1YFTA

The crystal structure of the catalytic fragment of alanyl-trna synthetase in complex wtih glycine
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
457
structure length
448
Chain Sequence
SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Breaking sieve for steric exclusion of a noncognate amino acid from active site of a tRNA synthetase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Alanyl-tRNA synthetase
total genus 151
structure length 448
sequence length 457
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2005-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1yftA01
4YCWA 2CJBA 2QHUA 4AH6A 5F5WA 3REUA 4XTUA 3IG2A 3V7SA 2C8MA 1JJCA 4YRKA 1YFTA 4P72C 3OD1A 4HWTA 1E22A 1NNHA 3L4GB 1H4TA 5K1XA 4P3NA 4TQDA 1B7YB 5C52B 1SETA 4YRTA 3TUPA 1N9WA 4YP0A 2Q7HA 2ZZGA 4KQEA 3M4QA 3QTCA 2RHSB 4YCVA 1X54A 2HNIA 4PG3A 4ZTZB 4XU1A 4YRQA 4Q15A 3LSSA 2ZIOA 4CH3A 2CGHA 4YRLA 3HXZA 2AKWB 2CIMA 3P8VA 3A5ZA 2CJAA 2DU7A 2E10A 1X55A 1BBWA 2ZIMA 1HC7A 2IY5B 3FJPA 3ICAA 3BJUA 3QO8A 1Z7MA 4UP9A 1HTTA 4NCXA 3EFSA 1IL2A 2RHQB 1G51A 4KR3A 3HY1A 2EL9A 4TTVA 3BFMA 3V8JA 1GGMA 4UP7A 4P74A 3TEHA 4YRCA 1QF6A 3HXXA 3NEMA 1ADYA 1NJ1A 2EWNA 2DTOA 3NENA 4WJ3M 2G4CA 3IKMB 1L0WA 4P3OA 3MEYA 3V7RA 2ZR2A 4UP8A 4HWSA 3LC0A 4H2SA 2ZXFA 2DDZA 4DQ2A 4J15A 3HXUA 3QNEA 2J3LA 1B70A 4YRPA 3L4GA 1NYRA 4YRGA 5C53B 3P8YA 4K87A 2C7IA 1ATIA 1BIAA 3UGTA 3VQWA 1USYA 4YRFA 3HFZA 5KNNA 2Q5HA 5E3IA 3RKWA 2ZCEA 5C51B 1WLEA 5ELNA 3RUXA 1E24A 4YDQA 3A7UA 3UFGA 1X2GA 2P5IA 3WQZA 2ZR3A 4K88A 1YB3A 4YREA 1X2HA 2DTHA 4YRRA 1H4QA 1KMNA 4P72A 4EO4A 4XTVA 4P74C 4ZTUB 4P3PA 3MF1A 5K1PA 1EFWA 3VQYA 1HXDA 3RGLA 3E9IA 2ALYB 4BW9A 4WJ4A 1NYQA 3HRIA 4TVYA 1WQWA 4YYEA 2QHVA 1B7YA 2E3CA 4XU3A 2DZCA 3HXVA 3RKYA 1EOVA 1X01A 4WF2A 1EVKA 2XTIA 4H02A 1WYDA 1Z7NA 2ZT6A 4XU0A 1B76A 2PMFA 4HWPA 2IY5A 1JJCB 1VQZA 3RF1A 1G5IA 4Q6GA 3VQVA 2Q7EA 4EX5A 2EJ9A 1SRYA 4RQFA 3PCOA 2E1HA 3RL6A 1USYC 1LYLA 4CH5A 3HY0A 4E51A 3A5YA 4HVCA 2ODRC 2Q7GA 4WI1A 4XTZA 2I4LA 2ZNJA 4YRMA 3HXWA 2ZGWA 3CMQA 3A7AA 3PCOB 1EIYB 2DEQA 4YROA 4XTWA 3A74A 1X56A 3G1ZA 1RIQA 2RHSA 3W3SA 3V8KA 3V8LA 2EJGA 11ASA 2ODRD 4HWOA 4OP0A 4H2TA 2J3MA 3KFUA 4H2UA 1QE0A 3TEGA 2CJ9A 4G85A 3L1AA 2AKWA 3HFVA 3ERRA 2I4OA 1SESA 2EJFA 3QO5A 3EFRA 1H4SA 4CS4A 1H4VB 12ASA 3I7FA 2RHQA 2ZT7A 3DSQA 4CH6A 4XTYA 1EQRA 4RQEA 4TVAB 2ZZEA 2E41A 4P73A 4HWRA 2AMCA 3UGQA 3VQXA 1KOGA 1SERA 4L87A 4XEOA 2I4MA 1PYSB 2ZNIA 1W66A 2AMCB 4P71C 5HGQA 3HRKA 1WQ7A 4TVAA 4CS2A 2I4NA 2ARSA 1YFRA 4H2YA 3HFZB 3V7CA 4YRNA 4K86A 3NETA 1B8AA 2DTIA 4P75A 4YCUA 4YRIA 2XGTA 2DZ9A 2ZT5A 2FYKA 4HA8A 3QO7A 1NJ2A 4DPGA 4CH4A 1EVLA 4H2XB 4CS3A 1ASZA 4RMFA 2ZINA 3UH0A 3A7RA 3LSQA 3NELA 1B70B 2DKGA 4LNSA 4YRSA 1BIBA 2DXUA 2DQ0A 2ZT8A 4TQFA 1C0AA 4UPAA 3A31A 3M4PA 1J5WA 4PHCA 2DXTA 2E5AA 1WPYA 2DVEA 3MF2A 2QHTA 1NJ5A 4OLFA 2ZZFA 2E64A 1YGBA 3IALA 3RKXA 1ADJA 1NJ8A 4H2WA 4XEMA 4XU2A 4YRJA 1E1TA 3PZCA 2DQ3A 4O2DA 4H2XA 1KMMA 4TVWA 3VBBA 3A32A 3R07A 4ZIBA 2DJZA 4X5OA 5ELOA 2DU5A 4P75C 1YFSA 3HXYA 3HTZA 3E9HA 2ARUA 1BBUA 1NJ6A 4YPFA 1FYFA 3RIRA 4XTXA 3IKLA 1EIYA 2ALYA 1ASYA 3P8TA 4P73C 1E1OA 2E65A 3TEHB 2P0LA 4KR2A 1WU7A 4G84A 4P71A 4TWAA 1G5HA 2ZTGA 2PMEA 3L2ZA 4BWAA 1PYSA 2Q5IA 4H2VA 2EAYA 2QHSA 3REXA 3RACA 4RDXA 1WNLA 2ARTA
chains in the Genus database with same CATH superfamily
4YCWA 2CJBA 4HT4A 2QHUA 4AH6A 5F5WA 3REUA 4XTUA 3IG2A 3V7SA 2C8MA 1JJCA 4YRKA 1YFTA 4P72C 3OD1A 4HWTA 1E22A 1NNHA 3L4GB 1H4TA 5K1XA 4P3NA 4TQDA 1B7YB 5C52B 1SETA 4YRTA 3TUPA 1N9WA 4YP0A 2Q7HA 2ZZGA 4KQEA 3M4QA 3QTCA 2RHSB 4YCVA 1X54A 2HNIA 4PG3A 4ZTZB 4XU1A 4YRQA 4Q15A 3LSSA 2ZIOA 4CH3A 2CGHA 4YRLA 3HXZA 2AKWB 2CIMA 3P8VA 3A5ZA 4LVLA 2CJAA 2DU7A 2E10A 1X55A 1BBWA 3MQZA 2ZIMA 1HC7A 2IY5B 3FJPA 3ICAA 3BJUA 3QO8A 1Z7MA 4UP9A 1HTTA 4NCXA 3EFSA 1IL2A 2RHQB 1G51A 4KR3A 3HY1A 4LVMA 2EL9A 4TTVA 3BFMA 3V8JA 1GGMA 4UP7A 4P74A 3TEHA 4YRCA 1QF6A 3HXXA 4LVJA 3NEMA 1ADYA 1NJ1A 2EWNA 2DTOA 3NENA 4WJ3M 2G4CA 3IKMB 1L0WA 4P3OA 3MEYA 3V7RA 2ZR2A 4UP8A 4HWSA 3LC0A 4H2SA 2ZXFA 2DDZA 4DQ2A 4J15A 3HXUA 3QNEA 2J3LA 1B70A 4YRPA 3L4GA 1NYRA 4YRGA 5C53B 3P8YA 4K87A 2C7IA 1ATIA 1BIAA 3UGTA 3VQWA 1USYA 4YRFA 3HFZA 5KNNA 2Q5HA 5E3IA 3RKWA 2ZCEA 5C51B 1WLEA 5ELNA 3RUXA 1E24A 4YDQA 3A7UA 3UFGA 1X2GA 2P5IA 3WQZA 2ZR3A 4K88A 1YB3A 4YREA 1X2HA 2DTHA 4YRRA 1H4QA 1KMNA 4P72A 4EO4A 4XTVA 4P74C 4ZTUB 4P3PA 3MF1A 5K1PA 1EFWA 3VQYA 1HXDA 3RGLA 3E9IA 2ALYB 4BW9A 4WJ4A 1NYQA 3HRIA 4TVYA 1WQWA 4YYEA 2QHVA 1B7YA 2E3CA 4XU3A 2DZCA 3HXVA 3RKYA 1EOVA 1X01A 4WF2A 1EVKA 2XTIA 4H02A 1WYDA 1Z7NA 2ZT6A 4XU0A 1B76A 2PMFA 4HWPA 2IY5A 1JJCB 1VQZA 3RF1A 1G5IA 4Q6GA 3VQVA 2Q7EA 4EX5A 2EJ9A 1SRYA 4RQFA 3PCOA 2E1HA 3RL6A 1USYC 1LYLA 4CH5A 3HY0A 4E51A 3A5YA 4HVCA 2ODRC 2Q7GA 4WI1A 4XTZA 2I4LA 2ZNJA 4YRMA 3HXWA 2ZGWA 3CMQA 3A7AA 3PCOB 1EIYB 2DEQA 4YROA 4XTWA 3A74A 1X56A 3G1ZA 1RIQA 2RHSA 3W3SA 3V8KA 3V8LA 2EJGA 11ASA 2ODRD 4HWOA 4OP0A 4H2TA 2J3MA 3KFUA 4H2UA 1QE0A 3TEGA 2CJ9A 4G85A 3L1AA 2AKWA 3HFVA 3ERRA 2I4OA 1SESA 2EJFA 3QO5A 3EFRA 1H4SA 4CS4A 1H4VB 12ASA 3I7FA 2RHQA 2ZT7A 3DSQA 2NS6A 4CH6A 4XTYA 1EQRA 4RQEA 4TVAB 2ZZEA 2E41A 4P73A 4HWRA 2AMCA 3UGQA 3VQXA 1KOGA 1SERA 4L87A 4XEOA 2I4MA 1PYSB 2ZNIA 1W66A 2AMCB 4P71C 5HGQA 3HRKA 1WQ7A 4TVAA 4CS2A 2I4NA 2ARSA 1YFRA 4H2YA 3HFZB 3V7CA 4YRNA 4K86A 3NETA 1B8AA 2DTIA 4P75A 4YCUA 4YRIA 2XGTA 2DZ9A 2ZT5A 2FYKA 4HA8A 3QO7A 1NJ2A 4DPGA 4CH4A 1EVLA 4H2XB 4CS3A 1ASZA 4RMFA 2ZINA 3UH0A 3A7RA 3LSQA 3NELA 1B70B 2DKGA 4LNSA 4YRSA 1BIBA 2DXUA 2DQ0A 2ZT8A 4TQFA 1C0AA 4UPAA 3A31A 3M4PA 1J5WA 4PHCA 2DXTA 2E5AA 1WPYA 2DVEA 3MF2A 2QHTA 1NJ5A 4OLFA 2ZZFA 2E64A 1YGBA 3IALA 3RKXA 1ADJA 1NJ8A 4H2WA 4XEMA 4XU2A 4YRJA 1E1TA 3PZCA 2DQ3A 4O2DA 4LVIA 2A8EA 4H2XA 1KMMA 4TVWA 3VBBA 3A32A 3R07A 4ZIBA 2DJZA 4X5OA 5ELOA 2DU5A 4P75C 1YFSA 3HXYA 3HTZA 3E9HA 2ARUA 1BBUA 1NJ6A 4YPFA 1FYFA 3RIRA 4XTXA 3IKLA 1EIYA 2ALYA 1ASYA 3P8TA 4LVKA 4P73C 1E1OA 2E65A 3TEHB 2P0LA 4KR2A 1WU7A 4G84A 4P71A 4TWAA 1G5HA 2ZTGA 2PMEA 3L2ZA 4BWAA 1PYSA 2Q5IA 4H2VA 2EAYA 2QHSA 3REXA 3RACA 4RDXA 1WNLA 2ARTA
chains in the Genus database with same CATH topology
4YCWA 2CJBA 4HT4A 2QHUA 4AH6A 5F5WA 3REUA 4XTUA 3IG2A 3V7SA 2C8MA 1JJCA 4YRKA 1YFTA 4P72C 3OD1A 4HWTA 1E22A 1NNHA 3L4GB 1H4TA 5K1XA 4P3NA 4TQDA 1B7YB 5C52B 1SETA 4YRTA 3TUPA 1N9WA 4YP0A 2Q7HA 2ZZGA 4KQEA 3M4QA 3QTCA 2RHSB 4YCVA 1X54A 2HNIA 4PG3A 4ZTZB 4XU1A 4YRQA 4Q15A 3LSSA 2ZIOA 4CH3A 2CGHA 4YRLA 3HXZA 2AKWB 2CIMA 3P8VA 3A5ZA 4LVLA 2CJAA 2DU7A 2E10A 1X55A 1BBWA 3MQZA 2ZIMA 1HC7A 2IY5B 3FJPA 3ICAA 3BJUA 3QO8A 1Z7MA 4UP9A 1HTTA 4NCXA 3EFSA 1IL2A 2RHQB 1G51A 4KR3A 3HY1A 4LVMA 2EL9A 4TTVA 3BFMA 3V8JA 1GGMA 4UP7A 4P74A 3TEHA 4YRCA 1QF6A 3HXXA 4LVJA 3NEMA 1ADYA 1NJ1A 2EWNA 2DTOA 3NENA 4WJ3M 2G4CA 3IKMB 1L0WA 4P3OA 3MEYA 3V7RA 2ZR2A 4UP8A 4HWSA 3LC0A 4H2SA 2ZXFA 2DDZA 4DQ2A 4J15A 3HXUA 3QNEA 2J3LA 1B70A 4YRPA 3L4GA 1NYRA 4YRGA 5C53B 3P8YA 4K87A 2C7IA 1ATIA 1BIAA 3UGTA 3VQWA 1USYA 4YRFA 3HFZA 5KNNA 2Q5HA 5E3IA 3RKWA 2ZCEA 5C51B 1WLEA 5ELNA 3RUXA 1E24A 4YDQA 3A7UA 3UFGA 1X2GA 2P5IA 3WQZA 2ZR3A 4K88A 1YB3A 4YREA 1X2HA 2DTHA 4YRRA 1H4QA 1KMNA 4P72A 4EO4A 4XTVA 4P74C 4ZTUB 4P3PA 3MF1A 5K1PA 1EFWA 3VQYA 1HXDA 3RGLA 3E9IA 2ALYB 4BW9A 4WJ4A 1NYQA 3HRIA 4TVYA 1WQWA 4YYEA 2QHVA 1B7YA 2E3CA 4XU3A 2DZCA 3HXVA 3RKYA 1EOVA 1X01A 4WF2A 1EVKA 2XTIA 4H02A 1WYDA 1Z7NA 2ZT6A 4XU0A 1B76A 2PMFA 4HWPA 2IY5A 1JJCB 1VQZA 3RF1A 1G5IA 4Q6GA 3VQVA 2Q7EA 4EX5A 2EJ9A 1SRYA 4RQFA 3PCOA 2E1HA 3RL6A 1USYC 1LYLA 4CH5A 3HY0A 4E51A 3A5YA 4HVCA 2ODRC 2Q7GA 4WI1A 4XTZA 2I4LA 2ZNJA 4YRMA 3HXWA 2ZGWA 3CMQA 3A7AA 3PCOB 1EIYB 2DEQA 4YROA 4XTWA 3A74A 1X56A 3G1ZA 1RIQA 2RHSA 3W3SA 3V8KA 3V8LA 2EJGA 11ASA 2ODRD 4HWOA 4OP0A 4H2TA 2J3MA 3KFUA 4H2UA 1QE0A 3TEGA 2CJ9A 4G85A 3L1AA 2AKWA 3HFVA 3ERRA 2I4OA 1SESA 2EJFA 3QO5A 3EFRA 1H4SA 4CS4A 1H4VB 12ASA 3I7FA 2RHQA 2ZT7A 3DSQA 2NS6A 4CH6A 4XTYA 1EQRA 4RQEA 4TVAB 2ZZEA 2E41A 4P73A 4HWRA 2AMCA 3UGQA 3VQXA 1KOGA 1SERA 4L87A 4XEOA 2I4MA 1PYSB 2ZNIA 1W66A 2AMCB 4P71C 5HGQA 3HRKA 1WQ7A 4TVAA 4CS2A 2I4NA 2ARSA 1YFRA 4H2YA 3HFZB 3V7CA 4YRNA 4K86A 3NETA 1B8AA 2DTIA 4P75A 4YCUA 4YRIA 2XGTA 2DZ9A 2ZT5A 2FYKA 4HA8A 3QO7A 1NJ2A 4DPGA 4CH4A 1EVLA 4H2XB 4CS3A 1ASZA 4RMFA 2ZINA 3UH0A 3A7RA 3LSQA 3NELA 1B70B 2DKGA 4LNSA 4YRSA 1BIBA 2DXUA 2DQ0A 2ZT8A 4TQFA 1C0AA 4UPAA 3A31A 3M4PA 1J5WA 4PHCA 2DXTA 2E5AA 1WPYA 2DVEA 3MF2A 2QHTA 1NJ5A 4OLFA 2ZZFA 2E64A 1YGBA 3IALA 3RKXA 1ADJA 1NJ8A 4H2WA 4XEMA 4XU2A 4YRJA 1E1TA 3PZCA 2DQ3A 4O2DA 4LVIA 2A8EA 4H2XA 1KMMA 4TVWA 3VBBA 3A32A 3R07A 4ZIBA 2DJZA 4X5OA 5ELOA 2DU5A 4P75C 1YFSA 3HXYA 3HTZA 3E9HA 2ARUA 1BBUA 1NJ6A 4YPFA 1FYFA 3RIRA 4XTXA 3IKLA 1EIYA 2ALYA 1ASYA 3P8TA 4LVKA 4P73C 1E1OA 2E65A 3TEHB 2P0LA 4KR2A 1WU7A 4G84A 4P71A 4TWAA 1G5HA 2ZTGA 2PMEA 3L2ZA 4BWAA 1PYSA 2Q5IA 4H2VA 2EAYA 2QHSA 3REXA 3RACA 4RDXA 1WNLA 2ARTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YCW A;  2CJB A;  2QHU A;  4AH6 A;  5F5W A;  3REU A;  4XTU A;  3IG2 A;  3V7S A;  2C8M A;  1JJC A;  4YRK A;  1YFT A;  4P72 C;  3OD1 A;  4HWT A;  1E22 A;  1NNH A;  3L4G B;  1H4T A;  5K1X A;  4P3N A;  4TQD A;  1B7Y B;  5C52 B;  1SET A;  4YRT A;  3TUP A;  1N9W A;  4YP0 A;  2Q7H A;  2ZZG A;  4KQE A;  3M4Q A;  3QTC A;  2RHS B;  4YCV A;  1X54 A;  2HNI A;  4PG3 A;  4ZTZ B;  4XU1 A;  4YRQ A;  4Q15 A;  3LSS A;  2ZIO A;  4CH3 A;  2CGH A;  4YRL A;  3HXZ A;  2AKW B;  2CIM A;  3P8V A;  3A5Z A;  2CJA A;  2DU7 A;  2E10 A;  1X55 A;  1BBW A;  2ZIM A;  1HC7 A;  2IY5 B;  3FJP A;  3ICA A;  3BJU A;  3QO8 A;  1Z7M A;  4UP9 A;  1HTT A;  4NCX A;  3EFS A;  1IL2 A;  2RHQ B;  1G51 A;  4KR3 A;  3HY1 A;  2EL9 A;  4TTV A;  3BFM A;  3V8J A;  1GGM A;  4UP7 A;  4P74 A;  3TEH A;  4YRC A;  1QF6 A;  3HXX A;  3NEM A;  1ADY A;  1NJ1 A;  2EWN A;  2DTO A;  3NEN A;  4WJ3 M;  2G4C A;  3IKM B;  1L0W A;  4P3O A;  3MEY A;  3V7R A;  2ZR2 A;  4UP8 A;  4HWS A;  3LC0 A;  4H2S A;  2ZXF A;  2DDZ A;  4DQ2 A;  4J15 A;  3HXU A;  3QNE A;  2J3L A;  1B70 A;  4YRP A;  3L4G A;  1NYR A;  4YRG A;  5C53 B;  3P8Y A;  4K87 A;  2C7I A;  1ATI A;  1BIA A;  3UGT A;  3VQW A;  1USY A;  4YRF A;  3HFZ A;  5KNN A;  2Q5H A;  5E3I A;  3RKW A;  2ZCE A;  5C51 B;  1WLE A;  5ELN A;  3RUX A;  1E24 A;  4YDQ A;  3A7U A;  3UFG A;  1X2G A;  2P5I A;  3WQZ A;  2ZR3 A;  4K88 A;  1YB3 A;  4YRE A;  1X2H A;  2DTH A;  4YRR A;  1H4Q A;  1KMN A;  4P72 A;  4EO4 A;  4XTV A;  4P74 C;  4ZTU B;  4P3P A;  3MF1 A;  5K1P A;  1EFW A;  3VQY A;  1HXD A;  3RGL A;  3E9I A;  2ALY B;  4BW9 A;  4WJ4 A;  1NYQ A;  3HRI A;  4TVY A;  1WQW A;  4YYE A;  2QHV A;  1B7Y A;  2E3C A;  4XU3 A;  2DZC A;  3HXV A;  3RKY A;  1EOV A;  1X01 A;  4WF2 A;  1EVK A;  2XTI A;  4H02 A;  1WYD A;  1Z7N A;  2ZT6 A;  4XU0 A;  1B76 A;  2PMF A;  4HWP A;  2IY5 A;  1JJC B;  1VQZ A;  3RF1 A;  1G5I A;  4Q6G A;  3VQV A;  2Q7E A;  4EX5 A;  2EJ9 A;  1SRY A;  4RQF A;  3PCO A;  2E1H A;  3RL6 A;  1USY C;  1LYL A;  4CH5 A;  3HY0 A;  4E51 A;  3A5Y A;  4HVC A;  2ODR C;  2Q7G A;  4WI1 A;  4XTZ A;  2I4L A;  2ZNJ A;  4YRM A;  3HXW A;  2ZGW A;  3CMQ A;  3A7A A;  3PCO B;  1EIY B;  2DEQ A;  4YRO A;  4XTW A;  3A74 A;  1X56 A;  3G1Z A;  1RIQ A;  2RHS A;  3W3S A;  3V8K A;  3V8L A;  2EJG A;  11AS A;  2ODR D;  4HWO A;  4OP0 A;  4H2T A;  2J3M A;  3KFU A;  4H2U A;  1QE0 A;  3TEG A;  2CJ9 A;  4G85 A;  3L1A A;  2AKW A;  3HFV A;  3ERR A;  2I4O A;  1SES A;  2EJF A;  3QO5 A;  3EFR A;  1H4S A;  4CS4 A;  1H4V B;  12AS A;  3I7F A;  2RHQ A;  2ZT7 A;  3DSQ A;  4CH6 A;  4XTY A;  1EQR A;  4RQE A;  4TVA B;  2ZZE A;  2E41 A;  4P73 A;  4HWR A;  2AMC A;  3UGQ A;  3VQX A;  1KOG A;  1SER A;  4L87 A;  4XEO A;  2I4M A;  1PYS B;  2ZNI A;  1W66 A;  2AMC B;  4P71 C;  5HGQ A;  3HRK A;  1WQ7 A;  4TVA A;  4CS2 A;  2I4N A;  2ARS A;  1YFR A;  4H2Y A;  3HFZ B;  3V7C A;  4YRN A;  4K86 A;  3NET A;  1B8A A;  2DTI A;  4P75 A;  4YCU A;  4YRI A;  2XGT A;  2DZ9 A;  2ZT5 A;  2FYK A;  4HA8 A;  3QO7 A;  1NJ2 A;  4DPG A;  4CH4 A;  1EVL A;  4H2X B;  4CS3 A;  1ASZ A;  4RMF A;  2ZIN A;  3UH0 A;  3A7R A;  3LSQ A;  3NEL A;  1B70 B;  2DKG A;  4LNS A;  4YRS A;  1BIB A;  2DXU A;  2DQ0 A;  2ZT8 A;  4TQF A;  1C0A A;  4UPA A;  3A31 A;  3M4P A;  1J5W A;  4PHC A;  2DXT A;  2E5A A;  1WPY A;  2DVE A;  3MF2 A;  2QHT A;  1NJ5 A;  4OLF A;  2ZZF A;  2E64 A;  1YGB A;  3IAL A;  3RKX A;  1ADJ A;  1NJ8 A;  4H2W A;  4XEM A;  4XU2 A;  4YRJ A;  1E1T A;  3PZC A;  2DQ3 A;  4O2D A;  4H2X A;  1KMM A;  4TVW A;  3VBB A;  3A32 A;  3R07 A;  4ZIB A;  2DJZ A;  4X5O A;  5ELO A;  2DU5 A;  4P75 C;  1YFS A;  3HXY A;  3HTZ A;  3E9H A;  2ARU A;  1BBU A;  1NJ6 A;  4YPF A;  1FYF A;  3RIR A;  4XTX A;  3IKL A;  1EIY A;  2ALY A;  1ASY A;  3P8T A;  4P73 C;  1E1O A;  2E65 A;  3TEH B;  2P0L A;  4KR2 A;  1WU7 A;  4G84 A;  4P71 A;  4TWA A;  1G5H A;  2ZTG A;  2PME A;  3L2Z A;  4BWA A;  1PYS A;  2Q5I A;  4H2V A;  2EAY A;  2QHS A;  3REX A;  3RAC A;  4RDX A;  1WNL A;  2ART A; 
#chains in the Genus database with same CATH topology
 4YCW A;  2CJB A;  4HT4 A;  2QHU A;  4AH6 A;  5F5W A;  3REU A;  4XTU A;  3IG2 A;  3V7S A;  2C8M A;  1JJC A;  4YRK A;  1YFT A;  4P72 C;  3OD1 A;  4HWT A;  1E22 A;  1NNH A;  3L4G B;  1H4T A;  5K1X A;  4P3N A;  4TQD A;  1B7Y B;  5C52 B;  1SET A;  4YRT A;  3TUP A;  1N9W A;  4YP0 A;  2Q7H A;  2ZZG A;  4KQE A;  3M4Q A;  3QTC A;  2RHS B;  4YCV A;  1X54 A;  2HNI A;  4PG3 A;  4ZTZ B;  4XU1 A;  4YRQ A;  4Q15 A;  3LSS A;  2ZIO A;  4CH3 A;  2CGH A;  4YRL A;  3HXZ A;  2AKW B;  2CIM A;  3P8V A;  3A5Z A;  4LVL A;  2CJA A;  2DU7 A;  2E10 A;  1X55 A;  1BBW A;  3MQZ A;  2ZIM A;  1HC7 A;  2IY5 B;  3FJP A;  3ICA A;  3BJU A;  3QO8 A;  1Z7M A;  4UP9 A;  1HTT A;  4NCX A;  3EFS A;  1IL2 A;  2RHQ B;  1G51 A;  4KR3 A;  3HY1 A;  4LVM A;  2EL9 A;  4TTV A;  3BFM A;  3V8J A;  1GGM A;  4UP7 A;  4P74 A;  3TEH A;  4YRC A;  1QF6 A;  3HXX A;  4LVJ A;  3NEM A;  1ADY A;  1NJ1 A;  2EWN A;  2DTO A;  3NEN A;  4WJ3 M;  2G4C A;  3IKM B;  1L0W A;  4P3O A;  3MEY A;  3V7R A;  2ZR2 A;  4UP8 A;  4HWS A;  3LC0 A;  4H2S A;  2ZXF A;  2DDZ A;  4DQ2 A;  4J15 A;  3HXU A;  3QNE A;  2J3L A;  1B70 A;  4YRP A;  3L4G A;  1NYR A;  4YRG A;  5C53 B;  3P8Y A;  4K87 A;  2C7I A;  1ATI A;  1BIA A;  3UGT A;  3VQW A;  1USY A;  4YRF A;  3HFZ A;  5KNN A;  2Q5H A;  5E3I A;  3RKW A;  2ZCE A;  5C51 B;  1WLE A;  5ELN A;  3RUX A;  1E24 A;  4YDQ A;  3A7U A;  3UFG A;  1X2G A;  2P5I A;  3WQZ A;  2ZR3 A;  4K88 A;  1YB3 A;  4YRE A;  1X2H A;  2DTH A;  4YRR A;  1H4Q A;  1KMN A;  4P72 A;  4EO4 A;  4XTV A;  4P74 C;  4ZTU B;  4P3P A;  3MF1 A;  5K1P A;  1EFW A;  3VQY A;  1HXD A;  3RGL A;  3E9I A;  2ALY B;  4BW9 A;  4WJ4 A;  1NYQ A;  3HRI A;  4TVY A;  1WQW A;  4YYE A;  2QHV A;  1B7Y A;  2E3C A;  4XU3 A;  2DZC A;  3HXV A;  3RKY A;  1EOV A;  1X01 A;  4WF2 A;  1EVK A;  2XTI A;  4H02 A;  1WYD A;  1Z7N A;  2ZT6 A;  4XU0 A;  1B76 A;  2PMF A;  4HWP A;  2IY5 A;  1JJC B;  1VQZ A;  3RF1 A;  1G5I A;  4Q6G A;  3VQV A;  2Q7E A;  4EX5 A;  2EJ9 A;  1SRY A;  4RQF A;  3PCO A;  2E1H A;  3RL6 A;  1USY C;  1LYL A;  4CH5 A;  3HY0 A;  4E51 A;  3A5Y A;  4HVC A;  2ODR C;  2Q7G A;  4WI1 A;  4XTZ A;  2I4L A;  2ZNJ A;  4YRM A;  3HXW A;  2ZGW A;  3CMQ A;  3A7A A;  3PCO B;  1EIY B;  2DEQ A;  4YRO A;  4XTW A;  3A74 A;  1X56 A;  3G1Z A;  1RIQ A;  2RHS A;  3W3S A;  3V8K A;  3V8L A;  2EJG A;  11AS A;  2ODR D;  4HWO A;  4OP0 A;  4H2T A;  2J3M A;  3KFU A;  4H2U A;  1QE0 A;  3TEG A;  2CJ9 A;  4G85 A;  3L1A A;  2AKW A;  3HFV A;  3ERR A;  2I4O A;  1SES A;  2EJF A;  3QO5 A;  3EFR A;  1H4S A;  4CS4 A;  1H4V B;  12AS A;  3I7F A;  2RHQ A;  2ZT7 A;  3DSQ A;  2NS6 A;  4CH6 A;  4XTY A;  1EQR A;  4RQE A;  4TVA B;  2ZZE A;  2E41 A;  4P73 A;  4HWR A;  2AMC A;  3UGQ A;  3VQX A;  1KOG A;  1SER A;  4L87 A;  4XEO A;  2I4M A;  1PYS B;  2ZNI A;  1W66 A;  2AMC B;  4P71 C;  5HGQ A;  3HRK A;  1WQ7 A;  4TVA A;  4CS2 A;  2I4N A;  2ARS A;  1YFR A;  4H2Y A;  3HFZ B;  3V7C A;  4YRN A;  4K86 A;  3NET A;  1B8A A;  2DTI A;  4P75 A;  4YCU A;  4YRI A;  2XGT A;  2DZ9 A;  2ZT5 A;  2FYK A;  4HA8 A;  3QO7 A;  1NJ2 A;  4DPG A;  4CH4 A;  1EVL A;  4H2X B;  4CS3 A;  1ASZ A;  4RMF A;  2ZIN A;  3UH0 A;  3A7R A;  3LSQ A;  3NEL A;  1B70 B;  2DKG A;  4LNS A;  4YRS A;  1BIB A;  2DXU A;  2DQ0 A;  2ZT8 A;  4TQF A;  1C0A A;  4UPA A;  3A31 A;  3M4P A;  1J5W A;  4PHC A;  2DXT A;  2E5A A;  1WPY A;  2DVE A;  3MF2 A;  2QHT A;  1NJ5 A;  4OLF A;  2ZZF A;  2E64 A;  1YGB A;  3IAL A;  3RKX A;  1ADJ A;  1NJ8 A;  4H2W A;  4XEM A;  4XU2 A;  4YRJ A;  1E1T A;  3PZC A;  2DQ3 A;  4O2D A;  4LVI A;  2A8E A;  4H2X A;  1KMM A;  4TVW A;  3VBB A;  3A32 A;  3R07 A;  4ZIB A;  2DJZ A;  4X5O A;  5ELO A;  2DU5 A;  4P75 C;  1YFS A;  3HXY A;  3HTZ A;  3E9H A;  2ARU A;  1BBU A;  1NJ6 A;  4YPF A;  1FYF A;  3RIR A;  4XTX A;  3IKL A;  1EIY A;  2ALY A;  1ASY A;  3P8T A;  4LVK A;  4P73 C;  1E1O A;  2E65 A;  3TEH B;  2P0L A;  4KR2 A;  1WU7 A;  4G84 A;  4P71 A;  4TWA A;  1G5H A;  2ZTG A;  2PME A;  3L2Z A;  4BWA A;  1PYS A;  2Q5I A;  4H2V A;  2EAY A;  2QHS A;  3REX A;  3RAC A;  4RDX A;  1WNL A;  2ART A; 
#chains in the Genus database with same CATH homology
 4YCW A;  2CJB A;  4HT4 A;  2QHU A;  4AH6 A;  5F5W A;  3REU A;  4XTU A;  3IG2 A;  3V7S A;  2C8M A;  1JJC A;  4YRK A;  1YFT A;  4P72 C;  3OD1 A;  4HWT A;  1E22 A;  1NNH A;  3L4G B;  1H4T A;  5K1X A;  4P3N A;  4TQD A;  1B7Y B;  5C52 B;  1SET A;  4YRT A;  3TUP A;  1N9W A;  4YP0 A;  2Q7H A;  2ZZG A;  4KQE A;  3M4Q A;  3QTC A;  2RHS B;  4YCV A;  1X54 A;  2HNI A;  4PG3 A;  4ZTZ B;  4XU1 A;  4YRQ A;  4Q15 A;  3LSS A;  2ZIO A;  4CH3 A;  2CGH A;  4YRL A;  3HXZ A;  2AKW B;  2CIM A;  3P8V A;  3A5Z A;  4LVL A;  2CJA A;  2DU7 A;  2E10 A;  1X55 A;  1BBW A;  3MQZ A;  2ZIM A;  1HC7 A;  2IY5 B;  3FJP A;  3ICA A;  3BJU A;  3QO8 A;  1Z7M A;  4UP9 A;  1HTT A;  4NCX A;  3EFS A;  1IL2 A;  2RHQ B;  1G51 A;  4KR3 A;  3HY1 A;  4LVM A;  2EL9 A;  4TTV A;  3BFM A;  3V8J A;  1GGM A;  4UP7 A;  4P74 A;  3TEH A;  4YRC A;  1QF6 A;  3HXX A;  4LVJ A;  3NEM A;  1ADY A;  1NJ1 A;  2EWN A;  2DTO A;  3NEN A;  4WJ3 M;  2G4C A;  3IKM B;  1L0W A;  4P3O A;  3MEY A;  3V7R A;  2ZR2 A;  4UP8 A;  4HWS A;  3LC0 A;  4H2S A;  2ZXF A;  2DDZ A;  4DQ2 A;  4J15 A;  3HXU A;  3QNE A;  2J3L A;  1B70 A;  4YRP A;  3L4G A;  1NYR A;  4YRG A;  5C53 B;  3P8Y A;  4K87 A;  2C7I A;  1ATI A;  1BIA A;  3UGT A;  3VQW A;  1USY A;  4YRF A;  3HFZ A;  5KNN A;  2Q5H A;  5E3I A;  3RKW A;  2ZCE A;  5C51 B;  1WLE A;  5ELN A;  3RUX A;  1E24 A;  4YDQ A;  3A7U A;  3UFG A;  1X2G A;  2P5I A;  3WQZ A;  2ZR3 A;  4K88 A;  1YB3 A;  4YRE A;  1X2H A;  2DTH A;  4YRR A;  1H4Q A;  1KMN A;  4P72 A;  4EO4 A;  4XTV A;  4P74 C;  4ZTU B;  4P3P A;  3MF1 A;  5K1P A;  1EFW A;  3VQY A;  1HXD A;  3RGL A;  3E9I A;  2ALY B;  4BW9 A;  4WJ4 A;  1NYQ A;  3HRI A;  4TVY A;  1WQW A;  4YYE A;  2QHV A;  1B7Y A;  2E3C A;  4XU3 A;  2DZC A;  3HXV A;  3RKY A;  1EOV A;  1X01 A;  4WF2 A;  1EVK A;  2XTI A;  4H02 A;  1WYD A;  1Z7N A;  2ZT6 A;  4XU0 A;  1B76 A;  2PMF A;  4HWP A;  2IY5 A;  1JJC B;  1VQZ A;  3RF1 A;  1G5I A;  4Q6G A;  3VQV A;  2Q7E A;  4EX5 A;  2EJ9 A;  1SRY A;  4RQF A;  3PCO A;  2E1H A;  3RL6 A;  1USY C;  1LYL A;  4CH5 A;  3HY0 A;  4E51 A;  3A5Y A;  4HVC A;  2ODR C;  2Q7G A;  4WI1 A;  4XTZ A;  2I4L A;  2ZNJ A;  4YRM A;  3HXW A;  2ZGW A;  3CMQ A;  3A7A A;  3PCO B;  1EIY B;  2DEQ A;  4YRO A;  4XTW A;  3A74 A;  1X56 A;  3G1Z A;  1RIQ A;  2RHS A;  3W3S A;  3V8K A;  3V8L A;  2EJG A;  11AS A;  2ODR D;  4HWO A;  4OP0 A;  4H2T A;  2J3M A;  3KFU A;  4H2U A;  1QE0 A;  3TEG A;  2CJ9 A;  4G85 A;  3L1A A;  2AKW A;  3HFV A;  3ERR A;  2I4O A;  1SES A;  2EJF A;  3QO5 A;  3EFR A;  1H4S A;  4CS4 A;  1H4V B;  12AS A;  3I7F A;  2RHQ A;  2ZT7 A;  3DSQ A;  2NS6 A;  4CH6 A;  4XTY A;  1EQR A;  4RQE A;  4TVA B;  2ZZE A;  2E41 A;  4P73 A;  4HWR A;  2AMC A;  3UGQ A;  3VQX A;  1KOG A;  1SER A;  4L87 A;  4XEO A;  2I4M A;  1PYS B;  2ZNI A;  1W66 A;  2AMC B;  4P71 C;  5HGQ A;  3HRK A;  1WQ7 A;  4TVA A;  4CS2 A;  2I4N A;  2ARS A;  1YFR A;  4H2Y A;  3HFZ B;  3V7C A;  4YRN A;  4K86 A;  3NET A;  1B8A A;  2DTI A;  4P75 A;  4YCU A;  4YRI A;  2XGT A;  2DZ9 A;  2ZT5 A;  2FYK A;  4HA8 A;  3QO7 A;  1NJ2 A;  4DPG A;  4CH4 A;  1EVL A;  4H2X B;  4CS3 A;  1ASZ A;  4RMF A;  2ZIN A;  3UH0 A;  3A7R A;  3LSQ A;  3NEL A;  1B70 B;  2DKG A;  4LNS A;  4YRS A;  1BIB A;  2DXU A;  2DQ0 A;  2ZT8 A;  4TQF A;  1C0A A;  4UPA A;  3A31 A;  3M4P A;  1J5W A;  4PHC A;  2DXT A;  2E5A A;  1WPY A;  2DVE A;  3MF2 A;  2QHT A;  1NJ5 A;  4OLF A;  2ZZF A;  2E64 A;  1YGB A;  3IAL A;  3RKX A;  1ADJ A;  1NJ8 A;  4H2W A;  4XEM A;  4XU2 A;  4YRJ A;  1E1T A;  3PZC A;  2DQ3 A;  4O2D A;  4LVI A;  2A8E A;  4H2X A;  1KMM A;  4TVW A;  3VBB A;  3A32 A;  3R07 A;  4ZIB A;  2DJZ A;  4X5O A;  5ELO A;  2DU5 A;  4P75 C;  1YFS A;  3HXY A;  3HTZ A;  3E9H A;  2ARU A;  1BBU A;  1NJ6 A;  4YPF A;  1FYF A;  3RIR A;  4XTX A;  3IKL A;  1EIY A;  2ALY A;  1ASY A;  3P8T A;  4LVK A;  4P73 C;  1E1O A;  2E65 A;  3TEH B;  2P0L A;  4KR2 A;  1WU7 A;  4G84 A;  4P71 A;  4TWA A;  1G5H A;  2ZTG A;  2PME A;  3L2Z A;  4BWA A;  1PYS A;  2Q5I A;  4H2V A;  2EAY A;  2QHS A;  3REX A;  3RAC A;  4RDX A;  1WNL A;  2ART A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...