Q A;  3IKL A;  1WQ7 A;  1VQZ A;  2C8M A;  2IY5 B;  2DXT A;  1GGM A;  3HY1 A;  3V8L A;  2AKW B;  5HGQ A;  2ZZG A;  2E10 A;  1ATI A;  1PYS A;  2DJZ A;  4YRO A;  2EJF A;  3P8Y A;  4AH6 A;  3HY0 A;  2I4O A;  2Q7G A;  4YRS A;  5K1P A;  4YRJ A;  3W3S A;  3OD1 A;  2DXU A;  3RIR A;  2E41 A;  1E22 A;  4O2D A;  2DZC A;  1PYS B;  3PCO A;  3NEN A;  3VQY A;  4WJ4 A;  2XGT A;  1USY A;  2ZT8 A;  4KQE A;  3P8T A;  3RL6 A;  1YFR A;  1NJ6 A;  2I4N A;  2DVE A;  3PCO B;  4NCX A;  3ERR A;  1B70 B;  4YRP A;  3RUX A;  4P75 C;  2RHS A;  4YP0 A;  2QHU A;  2E1H A;  1G5H A;  3BJU A;  4P3P A;  1H4V B;  4ZTZ B;  1H4T A;  4TWA A;  1E24 A;  1HXD A;  1QE0 A;  2DTI A;  3QO5 A;  4K87 A;  5ELO A;  1YFS A;  1J5W A;  3VBB A;  2ZT6 A;  4YRR A;  12AS A;  4YCW A;  3IKM B;  2C7I A;  4YRG A;  4TVA A;  2AMC B;  4P72 C;  1EOV A;  2E65 A;  4XTV A;  4XTX A;  3VQV A;  2ZCE A;  2ODR D;  2ZGW A;  1HTT A;  4UP8 A;  2HNI A;  1WNL A;  4G85 A;  4PG3 A;  4WF2 A;  4HA8 A;  3V8K A;  3HRI A;  3MF1 A;  4XEO A;  2XTI A;  4YRT A;  2CJ9 A;  4ZTU B;  3IG2 A;  3EFR A;  1BBU A;  2EAY A;  3E9H A;  2AKW A;  3L4G A;  2G4C A;  2PMF A;  1YGB A;  4YRQ A;  4ZIB A;  4CH4 A;  3VQW A;  3A7A A;  1YFT A;  2ZR2 A;  2DZ9 A;  4P74 C;  2ZIO A;  1E1O A;  3HFZ A;  3PZC A;  4YRC A;  3RGL A;  3L4G B;  5F5W A;  2EJ9 A;  3A7R A;  4H2X B; 
#chains in the Genus database with same CATH topology
 3V7C A;  4EX5 A;  2DTO A;  2ZIM A;  4TVY A;  4XTW A;  4UP7 A;  2E5A A;  2P5I A;  3MF2 A;  1WU7 A;  3BFM A;  3A5Z A;  3G1Z A;  3NET A;  3R07 A;  4YDQ A;  3IAL A;  3HTZ A;  4HWS A;  4P73 C;  3TEH B;  1KMM A;  4CH3 A;  2EWN A;  1YB3 A;  2DEQ A;  3RKW A;  3REU A;  4P72 A;  1WLE A;  1QF6 A;  2AMC A;  4YYE A;  5KNN A;  1N9W A;  1G51 A;  4TVA B;  3RKY A;  3A32 A;  4KR2 A;  2IY5 A;  4BWA A;  2ZNI A;  4CS4 A;  2P0L A;  3HXZ A;  1C0A A;  2I4L A;  2EL9 A;  3UGQ A;  3P8V A;  2DDZ A;  1SET A;  3KFU A;  2E64 A;  2RHQ A;  3HXX A;  4L87 A;  1EIY B;  1X2G A;  3V7S A;  1ASY A;  2Q5I A;  4H2V A;  2ZR3 A;  4XU0 A;  3QO7 A;  3REX A;  4H2T A;  4RQF A;  4HVC A;  1B8A A;  1X55 A;  2DU7 A;  3WQZ A;  1JJC B;  1IL2 A;  4LVJ A;  4LVK A;  2CJA A;  2DQ3 A;  4XTY A;  2CJB A;  4XU3 A;  4YRL A;  4H02 A;  3A7U A;  3UH0 A;  3HXY A;  4YCV A;  4TQD A;  1EVL A;  3TEG A;  2EJG A;  2RHS B;  3MEY A;  1KMN A;  4XTZ A;  2ODR C;  3L2Z A;  1SRY A;  1ADJ A;  1BIA A;  1E1T A;  4OP0 A;  1KOG A;  3RKX A;  3VQX A;  1NJ5 A;  4YRN A;  2J3L A;  3V7R A;  1X54 A;  1EFW A;  4CH5 A;  4HWP A;  3I7F A;  3E9I A;  2QHV A;  1X2H A;  2Q5H A;  1NNH A;  2ALY A;  3FJP A;  4HWO A;  4UPA A;  1W66 A;  1SES A;  2ZIN A;  3A5Y A;  2ZZE A;  3M4P A;  1WPY A;  3L1A A;  4XTU A;  1NJ2 A;  3HFV A;  4EO4 A;  4H2W A;  2I4M A;  1Z7N A;  2DKG A;  2Q7H A;  4YCU A;  4HWR A;  1NJ1 A;  2DTH A;  1LYL A;  3DSQ A;  4P74 A;  3LC0 A;  4J15 A;  3RAC A;  4H2U A;  4H2S A;  1X01 A;  1B70 A;  1NYQ A;  4TVW A;  1WQW A;  2ZXF A;  2FYK A;  3HXW A;  5E3I A;  3HRK A;  4YRI A;  2DQ0 A;  4HT4 A;  1ADY A;  3QNE A;  3TEH A;  2ARU A;  1RIQ A;  2DU5 A;  2QHT A;  3TUP A;  4RMF A;  1USY C;  3QO8 A;  2ZT7 A;  5ELN A;  3CMQ A;  5C52 B;  4K86 A;  2E3C A;  3A31 A;  4XEM A;  2PME A;  2ZTG A;  4K88 A;  5C53 B;  2ZT5 A;  1L0W A;  4OLF A;  3V8J A;  2Q7E A;  3LSQ A;  4BW9 A;  1JJC A;  1BIB A;  4RQE A;  4H2X A;  4Q6G A;  4RDX A;  4LNS A;  4CS3 A;  4PHC A;  4H2Y A;  4P3N A;  4WI1 A;  3RF1 A;  4TQF A;  1H4S A;  4YRK A;  2J3M A;  1EIY A;  4CH6 A;  1B7Y B;  3UFG A;  1X56 A;  3EFS A;  2ZZF A;  3HXV A;  4DQ2 A;  4P75 A;  1EVK A;  4YRM A;  4XU1 A;  1H4Q A;  1WYD A;  4G84 A;  4YPF A;  2RHQ B;  3NEL A;  1G5I A;  1B76 A;  1NYR A;  1ASZ A;  3LSS A;  2QHS A;  1SER A;  4TTV A;  2CGH A;  1B7Y A;  1FYF A;  4X5O A;  5C51 B;  11AS A;  3NEM A;  4DPG A;  3A74 A;  2ARS A;  4E51 A;  1NJ8 A;  1HC7 A;  3UGT A;  4CS2 A;  5K1X A;  4YRF A;  1Z7M A;  4P71 A;  4WJ3 M;  1EQR A;  1BBW A;  4LVI A;  4Q15 A;  4LVM A;  4YRE A;  2ZNJ A;  2ART A;  4KR3 A;  3HFZ B;  4P71 C;  4P3O A;  3ICA A;  2ALY B;  4HWT A;  4XU2 A;  2CIM A;  3HXU A;  4P73 A;  4UP9 A;  3QTC A;  3M4Q A;  3IKL A;  1WQ7 A;  1VQZ A;  2C8M A;  2IY5 B;  2DXT A;  1GGM A;  3HY1 A;  3V8L A;  2AKW B;  5HGQ A;  2ZZG A;  2E10 A;  1ATI A;  1PYS A;  2DJZ A;  4YRO A;  2EJF A;  3P8Y A;  4AH6 A;  3HY0 A;  2I4O A;  2Q7G A;  4YRS A;  5K1P A;  4YRJ A;  3W3S A;  3OD1 A;  2DXU A;  3RIR A;  2E41 A;  1E22 A;  4O2D A;  2DZC A;  1PYS B;  3PCO A;  3NEN A;  3VQY A;  4WJ4 A;  2XGT A;  3MQZ A;  1USY A;  2ZT8 A;  4KQE A;  3P8T A;  3RL6 A;  1YFR A;  1NJ6 A;  2I4N A;  2DVE A;  3PCO B;  4NCX A;  3ERR A;  1B70 B;  4YRP A;  3RUX A;  4P75 C;  2RHS A;  4YP0 A;  2QHU A;  2E1H A;  1G5H A;  3BJU A;  4LVL A;  4P3P A;  1H4V B;  4ZTZ B;  1H4T A;  4TWA A;  1E24 A;  1HXD A;  1QE0 A;  2DTI A;  3QO5 A;  4K87 A;  5ELO A;  1YFS A;  1J5W A;  3VBB A;  2ZT6 A;  4YRR A;  12AS A;  4YCW A;  3IKM B;  2C7I A;  4YRG A;  4TVA A;  2AMC B;  4P72 C;  1EOV A;  2E65 A;  4XTV A;  4XTX A;  3VQV A;  2ZCE A;  2ODR D;  2ZGW A;  1HTT A;  4UP8 A;  2HNI A;  1WNL A;  4G85 A;  4PG3 A;  2NS6 A;  4WF2 A;  4HA8 A;  3V8K A;  3HRI A;  2A8E A;  3MF1 A;  4XEO A;  2XTI A;  4YRT A;  2CJ9 A;  4ZTU B;  3IG2 A;  3EFR A;  1BBU A;  2EAY A;  3E9H A;  2AKW A;  3L4G A;  2G4C A;  2PMF A;  1YGB A;  4YRQ A;  4ZIB A;  4CH4 A;  3VQW A;  3A7A A;  1YFT A;  2ZR2 A;  2DZ9 A;  4P74 C;  2ZIO A;  1E1O A;  3HFZ A;  3PZC A;  4YRC A;  3RGL A;  3L4G B;  5F5W A;  2EJ9 A;  3A7R A;  4H2X B; 
#chains in the Genus database with same CATH homology
 3V7C A;  4EX5 A;  2DTO A;  2ZIM A;  4TVY A;  4XTW A;  4UP7 A;  2E5A A;  2P5I A;  3MF2 A;  1WU7 A;  3BFM A;  3A5Z A;  3G1Z A;  3NET A;  3R07 A;  4YDQ A;  3IAL A;  3HTZ A;  4HWS A;  4P73 C;  3TEH B;  1KMM A;  4CH3 A;  2EWN A;  1YB3 A;  2DEQ A;  3RKW A;  3REU A;  4P72 A;  1WLE A;  1QF6 A;  2AMC A;  4YYE A;  5KNN A;  1N9W A;  1G51 A;  4TVA B;  3RKY A;  3A32 A;  4KR2 A;  2IY5 A;  4BWA A;  2ZNI A;  4CS4 A;  2P0L A;  3HXZ A;  1C0A A;  2I4L A;  2EL9 A;  3UGQ A;  3P8V A;  2DDZ A;  1SET A;  3KFU A;  2E64 A;  2RHQ A;  3HXX A;  4L87 A;  1EIY B;  1X2G A;  3V7S A;  1ASY A;  2Q5I A;  4H2V A;  2ZR3 A;  4XU0 A;  3QO7 A;  3REX A;  4H2T A;  4RQF A;  4HVC A;  1B8A A;  1X55 A;  2DU7 A;  3WQZ A;  1JJC B;  1IL2 A;  4LVJ A;  4LVK A;  2CJA A;  2DQ3 A;  4XTY A;  2CJB A;  4XU3 A;  4YRL A;  4H02 A;  3A7U A;  3UH0 A;  3HXY A;  4YCV A;  4TQD A;  1EVL A;  3TEG A;  2EJG A;  2RHS B;  3MEY A;  1KMN A;  4XTZ A;  2ODR C;  3L2Z A;  1SRY A;  1ADJ A;  1BIA A;  1E1T A;  4OP0 A;  1KOG A;  3RKX A;  3VQX A;  1NJ5 A;  4YRN A;  2J3L A;  3V7R A;  1X54 A;  1EFW A;  4CH5 A;  4HWP A;  3I7F A;  3E9I A;  2QHV A;  1X2H A;  2Q5H A;  1NNH A;  2ALY A;  3FJP A;  4HWO A;  4UPA A;  1W66 A;  1SES A;  2ZIN A;  3A5Y A;  2ZZE A;  3M4P A;  1WPY A;  3L1A A;  4XTU A;  1NJ2 A;  3HFV A;  4EO4 A;  4H2W A;  2I4M A;  1Z7N A;  2DKG A;  2Q7H A;  4YCU A;  4HWR A;  1NJ1 A;  2DTH A;  1LYL A;  3DSQ A;  4P74 A;  3LC0 A;  4J15 A;  3RAC A;  4H2U A;  4H2S A;  1X01 A;  1B70 A;  1NYQ A;  4TVW A;  1WQW A;  2ZXF A;  2FYK A;  3HXW A;  5E3I A;  3HRK A;  4YRI A;  2DQ0 A;  4HT4 A;  1ADY A;  3QNE A;  3TEH A;  2ARU A;  1RIQ A;  2DU5 A;  2QHT A;  3TUP A;  4RMF A;  1USY C;  3QO8 A;  2ZT7 A;  5ELN A;  3CMQ A;  5C52 B;  4K86 A;  2E3C A;  3A31 A;  4XEM A;  2PME A;  2ZTG A;  4K88 A;  5C53 B;  2ZT5 A;  1L0W A;  4OLF A;  3V8J A;  2Q7E A;  3LSQ A;  4BW9 A;  1JJC A;  1BIB A;  4RQE A;  4H2X A;  4Q6G A;  4RDX A;  4LNS A;  4CS3 A;  4PHC A;  4H2Y A;  4P3N A;  4WI1 A;  3RF1 A;  4TQF A;  1H4S A;  4YRK A;  2J3M A;  1EIY A;  4CH6 A;  1B7Y B;  3UFG A;  1X56 A;  3EFS A;  2ZZF A;  3HXV A;  4DQ2 A;  4P75 A;  1EVK A;  4YRM A;  4XU1 A;  1H4Q A;  1WYD A;  4G84 A;  4YPF A;  2RHQ B;  3NEL A;  1G5I A;  1B76 A;  1NYR A;  1ASZ A;  3LSS A;  2QHS A;  1SER A;  4TTV A;  2CGH A;  1B7Y A;  1FYF A;  4X5O A;  5C51 B;  11AS A;  3NEM A;  4DPG A;  3A74 A;  2ARS A;  4E51 A;  1NJ8 A;  1HC7 A;  3UGT A;  4CS2 A;  5K1X A;  4YRF A;  1Z7M A;  4P71 A;  4WJ3 M;  1EQR A;  1BBW A;  4LVI A;  4Q15 A;  4LVM A;  4YRE A;  2ZNJ A;  2ART A;  4KR3 A;  3HFZ B;  4P71 C;  4P3O A;  3ICA A;  2ALY B;  4HWT A;  4XU2 A;  2CIM A;  3HXU A;  4P73 A;  4UP9 A;  3QTC A;  3M4Q A;  3IKL A;  1WQ7 A;  1VQZ A;  2C8M A;  2IY5 B;  2DXT A;  1GGM A;  3HY1 A;  3V8L A;  2AKW B;  5HGQ A;  2ZZG A;  2E10 A;  1ATI A;  1PYS A;  2DJZ A;  4YRO A;  2EJF A;  3P8Y A;  4AH6 A;  3HY0 A;  2I4O A;  2Q7G A;  4YRS A;  5K1P A;  4YRJ A;  3W3S A;  3OD1 A;  2DXU A;  3RIR A;  2E41 A;  1E22 A;  4O2D A;  2DZC A;  1PYS B;  3PCO A;  3NEN A;  3VQY A;  4WJ4 A;  2XGT A;  3MQZ A;  1USY A;  2ZT8 A;  4KQE A;  3P8T A;  3RL6 A;  1YFR A;  1NJ6 A;  2I4N A;  2DVE A;  3PCO B;  4NCX A;  3ERR A;  1B70 B;  4YRP A;  3RUX A;  4P75 C;  2RHS A;  4YP0 A;  2QHU A;  2E1H A;  1G5H A;  3BJU A;  4LVL A;  4P3P A;  1H4V B;  4ZTZ B;  1H4T A;  4TWA A;  1E24 A;  1HXD A;  1QE0 A;  2DTI A;  3QO5 A;  4K87 A;  5ELO A;  1YFS A;  1J5W A;  3VBB A;  2ZT6 A;  4YRR A;  12AS A;  4YCW A;  3IKM B;  2C7I A;  4YRG A;  4TVA A;  2AMC B;  4P72 C;  1EOV A;  2E65 A;  4XTV A;  4XTX A;  3VQV A;  2ZCE A;  2ODR D;  2ZGW A;  1HTT A;  4UP8 A;  2HNI A;  1WNL A;  4G85 A;  4PG3 A;  2NS6 A;  4WF2 A;  4HA8 A;  3V8K A;  3HRI A;  2A8E A;  3MF1 A;  4XEO A;  2XTI A;  4YRT A;  2CJ9 A;  4ZTU B;  3IG2 A;  3EFR A;  1BBU A;  2EAY A;  3E9H A;  2AKW A;  3L4G A;  2G4C A;  2PMF A;  1YGB A;  4YRQ A;  4ZIB A;  4CH4 A;  3VQW A;  3A7A A;  1YFT A;  2ZR2 A;  2DZ9 A;  4P74 C;  2ZIO A;  1E1O A;  3HFZ A;  3PZC A;  4YRC A;  3RGL A;  3L4G B;  5F5W A;  2EJ9 A;  3A7R A;  4H2X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...