1YFTA

The crystal structure of the catalytic fragment of alanyl-trna synthetase in complex wtih glycine
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
457
structure length
448
Chain Sequence
SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanyl-tRNA synthetase
publication title Breaking sieve for steric exclusion of a noncognate amino acid from active site of a tRNA synthetase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 151
structure length 448
sequence length 457
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2005-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1yftA01
1J5WA 2QHUA 4K87A 2CJBA 3QNEA 4P71C 2ZIOA 3REXA 4WJ4A 2E10A 4OP0A 4H2XA 3W3SA 4YRCA 3NEMA 3NENA 1Z7NA 3A32A 1H4QA 5HGQA 3HXVA 2J3MA 1USYA 5K1PA 1YFSA 3QTCA 1G51A 4H2TA 3UH0A 4ZIBA 5ELNA 4BW9A 1NJ1A 1WU7A 3QO5A 4HWPA 1H4SA 4CH3A 4KQEA 1PYSA 3V8LA 4YCUA 3RKWA 4YP0A 2EWNA 4RDXA 4P71A 1BIBA 2ZT6A 1X55A 4P3NA 4KR2A 2Q5IA 1B76A 4HWOA 3HFZB 4XTVA 3HXZA 2I4LA 3BJUA 3A5ZA 2RHQB 2AMCA 4YRGA 5C51B 1EOVA 1X54A 2P0LA 2Q7EA 3RACA 2DU5A 1X2GA 1NJ2A 3L4GA 2RHSA 3REUA 1G5IA 1WQWA 2J3LA 1E24A 4YRNA 1BIAA 2EJFA 4XU1A 2DKGA 1YFTA 3L1AA 1QF6A 2XTIA 2XGTA 1NYRA 4Q6GA 4HWSA 4L87A 1YGBA 1SESA 4H2UA 4RQEA 1WPYA 2DU7A 2ZXFA 1ATIA 4RQFA 2I4OA 4YRKA 4YCWA 3MF2A 2CJAA 2ZTGA 4YREA 4YROA 1KOGA 1W66A 3A7AA 2ZR3A 2E3CA 4RMFA 1ADJA 3M4QA 2DXUA 2HNIA 1EFWA 3WQZA 3HXYA 4XTUA 2DTIA 4CS4A 4WF2A 3KFUA 2P5IA 4EX5A 2ZT7A 3EFRA 4TVYA 3MF1A 3OD1A 4UP7A 3VQYA 1HC7A 2DQ0A 4XTXA 3RL6A 4KR3A 1GGMA 1JJCA 3EFSA 4P74C 2ARTA 1E1TA 4CS3A 4XEMA 4G84A 1SETA 1HXDA 2DDZA 4YRQA 12ASA 3TUPA 4H2WA 4X5OA 2I4NA 4NCXA 3P8YA 4YRMA 1X56A 3QO7A 1ASZA 1NJ5A 4XTWA 5F5WA 4DQ2A 1BBUA 4G85A 2EJ9A 3V7SA 2DXTA 2ZNJA 1NYQA 2ZINA 4TQDA 1LYLA 3HRIA 4TVAB 4YRTA 1NNHA 4XEOA 2ARUA 4PHCA 3PCOA 3RF1A 2CJ9A 3G1ZA 1B7YA 4K88A 2ALYA 2CGHA 4P74A 4LNSA 1FYFA 1EIYA 3L2ZA 3IG2A 2DTHA 4BWAA 2EJGA 3P8VA 3TEHB 4P73C 4EO4A 1KMMA 4H2YA 4CH6A 3UFGA 4CS2A 4Q15A 11ASA 3M4PA 2CIMA 4YRLA 1BBWA 1EVKA 2PMFA 3HFVA 3R07A 2E5AA 5C53B 3A31A 4YCVA 2C8MA 4PG3A 3VQWA 3HXWA 4H2VA 2DJZA 2QHTA 2ODRD 2ARSA 4P75C 4CH5A 4TWAA 1L0WA 1E1OA 2IY5A 1C0AA 2AKWA 1SRYA 3L4GB 4XTYA 1VQZA 1B70B 1B8AA 4P73A 4TTVA 4DPGA 4YRFA 2ZGWA 1HTTA 3TEGA 3BFMA 3NETA 5KNNA 2ZT5A 3V7RA 4YRRA 3A7RA 3RIRA 4ZTZB 2DVEA 4WJ3M 4XU0A 2ZT8A 1E22A 1H4TA 1NJ8A 3ICAA 3E9IA 4P75A 1SERA 1N9WA 1ASYA 3LC0A 1EVLA 3ERRA 3MEYA 4XTZA 3P8TA 4E51A 2ZR2A 1G5HA 3A5YA 4HVCA 4P72C 4H2SA 2QHSA 1Z7MA 3RKYA 4H02A 4TVWA 3HY0A 1EQRA 2E64A 4YRPA 2I4MA 2ZCEA 4WI1A 4K86A 1WNLA 4UP8A 3UGTA 2Q7HA 2DEQA 1X01A 3HXXA 1JJCB 1H4VB 4H2XB 3V8KA 3RKXA 2Q5HA 3QO8A 4TVAA 4TQFA 5C52B 4YRSA 3DSQA 4P72A 3HRKA 3V7CA 4J15A 3V8JA 4OLFA 5E3IA 1YFRA 3IALA 3LSSA 1X2HA 4CH4A 3HFZA 4YRJA 3TEHA 2EAYA 3IKMB 1PYSB 2RHQA 3LSQA 2C7IA 3RUXA 3VBBA 2DQ3A 5ELOA 1WQ7A 1NJ6A 2QHVA 1IL2A 2FYKA 4HWRA 3PCOB 4UP9A 1B7YB 2ALYB 3UGQA 4AH6A 4YDQA 1EIYB 1KMNA 2DZ9A 3A74A 3A7UA 2ZIMA 3PZCA 3VQVA 4YYEA 4P3PA 2AMCB 2PMEA 2ZZEA 1YB3A 4HA8A 1QE0A 2RHSB 1B70A 2G4CA 2Q7GA 2DZCA 3E9HA 2DTOA 2E1HA 2E65A 4XU2A 2IY5B 2ODRC 3FJPA 5K1XA 2ZNIA 2AKWB 1WLEA 4O2DA 3RGLA 4YRIA 3HY1A 4ZTUB 1RIQA 1ADYA 3NELA 3HXUA 1WYDA 3I7FA 1USYC 4YPFA 3VQXA 4P3OA 2ZZFA 4UPAA 2EL9A 3HTZA 2ZZGA 4XU3A 3CMQA 3IKLA 4HWTA 2E41A
chains in the Genus database with same CATH superfamily
4LVKA 1J5WA 2QHUA 4K87A 2CJBA 3QNEA 4P71C 2ZIOA 3REXA 4WJ4A 2E10A 4OP0A 4H2XA 3W3SA 4YRCA 3NEMA 3NENA 1Z7NA 3A32A 1H4QA 5HGQA 3HXVA 4LVLA 2J3MA 1USYA 5K1PA 1YFSA 3QTCA 1G51A 4H2TA 3UH0A 4ZIBA 5ELNA 4BW9A 1NJ1A 1WU7A 3QO5A 4HWPA 1H4SA 4CH3A 4KQEA 1PYSA 3V8LA 4YCUA 3RKWA 4YP0A 2EWNA 4RDXA 4P71A 1BIBA 2ZT6A 1X55A 4P3NA 4KR2A 2Q5IA 1B76A 4HWOA 3HFZB 4XTVA 3HXZA 2I4LA 3BJUA 3A5ZA 2RHQB 2AMCA 4YRGA 5C51B 1EOVA 1X54A 2P0LA 2Q7EA 3RACA 2DU5A 1X2GA 1NJ2A 3L4GA 2RHSA 3REUA 1G5IA 1WQWA 2J3LA 1E24A 4YRNA 1BIAA 2EJFA 4XU1A 2DKGA 1YFTA 3L1AA 1QF6A 2XTIA 2XGTA 1NYRA 4Q6GA 4HWSA 4L87A 1YGBA 1SESA 4H2UA 4RQEA 1WPYA 2DU7A 2ZXFA 1ATIA 4RQFA 2I4OA 4YRKA 4YCWA 3MF2A 2CJAA 2ZTGA 4YREA 4YROA 1KOGA 1W66A 3A7AA 2ZR3A 2E3CA 4RMFA 1ADJA 3M4QA 2DXUA 2HNIA 1EFWA 3WQZA 3HXYA 4XTUA 2DTIA 4CS4A 4WF2A 3KFUA 2A8EA 2P5IA 4EX5A 2ZT7A 3EFRA 4TVYA 3MF1A 3OD1A 4UP7A 3VQYA 1HC7A 2DQ0A 4XTXA 3RL6A 4KR3A 1GGMA 1JJCA 3EFSA 4P74C 2ARTA 1E1TA 4CS3A 4XEMA 4G84A 1SETA 1HXDA 2DDZA 4YRQA 12ASA 3TUPA 4H2WA 4X5OA 2I4NA 4NCXA 3P8YA 4YRMA 1X56A 3QO7A 1ASZA 1NJ5A 4XTWA 5F5WA 4DQ2A 1BBUA 4G85A 2EJ9A 3V7SA 2DXTA 2ZNJA 1NYQA 2ZINA 4TQDA 1LYLA 3HRIA 4TVAB 4YRTA 1NNHA 4XEOA 2ARUA 4PHCA 3PCOA 3RF1A 2CJ9A 3G1ZA 1B7YA 4K88A 2ALYA 2CGHA 4P74A 4LNSA 1FYFA 1EIYA 3L2ZA 3IG2A 2DTHA 4BWAA 2EJGA 3P8VA 3TEHB 4P73C 4EO4A 1KMMA 4H2YA 4CH6A 3UFGA 4CS2A 4Q15A 11ASA 3M4PA 2CIMA 4YRLA 1BBWA 1EVKA 2PMFA 3HFVA 3R07A 2E5AA 5C53B 3A31A 4YCVA 2C8MA 4PG3A 3VQWA 3HXWA 4H2VA 2DJZA 2QHTA 2ODRD 2ARSA 4P75C 4CH5A 4TWAA 1L0WA 1E1OA 2IY5A 1C0AA 2AKWA 1SRYA 3L4GB 4XTYA 1VQZA 1B70B 4HT4A 1B8AA 4P73A 4TTVA 4DPGA 4YRFA 2ZGWA 1HTTA 3TEGA 3BFMA 3NETA 5KNNA 2ZT5A 3V7RA 4YRRA 3A7RA 3RIRA 4ZTZB 2DVEA 4WJ3M 4XU0A 2ZT8A 1E22A 1H4TA 1NJ8A 3ICAA 3E9IA 4P75A 1SERA 1N9WA 1ASYA 3LC0A 1EVLA 3ERRA 3MEYA 4XTZA 3P8TA 4E51A 2ZR2A 1G5HA 3A5YA 4HVCA 4P72C 4H2SA 2QHSA 1Z7MA 3RKYA 4H02A 4TVWA 3HY0A 1EQRA 2E64A 4LVIA 4YRPA 2I4MA 2ZCEA 4WI1A 4K86A 1WNLA 4UP8A 3UGTA 2Q7HA 2DEQA 1X01A 3HXXA 1JJCB 1H4VB 4H2XB 3V8KA 3RKXA 2Q5HA 4LVJA 3QO8A 4TVAA 4TQFA 2NS6A 5C52B 4YRSA 3DSQA 4P72A 3HRKA 3V7CA 4J15A 3V8JA 4OLFA 5E3IA 1YFRA 3IALA 3LSSA 1X2HA 4CH4A 3HFZA 4YRJA 3TEHA 2EAYA 3IKMB 1PYSB 2RHQA 3LSQA 2C7IA 3RUXA 3VBBA 2DQ3A 5ELOA 1WQ7A 1NJ6A 2QHVA 1IL2A 2FYKA 4HWRA 3PCOB 4UP9A 1B7YB 2ALYB 3UGQA 4AH6A 4LVMA 4YDQA 1EIYB 1KMNA 2DZ9A 3A74A 3A7UA 2ZIMA 3PZCA 3VQVA 4YYEA 4P3PA 2AMCB 2PMEA 2ZZEA 1YB3A 4HA8A 1QE0A 2RHSB 1B70A 2G4CA 2Q7GA 2DZCA 3E9HA 2DTOA 2E1HA 2E65A 4XU2A 2IY5B 2ODRC 3FJPA 5K1XA 2ZNIA 2AKWB 1WLEA 4O2DA 3RGLA 4YRIA 3HY1A 4ZTUB 1RIQA 1ADYA 3NELA 3HXUA 1WYDA 3I7FA 1USYC 3MQZA 4YPFA 3VQXA 4P3OA 2ZZFA 4UPAA 2EL9A 3HTZA 2ZZGA 4XU3A 3CMQA 3IKLA 4HWTA 2E41A
chains in the Genus database with same CATH topology
4LVKA 1J5WA 2QHUA 4K87A 2CJBA 3QNEA 4P71C 2ZIOA 3REXA 4WJ4A 2E10A 4OP0A 4H2XA 3W3SA 4YRCA 3NEMA 3NENA 1Z7NA 3A32A 1H4QA 5HGQA 3HXVA 4LVLA 2J3MA 1USYA 5K1PA 1YFSA 3QTCA 1G51A 4H2TA 3UH0A 4ZIBA 5ELNA 4BW9A 1NJ1A 1WU7A 3QO5A 4HWPA 1H4SA 4CH3A 4KQEA 1PYSA 3V8LA 4YCUA 3RKWA 4YP0A 2EWNA 4RDXA 4P71A 1BIBA 2ZT6A 1X55A 4P3NA 4KR2A 2Q5IA 1B76A 4HWOA 3HFZB 4XTVA 3HXZA 2I4LA 3BJUA 3A5ZA 2RHQB 2AMCA 4YRGA 5C51B 1EOVA 1X54A 2P0LA 2Q7EA 3RACA 2DU5A 1X2GA 1NJ2A 3L4GA 2RHSA 3REUA 1G5IA 1WQWA 2J3LA 1E24A 4YRNA 1BIAA 2EJFA 4XU1A 2DKGA 1YFTA 3L1AA 1QF6A 2XTIA 2XGTA 1NYRA 4Q6GA 4HWSA 4L87A 1YGBA 1SESA 4H2UA 4RQEA 1WPYA 2DU7A 2ZXFA 1ATIA 4RQFA 2I4OA 4YRKA 4YCWA 3MF2A 2CJAA 2ZTGA 4YREA 4YROA 1KOGA 1W66A 3A7AA 2ZR3A 2E3CA 4RMFA 1ADJA 3M4QA 2DXUA 2HNIA 1EFWA 3WQZA 3HXYA 4XTUA 2DTIA 4CS4A 4WF2A 3KFUA 2A8EA 2P5IA 4EX5A 2ZT7A 3EFRA 4TVYA 3MF1A 3OD1A 4UP7A 3VQYA 1HC7A 2DQ0A 4XTXA 3RL6A 4KR3A 1GGMA 1JJCA 3EFSA 4P74C 2ARTA 1E1TA 4CS3A 4XEMA 4G84A 1SETA 1HXDA 2DDZA 4YRQA 12ASA 3TUPA 4H2WA 4X5OA 2I4NA 4NCXA 3P8YA 4YRMA 1X56A 3QO7A 1ASZA 1NJ5A 4XTWA 5F5WA 4DQ2A 1BBUA 4G85A 2EJ9A 3V7SA 2DXTA 2ZNJA 1NYQA 2ZINA 4TQDA 1LYLA 3HRIA 4TVAB 4YRTA 1NNHA 4XEOA 2ARUA 4PHCA 3PCOA 3RF1A 2CJ9A 3G1ZA 1B7YA 4K88A 2ALYA 2CGHA 4P74A 4LNSA 1FYFA 1EIYA 3L2ZA 3IG2A 2DTHA 4BWAA 2EJGA 3P8VA 3TEHB 4P73C 4EO4A 1KMMA 4H2YA 4CH6A 3UFGA 4CS2A 4Q15A 11ASA 3M4PA 2CIMA 4YRLA 1BBWA 1EVKA 2PMFA 3HFVA 3R07A 2E5AA 5C53B 3A31A 4YCVA 2C8MA 4PG3A 3VQWA 3HXWA 4H2VA 2DJZA 2QHTA 2ODRD 2ARSA 4P75C 4CH5A 4TWAA 1L0WA 1E1OA 2IY5A 1C0AA 2AKWA 1SRYA 3L4GB 4XTYA 1VQZA 1B70B 4HT4A 1B8AA 4P73A 4TTVA 4DPGA 4YRFA 2ZGWA 1HTTA 3TEGA 3BFMA 3NETA 5KNNA 2ZT5A 3V7RA 4YRRA 3A7RA 3RIRA 4ZTZB 2DVEA 4WJ3M 4XU0A 2ZT8A 1E22A 1H4TA 1NJ8A 3ICAA 3E9IA 4P75A 1SERA 1N9WA 1ASYA 3LC0A 1EVLA 3ERRA 3MEYA 4XTZA 3P8TA 4E51A 2ZR2A 1G5HA 3A5YA 4HVCA 4P72C 4H2SA 2QHSA 1Z7MA 3RKYA 4H02A 4TVWA 3HY0A 1EQRA 2E64A 4LVIA 4YRPA 2I4MA 2ZCEA 4WI1A 4K86A 1WNLA 4UP8A 3UGTA 2Q7HA 2DEQA 1X01A 3HXXA 1JJCB 1H4VB 4H2XB 3V8KA 3RKXA 2Q5HA 4LVJA 3QO8A 4TVAA 4TQFA 2NS6A 5C52B 4YRSA 3DSQA 4P72A 3HRKA 3V7CA 4J15A 3V8JA 4OLFA 5E3IA 1YFRA 3IALA 3LSSA 1X2HA 4CH4A 3HFZA 4YRJA 3TEHA 2EAYA 3IKMB 1PYSB 2RHQA 3LSQA 2C7IA 3RUXA 3VBBA 2DQ3A 5ELOA 1WQ7A 1NJ6A 2QHVA 1IL2A 2FYKA 4HWRA 3PCOB 4UP9A 1B7YB 2ALYB 3UGQA 4AH6A 4LVMA 4YDQA 1EIYB 1KMNA 2DZ9A 3A74A 3A7UA 2ZIMA 3PZCA 3VQVA 4YYEA 4P3PA 2AMCB 2PMEA 2ZZEA 1YB3A 4HA8A 1QE0A 2RHSB 1B70A 2G4CA 2Q7GA 2DZCA 3E9HA 2DTOA 2E1HA 2E65A 4XU2A 2IY5B 2ODRC 3FJPA 5K1XA 2ZNIA 2AKWB 1WLEA 4O2DA 3RGLA 4YRIA 3HY1A 4ZTUB 1RIQA 1ADYA 3NELA 3HXUA 1WYDA 3I7FA 1USYC 3MQZA 4YPFA 3VQXA 4P3OA 2ZZFA 4UPAA 2EL9A 3HTZA 2ZZGA 4XU3A 3CMQA 3IKLA 4HWTA 2E41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5W A;  2QHU A;  4K87 A;  2CJB A;  3QNE A;  4P71 C;  2ZIO A;  3REX A;  4WJ4 A;  2E10 A;  4OP0 A;  4H2X A;  3W3S A;  4YRC A;  3NEM A;  3NEN A;  1Z7N A;  3A32 A;  1H4Q A;  5HGQ A;  3HXV A;  2J3M A;  1USY A;  5K1P A;  1YFS A;  3QTC A;  1G51 A;  4H2T A;  3UH0 A;  4ZIB A;  5ELN A;  4BW9 A;  1NJ1 A;  1WU7 A;  3QO5 A;  4HWP A;  1H4S A;  4CH3 A;  4KQE A;  1PYS A;  3V8L A;  4YCU A;  3RKW A;  4YP0 A;  2EWN A;  4RDX A;  4P71 A;  1BIB A;  2ZT6 A;  1X55 A;  4P3N A;  4KR2 A;  2Q5I A;  1B76 A;  4HWO A;  3HFZ B;  4XTV A;  3HXZ A;  2I4L A;  3BJU A;  3A5Z A;  2RHQ B;  2AMC A;  4YRG A;  5C51 B;  1EOV A;  1X54 A;  2P0L A;  2Q7E A;  3RAC A;  2DU5 A;  1X2G A;  1NJ2 A;  3L4G A;  2RHS A;  3REU A;  1G5I A;  1WQW A;  2J3L A;  1E24 A;  4YRN A;  1BIA A;  2EJF A;  4XU1 A;  2DKG A;  1YFT A;  3L1A A;  1QF6 A;  2XTI A;  2XGT A;  1NYR A;  4Q6G A;  4HWS A;  4L87 A;  1YGB A;  1SES A;  4H2U A;  4RQE A;  1WPY A;  2DU7 A;  2ZXF A;  1ATI A;  4RQF A;  2I4O A;  4YRK A;  4YCW A;  3MF2 A;  2CJA A;  2ZTG A;  4YRE A;  4YRO A;  1KOG A;  1W66 A;  3A7A A;  2ZR3 A;  2E3C A;  4RMF A;  1ADJ A;  3M4Q A;  2DXU A;  2HNI A;  1EFW A;  3WQZ A;  3HXY A;  4XTU A;  2DTI A;  4CS4 A;  4WF2 A;  3KFU A;  2P5I A;  4EX5 A;  2ZT7 A;  3EFR A;  4TVY A;  3MF1 A;  3OD1 A;  4UP7 A;  3VQY A;  1HC7 A;  2DQ0 A;  4XTX A;  3RL6 A;  4KR3 A;  1GGM A;  1JJC A;  3EFS A;  4P74 C;  2ART A;  1E1T A;  4CS3 A;  4XEM A;  4G84 A;  1SET A;  1HXD A;  2DDZ A;  4YRQ A;  12AS A;  3TUP A;  4H2W A;  4X5O A;  2I4N A;  4NCX A;  3P8Y A;  4YRM A;  1X56 A;  3QO7 A;  1ASZ A;  1NJ5 A;  4XTW A;  5F5W A;  4DQ2 A;  1BBU A;  4G85 A;  2EJ9 A;  3V7S A;  2DXT A;  2ZNJ A;  1NYQ A;  2ZIN A;  4TQD A;  1LYL A;  3HRI A;  4TVA B;  4YRT A;  1NNH A;  4XEO A;  2ARU A;  4PHC A;  3PCO A;  3RF1 A;  2CJ9 A;  3G1Z A;  1B7Y A;  4K88 A;  2ALY A;  2CGH A;  4P74 A;  4LNS A;  1FYF A;  1EIY A;  3L2Z A;  3IG2 A;  2DTH A;  4BWA A;  2EJG A;  3P8V A;  3TEH B;  4P73 C;  4EO4 A;  1KMM A;  4H2Y A;  4CH6 A;  3UFG A;  4CS2 A;  4Q15 A;  11AS A;  3M4P A;  2CIM A;  4YRL A;  1BBW A;  1EVK A;  2PMF A;  3HFV A;  3R07 A;  2E5A A;  5C53 B;  3A31 A;  4YCV A;  2C8M A;  4PG3 A;  3VQW A;  3HXW A;  4H2V A;  2DJZ A;  2QHT A;  2ODR D;  2ARS A;  4P75 C;  4CH5 A;  4TWA A;  1L0W A;  1E1O A;  2IY5 A;  1C0A A;  2AKW A;  1SRY A;  3L4G B;  4XTY A;  1VQZ A;  1B70 B;  1B8A A;  4P73 A;  4TTV A;  4DPG A;  4YRF A;  2ZGW A;  1HTT A;  3TEG A;  3BFM A;  3NET A;  5KNN A;  2ZT5 A;  3V7R A;  4YRR A;  3A7R A;  3RIR A;  4ZTZ B;  2DVE A;  4WJ3 M;  4XU0 A;  2ZT8 A;  1E22 A;  1H4T A;  1NJ8 A;  3ICA A;  3E9I A;  4P75 A;  1SER A;  1N9W A;  1ASY A;  3LC0 A;  1EVL A;  3ERR A;  3MEY A;  4XTZ A;  3P8T A;  4E51 A;  2ZR2 A;  1G5H A;  3A5Y A;  4HVC A;  4P72 C;  4H2S A;  2QHS A;  1Z7M A;  3RKY A;  4H02 A;  4TVW A;  3HY0 A;  1EQR A;  2E64 A;  4YRP A;  2I4M A;  2ZCE A;  4WI1 A;  4K86 A;  1WNL A;  4UP8 A;  3UGT A;  2Q7H A;  2DEQ A;  1X01 A;  3HXX A;  1JJC B;  1H4V B;  4H2X B;  3V8K A;  3RKX A;  2Q5H A;  3QO8 A;  4TVA A;  4TQF A;  5C52 B;  4YRS A;  3DSQ A;  4P72 A;  3HRK A;  3V7C A;  4J15 A;  3V8J A;  4OLF A;  5E3I A;  1YFR A;  3IAL A;  3LSS A;  1X2H A;  4CH4 A;  3HFZ A;  4YRJ A;  3TEH A;  2EAY A;  3IKM B;  1PYS B;  2RHQ A;  3LSQ A;  2C7I A;  3RUX A;  3VBB A;  2DQ3 A;  5ELO A;  1WQ7 A;  1NJ6 A;  2QHV A;  1IL2 A;  2FYK A;  4HWR A;  3PCO B;  4UP9 A;  1B7Y B;  2ALY B;  3UGQ A;  4AH6 A;  4YDQ A;  1EIY B;  1KMN A;  2DZ9 A;  3A74 A;  3A7U A;  2ZIM A;  3PZC A;  3VQV A;  4YYE A;  4P3P A;  2AMC B;  2PME A;  2ZZE A;  1YB3 A;  4HA8 A;  1QE0 A;  2RHS B;  1B70 A;  2G4C A;  2Q7G A;  2DZC A;  3E9H A;  2DTO A;  2E1H A;  2E65 A;  4XU2 A;  2IY5 B;  2ODR C;  3FJP A;  5K1X A;  2ZNI A;  2AKW B;  1WLE A;  4O2D A;  3RGL A;  4YRI A;  3HY1 A;  4ZTU B;  1RIQ A;  1ADY A;  3NEL A;  3HXU A;  1WYD A;  3I7F A;  1USY C;  4YPF A;  3VQX A;  4P3O A;  2ZZF A;  4UPA A;  2EL9 A;  3HTZ A;  2ZZG A;  4XU3 A;  3CMQ A;  3IKL A;  4HWT A;  2E41 A; 
#chains in the Genus database with same CATH topology
 4LVK A;  1J5W A;  2QHU A;  4K87 A;  2CJB A;  3QNE A;  4P71 C;  2ZIO A;  3REX A;  4WJ4 A;  2E10 A;  4OP0 A;  4H2X A;  3W3S A;  4YRC A;  3NEM A;  3NEN A;  1Z7N A;  3A32 A;  1H4Q A;  5HGQ A;  3HXV A;  4LVL A;  2J3M A;  1USY A;  5K1P A;  1YFS A;  3QTC A;  1G51 A;  4H2T A;  3UH0 A;  4ZIB A;  5ELN A;  4BW9 A;  1NJ1 A;  1WU7 A;  3QO5 A;  4HWP A;  1H4S A;  4CH3 A;  4KQE A;  1PYS A;  3V8L A;  4YCU A;  3RKW A;  4YP0 A;  2EWN A;  4RDX A;  4P71 A;  1BIB A;  2ZT6 A;  1X55 A;  4P3N A;  4KR2 A;  2Q5I A;  1B76 A;  4HWO A;  3HFZ B;  4XTV A;  3HXZ A;  2I4L A;  3BJU A;  3A5Z A;  2RHQ B;  2AMC A;  4YRG A;  5C51 B;  1EOV A;  1X54 A;  2P0L A;  2Q7E A;  3RAC A;  2DU5 A;  1X2G A;  1NJ2 A;  3L4G A;  2RHS A;  3REU A;  1G5I A;  1WQW A;  2J3L A;  1E24 A;  4YRN A;  1BIA A;  2EJF A;  4XU1 A;  2DKG A;  1YFT A;  3L1A A;  1QF6 A;  2XTI A;  2XGT A;  1NYR A;  4Q6G A;  4HWS A;  4L87 A;  1YGB A;  1SES A;  4H2U A;  4RQE A;  1WPY A;  2DU7 A;  2ZXF A;  1ATI A;  4RQF A;  2I4O A;  4YRK A;  4YCW A;  3MF2 A;  2CJA A;  2ZTG A;  4YRE A;  4YRO A;  1KOG A;  1W66 A;  3A7A A;  2ZR3 A;  2E3C A;  4RMF A;  1ADJ A;  3M4Q A;  2DXU A;  2HNI A;  1EFW A;  3WQZ A;  3HXY A;  4XTU A;  2DTI A;  4CS4 A;  4WF2 A;  3KFU A;  2A8E A;  2P5I A;  4EX5 A;  2ZT7 A;  3EFR A;  4TVY A;  3MF1 A;  3OD1 A;  4UP7 A;  3VQY A;  1HC7 A;  2DQ0 A;  4XTX A;  3RL6 A;  4KR3 A;  1GGM A;  1JJC A;  3EFS A;  4P74 C;  2ART A;  1E1T A;  4CS3 A;  4XEM A;  4G84 A;  1SET A;  1HXD A;  2DDZ A;  4YRQ A;  12AS A;  3TUP A;  4H2W A;  4X5O A;  2I4N A;  4NCX A;  3P8Y A;  4YRM A;  1X56 A;  3QO7 A;  1ASZ A;  1NJ5 A;  4XTW A;  5F5W A;  4DQ2 A;  1BBU A;  4G85 A;  2EJ9 A;  3V7S A;  2DXT A;  2ZNJ A;  1NYQ A;  2ZIN A;  4TQD A;  1LYL A;  3HRI A;  4TVA B;  4YRT A;  1NNH A;  4XEO A;  2ARU A;  4PHC A;  3PCO A;  3RF1 A;  2CJ9 A;  3G1Z A;  1B7Y A;  4K88 A;  2ALY A;  2CGH A;  4P74 A;  4LNS A;  1FYF A;  1EIY A;  3L2Z A;  3IG2 A;  2DTH A;  4BWA A;  2EJG A;  3P8V A;  3TEH B;  4P73 C;  4EO4 A;  1KMM A;  4H2Y A;  4CH6 A;  3UFG A;  4CS2 A;  4Q15 A;  11AS A;  3M4P A;  2CIM A;  4YRL A;  1BBW A;  1EVK A;  2PMF A;  3HFV A;  3R07 A;  2E5A A;  5C53 B;  3A31 A;  4YCV A;  2C8M A;  4PG3 A;  3VQW A;  3HXW A;  4H2V A;  2DJZ A;  2QHT A;  2ODR D;  2ARS A;  4P75 C;  4CH5 A;  4TWA A;  1L0W A;  1E1O A;  2IY5 A;  1C0A A;  2AKW A;  1SRY A;  3L4G B;  4XTY A;  1VQZ A;  1B70 B;  4HT4 A;  1B8A A;  4P73 A;  4TTV A;  4DPG A;  4YRF A;  2ZGW A;  1HTT A;  3TEG A;  3BFM A;  3NET A;  5KNN A;  2ZT5 A;  3V7R A;  4YRR A;  3A7R A;  3RIR A;  4ZTZ B;  2DVE A;  4WJ3 M;  4XU0 A;  2ZT8 A;  1E22 A;  1H4T A;  1NJ8 A;  3ICA A;  3E9I A;  4P75 A;  1SER A;  1N9W A;  1ASY A;  3LC0 A;  1EVL A;  3ERR A;  3MEY A;  4XTZ A;  3P8T A;  4E51 A;  2ZR2 A;  1G5H A;  3A5Y A;  4HVC A;  4P72 C;  4H2S A;  2QHS A;  1Z7M A;  3RKY A;  4H02 A;  4TVW A;  3HY0 A;  1EQR A;  2E64 A;  4LVI A;  4YRP A;  2I4M A;  2ZCE A;  4WI1 A;  4K86 A;  1WNL A;  4UP8 A;  3UGT A;  2Q7H A;  2DEQ A;  1X01 A;  3HXX A;  1JJC B;  1H4V B;  4H2X B;  3V8K A;  3RKX A;  2Q5H A;  4LVJ A;  3QO8 A;  4TVA A;  4TQF A;  2NS6 A;  5C52 B;  4YRS A;  3DSQ A;  4P72 A;  3HRK A;  3V7C A;  4J15 A;  3V8J A;  4OLF A;  5E3I A;  1YFR A;  3IAL A;  3LSS A;  1X2H A;  4CH4 A;  3HFZ A;  4YRJ A;  3TEH A;  2EAY A;  3IKM B;  1PYS B;  2RHQ A;  3LSQ A;  2C7I A;  3RUX A;  3VBB A;  2DQ3 A;  5ELO A;  1WQ7 A;  1NJ6 A;  2QHV A;  1IL2 A;  2FYK A;  4HWR A;  3PCO B;  4UP9 A;  1B7Y B;  2ALY B;  3UGQ A;  4AH6 A;  4LVM A;  4YDQ A;  1EIY B;  1KMN A;  2DZ9 A;  3A74 A;  3A7U A;  2ZIM A;  3PZC A;  3VQV A;  4YYE A;  4P3P A;  2AMC B;  2PME A;  2ZZE A;  1YB3 A;  4HA8 A;  1QE0 A;  2RHS B;  1B70 A;  2G4C A;  2Q7G A;  2DZC A;  3E9H A;  2DTO A;  2E1H A;  2E65 A;  4XU2 A;  2IY5 B;  2ODR C;  3FJP A;  5K1X A;  2ZNI A;  2AKW B;  1WLE A;  4O2D A;  3RGL A;  4YRI A;  3HY1 A;  4ZTU B;  1RIQ A;  1ADY A;  3NEL A;  3HXU A;  1WYD A;  3I7F A;  1USY C;  3MQZ A;  4YPF A;  3VQX A;  4P3O A;  2ZZF A;  4UPA A;  2EL9 A;  3HTZ A;  2ZZG A;  4XU3 A;  3CMQ A;  3IKL A;  4HWT A;  2E41 A; 
#chains in the Genus database with same CATH homology
 4LVK A;  1J5W A;  2QHU A;  4K87 A;  2CJB A;  3QNE A;  4P71 C;  2ZIO A;  3REX A;  4WJ4 A;  2E10 A;  4OP0 A;  4H2X A;  3W3S A;  4YRC A;  3NEM A;  3NEN A;  1Z7N A;  3A32 A;  1H4Q A;  5HGQ A;  3HXV A;  4LVL A;  2J3M A;  1USY A;  5K1P A;  1YFS A;  3QTC A;  1G51 A;  4H2T A;  3UH0 A;  4ZIB A;  5ELN A;  4BW9 A;  1NJ1 A;  1WU7 A;  3QO5 A;  4HWP A;  1H4S A;  4CH3 A;  4KQE A;  1PYS A;  3V8L A;  4YCU A;  3RKW A;  4YP0 A;  2EWN A;  4RDX A;  4P71 A;  1BIB A;  2ZT6 A;  1X55 A;  4P3N A;  4KR2 A;  2Q5I A;  1B76 A;  4HWO A;  3HFZ B;  4XTV A;  3HXZ A;  2I4L A;  3BJU A;  3A5Z A;  2RHQ B;  2AMC A;  4YRG A;  5C51 B;  1EOV A;  1X54 A;  2P0L A;  2Q7E A;  3RAC A;  2DU5 A;  1X2G A;  1NJ2 A;  3L4G A;  2RHS A;  3REU A;  1G5I A;  1WQW A;  2J3L A;  1E24 A;  4YRN A;  1BIA A;  2EJF A;  4XU1 A;  2DKG A;  1YFT A;  3L1A A;  1QF6 A;  2XTI A;  2XGT A;  1NYR A;  4Q6G A;  4HWS A;  4L87 A;  1YGB A;  1SES A;  4H2U A;  4RQE A;  1WPY A;  2DU7 A;  2ZXF A;  1ATI A;  4RQF A;  2I4O A;  4YRK A;  4YCW A;  3MF2 A;  2CJA A;  2ZTG A;  4YRE A;  4YRO A;  1KOG A;  1W66 A;  3A7A A;  2ZR3 A;  2E3C A;  4RMF A;  1ADJ A;  3M4Q A;  2DXU A;  2HNI A;  1EFW A;  3WQZ A;  3HXY A;  4XTU A;  2DTI A;  4CS4 A;  4WF2 A;  3KFU A;  2A8E A;  2P5I A;  4EX5 A;  2ZT7 A;  3EFR A;  4TVY A;  3MF1 A;  3OD1 A;  4UP7 A;  3VQY A;  1HC7 A;  2DQ0 A;  4XTX A;  3RL6 A;  4KR3 A;  1GGM A;  1JJC A;  3EFS A;  4P74 C;  2ART A;  1E1T A;  4CS3 A;  4XEM A;  4G84 A;  1SET A;  1HXD A;  2DDZ A;  4YRQ A;  12AS A;  3TUP A;  4H2W A;  4X5O A;  2I4N A;  4NCX A;  3P8Y A;  4YRM A;  1X56 A;  3QO7 A;  1ASZ A;  1NJ5 A;  4XTW A;  5F5W A;  4DQ2 A;  1BBU A;  4G85 A;  2EJ9 A;  3V7S A;  2DXT A;  2ZNJ A;  1NYQ A;  2ZIN A;  4TQD A;  1LYL A;  3HRI A;  4TVA B;  4YRT A;  1NNH A;  4XEO A;  2ARU A;  4PHC A;  3PCO A;  3RF1 A;  2CJ9 A;  3G1Z A;  1B7Y A;  4K88 A;  2ALY A;  2CGH A;  4P74 A;  4LNS A;  1FYF A;  1EIY A;  3L2Z A;  3IG2 A;  2DTH A;  4BWA A;  2EJG A;  3P8V A;  3TEH B;  4P73 C;  4EO4 A;  1KMM A;  4H2Y A;  4CH6 A;  3UFG A;  4CS2 A;  4Q15 A;  11AS A;  3M4P A;  2CIM A;  4YRL A;  1BBW A;  1EVK A;  2PMF A;  3HFV A;  3R07 A;  2E5A A;  5C53 B;  3A31 A;  4YCV A;  2C8M A;  4PG3 A;  3VQW A;  3HXW A;  4H2V A;  2DJZ A;  2QHT A;  2ODR D;  2ARS A;  4P75 C;  4CH5 A;  4TWA A;  1L0W A;  1E1O A;  2IY5 A;  1C0A A;  2AKW A;  1SRY A;  3L4G B;  4XTY A;  1VQZ A;  1B70 B;  4HT4 A;  1B8A A;  4P73 A;  4TTV A;  4DPG A;  4YRF A;  2ZGW A;  1HTT A;  3TEG A;  3BFM A;  3NET A;  5KNN A;  2ZT5 A;  3V7R A;  4YRR A;  3A7R A;  3RIR A;  4ZTZ B;  2DVE A;  4WJ3 M;  4XU0 A;  2ZT8 A;  1E22 A;  1H4T A;  1NJ8 A;  3ICA A;  3E9I A;  4P75 A;  1SER A;  1N9W A;  1ASY A;  3LC0 A;  1EVL A;  3ERR A;  3MEY A;  4XTZ A;  3P8T A;  4E51 A;  2ZR2 A;  1G5H A;  3A5Y A;  4HVC A;  4P72 C;  4H2S A;  2QHS A;  1Z7M A;  3RKY A;  4H02 A;  4TVW A;  3HY0 A;  1EQR A;  2E64 A;  4LVI A;  4YRP A;  2I4M A;  2ZCE A;  4WI1 A;  4K86 A;  1WNL A;  4UP8 A;  3UGT A;  2Q7H A;  2DEQ A;  1X01 A;  3HXX A;  1JJC B;  1H4V B;  4H2X B;  3V8K A;  3RKX A;  2Q5H A;  4LVJ A;  3QO8 A;  4TVA A;  4TQF A;  2NS6 A;  5C52 B;  4YRS A;  3DSQ A;  4P72 A;  3HRK A;  3V7C A;  4J15 A;  3V8J A;  4OLF A;  5E3I A;  1YFR A;  3IAL A;  3LSS A;  1X2H A;  4CH4 A;  3HFZ A;  4YRJ A;  3TEH A;  2EAY A;  3IKM B;  1PYS B;  2RHQ A;  3LSQ A;  2C7I A;  3RUX A;  3VBB A;  2DQ3 A;  5ELO A;  1WQ7 A;  1NJ6 A;  2QHV A;  1IL2 A;  2FYK A;  4HWR A;  3PCO B;  4UP9 A;  1B7Y B;  2ALY B;  3UGQ A;  4AH6 A;  4LVM A;  4YDQ A;  1EIY B;  1KMN A;  2DZ9 A;  3A74 A;  3A7U A;  2ZIM A;  3PZC A;  3VQV A;  4YYE A;  4P3P A;  2AMC B;  2PME A;  2ZZE A;  1YB3 A;  4HA8 A;  1QE0 A;  2RHS B;  1B70 A;  2G4C A;  2Q7G A;  2DZC A;  3E9H A;  2DTO A;  2E1H A;  2E65 A;  4XU2 A;  2IY5 B;  2ODR C;  3FJP A;  5K1X A;  2ZNI A;  2AKW B;  1WLE A;  4O2D A;  3RGL A;  4YRI A;  3HY1 A;  4ZTU B;  1RIQ A;  1ADY A;  3NEL A;  3HXU A;  1WYD A;  3I7F A;  1USY C;  3MQZ A;  4YPF A;  3VQX A;  4P3O A;  2ZZF A;  4UPA A;  2EL9 A;  3HTZ A;  2ZZG A;  4XU3 A;  3CMQ A;  3IKL A;  4HWT A;  2E41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...