1YFWA

Crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase from ralstonia metallidurans complexed with 4-chloro-3-hydroxyanthranilic acid and o2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
174
Chain Sequence
b'MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-hydroxyanthranilate-3,4-dioxygenase
publication title Structural Studies on 3-Hydroxyanthranilate-3,4-dioxygenase: The Catalytic Mechanism of a Complex Oxidation Involved in NAD Biosynthesis.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Oxidoreductase
total genus 38
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2005-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06052 3-HAO 3-hydroxyanthranilic acid dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yfwA01
2N7GA 1CAUB 4IETA 4KWLA 4IEWA 3MDPA 1O3SA 4I0AA 1OMIA 1NZCA 2GC1A 1GQHA 1H1MA 1EPZA 3WW3A 3KSCA 4QM9A 4WBBA 4EWDA 4EROA 3CLPA 1UPIA 2WFPA 3PNAA 4CYDA 4DINB 5D1IA 5J48A 1ZZ7A 3NKTA 1RL3A 4PIXA 3HIFA 3SXWA 4QX5A 5I8YA 5I0TA 4EWAA 2ATFA 1NE4A 1O4TA 4XFGA 2QJVA 2OA2A 2GC0A 1V70A 2OZJA 2H6BA 3H9AA 4ZU7A 2CV6A 1OFNA 3HT1A 1DGRA 4Z82A 4XETA 3DKWA 3U10A 2EAAA 1ZZ8A 3H3UA 4KL1A 4PIYA 5BXXA 3MPBA 2D5HA 1IPKA 3I59B 3D0JA 4QXKA 3PLQA 3ZDSA 5J3UA 4AVAA 1VP6A 2XL9A 4F7ZA 4L2NA 3UKNA 3G7DA 1J3QA 4Q29A 1YUDA 4XFHA 5KHGA 2GU9A 1XRUA 4JVAA 4KU7A 5E1RA 1VJ2A 3IDBB 4MZUA 3CEWA 4LEJA 5BPXA 2CGPA 5CADA 1EYBA 3FHIB 3DL3A 5KHHA 4IEPA 3O14A 2PHDA 2Y0OA 3SCFA 2XHKA 4A2UA 1CAUA 3KMHA 3NVCA 4WZCA 1PMIA 3ES4A 3E6DA 3UKVA 2PA7A 1UIKA 1NE6A 4YNIA 2GH2A 2QVSB 3FJSA 4XF0A 1CX4A 3LWCA 2V09A 1CGPA 2XLFA 1CAWB 2ET1A 2XLGA 4I09A 4AQ6A 4PIZA 2WC2A 1UIJA 4META 1Q5OA 3H7YA 3WW1A 5FLJA 2K0GA 4Q0UA 4XFIA 3MZHA 5T3NA 4XF1A 4MUVA 4KU8A 1J58A 3GBFA 5CU1A 5I8TA 4HZFA 2B5HA 1U12A 2H6CA 2MNGA 2B9UA 5JSRA 4HVQA 3ST7A 3FX3A 5FCCA 3VHRA 3JZVA 2ZCWA 3IBMA 3C3VA 4IEUA 3FFQA 4UXAA 2OYZA 3S7EA 4MV2A 2Q0AA 4FAHA 1ZZBA 1O5LA 3I59A 5BV6A 4I0BA 2DCTA 1J59A 1UD1A 4UBGA 2PQQA 3ROUA 4BYYA 5I0UA 4QGNA 2CAVA 4AXOA 2UY8A 2PYTA 5KBFA 1O5UA 3D0SA 2Q4SA 1YLLA 4P9GA 1WLTA 4IERA 3EO6A 3I54A 1CAXB 3HT2A 3IDCB 3PVBB 4N9IA 1Y9QA 4YRDA 5LRSA 5AVPA 4ORFA 3E97A 5FLIA 1VR3A 4XFAA 1X82A 1EY2A 4IEXA 4X6RB 4MGZE 3UKTA 4HN0A 5JSOA 2IXIA 3DN7A 1QXJA 4IEOA 2PAKA 3OCPA 2O1QA 2PTMA 1CAWA 3B02A 4HSJA 2BEOA 3EJKA 2BNNA 1RGSA 1O3TA 3LAGA 4IEVA 5EZWA 3DV8A 2Q1ZB 2F4PA 2BGCA 3ES1A 2D93A 4K8FA 3MYXA 3NJZA 2FMYA 4MGIE 2XLAA 4MH0E 4Q0QA 2PFWA 1G6NA 2GZWA 1IPJA 2QNKA 2D40A 1O7FA 3S0MA 3OTFA 1YFYA 1YFXA 1OD5A 3EQEA 1LRHA 2E9QA 1ZZCA 4HBNA 4O9EA 3LOIA 2IXCA 4LA3A 1Q3EA 2I45A 4OFGA 1OI6A 1WGPA 3H1MA 4FAGA 1FI2A 5J7MA 1SEFA 2QCSB 2H0VA 2MHFA 4Q0VA 1I5ZA 4I01A 4Q0PA 3NL1A 1YFUA 4MGKE 2EVXA 3NW4A 3RYKA 3ACLA 4JTOA 1YHFA 1QY4A 3FWEA 2QDRA 4ONUA 4AQ2A 1CAXA 3N4MA 3BPZA 3CJXA 3U0ZA 2BNMA 3KCCA 1X7NA 3IIAA 4LULA 5LEKA 1YFWA 3R6SA 3D82A 2IXLA 1XE7A 5KHKA 1LKNA 1Q43A 1ZRFA 2KXLA 4JV4A 3TNPB 3LZZA 1SFNA 5FQ0B 1SQ4A 3RZZA 4HSLA 4IEYA 3KGLA 1CAVB 3LA3A 5JR7B 1X8EA 2GC2A 3RNSA 4R8HA 3M3IA 4GULA 1UW8A 4OLLA 5LEJA 5BY5A 4J1WA 4IEZA 4IEQA 4FBFA 1RUOA 4HVRA 2D5FA 1J3RA 2Z69A 3E5XA 4O9GA 2CAUA 4YSFA 1ZZ9A 5K8SA 4LLOA 3OF1A 2K9ZA 4XFBA 2XKOA 2VPVA 1J1LA 5JCTA 2UYAA 4D7SA 3RPQA 3QOPA 4MX3A 4BH9A 4QGMA 2IXKA 5JAXA 4ZU5A 1JUHA 3KGZA 4PJYA 4XEZA 5JSPA 2BYVE 1H1IA 4XF9A 2XGXA 2C0ZA 5I93A 5I8SA 4YARA 4HN1A 1O3RA 4ZU4A 1ZRCA 4F8AA 1UCXA 5I0RA 1GQGA 4B29A 1PM7A 1I6XA 5FLHA 4N9HA 4Q0SA 4WVZA 3M70A 5FPZA 4HLTA 1O3QA 4XF4A 4LA2A 3IWZA 2OZ6A 1DZRA 3BCWA 2ET7A 1HW5A 1NXMA 1QWRA 3FE5A 2ETEA 1ZNPA 4AVCA 4BHPA 2IXJA 2UYBA 5E16A 1L3JA 3L2HA 3BB6A 3E5UA 3OD0A 4QGLA 4KWJA 3EBRA 4TLFA 3E6CC 2PAEA 5EFUA 1LR5A 3BU7A 3SMHA 5FQ0A 3H8UA 4AVBA 1X8MA 4RD7A 4UBHA 4HMZA 1DGWA 3BALA 1J3PA 4FT8A 5KHIA 1CAVA 5BUVA 2Q30A 5C8WA 4QM8A 3H50A 3CF6E 3NSTA 3S7IA 3HQXA 4LTAA 5F1RA 4XFCA 3ETQA 1TQ5A 1RC6A 3RYPA 4D7TA 3H1WA 2MPFA 3I7DA 4L11A 3CO2A 2UY9A 2XKPA 4LUMA 3QACA 2IXHA 2FQPA 3H3ZA 4LUKA 4EV0A 1FXZA 5I91A 3LA7A 3U11A 1ZREA 1DZTA 4NVPA 4H7LA 2GAUA 3RYRA 5FDBA 2EA7A 2B8MA 3SCGA 3WW2A 4I02A 1ZRDA 2HKXA 2IC1A 2ZKLA 3E5QA 4YYOA 2GC3A 3WW4A 3USSA 2PHLA 2VQAA 3SHRA 3H7JA 4BIFA 4E2GA 1QXRA 1ZX5A 3H1YA 5CVRA 4MGYE 4J1XA 2Z2SB 4JTNA 5I0SA 4QMAA 1RUNA 4XFFA 4I2OA 3LA2A 1Y3TA 2HJIA 3FZ3A 4IESA 4X6QB 5HI0A 1FT9A 1RTVA 4EWEA 3GYDA 3RDIA 3ELNA 2O8QA 5C6CA 3CL1A 1ZRRA 4XF3A 1LB2A 1EP0A 1XE8A 4KWKA 5FPXA 2PAMA 1ZVFA 2P17A 2VECA 3SCHA 5LRRA 3EHKA 4Z07A 5KHJA 3TNQA 4R52A 2OPKA 2XL7A 1YWKA 4E2QA 1ZZ6A 3E6BA 4E2SA 3OGJA 1WA4A 4HVOA 1NYWA 4I3PA 2BNOA
chains in the Genus database with same CATH superfamily
3I4IA 2N7GA 5FWJA 1N3OA 4BLIA 4GWNA 5FPLA 2Q8CA 5J09A 3U75A 3J8F2 2DBNA 1NZCA 2W39A 3ATGA 3FBYA 5CFCB 2DFBA 1RHI1 4HANA 1H1MA 2RS51 4DXRA 3HJRA 3ZR5A 1DLCA 3WW3A 2WS93 3PUQA 3W58A 3ZN5A 4AVTA 2P5BA 1ASJ2 2C6SA 1RUG2 3M3QA 5JMCA 3CLPA 2DURA 5A3NA 1UPIA 2Y60A 4IV1C 5FY5A 4AG4A 5BYNA 1V6IA 4CYDA 2B45X 1C8M1 2W1UA 1ZZ7A 5D1IA 2Q1FA 1NCQB 3I2JA 4PIXA 3HIFA 1ND2C 2WIIB 3T0BA 5I8YA 1HB1A 2BUKA 1NE4A 3OEAA 4BWOA 5KXCA 2QJVA 2XQXA 2DCYA 3VBRA 3GZEA 3TN92 3WZ1A 3RFRA 5CB7A 2JKBA 3HOBA 1W2OA 5LASA 4BCUA 1QJX1 1Z0HA 3P1IA 1T6BX 1YXWA 1UU5A 1RMU1 4N53B 1P8JA 3DPRC 4XZUG 1ENRA 1RUF1 4Z82A 2DCJA 3J26N 4BISA 3CBNA 5LA2A 2JG9A 4AEKA 4AAPA 5BNPC 3VDAA 1ZZ8A 4E27A 4AQSA 2KR2A 5SV5A 3KQRA 5F3IA 3WY6A 4PIYA 3MLLA 3ZLIA 4UFHA 4XUNA 5BXXA 1D0HA 2D5HA 2GDFA 4CDWA 2LTNA 5IVFA 2ZPXA 3I59B 3D0JA 4QHZA 3W59A 4XDOA 2VH9A 2RS13 1OA2A 3ETPA 5J3UA 4AVAA 5LK7B 4BQ1A 3IT8A 3S57A 3KCXA 1X50A 1GLHA 2ERFA 1B09A 2WA4A 4Q4W2 4E8CA 1VMJA 1KGYA 4MXWA 4QHOA 3MIFA 2YC2A 2F6BA 2IZWA 2JENA 4Q29A 1YUDA 3I2OA 2RMU2 4BQ4A 4XACA 2GU9A 5HCBA 1XRUA 1W6QA 3AVSA 4JVAA 2R16A 4KU7A 2BZDA 4LEJA 5BPXA 3S30A 5FK8A 1AL0G 1RHI3 2CY6A 5K0UB 5ABJB 1RUJ1 2CGPA 4CCNA 5FMOS 2C4XA 3VBFA 1OQ1A 3I49A 5KHHA 4MG2A 4A4AA 3SCFA 3X29B 3ZFFA 4YW2A 4LT5A 4O65A 5CEHA 1W04A 3AMQA 2YHJA 3I2FA 3J8F1 4QKFA 1XNAA 3TEZA 1QF3A 5CIRA 3OBTA 4AEMA 3K3NA 3AMNA 5FYVA 1YJKA 2YU1A 1KFUL 2VR4A 4YNIA 1LOFC 5FZ8A 4A45A 5F7UA 1FX5A 2VNVA 1W99A 3THCA 3WG1A 3MIEA 1ASJ1 2V09A 3LWCA 5DG2A 1RUG1 1CAWB 1SDWA 2XLGA 4I09A 5E88A 3KS7A 3WG4A 1CGPA 4YVSA 4LBNA 3CZJA 4Y3OA 2QFEA 1LU1A 1MS4A 2LW8A 2W94A 2WC2A 4META 1Q5OA 4NHLA 3VD7A 2WNUC 3WF3A 1MEC2 2K0GA 3N7MA 1O59A 2VBDA 3WHTA 2JDUA 5HBAA 1H4HA 1NCQA 2WWUA 4PCRA 4XF1A 4MUVA 2EIDA 5T5OA 5AC93 4UOJA 3KM5A 3GBFA 3MIDA 4PBOA 2GNMA 1SG3A 3K51A 4XXAA 5CU1A 5GZDA 4E4SA 1Q8QA 3WV6A 4XMAA 2VZTA 4RR3C 3TN91 3WX5A 5JIAA 1TMF2 2LRPA 5JSRA 1LULA 2WZ8A 3VD9A 3ST7A 1G8WA 1MVQA 5JUVA 1V6JA 1OH3A 1YIPA 4ARXA 1JI6A 1DGLA 1QNWA 2QZ3A 1HRI2 2FHRA 2XJQA 3BTAA 5A70A 1M06G 4N53A 2XJSA 2JDYA 4YW1A 4UYBA 5FY0A 4QQHA 4D8MA 4DFSA 2YPDA 3APBA 5A3PA 1BZWA 1YQCA 3IBMA 4WVVA 5EIYB 5F39A 1JN2P 1UXXX 4UXAA 1FOD2 2AREA 3ZSEA 4CU6A 4MV2A 3SLIA 4E8DA 2HLEA 1ZZBA 3OGSA 3I59A 2PELA 1WBLA 1IOAA 2V5YA 3KF3A 5BV6A 1J59A 5T5PA 2LS6A 3ROUA 1UYZA 4OZXA 4Q4W1 1Z7S2 4BXSV 2ZGUA 2BVVA 5I0UA 4P5YA 2CAVA 4AXOA 2X09A 1NG0A 4NN0A 4JKLA 4PDWA 2RMU1 4AHYA 3WG2A 1BVP1 4FPEA 1JW6A 3J8F3 3IPVA 2Y6LA 2AEYA 4JC1A 5ERLA 1LNSA 5C3PA 2A3WA 1YLLA 3BUCA 3C7OA 5DAWA 5C4WA 4CPBA 2RHPA 4K3UA 1BK0A 3T2OA 4PLMA 5K0UA 4DMIA 5ABJA 3HT2A 2QUOA 2VM9A 3GZTB 4NRPA 3KVBA 1UY2A 2OIIA 4CCMA 1JOBA 1RYYA 2ZEXA 3ABZA 5LRSA 3JQWA 5BNOB 2NMOA 5AVPA 1FNZA 2CHHA 3VBOC 4XMIA 2D3RA 1VMHA 5FLIA 5IK8A 1ALYA 1X82A 3J9SA 3Q9OA 3QCWA 2HWE3 5L7OA 5DG1A 3CU7A 4MGZE 2ARAA 3ZXFA 1BMV2 1UY4A 4P9IA 2SLIA 4N43B 1L7LA 2E31A 2V72A 1UX6A 4IDZA 1GOFA 4CA9A 5FTTC 2PAKA 1LGCA 2O1QA 2PTMA 1CAWA 1Q56A 2WQ8A 3LSEA 4QX8A 4WM7C 2BEOA 5FXVA 2VUJA 1OF3A 3PL0A 5IVVA 1RGSA 1QKQA 5CKNA 2RS33 1MVEA 3LAGA 5LW9A 4DIQA 5GLZA 1MEC1 3DV8A 3ES1A 4MSVA 5CZKA 5FZ7A 3NJZA 2QTWB 2FMYA 1QQP2 2BBAA 2XDVA 3DXUA 2QQOA 4BQ3A 1YQ5A 3DUIA 4PLNA 1W8UA 1G6NA 4GWMA 2GZWA 4XTPA 4A6SA 1R1A2 1UL9A 3C7EA 3B7MA 4GH4B 1TMF1 1CX1A 3ZVXA 1F35A 2PN5A 2VZVA 2W46A 1VBC2 2C9AA 3SITA 2E9QA 1ZZCA 3RI8A 5JZGC 4YG6A 4EN7B 1H8TA 4LA3A 1UNBA 2OXBA 3O1SA 1Q3EA 4C1XA 4UAPA 2XUEA 5FY9A 3PIJA 4Q1PA 4RGKA 4RSUA 2HYKA 4XJUA 1FI2A 5FV3A 1FOD1 5J7MA 2QCSB 2RMU3 2H0VA 1UOGA 3M3OA 3W21A 3AXDA 1PO12 4NHXA 1WW5A 1ULOA 5JOYA 2XWBB 1B35B 1RUH3 3OOXA 2IUWA 4CEYB 1Z7S1 2XR4A 1UQXA 1VE0A 2XHNA 3LEKA 2DFCA 2FDIA 5FY4A 5IWFA 4GD4A 1JZ2A 5BNQA 2JIJA 1PZ9A 2H0BA 2Y6HA 4HETA 1IQAA 1K12A 2VO5A 3ACLA 4XYXA 1F4HA 2DTWA 3VBHC 2XJPA 5FY7A 2RDQA 5FJHA 4AQ2A 1IKQA 3N4MA 3K4AA 3BPZA 4QPWA 3N9NA 3WP6A 3CJXA 1I9RA 4OQ9A 3U0ZA 1JHNA 3KCCA 5BNOA 5DAQA 4NHKA 5H9PA 4DB5A 2GALA 4FOQA 3PURA 3AX4A 4JRAA 5F2SA 4AFMA 1POQA 3I3MA 1CJPA 2B46X 4H2AA 2YU2A 4V1PA 3UT0A 1LESA 1BMV1 5FP7A 3LZZA 5LATA 3KV6A 3OBAA 4N43A 4DY5A 5HCAA 3U14A 3PTRB 1BBT2 4HSLA 3KGLA 4DPNA 1GV9A 3C7HA 4OYUA 1XB9A 3DYOA 4D94A 2AZ5A 4BU2A 1AR93 1NLQA 4R9AA 1Z78A 4RN5A 3EMRA 4INDA 4XQ4A 3MO4A 3VKMA 1NT0A 2VZQA 4GULA 3KV5A 4DNYA 2E33A 5BY5A 1VAMA 5FIXA 4J1WA 4KBBA 2HWB3 1QQP1 5FZ9A 2OVUA 1E57A 3AXEA 1HRI3 4IEZA 1AF9A 1FPN3 4HKLA 4ASMB 3AMMA 3MEPA 4YFZA 4EZ4A 1R1A1 3OD4A 1A6CA 2JDAA 1J84A 4HVRA 1E5SA 4A42A 2D5FA 1AXZA 3N7JA 3RZGA 1H30A 4YSFA 4QDQA 1XC6A 4A3ZA 1VBC1 3MW2A 2JDPA 1UX7A 1TNRA 2JIGA 3HMYA 4GXLA 4AWDA 2K9ZA 3ZFEC 1GU3A 2XKOA 2DF7A 5J37A 3FLPA 1EAH3 1W2TA 3T1LA 4Y1VA 5FZKA 5JCTA 3GM8A 4D7SA 4Q1RA 4XQDA 2WAAA 4CP9B 5CAZA 4ZU5A 2X5IA 1RUD2 4XEZA 5IHRA 2BYVE 3B9IA 1QH6A 1H2MA 1PO11 2BERA 4XF9A 2XGXA 2P3YA 5FYYA 5IT6A 4M01A 4XTMA 3UV9A 3FUQA 1B35A 5F2WA 4CEYA 1ZRCA 2GNTA 4XCBA 4NWWA 3WHUA 4Q4Y2 1KDKA 4F8AA 1QJEA 5GZGA 3H8OA 1WLCA 4JGZC 4XABA 2YMZA 4Q4X3 1GZ9A 2NP0A 3O1RA 3C7GA 3K2OA 4CUCA 4Q0SA 4WVZA 4LBLA 1VRH2 4NHYA 3WQ7A 2DUPA 4B1MA 4XF4A 2F4LA 1WCDJ 1GP5A 2WBKA 3FLTA 4GZ9A 4IE6A 4K40A 5CISA 2RR12 1QWRA 2XONA 1N3PA 1ZNPA 2ETEA 4LXLA 4URTA 2IXJA 2UYBA 3R4UA 1L3JA 3BB6A 3ILRA 3AL6A 1SBEA 1LHWA 2WRAA 3CZUA 4A3XA 3E6CC 5EFUA 5FZIA 4JGYC 4LKEA 4AVBA 1K5MB 2E26A 1BBT1 5L19A 4Y24A 2BDRA 4ZHNA 2CWMA 4AF9A 1UZZA 2GNDA 1UPSA 1QMJA 5FZ4A 5EPAA 1EV13 2UWCA 3JXSA 4LOSA 1AL22 3NWKA 5HV0A 3PDQA 3HQXA 4LTAA 2DWRA 1OSGA 1XE0A 2IFRA 5DDJ2 3WDUA 5F1RA 1W39A 3MUY1 3WF0A 5C7GA 3F95A 1WMFA 1ZRIA 3L9JT 3MV01 3RYPA 3ZKUA 4AW7A 5LA1A 4SBVA 1VRBA 3AM2A 3ZYGA 3CO2A 4LE3A 1AR73 1UOFA 2V4VA 2WDBA 1G7YA 2XH6A 2P4EA 2PHXA 2FCTA 2WO1A 5EQUA 5LA9A 1HXS2 4LUMA 3QACA 2AC1A 2WZEA 3OYWB 4YVWB 2FQPA 3NAPA 1FAYA 4WM8A 2R49A 4EV0A 5I91A 3GJBA 4KG8A 2A6YA 2R063 1MQTA 1DZTA 4NVPA 4Q4V3 1RUD1 4DXTA 5A3TA 3P3NA 3LIHA 5FYBA 5DMYA 2OS2A 3ZN6B 5FZDA 5FDBA 1PVC3 3LFMA 3BTXA 3K75B 4LO4B 3WW2A 3MW4A 1ZRDA 3HBKA 3NNFA 2W5FA 3IDAA 3NNGA 1PGSA 1XSQA 2AGSA 2BFUL 4K9SA 4Q4Y1 5F5AA 4AHWA 4XOGA 3USSA 3VBRC 4BIFA 3H7JA 1RVF2 1REFA 5C71A 1ZX5A 4RHV3 1GP4A 2R041 3H1YA 5CVRA 1W2NA 1HLCA 4JTNA 1VRH1 4DUWA 3TEYA 4CU8A 1US2A 2O0OA 4DEQA 5CG8A 3ZXGA 3R4DB 1X9PA 2JG9C 3LA2A 5FZ1A 4I2OA 1AYN2 4E4ZA 2LALA 5DQ0A 3ZYBA 1X36A 2Y34A 2OQ6A 2GP5A 4PHZA 1UN1A 5HI0A 1JZ7A 1RTVA 4RFT0 2ZHMA 4ISQA 5DPNA 1SCRA 4CDWC 3UETA 4UW4A 4C0BA 4XBQA 3LEGA 3WLUA 4AYUA 3V65A 1ZRRA 1W6OA 1LODA 5LBCA 1JZ4A 4NMIA 4CDXA 1ND3B 1SLCA 4I30A 2VBBA 5FYZA 2Y6KA 3VZLA 4CCOA 1ENSA 3TEXA 2XVGA 2LUWA 3JBG3 1K5MA 3PVNA 1XXNA 4QWNA 4YLZA 2VECA 2OKXA 3SC7X 5LRRA 1C3HA 2MEV2 5KHJA 4YW3A 3TNQA 4D0QA 1BVVA 2OPKA 1RUI2 3LF7A 3NKGA 5FYIA 4EN8B 2AH2A 3LDKA 5L9RA 3I8TA 3MF9A 3VBFC 1AL21 2AENA 1ZBE3 3MI8A 3BN6A 4ITCA 4MHRA 1JBCA 5IK5A 2WLQA 1D4M2 5DDJ1 3B01A 3POFA 1JYIA 3ZFFC 4B7EA 1O6UA 5BNNA 2WQZC 1WA4A 2WT1A 1R092 1T6GC 4LLFA 4C90A 2VNGA 2BNOA 3M7AA 5HCFA 1CAUB 2VVFA 4IETA 1LEMA 4KWLA 4QT6A 1REEA 3AMPA 1O3SA 3KQ4B 4GA9A 2OT7A 3N3HA 4FPJA 1HXS1 1XBFA 4OVEA 5EP9A 5EXOA 1G9FA 1MACA 3LGRA 1JU3A 3GHMA 5B4XA 1SBDA 3OUHA 5IAVA 4BIOA 5JPMB 4AI1A 2YFZA 4YVSC 4LQRA 1LTEA 2P34A 1H2NA 4WBBA 1J83A 1V9U2 4S2GA 4EROA 2QQVA 2ADDA 1LAJA 4YZ4A 1DGRN 3WDVA 4W4ZA 1NCQC 3OPWA 1C1FA 4DINB 1SLLA 3BOWA 2XBO3 5FRAA 1N1YA 3NKTA 3WT3A 5J48A 5JXJA 2QQKA 4HPKA 2QE3A 4UFMA 2HWF3 3SXWA 2WLPA 1RVF1 3KT7A 1XQNA 3AYCA 1IS4A 1QJFA 3H3LA 5DABA 5FREA 2Q8EA 1AR62 4FPYA 2OA2A 1POV3 3J7NA 2ZGNA 5FUPA 2RR13 2YBKA 3VDCA 1YRZA 5FP4A 4JRLA 1LOAA 2H6BA 1A78A 3ZYJB 2VMFA 4N53C 5HV4A 3GBGA 3KLSA 1IHMA 3RSJA 1AYN1 3HT1A 1WD4A 1FV2A 2ZGOA 3PVOA 2YYOA 2YUEA 4LHSA 3ZYRA 1QJU2 1GYKA 3DKWA 4HFSA 3UK9A 4YWAA 1NOVA 5FZMA 1QOSA 2VXJA 1XYNA 2VMDA 4AI0A 5C5TA 4L99A 4QPIA 4HT1T 1NQDA 5A7OA 2ZGPA 3T09A 1Y4WA 1ND3A 4IQPA 3ZDSA 2VZ1A 1BYHA 3VKOA 4LE4A 4PDWC 1DU3D 2PHFA 2XL9A 3FL7A 2MEV1 1DYPA 2YROA 3B00A 4M4RA 5F8PA 4XFHA 3RRDA 1U0AA 5C4WC 5IATA 5K0UC 2LM3A 4FPHA 2BGOA 5E1RA 1VJ2A 4MZUA 4M3CA 3DF0A 4QXCA 4LHKA 1D4M1 2ARBA 4G9SB 3ZMOA 2WFF3 4DXZA 3HD8B 5CADA 4QAWA 3WP3A 3FHIB 4BB3A 1UZYA 1QOOA 1R091 1JYTA 4BMEA 2XHKA 2RVAA 1CAUA 4GALA 5L7OC 1DQ0A 3KMHA 4XJWA 1JZ6A 5EYXA 3USUA 1PMIA 2Y6GA 3UKVA 4K8RB 3ZXAC 1CPNA 3VDDB 5FMCA 3ZXKA 4MADA 5IW0A 2GH2A 2PQSA 2QVSB 4MXVA 4RS5A 3NO8A 3WCSA 3WNPA 3RG0A 4JDOA 5KXEA 3WVJA 3VHOA 1REDA 3NNJA 1T2XA 2QQPA 1CONA 3Q8EA 1V9U1 4PT6A 1CX4A 4XIOA 1OF4A 2DVDA 1MZFA 2XLFA 4XILA 2CYFA 1UYYA 4A41A 2A3YA 2RM22 2DYCA 2ZHNA 3TOJA 2Q5TA 5JOXA 4AQ6A 1O91A 1UIJA 4XPVA 1WLDA 1LGBA 2EALA 3HN1A 4BZ4A 5GZEA 1SPPA 3SH4A 2A71A 4Q0UA 3MZHA 3TB0A 1NCRA 5T3NA 3LEIA 3HNBM 4AGRA 1AR61 4KU8A 1SMVA 5I8TA 1W9SA 1JUIA 4LHLA 4CCEA 1DBNA 1KD7A 5JLVA 2WKKA 5JMOA 1H8TC 3DKQA 4YZ3A 4HVQA 4NWVA 3O0XA 3VBSB 3VHRA 3H0OA 4AI3A 1IG0A 2HEVF 2Y64A 2G19A 2QDNA 1VPHA 1COV2 1TME2 4AGGA 1R082 1QJU1 3DECA 2IVIB 2RDRA 3O7OA 1AR82 3OG2A 2MEV3 2VOVA 5SV8A 3FFQA 1RUI3 1RXGA 3AKPA 1WZXA 4IGOA 4NUBA 5FYUA 4D3WA 1HRV3 2Q0AA 4Y1ZA 3SQOA 1GNHA 4B4QA 1UYXA 4HONA 4KG0A 4UBGA 3MPPG 3AYEA 2E32A 3GZUC 4CDUB 4AEDB 5C9AB 3C7FA 1AHSA 1L7RA 3MIBA 4RGAA 1WD3A 2GH8A 2PYTA 4MGQA 1LU2A 3ZM8A 1VBE2 3D0SA 4LJHA 1SDDB 3R0RA 3M4FA 3NJXA 1WLTA 5IVJA 2WN3A 2ZGMA 2XB6C 3VBUC 4A44A 1GICA 3I54A 1EUUA 2DCZA 5FBJA 3ZYHA 4LO5B 2FDFA 4RFRB 3POYA 3ACIA 1JYCA 5FO9B 3AMHA 1ZYBA 4H55A 2QBXA 4ORFA 2C1FA 4ZKTB 1PIV2 1GNZA 5DZEA 2ILMA 2XXZA 2ZS6B 5F5CA 4AGVA 4XFAA 4N43C 1LECA 4IEXA 4COYA 4I3GA 4X6RB 3UKTA 2ZX1A 3PU8A 1ENQA 1JODA 1G9BA 2IXIA 1OUSA 3ECQA 3O5SA 1ZBA2 2X29A 1LOCA 3OCPA 2JDZA 2RM21 4HSJA 5A7SA 5GJ6A 3EJKA 2A6ZA 4BE3A 2BNNA 3HAGA 3ZDVA 1O3TA 2DUOA 3V56A 1AYM2 2WZR3 2VCBA 5LCWL 2F4PA 2VE1A 4K8FA 2D93A 1KJLA 1OT5A 1HX6A 4MGIE 2C5DA 1H9WA 2O8OA 1WBFA 2P6CA 2ZACA 3GCWA 4W6YA 4XQWA 5J36A 3T1MA 2AACA 1QJU3 5A1AA 2ZGKA 4GMP1 5KC6A 1VBD3 1PK6B 3OTFA 5FK7A 1X33A 3O0VA 2PHRA 4DUVA 4KBZA 1OD5A 5L36A 1LRHA 3VBSA 1PO23 4O9EA 2OPWA 4P08A 2IXCA 2BGPA 1COV1 1TME1 1O4YA 3VZMA 2X5IC 2A5ZA 3S5QA 4AHXA 1R081 2I45A 2EICA 2BOJA 2TUNA 4LO7A 4HG6B 4YM0A 1AR81 1WGPA 4JDMA 2TBVA 2SBAA 1SEFA 4LBQD 1OVPA 3T4VA 2RS53 3BVCA 1S2KA 4XBLA 4FVVA 1I5ZA 2YZ4A 5A7PA 4PF5A 4CEYC 5B4NA 4JHZA 4H3WA 1AVBA 1GP6A 5EWSA 4CUGA 5AFEA 4PI2A 2BJSA 4MGKE 5J98B 2Z42A 3ON7A 1MS5A 5CFCA 4Q2FA 1C8M3 1AZDA 2KA3A 2OUJA 2WABA 5D8AB 1OLRA 2C9KA 2BPA2 1M4WA 1VBE1 4RQPB 1RB8G 4J6GA 5A3MA 2WUHA 3WDWA 3FWEA 2VW2A 4Z1VA 4CEWB 1W3VA 2QDRA 2RE9A 2J7MA 1OLME 2OUHA 3O0WA 5CFDB 1H6YA 1HB4A 3THPA 1KDMA 2C24A 1R64A 4TYSA 1QEXA 5F37A 1G9DA 4EE2A 2BNMA 4N7UA 1X7NA 1QJX3 3IIAA 5F6KA 3CIHA 5LEKA 1YFWA 1PIV1 3D82A 3AFGA 5APAA 1RMU3 2DCKA 4FPGA 3T2QA 2JE7A 1VAKA 4FPCA 1NA1B 1RUF3 2DUQA 4RYDA 2KXLA 3OSDA 4JV4A 3EYPA 4NIGA 1V6MA 2VQTA 4HK8A 5FQ0B 4YW5A 2ZEWA 3O1OA 5EV7A 1ZBA1 1QGLA 3RZZA 5IVCA 4FSJA 2D6KA 3N7LA 1CAVB 4YM3A 1GZTA 2ZGTA 3DYMA 3LA3A 4UFJA 5JR7B 3M3IA 1AYM1 4C1WA 1UW8A 1C5HA 3A4UA 3NQHA 4KMQA 5C3QA 5LEJA 1SZBA 4QQLA 3AKRA 5L9BA 2RDNA 3AYDA 1Q8PA 1QDCA 2WQ4A 3CQOA 1F5FA 4YW6A 1F9KA 2Q8OA 4XCAA 3O1MA 2W47A 1WCQA 2Z69A 3NAPC 1PK6A 1RUJ3 5IVBA 4GB32 1RXFA 2CSGA 4WM8C 4KQ7A 5EHDA 2BV4A 5A6ZA 2XMLA 3OUJA 4R4XA 1MQTC 2RDSA 1TEIA 3PUSA 3SNMA 2VPVA 4N8MA 4XUOA 2ZABA 4COWA 5A7QA 3RPQA 5J1XA 2XPJA 1VALA 3KWVA 4WVWA 4QGMA 2IXKA 4BH9A 2WNVB 5JOWA 4AI8A 1ODMA 3WNMA 3UJOA 1VBE3 3AP9A 1MZEA 3RWNA 5C8CC 2XWJB 4TWTA 1ASJ3 4F3JA 1RUG3 3OGGA 4HN1A 3ZYFA 4DY3A 3IIIA 2D6MA 1UCXA 2OX0A 3EB7A 2DTYA 1YQ2A 2VZUA 1A8MA 4WV8A 1WMEA 1GOHA 1YIFA 1H6XA 4JZRA 4LBMA 3WUDA 1PM7A 2BWCA 1U5YA 1JS9A 5FLHA 3N36A 2RG4A 4IGPA 2BRTA 4RQPA 3ZSMA 4L97A 3WQBA 5FPZA 1S55A 4XHXA 2JECA 1BK1A 4X8PA 5G05L 5IYYA 2GNBA 2R6QA 1F15A 3RJ2X 4QKNA 3TN93 3UL2A 4Q26A 1DZRA 1FV3A 3BCWA 5F3GA 3Q8BA 1VBB2 1WWYA 1OQDA 1HW5A 1OFSA 4XC9A 4CDXC 4CUBA 1F4AA 5C33A 3L2HA 5FUNA 1JHJA 1NA1A 3D5OA 1K5MC 1D2QA 1ND2B 5I0DA 4MHUA 1SLTA 2NMNA 3EBRA 4TLFA 2ZZQA 3BU7A 5FQ0A 1X8MA 4Z92B 3BALA 5KHIA 2VAUA 4FT8A 4XUQA 1CAVA 1MR5A 3M3CA 2A75A 5ANQA 5BUVA 4YGEA 4ATFA 3IKWA 4YM1A 2J1AA 2D3PA 4RL7A 1PNGA 1ODNA 4NROA 4Q4W3 4ZZ5A 5BNNC 3PIGA 4Y5Z0 1KEXA 3ZO0B 4NPRA 3DPRB 5DAVA 4AHZA 1JYVA 1WW7A 1Q8VA 4DQAA 2ARCA 5FOBB 3OGRA 2W92A 3KCYA 3RMYA 1SACA 1CJDA 1RINA 2ZX2A 5LBEA 1DYOA 1RC6A 3LPFA 3WNKA 3H42B 5A1FA 4CVUA 2MPFA 4WVMB 2ZEZA 3I7DA 5C3RA 4OHWA 4PI0A 4GB31 1G9AA 3B3QE 1UOJA 2XKPA 2IXHA 2V73A 3SH3A 1H8VA 3ACFA 1J1TA 3H3ZA 4LBKA 3NV3A 1TZOA 2JKXA 1JU4A 1N3QA 3ZMNA 4B3NA 1OVSA 1JH5A 1UMZA 4EN0A 4TN7A 1KRIA 1CN1A 2GAUA 2A3XA 1DCSA 5A32B 3WF1A 5JXIA 1BLZA 3RYRA 3RGBA 1RUE2 1OH4A 2EA7A 4QPGB 3AP4A 2G9FA 4YZ1A 3GALA 4UFLA 4EWAA 3HR9A 4LPLA 1UZWA 2VQAA 2ARXA 2VUCA 2WINB 1LCLA 2Q1MA 3M1HA 1MEC3 4H7MA 1QXRA 3KZ4C 1ONAA 2W0XA 4XHBA 3WP4A 1UU4A 2Y6JA 5I0SA 4TSVA 1BCXA 1W3XA 1IQDC 4QMAA 3VKNA 2FCVA 2NN8A 2TEPA 2QQUA 1CIYA 3GZAA 4U2AA 1Y3TA 4XFFA 4IESA 1FT9A 1TMF3 3A22A 1N1VA 1O8PA 4KH9A 4QPIC 3MW3A 1VBB1 1UKGA 5AVAA 3LDBA 4BM8A 3VLBB 1ND3C 2X8KA 4A6OA 4M0NA 3FHAA 3ZXJA 4NIAA 1W6NB 2D44A 4XF3A 5IUQA 3LOBA 2X53S 1GUIA 3N35A 5D2AA 4UW3A 1EP0A 1XE8A 5LB6A 2P1BA 2ZBJA 1FOD3 2D98A 5T54A 4GH4A 1XPWA 3MGUA 1SLIA 2P17A 3SCHA 4RR3B 3POSA 3T2TA 5K7PA 3EHKA 4IV3C 4Z07A 2VBPA 3RI9A 1QJZA 1W9FA 3DEMA 1OKQA 1QJY2 4AFCA 2J1RA 1Z7S3 2VMEA 1K5JA 3WP5A 1QHDA 4QQPA 3Q8FA 4W8JA 3DPRA 3L2YA 3E6BA 1PZ8A 2AEZA 3I3BA 4E2SA 4CZSA 4P9WA 4QQ2A 3IZOA 3OGJA 3QLQA 1UZVA 2VMIA 4OULA 2R071 3WQ1A 2YFUA 3NV4A 4YW4A 5C6CA 2J1UA 4WVMA 1W03A 2NPIA 1TE1B 3NV1A 4RS5C 4I0AA 2Y26A 3H8RA 4GJZA 1Q8SA 4PF1A 2J1SA 5CG9A 1K42A 1KJRA 2Y33A 2QQLA 3ZSJA 2A7AA 1GZCA 2R042 5B2GB 2WWSA 2V4AA 3AKSA 2VZ3A 4QM9A 1GFF2 5H9SA 4JKMA 3RZLA 1C8NA 4AK3A 3WXPA 3HN3A 3M3EA 5A3LA 1RUE1 1NCRC 1U5IA 2WFPA 5FYMA 4QXBA 4QPGA 1V6LA 4NO4A 4FOYA 1ULEA 1DIWA 3P6BA 1RL3A 1RITA 2DU0A 2NZ9A 4FPKA 4ZXEA 2NLRA 2FBEA 1XYPA 3BODA 2OQ7A 2V5DA 5I0TA 3HWJA 2ZGSA 2ATFA 4CCKA 4YZ2A 1O4TA 4XFGA 3VBOB 3NMBA 4L0PA 5LBBA 3J7HA 1CD3G 1QQP3 3UGHA 1S2BA 2YG0A 3UYJA 2E6VA 3I2HA 2HYXA 2R1BA 2OZJA 3PUIA 4BPZA 2ORZA 4ZU7A 5E89A 2VOTA 1R1A3 3V0BB 4PQ9A 5ACA2 1OFNA 2D7FA 1DGRA 2VGDA 3ZKYA 1MS8A 2CL2A 4YG3A 1I5PA 4LOTA 5FKBA 4WM7B 5A1LA 3CMGA 1VBC3 4URAA 1QDOA 2EAAA 3H3UA 2IWGB 4KL1A 1WCSA 2A6WA 1IPKA 1S0EA 1CR7A 4JX0A 5JI7A 4QXKA 5FUIA 1XNTA 4OI2A 1OUXA 2WR9A 5T50A 1OHFA 4CU9A 1VP6A 1BQPA 5FR3A 4BQYA 4DRRA 4JKKA 2RV9A 1PO13 1DFQA 4B8EA 2VQUA 1J3QA 2DVAA 3I2DA 4CXWA 2XVLA 1QJY1 2GMPA 3KD4A 5JZGB 3CEWA 3LE0A 4OCTA 4CP9A 1GOGA 1DF0A 3A21A 3URFA 3B9CA 2RJ2A 1QNYA 3CHXA 4HL0A 1EYBA 2VTFA 3ACHA 5F32A 1XNDA 3HEIA 5IFPA 4IEPA 3TAYA 4YZ5A 4OI4A 3WF2A 4A2UA 4QPYA 3NNMA 4P9JA 1SLBA 1PX3A 1VBA2 3NVCA 4WZCA 1K45A 1STMA 4FI9A 4TTGA 3RZMA 1XOYA 1YI7A 3E6DA 4QX2A 2FCUA 2PLV2 5IVYA 1DP0A 3QD6A 5C70A 3OPTA 5C3OA 5A3OA 1LOBA 3KF5A 1O8SA 3FJSA 4KI5M 4TXWA 2VUDA 3N9LA 3ZXLA 1GKBA 3MHZA 3FFZA 5IJRA 2PMWB 3EXUA 2HWC2 3AJYA 3JD72 4Y20B 4NIIA 3SEEA 4OUEA 3VBHB 1BBT3 1CZVA 3H7YA 4I0WB 5GLVA 3UGGA 3WW1A 4K21A 4D69A 2FDGA 5A6XA 1PGW1 4ISRA 4XURA 2K46A 1Y7BA 3D8CA 2G1MA 2EXIA 4W6XA 4HZFA 5A6YA 2WT0A 5DZGA 2B5HA 3VBSC 2JG8B 4ES8A 2E51A 2MNGA 4P9LA 2B9UA 2E7AA 3O1PA 5FCCA 2AUYA 3T4HB 2YDEA 4AQTA 5ACA1 4TZDA 2DV9A 3AL5A 3VUOA 1UOBA 3JZVA 3NRUA 4LR4A 1WMDA 2HWD2 1SHWB 3O12A 1OURA 3Q8CA 4OUMA 4Y5SA 2JDMA 2ZTNA 5FXZA 2OYZA 1QH7A 5GZFA 2BBVA 3GGLA 5FY8A 4CDQB 4NRQA 4FAHA 1O5LA 1RUC2 1AX1A 3AP7A 4BMBA 5CFCC 1RUD3 4BYYA 1H0BA 3LD8A 2ZKNA 3GNEA 1VIWB 4QGNA 5DUXA 2HBTA 3U78A 3OYWA 4YVWA 3VHPA 5LBFA 3ORJA 2CDOA 3TBDA 3VKLA 4GWIA 4Q4Y3 2Q4SA 3RMXA 2ORXA 4CP1A 4OQ8A 2G4IA 4IERA 2QZ2A 1MS0A 2R043 1CAXB 2BWAA 3IDCB 3PVBB 4N9IA 3VN4A 4YRDA 1VRH3 2BW8A 2VOKA 4MVTA 3ZN6A 4COVA 2ZEYA 1S0JA 1OD3A 1KQRA 1W8OA 2PHUA 2RJLA 2W91A 1VBA1 3A23A 3PU3A 2LROA 3CDZB 3SISA 3U37A 4CCDA 2WS92 2IVJA 2BOIA 4K1YA 1BEV2 4OMDA 1EY2A 2PLV1 5ANNA 5CBLA 1YQ6A 4AI9A 2YBSA 4K20A 1UWWA 4JGZB 3BI3A 3WDXA 1W28A 1QXJA 4IEOA 2YY1A 1LGNA 1SFPA 3OBZA 2KD7A 2HWC1 1Y9GA 3JD71 5DUWA 4Y20A 1H2KA 4OI0A 4IEVA 5EZWA 5GALA 3VL9A 2Q1ZB 3V0AB 5JXHA 2ZX3A 3ZPOA 2VZOA 3I2IA 3OJBA 2EIEA 4MH0E 4Q0QA 2UURA 3HQRA 5EYYA 2PFWA 4B4PA 3MIGA 1AL23 4N90A 2QNKA 5DDJ3 2D40A 1O7FA 4GMP0 5JDBA 3O1VA 2JG8A 5CNAA 1AUYA 1YFXA 2KM2A 4QD2A 1HV0A 1F31A 3KHBA 4UT5A 3NJVA 3EQEA 4JGYB 1PZ7A 4HBNA 2ZGQA 2ZMLA 4FTSA 3LOIA 2WO7A 5ABJC 4OFGA 2JX9A 4Y1UA 1HXS3 2HWD1 2L9LA 1OI6A 3C8XA 3H1MA 2RS12 4WZFA 4FAGA 4Y22B 1DLLA 3ACGA 4GAZA 3RZJA 1HIXA 2MHFA 5M0TA 3HQUA 2QQIA 4CDQA 1LHVA 1RUC1 1LHNA 1ST8A 5FZCA 3MUZ1 2R0HA 2VL4A 1S1AA 2D6OX 3NL1A 5G04L 4HK9A 4XJ8A 5FYHA 4QB6A 3HNMA 2YGMA 2E7TA 4RQPC 2Y0IA 3VZKA 2EVXA 1KFXL 3B93A 2XQRA 5FZGA 1GWKA 3RYKA 5KXBA 4AE2A 1ZA4A 3N9PA 1RVF3 4JTOA 1N1TA 1YHFA 4Y33A 1XYOA 4FCAA 3K4DA 4K6BA 5DUVA 4ONUA 4Y1XA 4XAEA 1CAXA 2BU9A 4QX0A 1LHUA 1W8FA 5KR7A 4CUAA 4PLOA 1S4CA 4KGGA 1V6NA 1NA1C 4LULA 1DG6A 3B5LB 3O1TA 1AYN3 1ACCA 4P14A 5FBZA 2WS91 5GLWA 1XE7A 1NAEA 1BEV1 5KHKA 2A73B 4EZHA 3PMEA 3TNPB 3BPSA 4DRVA 1DQ2A 5HXVA 1SFNA 4G4FA 5EJ3A 2GMEA 1ULCA 1OKOA 1MS9A 1W0PA 4K7JA 5ISLA 1F8VA 1L7QA 1X8EA 1E5HA 1IZ3A 2GC2A 1NLSA 3I2GA 3S6PA 3KHCA 3ENRA 3MICA 1ENXA 3PJYA 4GQ7A 4NAMA 3WR0A 5AC92 3T2PA 3O1UA 4OLLA 2FDKA 2A6XA 2UU8A 3MLKA 5FZ0A 4QU2A 4W50A 3N9QA 4CDWB 1UMIA 5KC5A 4ZPIA 4FBFA 5LZ6A 1XNKA 3IMNA 1PM4A 3BYWA 3B69A 5FP8A 4COZA 4EN9B 2HWD3 2O14A 3IB3A 1FMD2 3AZWA 1YO8A 2VJXA 1J3RA 1D4M3 5FAXA 5F9TA 4BLJA 2JD4A 1W90A 2CAUA 4LMFA 5FZEA 1ZZ9A 3SKJE 4MXWB 4GKXA 4XDQA 1R093 2JXAA 4LLOA 3OF1A 3WNNA 1HJFA 1NXD1 1JZ8A 3AZXA 4JGYA 4ZZ8A 3TRSB 1S0BA 4N7IA 4DZGA 3LFIA 1J1LA 2FMDA 1W6QB 3MFCA 2UYAA 3R4SA 4LHNA 3ZYIB 2YB7A 4MX3A 2RS11 5JAXA 2UWAA 1HQWA 3VD5A 4IE5A 3WF4A 1JUHA 2C26A 3KGZA 1E5IA 4W6WA 4Y22A 3VBFB 5BNOC 1JMUB 5F5IA 4LBQB 1YI9A 3I2KA 1JOJA 3D6EA 4R9CA 3IMMA 1WCKA 4XAAA 3ZFFB 1V9U3 2R1DA 4U36A 4BXFA 5I93A 2VZRA 1UKRA 4OZOA 1O3RA 2WO3A 3LIGA 1GNYA 4ZU4A 2B9VA 1S0FA 1ULFA 4FP2A 1NY72 3VDDA 5IVEA 3J7LA 1CESA 4NE9A 1IS3A 2JWPA 1C28A 2YPJA 4N9HA 3M70A 1BEV3 4BA6A 1AR63 2HBUA 1V6KA 4CRQA 1O3QA 4UW5A 2EIBA 4YVSB 1AJOA 2VZSA 4LIUA 1JYXA 2EIGA 3IWZA 4ZXKA 2ADEA 2OZ6A 2YV8A 5FY1A 2HWE2 3TWIA 5DAPA 2YGLA 4CCJA 3ZR6A 1C4RA 2VCMA 4QKBA 4D7YA 1NXMA 1PHMA 3WOGA 5FPUA 5F3CA 3FE5A 5FP9A 4AVCA 2QQMA 3A7QA 3GF6A 4BHPA 4GH4C 3FHQA 3OD0A 2WZPP 2VVEA 2W68A 3QH6A 4KWJA 4QGLA 1EPWA 1W8WA 3INAA 5FO7B 4FPOB 1KS4A 1LOGA 3SMHA 1OOPB 3H8UA 3ZFGB 2VG9A 4RD7A 2RS32 4UBHA 1VMFA 4HMZA 4HXCA 3LB9A 4CSWA 4YPJA 2R30A 1OA3A 2VW1A 1UZ0A 4NIHA 4AVSA 1IKPA 1AJKA 1ZA7A 2J42A 3HBZA 4QM8A 3JUUA 5C8WA 2D6NA 5AC91 3CF6E 1GWLA 3NSTA 4Y26A 4FQZA 3S7IA 4Z2AA 3CJIB 3U4XA 1FATA 4A7ZA 3WDTA 3VB9A 1W8HA 4XFCA 1D4VB 2D43A 1PX4A 1XU1A 1B35C 4OI1A 1JYWA 2VD7A 3ITQA 5L9VA 4D7TA 1FMD1 4ZS2A 3GDBA 3WEZA 5J96B 1E5RA 4K1ZA 2Z79A 3I3QA 1S0CA 1XNBA 4E4DX 1I1EA 4CDUA 2W08A 1OQEA 2DDUA 5FWEA 4HKOA 3CNAA 5FXXA 1W8TA 4AEDA 2B4KA 5C9AA 3SEPA 1AX2A 3HPNA 4PDWB 3KV9A 1O4ZA 3ME2A 3VZOA 4IGQA 2VW0A 4LUKA 3PVEA 4P9XA 4XJAA 3IPVB 1H4GA 3LA7A 1HKDA 2DVFA 2R0FA 2ZMKA 3I97A 3J4UH 3MFAA 4LNVA 3U11A 3NNLA 1ZREA 4R9DA 5C4WB 4QPGC 1RUH2 4X8NA 1WUVA 3MIHA 1QU0A 1HDKA 3POBA 4LBQA 3SCGA 3THDA 2I07B 1W6MB 4QDSA 2WAOA 2IC1A 5DN2A 3E5QA 2RM23 4YYOA 3PHMA 4QHBA 1TVGA 1CPMA 2JICA 2PHLA 3SHRA 5L7OB 3MV11 5GKAC 5FKCA 3IN9A 1NY71 1DQ1A 2JE9A 3T30A 4RGGA 3WNXA 4XBNA 3N7KA 2Z2SB 2K2SA 4P5HA 4Y4YA 2PHTA 3ZIWA 2ZAAA 1N1SA 2P2KA 4EN6B 1RUNA 4FP3A 4GMP3 1EUTA 1W9TA 3K3OA 1URXA 1PGL2 4R9BA 4X6QB 4DS0A 2ZA9A 2HWE1 3D3AA 3BIEA 4QU1A 4B1LA 4EWEA 1KS5A 4OHXA 4LKFA 3GYDA 1CWPA 1COV3 1TME3 3ELNA 3T08A 2A6VA 1R083 4MGTA 1AR92 1AR83 3B94A 3JU9A 3NJYA 4KWKA 5FPXA 2VMCA 5A3WA 1H1AA 1OPMA 2RS31 1OOPA 4YFWA 1CVNA 5FPVA 3ZFGA 1W8NA 2UWBA 4AEJA 2GN3A 2XOMA 2AYHA 3U1XA 2HWB2 2X05A 1FMD3 1DQ4A 1H8TB 4R52A 2OW4A 2GN7A 1FPN2 1UMHA 4AAXA 4PBPA 4UF0B 4NAOA 5T55A 1IS5A 1BXHA 2EXHA 4NR1A 2W1QA 4CPBD 1YC61 3FC0A 2ZGLA 4W65A 3R05A 3CJIA 5DZFA 3E1F1 5C3SA 2WO2A 5JVVA 3AP5A 4XUTA 5JR2A 5TSWA 1NQJA 4I3PA 1FXZA 4LO8A 3HVDA 3OB8A 5C5UA 3CKHA 2E7QA 2EXJA 1EAH2 3MDPA 4IEWA 1LOEA 2VU9A 1GZWB 3ZSKA 3POIA 2WJSA 1OMIA 4IUGA 1CZSA 1QIQA 2GC1A 2QQNA 5HXMA 4AOCA 1HJGA 1GQHA 3SH5A 2VY0A 3K48A 5IK4A 4FFIA 5D8AA 1EPZA 1PIV3 3DCQA 4Z2WA 1KITA 4L8QA 3BIWE 2VOXA 4B7KA 4CP2A 3W20A 1QOTA 3KSCA 4EWDA 4CP0A 4NHMA 1LENA 4M4PA 3QH7A 1RUH1 2JDNA 1GMMA 4MYEA 4C8DA 4CEWA 5FZAA 3RZHA 5CFDA 1UYPA 1D2SA 4Q5OA 4OUSA 3PNAA 1ZBA3 4Q4X2 3VBUB 3ZX7A 4E4HA 5T5JA 1W6MA 3T0AA 4IV1B 1LJ7A 2I2SA 5A7NA 1OLQA 4QX5A 4L9BA 2WA3A 1AYM3 1GBGA 3DGTA 4ASKA 3OPZA 2P3IA 4BQXA 1ULDA 5FZ6A 2VTXA 2NM1A 3RJRA 1XU2A 2GC0A 1JXNA 1V70A 4XJ9A 1JYNA 4M3CE 2D97A 5A7WB 3H9AA 1SCSA 2VCCA 2ZGRA 2CV6A 3VZNA 2XJUA 1PGL1 2VULA 1APNA 4XETA 3OBRA 4D6QA 4NOTA 1NX9A 4IE0A 3RZKA 3K46A 3U10A 3P5BA 3BKZA 4UW6A 5FZ3A 4SLIA 3WG3A 3JQXA 3MPBA 5BNPB 1W6PB 1V6OA 2DVBA 1AR91 2R072 2X10A 3PLQA 4FOVA 2VC9A 1K3IA 2B42B 1PMJX 3GCXA 3RS6A 4AL9A 5CA6A 4YVWC 4Q27A 2CGOA 3WUCA 1EV12 4LK7A 4P02B 4M00A 4L2NA 2HWB1 3UKNA 4F7ZA 3G7DA 1HRI1 4AFAA 2QKDA 1FPN1 2EAKA 4FXGB 4P9YA 3ILNA 1WW4A 5KHGA 1XSRA 1A34A 5F6LB 4UF0A 3RWKX 3VDBA 1YQ8A 3IDBB 2X5IB 4LBOA 4MOAA 2W52A 1DGWX 2ZJCA 2WNVA 4CXYA 1W2UA 4UFKA 1AR72 1XNCA 5A80A 3FUOA 3K77A 3DL3A 1UAIA 1HQNA 1RJ8A 2PHDA 2Y0OA 3O14A 1EAH1 2DVGA 3GBWA 3H8XA 4H14A 2WWJA 3BTZA 1CZTA 1HB3A 3FN9A 3A0NA 4PQQA 1GZWA 2R062 4ES9A 3ES4A 5HCHA 2BTVC 2R32A 3I3DA 1FYUA 1BJQA 2PA7A 4Q4V2 1NKGA 1UIKA 1NE6A 2GP3A 2VNRA 4Y5TA 4XW3A 4YGBA 3ZIXA 3UNPA 2W95A 3VKFC 1PVC2 4XF0A 1DDLA 2WNEA 3KVAA 2I74A 2ET1A 2WSVA 4XVHA 3THTA 1I3HA 1UU6A 4AR2A 1H2LA 2QQWA 2WN2A 4M0HA 4PIZA 4CU7A 4Q4X1 3GXUA 3VD3A 5EJZB 2NQYA 5FLJA 3VBUA 4EJRA 5A3UA 3BTYA 3FLRA 4RHV2 1VB2A 4XFIA 2WYFA 4BQ5A 4XE9A 4IV1A 1JOPA 2WNUB 3Q8AA 3TEWA 4FQ4A 3AKQA 2JG8C 4ZY9A 2VQ0A 1J58A 4AFDA 1ND2A 3J7MA 1W0NA 2D6LX 4S2HA 1U12A 2H6CA 4FFGA 3U4SA 5A7WA 3FX3A 1OXCA 2E53A 5A33B 2PXJA 3KV4A 5FYSA 4ASLA 4XDPA 4CCCA 4IL7A 2HEYF 3ZSLA 5FPBA 4CXXA 2ZCWA 4GB33 1JTZX 1W05A 3W5MA 1NUKA 4CDQC 3C3VA 4JCKA 4IEUA 1POV0 1YCIA 5DUUA 1ZM1A 3JBG2 4OHYA 3ZPYA 3S7EA 1WCUA 2FDJA 3W9AA 5BNPA 1W6PA 4QKDA 4QDRA 2D6PA 2BQPA 4CCLA 2ZZJA 4I0BA 5FO8B 1US3A 2DCTA 3VZJA 1UD1A 4NRMA 2PQQA 1VAVA 3V64A 1EV11 5KWRA 3M2MA 1ZBE2 4QQOA 3NAPB 1MPXA 4WM8B 2UY8A 3JCIA 1G86A 3KT4A 5KBFA 1OA4A 2BP6A 1O5UA 2P37A 1MQTB 2WSUA 4ARYA 2GMMA 2ZMNA 3FBMA 4P9GA 4S2DA 3WD5A 2YC0A 3EO6A 3DXTA 4LKDA 1OC1A 1AR71 4JAAA 4EQVA 5A32A 1KXGA 5FJKA 5FYTA 1Y9QA 3AP6A 3ILFA 1MZ6A 4A7YA 4BJ0A 4CTEA 2DU1A 5C8CB 3E97A 5GLTA 3ZOIA 2E63A 1XJAA 3OY8B 4JHTA 4BK5A 1PGW2 1U5ZA 1CIWA 1VR3A 2R061 2VOWA 5L73A 1WLWA 1YYNA 4Q4V1 1MZ5A 1VBB3 4HN0A 5JSOA 1OBNA 1PVC1 3DN7A 4BK4A 5FOJB 2XVKA 1IS6A 3PUHA 2XBO2 2Z4FA 3M8LA 1LOFA 3MBWA 4AZZA 3B02A 4QB2A 4FO9A 2HWF2 3LCPA 3RVHA 3LEMA 5FFOC 4Y4RA 5FMBA 4A7KA 2BGCA 2Y38A 2D3SA 4RHV1 3MYXA 1UXZA 2VZPA 2XLAA 1VLNA 4GWJA 4O61A 2WNUA 4Q8KA 1W6OB 1DZQA 2ZXQA 3AVRA 4CDXB 1W6NA 2FZ1A 1UF2C 5FPAA 1IPJA 1SLAA 5IFTA 2JD9A 1GANA 1Y9MA 2W1WA 3S0MA 4FFFA 5KXDA 3VD4A 1YFYA 4V2VA 4AVVA 4LORA 1IPSA 2JEMA 1DHKB 1WW6A 2R073 2ENRA 4RR3A 5A33A 4L92A 2ZX0A 1MS1A 1WKYA 2VCAA 5E6HA 2VNOA 4F83A 5AFBA 5HPOA 4XIKA 1FNYA 3UJQA 5IK7A 4ZS3A 1JZ5A 2FZ2A 2W87A 5BNNB 3JBG1 2VVDA 1S2EA 5H9RA 4Q0VA 4LBJA 1TG7A 4I01A 2WYSA 2ES3A 1R1ZA 3AZVA 4Q0PA 2ZHKA 3OGVA 1YFUA 1GWMA 4QB1A 3VDDC 4Q8LA 1RUE3 2BVBA 1ZBE1 4D6SA 4Z8BA 2P6HA 3BU0A 4QX1A 2WFF2 4C91A 4FPFA 4LKSA 3T0DA 1Q8OA 3NW4A 2J22A 2R7EB 3OUIA 4G3YC 5JPNB 5LK5A 3WNOA 2W2IA 1QY4A 1D0GA 1W9YA 1PNFA 1S0GA 3ALQA 1V00A 4FOWA 4E9KA 5A6QA 2JDHA 2DBIA 1HB2A 2A70A 1PMHX 4OMCA 5GM0A 4HPKB 3N9MA 2Y6FA 4P00B 2F17A 2YBPA 3DYPA 2IXLA 3R6SA 4S2FA 3VL8A 5C8CA 2WNOA 3OY8A 5K4LA 4IW3A 1LKNA 1Q43A 2G9GA 4AI2A 1ZRFA 4BDVB 1Y43B 1S0IA 3VBOA 4YGDA 1N47A 5FZBA 1W06A 1H9PA 1SQ4A 4YW7A 1A3KA 1DQ5A 2CTVA 4IEYA 2YXSA 2XBO1 3BGAA 2ZX4A 3OEBA 4KNCA 3S5AA 3F2ZA 1ULGA 2HWF1 3V0BA 3HNYM 3KT1A 3POWA 3RNSA 4AFBA 4R8HA 5FZHA 3IM0A 4OHZA 1S0DA 3LDRA 1IGOA 3LKJA 4IE4A 1AXYA 2QQJA 4HKWA 4WM7A 4YGCA 1POV1 5EJ1B 3VV1A 5GZCA 2RR11 4IE7A 4Y1YA 4LITA 4IEQA 4QPIB 1BHGA 1OLMA 1QJY3 4JDNA 4UFIA 5LWBA 4OHVA 3KB5A 1C5IA 5T52A 1RUOA 4CDUC 1BKZA 3C2UA 3AJZA 2JJ6A 4AEDC 5C9AC 3AFKA 3E5XA 2JB8A 2FD8A 4O9GA 3POGA 4V2WA 1HN1A 4NIDA 5K8SA 4JQRA 1MS3A 2A1XA 2ZOEB 4XFBA 4ATEA 3IAQA 2XJTA 3LSDA 2WT2A 1F2NA 2XUMA 1HV1A 1HRV2 4IV3B 1YNAA 3ZFEB 3QOPA 4M3CB 5JZGA 1UY3A 3NV2A 4M3CF 2JB4A 3UESA 2CGNA 4PJYA 4HOOA 1IG3A 5JSPA 1H1IA 4KWUA 4NJ4A 4COUA 4GJYA 2C0ZA 2B39A 2W1SA 2VMGA 1W9WA 5I8SA 4YARA 4QX3A 5DXDA 4BQWA 1JZ3A 2XG3A 4C0HA 4GIQA 3USUB 3ZYPA 5JIUA 5LY2A 1GQGA 5I0RA 5LY1A 4XUPA 5JOZA 1U5XA 3JB4C 2WFF1 5FXWA 4RS5B 4B29A 5IAXA 1TNFA 3WSOA 1V0AA 1I6XA 5FYCA 1YEWA 2P3KA 4FFHA 1W8ZA 4JQTA 1C1LA 4FTBA 4HLTA 5K9YA 5FZFA 2VXRA 2ZAHA 4LA2A 3RQ0A 3VBHA 1SPPB 2Q8DA 1NCRB 2ET7A 4QXHA 5ACA3 3AZYA 2P3JA 2J1TA 3MLJA 5E16A 3ZN4A 3WNLA 5FP3A 1OOPC 3E5UA 1PK6C 3ZFGC 3D4KA 2JDKA 4DOUA 1NLRA 2IFWA 2AR6A 2PAEA 4XJZA 1LR5A 3UGFA 3WCRA 3ZXEA 2FDHA 5T5LA 4ET7A 4TLGA 2WZR2 1GQPA 2ID4A 1DGWA 1WMXA 1J3PA 4B4RA 1SBFA 1ULPA 2Q30A 3FMGA 2EF6A 4DO0A 5FZOB 1LEDA 3CJIC 3H50A 4J25A 3PJQA 3P3PA 2Z5WA 3ZXDA 4XZPA 1VBD2 3IDEA 3WDYA 1C57A 3PMSA 3ETQA 1TQ5A 4IXLA 2XJVA 3MF6A 1DYKA 1PO22 3AK0A 5H9QA 3H1WA 3ASIA 4L11A 4DXSA 2Y8KA 2HH9A 2JE8A 4KGQA 1GR3A 1X9TA 2UY9A 4NPLA 3JB8A 5CKQA 4XXPA 5D8AC 2CDPA 1HN0A 2NYYA 2YC4A 4GKYA 1UO9A 4LIVA 2BFUS 1RIRA 1RHI2 2HEWF 1RUI1 4NPMA 2VUAA 3N9OA 2RS52 1VB4A 3POEA 3QBQA 4MGSA 1HRV1 1VBA3 5E8AA 3SKVA 4CEWC 4IV3A 5CFDC 3ZFEA 1G9CA 1DQ6A 2PLV3 4DEVA 4H7LA 2PHWA 4QX7A 2GSYA 3WQ0A 2VMHA 3W5NA 5FZLA 2TNFA 2ZHLA 4BOWA 2B8MA 4RA0A 4I02A 1C8M2 3K4ZA 2HKXA 4D6RA 2ZKLA 5JXGA 3BOPA 2GC3A 1WA6X 5F5QA 2HWC3 2W9XA 3AC0A 3A0KA 3JD73 4O7XA 3WW4A 4E2GA 5D21A 4ZONA 1LHOA 4LK6A 4LO6B 4MGYE 4J1XA 3VBRB 1UY1A 2B7YA 3AKTA 4CE8A 4JGZA 3I3EA 3AZZA 1QXPA 3GHNA 5FMOL 2RJKA 2VTXJ 3POJA 1CQ9A 4FXKB 1QJX2 3VGIA 4UWDA 1UY0A 1PVXA 4EYUA 4YM2A 2HJIA 4FTEA 1AX0A 3FZ3A 1RMU2 1OPOA 1RUF2 2JG9B 2J1EA 4MLOA 3G6JB 4FPLA 5CYYA 2WL1A 2W3JA 3VHNA 3V0AA 1A8DA 3RDIA 4MO3M 2CWSA 2O8QA 3CL1A 3GJAA 4DUXA 2XJRA 4YG0A 5F3EA 1AXKA 3WINE 2G9ZA 5JWPA 1F5JA 2CNAA 1LB2A 5FMDA 3IAPA 2PAMA 1ZVFA 2WZR1 3LPGA 3AB0A 3TYJA 1GSLA 1NZIA 5JI9A 1RUC3 1W2AX 3LQCA 2J1VA 2CU5A 4UI9L 1YJLA 2XL7A 4R4ZA 5LA0A 1YWKA 3T3YA 5FZOA 4E2QA 2WNVC 5CKMA 1HQLA 1RJ7A 1D7PM 1ZZ6A 2EXKA 1VBD1 3PUAA 4BQ2A 5DAXA 1RUJ2 1SFYA 1W0OA 3AYAA 3PTYA 4HVOA 3U07A 1PO21 1NYWA 5GLUA
chains in the Genus database with same CATH topology
3I4IA 2N7GA 1N3OA 4BLIA 4GWNA 5J09A 3J8F2 3ATGA 1NZCA 2W39A 3FBYA 5CFCB 2DFBA 1RHI1 4HANA 1H1MA 2RS51 3WW3A 2WS93 3W58A 3ZN5A 4AVTA 1ASJ2 1RUG2 3M3QA 5JMCA 3CLPA 2DURA 1UPIA 4IV1C 4AG4A 5BYNA 1V6IA 4CYDA 2B45X 1C8M1 5D1IA 1ZZ7A 1NCQB 4PIXA 3HIFA 1ND2C 2WIIB 5I8YA 2BUKA 1NE4A 4BWOA 5KXCA 2QJVA 2DCYA 3VBRA 3TN92 3WZ1A 5CB7A 2JKBA 4BCUA 1QJX1 1Z0HA 1YXWA 1UU5A 1RMU1 4N53B 3DPRC 1ENRA 1RUF1 4Z82A 2DCJA 3J26N 4AEKA 2JG9A 5BNPC 1ZZ8A 4E27A 4AQSA 5SV5A 3KQRA 3WY6A 4PIYA 3MLLA 5BXXA 4CDWA 1D0HA 2D5HA 2GDFA 2LTNA 2ZPXA 3I59B 3D0JA 3W59A 2VH9A 2RS13 1OA2A 5LK7B 5J3UA 4AVAA 4BQ1A 3IT8A 3KCXA 1X50A 1GLHA 2ERFA 1B09A 2WA4A 4Q4W2 4MXWA 3MIFA 2F6BA 2IZWA 2JENA 4Q29A 1YUDA 2RMU2 5HCBA 2GU9A 1XRUA 1W6QA 4JVAA 4KU7A 2R16A 4LEJA 5BPXA 3S30A 1AL0G 1RHI3 2CY6A 5K0UB 5ABJB 1RUJ1 2CGPA 5FMOS 3VBFA 1OQ1A 5KHHA 3SCFA 3X29B 3ZFFA 4YW2A 4LT5A 3AMQA 2YHJA 3J8F1 1QF3A 5CIRA 3OBTA 4AEMA 3AMNA 1YJKA 1KFUL 4YNIA 1LOFC 1FX5A 3WG1A 3MIEA 1ASJ1 2V09A 3LWCA 5DG2A 1RUG1 1CAWB 1SDWA 2XLGA 4I09A 5E88A 3KS7A 3WG4A 1CGPA 4YVSA 4LBNA 2QFEA 1LU1A 1MS4A 2WC2A 4META 1Q5OA 4NHLA 2WNUC 1MEC2 2K0GA 3N7MA 3WHTA 5HBAA 1H4HA 1NCQA 4PCRA 4XF1A 4MUVA 5T5OA 5AC93 3KM5A 3GBFA 3MIDA 4PBOA 2GNMA 4XXAA 3K51A 5CU1A 5GZDA 4E4SA 1Q8QA 3WV6A 4XMAA 4RR3C 3TN91 3WX5A 5JIAA 1TMF2 5JSRA 1LULA 3ST7A 1G8WA 1MVQA 1V6JA 1YIPA 1DGLA 1QNWA 2QZ3A 1HRI2 2FHRA 2XJQA 3BTAA 1M06G 4N53A 2XJSA 4YW1A 4QQHA 4DFSA 3APBA 1BZWA 3IBMA 4WVVA 1JN2P 4UXAA 1FOD2 2AREA 3ZSEA 4MV2A 3SLIA 1ZZBA 3I59A 2PELA 1WBLA 1IOAA 2V5YA 5BV6A 1J59A 5T5PA 3ROUA 4OZXA 4Q4W1 1Z7S2 2ZGUA 2BVVA 5I0UA 2CAVA 4AXOA 1NG0A 4NN0A 4PDWA 2RMU1 4AHYA 3WG2A 1BVP1 4FPEA 1JW6A 3J8F3 3IPVA 4JC1A 2A3WA 1YLLA 5C4WA 4DMIA 2RHPA 4K3UA 4PLMA 5K0UA 5ABJA 3HT2A 2QUOA 3GZTB 2OIIA 5LRSA 3JQWA 5BNOB 2NMOA 5AVPA 1FNZA 3VBOC 4XMIA 2D3RA 5FLIA 5IK8A 1ALYA 1X82A 3J9SA 3Q9OA 3QCWA 2HWE3 5L7OA 5DG1A 3CU7A 4MGZE 3ZXFA 1BMV2 4P9IA 2SLIA 4N43B 1UX6A 5FTTC 2PAKA 1LGCA 2O1QA 2PTMA 1CAWA 1Q56A 3LSEA 4WM7C 2BEOA 2VUJA 1RGSA 1QKQA 2RS33 1MVEA 3LAGA 5GLZA 1MEC1 3DV8A 3ES1A 4MSVA 3NJZA 2FMYA 1QQP2 3DUIA 4PLNA 1G6NA 4GWMA 2GZWA 4XTPA 1R1A2 1UL9A 3B7MA 4GH4B 1TMF1 3ZVXA 2PN5A 3SITA 1VBC2 2C9AA 2E9QA 1ZZCA 3RI8A 5JZGC 4YG6A 4EN7B 1H8TA 4LA3A 1Q3EA 4C1XA 4Q1PA 4RSUA 4XJUA 2HYKA 1FI2A 5J7MA 1FOD1 2QCSB 2RMU3 2H0VA 3M3OA 3AXDA 1PO12 1WW5A 5JOYA 2XWBB 1B35B 1RUH3 4CEYB 1Z7S1 2DFCA 5BNQA 1PZ9A 2H0BA 4HETA 1IQAA 3ACLA 4XYXA 2DTWA 3VBHC 2XJPA 4AQ2A 1IKQA 3N4MA 3BPZA 3WP6A 3CJXA 1I9RA 3U0ZA 1JHNA 3KCCA 5BNOA 4NHKA 5H9PA 4DB5A 2GALA 4FOQA 3AX4A 4JRAA 4AFMA 1CJPA 2B46X 4V1PA 1LESA 1BMV1 3LZZA 4N43A 4DY5A 1BBT2 4HSLA 3KGLA 4DPNA 1GV9A 4D94A 2AZ5A 1AR93 4R9AA 1Z78A 4INDA 4XQ4A 3VKMA 4GULA 4DNYA 5BY5A 1VAMA 4J1WA 4KBBA 2HWB3 1QQP1 2OVUA 1E57A 3AXEA 1HRI3 4IEZA 1AF9A 1FPN3 4HKLA 4ASMB 3AMMA 3MEPA 4YFZA 1R1A1 3OD4A 1A6CA 4HVRA 2D5FA 1AXZA 3N7JA 1H30A 4YSFA 1VBC1 3MW2A 1TNRA 4GXLA 3HMYA 4AWDA 2K9ZA 3ZFEC 2XKOA 2DF7A 5J37A 3FLPA 1EAH3 3T1LA 4Y1VA 5JCTA 4D7SA 4Q1RA 4XQDA 5CAZA 4ZU5A 2X5IA 1RUD2 4XEZA 2BYVE 3B9IA 1QH6A 1H2MA 1PO11 4XF9A 2XGXA 5IT6A 4M01A 4XTMA 3UV9A 3FUQA 1B35A 4CEYA 1ZRCA 2GNTA 4F8AA 4NWWA 3WHUA 4Q4Y2 1KDKA 5GZGA 1WLCA 4JGZC 2YMZA 4Q4X3 1GZ9A 2NP0A 4Q0SA 4WVZA 4LBLA 1VRH2 3WQ7A 2DUPA 4XF4A 1WCDJ 3FLTA 4K40A 2RR12 1QWRA 1N3PA 1ZNPA 2ETEA 4URTA 2IXJA 2UYBA 3R4UA 1L3JA 3BB6A 3ILRA 1SBEA 1LHWA 4A3XA 3E6CC 5EFUA 4JGYC 4AVBA 1K5MB 1BBT1 5L19A 4Y24A 2CWMA 4AF9A 1UZZA 2GNDA 1UPSA 1QMJA 1EV13 2UWCA 1AL22 3NWKA 3HQXA 4LTAA 2DWRA 1OSGA 2IFRA 5DDJ2 3WDUA 5F1RA 1W39A 1WMFA 3L9JT 3RYPA 4AW7A 4SBVA 3ZYGA 3AM2A 3CO2A 4LE3A 1AR73 2XH6A 1G7YA 2PHXA 1HXS2 4LUMA 3QACA 3OYWB 4YVWB 2FQPA 3NAPA 1FAYA 4WM8A 2R49A 4EV0A 5I91A 4KG8A 2A6YA 2R063 1MQTA 1DZTA 4NVPA 4Q4V3 1RUD1 3P3NA 3ZN6B 5FDBA 1PVC3 4LO4B 3WW2A 3MW4A 1ZRDA 1PGSA 2AGSA 2BFUL 4K9SA 4Q4Y1 4AHWA 4XOGA 3USSA 3VBRC 4BIFA 3H7JA 1RVF2 1REFA 1ZX5A 4RHV3 2R041 3H1YA 5CVRA 1HLCA 4JTNA 1VRH1 5CG8A 2O0OA 3ZXGA 3R4DB 4I2OA 2JG9C 3LA2A 1AYN2 4E4ZA 2LALA 1X36A 5HI0A 1JYIA 1UN1A 1RTVA 4RFT0 2ZHMA 4ISQA 1SCRA 4CDWC 4UW4A 4C0BA 4XBQA 3WLUA 4AYUA 3V65A 1ZRRA 1W6OA 1LODA 4CDXA 1ND3B 1SLCA 4I30A 3VZLA 1ENSA 2XVGA 2LUWA 3JBG3 1K5MA 3PVNA 1XXNA 4YLZA 2VECA 5LRRA 1C3HA 2MEV2 5KHJA 4YW3A 3TNQA 1BVVA 2OPKA 1RUI2 3NKGA 4EN8B 2AH2A 3I8TA 3MF9A 3VBFC 1AL21 2AENA 1ZBE3 3MI8A 4ITCA 1JBCA 5IK5A 2WLQA 1D4M2 5DDJ1 3B01A 3ZFFC 4B7EA 5BNNA 2WQZC 1WA4A 2WT1A 1R092 1T6GC 4LLFA 4C90A 2VNGA 2BNOA 3M7AA 5HCFA 1CAUB 2VVFA 4IETA 1LEMA 4KWLA 4QT6A 1REEA 3AMPA 1O3SA 4GA9A 3N3HA 4FPJA 1HXS1 4OVEA 5EXOA 1G9FA 1MACA 3LGRA 3GHMA 1SBDA 5JPMB 4BIOA 4AI1A 4YVSC 1LTEA 2P34A 1H2NA 4WBBA 1V9U2 4S2GA 4EROA 4YZ4A 1DGRN 3WDVA 1NCQC 1C1FA 4DINB 1SLLA 3BOWA 2XBO3 5FRAA 1N1YA 3NKTA 3WT3A 5J48A 4HPKA 2QE3A 2HWF3 3SXWA 2WLPA 1RVF1 3KT7A 1XQNA 3AYCA 1IS4A 4EWAA 1AR62 5FREA 4FPYA 2OA2A 1POV3 2ZGNA 2RR13 1YRZA 4JRLA 1LOAA 2H6BA 1A78A 3ZYJB 4N53C 3GBGA 3KLSA 1IHMA 3RSJA 1AYN1 3HT1A 1WD4A 1FV2A 2ZGOA 3PVOA 2YYOA 2YUEA 3ZYRA 1QJU2 1GYKA 3DKWA 4HFSA 3UK9A 1NOVA 1QOSA 1XYNA 4AI0A 4L99A 4QPIA 4HT1T 1NQDA 2ZGPA 1ND3A 4IQPA 3ZDSA 1BYHA 3VKOA 4LE4A 4PDWC 1DU3D 2PHFA 2XL9A 2MEV1 1DYPA 2YROA 3B00A 4XFHA 3RRDA 1U0AA 5C4WC 5K0UC 2LM3A 4FPHA 5E1RA 1VJ2A 4MZUA 4M3CA 3DF0A 4LHKA 1D4M1 2ARBA 4G9SB 3ZMOA 2WFF3 4DXZA 3HD8B 5CADA 3WP3A 3FHIB 1UZYA 1QOOA 1R091 4BMEA 2XHKA 1CAUA 4GALA 5L7OC 1DQ0A 3KMHA 4XJWA 5EYXA 3USUA 1PMIA 3UKVA 3ZXAC 1CPNA 3VDDB 3ZXKA 2GH2A 4MXVA 2QVSB 4RS5A 3WCSA 3NO8A 5KXEA 3RG0A 4JDOA 3WVJA 3VHOA 1REDA 2QQPA 1CONA 1V9U1 4XIOA 1CX4A 2DVDA 1MZFA 2XLFA 4XILA 2CYFA 2A3YA 2RM22 2DYCA 2ZHNA 3TOJA 2Q5TA 5JOXA 4AQ6A 1O91A 1UIJA 4XPVA 1WLDA 1LGBA 2EALA 3HN1A 4BZ4A 5GZEA 3SH4A 2A71A 4Q0UA 3MZHA 3TB0A 1NCRA 5T3NA 4AGRA 1AR61 4KU8A 1SMVA 5I8TA 1JUIA 4LHLA 1DBNA 1KD7A 5JLVA 2WKKA 1H8TC 4YZ3A 4HVQA 4NWVA 3O0XA 3VBSB 3VHRA 3H0OA 4AI3A 2HEVF 2QDNA 1COV2 1TME2 4AGGA 1R082 1QJU1 3O7OA 1AR82 2MEV3 2VOVA 5SV8A 3FFQA 1RUI3 3AKPA 4D3WA 1HRV3 2Q0AA 4Y1ZA 1GNHA 4B4QA 4KG0A 4UBGA 3MPPG 3AYEA 3GZUC 4CDUB 4AEDB 5C9AB 1AHSA 3MIBA 4RGAA 1WD3A 2GH8A 2PYTA 1LU2A 1VBE2 3D0SA 3R0RA 3M4FA 1WLTA 2ZGMA 2XB6C 3VBUC 1GICA 3I54A 2DCZA 4LO5B 3POYA 1JYCA 5FO9B 3AMHA 1ZYBA 4H55A 4ORFA 2C1FA 4ZKTB 1PIV2 1GNZA 5DZEA 2ILMA 4AGVA 2ZS6B 4XFAA 4N43C 1LECA 4IEXA 4COYA 4I3GA 4X6RB 3UKTA 2ZX1A 1ENQA 1G9BA 2IXIA 3ECQA 3O5SA 1ZBA2 2X29A 1LOCA 3OCPA 2JDZA 2RM21 4HSJA 5GJ6A 3EJKA 2A6ZA 4BE3A 2BNNA 3HAGA 1O3TA 2DUOA 3V56A 1AYM2 2WZR3 2F4PA 4K8FA 2D93A 1KJLA 1HX6A 4MGIE 2C5DA 1H9WA 2O8OA 1WBFA 4XQWA 2ZACA 4W6YA 5J36A 3T1MA 1QJU3 2ZGKA 4GMP1 5KC6A 1VBD3 1PK6B 3OTFA 1X33A 3O0VA 2PHRA 1OD5A 5L36A 1LRHA 3VBSA 1PO23 4O9EA 2IXCA 1COV1 1TME1 1O4YA 3VZMA 2X5IC 2A5ZA 4AHXA 1R081 2I45A 2TUNA 4LO7A 4YM0A 1AR81 1WGPA 4JDMA 2TBVA 2SBAA 1SEFA 4LBQD 2RS53 1S2KA 4XBLA 4FVVA 1I5ZA 2YZ4A 4CEYC 4PF5A 4H3WA 1AVBA 5EWSA 5AFEA 4MGKE 5J98B 2Z42A 1MS5A 5CFCA 4Q2FA 1C8M3 1AZDA 2KA3A 2OUJA 5D8AB 1OLRA 2BPA2 1M4WA 1VBE1 4RQPB 1RB8G 4J6GA 5A3MA 3WDWA 3FWEA 2VW2A 4Z1VA 4CEWB 2RE9A 2QDRA 3O0WA 2OUHA 5CFDB 3THPA 1KDMA 4TYSA 1G9DA 2BNMA 4N7UA 1X7NA 1QJX3 3IIAA 5F6KA 5LEKA 1YFWA 1PIV1 3D82A 3AFGA 1RMU3 2DCKA 4FPGA 2JE7A 1VAKA 4FPCA 1NA1B 1RUF3 2DUQA 2KXLA 4JV4A 1V6MA 4HK8A 5FQ0B 4YW5A 5EV7A 1ZBA1 1QGLA 3RZZA 4FSJA 2D6KA 3N7LA 1CAVB 4YM3A 2ZGTA 3LA3A 5JR7B 3M3IA 1AYM1 4C1WA 1UW8A 1C5HA 3A4UA 5LEJA 4QQLA 3AKRA 3AYDA 1Q8PA 1QDCA 2WQ4A 1F5FA 1F9KA 2Q8OA 2Z69A 3NAPC 1PK6A 1RUJ3 4GB32 4WM8C 4KQ7A 4R4XA 1MQTC 1TEIA 3SNMA 2VPVA 2ZABA 4COWA 3RPQA 2XPJA 1VALA 4WVWA 4BH9A 4QGMA 2IXKA 2WNVB 5JOWA 4AI8A 3UJOA 1VBE3 3AP9A 1MZEA 3RWNA 5C8CC 2XWJB 4TWTA 1ASJ3 4F3JA 1RUG3 3OGGA 4HN1A 4DY3A 2D6MA 1UCXA 2DTYA 1A8MA 4WV8A 1WMEA 1YIFA 4LBMA 3WUDA 1PM7A 2BWCA 1U5YA 5FLHA 3N36A 4RQPA 3ZSMA 4L97A 5FPZA 1S55A 4XHXA 2JECA 1BK1A 4X8PA 2GNBA 2R6QA 3RJ2X 3TN93 3UL2A 4Q26A 1DZRA 1FV3A 3BCWA 1VBB2 1OQDA 1HW5A 1OFSA 4CDXC 5C33A 3L2HA 1NA1A 3D5OA 1K5MC 1D2QA 1ND2B 1SLTA 2NMNA 3EBRA 4TLFA 2ZZQA 3BU7A 5FQ0A 1X8MA 4Z92B 3BALA 5KHIA 4FT8A 1CAVA 1MR5A 3M3CA 2A75A 5BUVA 4YGEA 4ATFA 3IKWA 4YM1A 2D3PA 4RL7A 1PNGA 4Q4W3 5BNNC 4Y5Z0 3ZO0B 4NPRA 3DPRB 4AHZA 1WW7A 1Q8VA 4DQAA 5FOBB 3KCYA 3RMYA 1SACA 1CJDA 1RINA 2ZX2A 1RC6A 2MPFA 4WVMB 3I7DA 4OHWA 4GB31 1G9AA 3B3QE 2XKPA 2IXHA 2V73A 3SH3A 1H8VA 1J1TA 3H3ZA 4LBKA 3NV3A 1N3QA 3ZMNA 4B3NA 4EN0A 1JH5A 1UMZA 1KRIA 1CN1A 2GAUA 2A3XA 5A32B 3RYRA 1RUE2 2EA7A 4QPGB 3AP4A 2G9FA 4YZ1A 3GALA 3HR9A 2VQAA 2ARXA 2WINB 1LCLA 2Q1MA 3M1HA 1MEC3 4H7MA 1QXRA 3KZ4C 1ONAA 2W0XA 4XHBA 3WP4A 1UU4A 5I0SA 4TSVA 1BCXA 4QMAA 3VKNA 2NN8A 2TEPA 4XFFA 3GZAA 4U2AA 1Y3TA 4IESA 1FT9A 1TMF3 1N1VA 4KH9A 4QPIC 3MW3A 1VBB1 1UKGA 5AVAA 4BM8A 3VLBB 1ND3C 2X8KA 4M0NA 3ZXJA 1W6NB 2D44A 4XF3A 5IUQA 3LOBA 2X53S 3N35A 4UW3A 1EP0A 1XE8A 2ZBJA 1FOD3 2D98A 5T54A 4GH4A 3MGUA 1SLIA 2P17A 3SCHA 4RR3B 3POSA 3T2TA 5K7PA 3EHKA 4IV3C 4Z07A 3RI9A 1QJZA 1OKQA 1QJY2 4AFCA 1Z7S3 3WP5A 1QHDA 4QQPA 3DPRA 3L2YA 3E6BA 1PZ8A 4E2SA 4CZSA 4P9WA 4QQ2A 3OGJA 3QLQA 2VMIA 4OULA 2R071 3WQ1A 3NV4A 4YW4A 5C6CA 4WVMA 2NPIA 1TE1B 3NV1A 4RS5C 4I0AA 2Y26A 1Q8SA 5CG9A 1KJRA 3ZSJA 2A7AA 1GZCA 2R042 5B2GB 2WWSA 3AKSA 4QM9A 1GFF2 5H9SA 1C8NA 4AK3A 3WXPA 3M3EA 5A3LA 1RUE1 1NCRC 1U5IA 2WFPA 4QPGA 1V6LA 4NO4A 4FOYA 1ULEA 1DIWA 4FPKA 1RL3A 1RITA 2DU0A 2NZ9A 2NLRA 2FBEA 1XYPA 3BODA 5I0TA 3HWJA 2ZGSA 2ATFA 4YZ2A 1O4TA 4XFGA 3VBOB 1CD3G 1QQP3 1S2BA 2E6VA 2R1BA 4BPZA 2OZJA 4ZU7A 5E89A 1R1A3 3V0BB 4PQ9A 5ACA2 1OFNA 2D7FA 1DGRA 2VGDA 1MS8A 2CL2A 4YG3A 4WM7B 1VBC3 1QDOA 2EAAA 3H3UA 2IWGB 4KL1A 1WCSA 2A6WA 1IPKA 1S0EA 1CR7A 5JI7A 4QXKA 4OI2A 5T50A 1OHFA 1VP6A 1BQPA 4DRRA 1PO13 1DFQA 4B8EA 1J3QA 2DVAA 3I2DA 2XVLA 1QJY1 2GMPA 3KD4A 5JZGB 3CEWA 1DF0A 3URFA 3B9CA 1QNYA 4HL0A 1EYBA 1XNDA 4IEPA 3TAYA 4YZ5A 4OI4A 4A2UA 4QPYA 4P9JA 1SLBA 1VBA2 3NVCA 4WZCA 1YI7A 3E6DA 2PLV2 3QD6A 1LOBA 3FJSA 3ZXLA 1GKBA 3FFZA 3EXUA 2HWC2 3AJYA 3JD72 4Y20B 3VBHB 1BBT3 3H7YA 4I0WB 5GLVA 3WW1A 4K21A 4D69A 1PGW1 4ISRA 1Y7BA 3D8CA 2EXIA 4W6XA 4HZFA 2WT0A 5DZGA 2B5HA 3VBSC 2JG8B 4ES8A 2E51A 2MNGA 4P9LA 2B9UA 2E7AA 5FCCA 2AUYA 4AQTA 2YDEA 5ACA1 4TZDA 2DV9A 3VUOA 3JZVA 4LR4A 1WMDA