1YGKA

Crystal structure of pyridoxal kinase in complex with roscovitine and derivatives
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
309
structure length
309
Chain Sequence
ECRVLSIQSHVVRGYVGNRAATFPLQVLGFEVDAVNSVQFSNHTGYSHWKGQVLNSDELQELYDGLKLNHVNQYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVMGDQRNGEGAMYVPDDLLPVYREKVVPVADIITPNQFEAELLTGRKIHSQEEALEVMDMLHSMGPDTVVITSSNLLSPRGSDYLMALGSQRTRAPDGSVVTQRIRMEMHKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSAMHHVLQRTIKCAKAKSGEGVKPSPAQLELRMVQSKKDIESPEIVVQATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of pyridoxal kinase in complex with roscovitine and derivatives
pubmed doi rcsb
molecule tags Transferase
molecule keywords Pyridoxal kinase
total genus 82
structure length 309
sequence length 309
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2005-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 1ygkA00
3UQEA 5C3YA 2NWHA 3GO6A 3RQ2A 3LKIA 3NL6A 4YWRA 3RTAA 1JXIA 5TQIA 3RM5A 1LIIA 1JXHA 1LIKA 3H74A 3NM3A 4C5NA 2YXUA 5EYNA 3LJSA 1V1AA 5C40A 3HYOA 1RFVA 3RTDA 2A9ZA 3K5WA 3RTCA 3FHXA 2AA0A 3LHXA 2JGVA 2QCVA 4O1GA 3RQ5A 3UMOA 3MBJA 3DRWA 5BYFA 4JKSA 2Q5RA 4N09A 5CM5A 4E3AA 3RPHA 4LBXA 4EOHA 4C5JA 1EKKA 4K9IA 2AJRA 3IE7A 2RBCA 5CGAA 3NL3A 4GM6A 3DZVA 3B1RA 3NBVA 4YL5A 3RREA 4C5LA 3PL2A 4E8ZA 2AB8A 4X8FA 2XTBA 2DDWA 3RPZA 3RSQA 3IQ0A 3B3LA 2YXTA 1ESJA 2R3BA 3RS9A 1TYYA 4K8CA 3RSSA 3RT7A 2DDMA 3KEUA 4PVVA 3KTNA 1RFTA 3K9EA 4U7XA 1BX4A 4K93A 3RY7A 4LBGA 1VK4A 3N1CA 3GO7A 3PZSA 1YGKA 4XCKA 3IBQA 4S1MA 5BYCA 3IN1A 1TZ6A 4LC4A 3RU2A 3VASA 3ZS7A 3B1QA 3RTEA 1LHRA 3Q92A 2ABSA 3GBUA 2AX3A 1UB0A 2R3EA 1YGJA 3HPDA 4K8TA 5BYDA 3BGKA 3NL2A 2I5BA 3Q1YA 3RSGA 5COJA 3CQDA 5C41A 2C49A 3RU3A 3H49A 3NM1A 2AWDA 5B6AA 3RQ8A 3RTGA 2QHPA 2I6AA 3UMPA 3OTXA 3LOOA 3UQ6A 1DGMA 2PKMA 3NC2A 5TRWA 4XF7A 1WYEA 2DCNA 3RS8A 4XDAA 4DC3A 3RQXA 3BF5A 4S1HA 4KALA 3B1PA 4XF6A 3JULA 1V1BA 2AFBA 1VM7A 1LIJA 3IH0A 1GC5A 4WJMA 4E69A 4S1IA 4E84A 1RFUA 2C4EA 3RT9A 1UA4A 4UBEA 3W4SA 5EY7A 3HICA 4EN4A 3RQ6A 2V78A 3NBWA 1YHJA 2HQQA 2HW1A 4KANA 1RKSA 4KBEA 1L2LA 4N08A 3QAIA 4E8WA 1EKQA 2PKNA 5BYEA 4K8KA 3RRBA 3RO4A 2PKKA 3NC9A 2AJPA 5CGEA 1VI9A 3I3YA 1RKDA 2HLZA 3RTBA 2ABQA 1KYHA 3RQQA 4KADA 4O1LA 3QA2A 4DU5A 2JG1A 1GQTA 4EUMA 3FHYA 4K8PA 1TZ3A 1TD2A 2FV7A 3IKHA 4S1IB 3MBHA 4C5MA 4LCAA 2A9YA 4E8YA 4EBUA 3RRFA 3UBOA 2I6BA 3KZHA 2PKFA 2F02A 3RRJA 2DDOA 2VARA 4B8RA 2F7KA 4C5KA 3B1NA 1RKAA 2JG5A 3RQHA 5C3ZA 3UQDA 1ESQA 3NCAA 3VAQA 1V1SA 3RSFA 4JJPA 1U2XA 3KD6A 4JKUA 5F11A 1RK2A 1V19A 4B8SA 4K9CA 3B1OA 3EWMA 5F0ZA 3UQ9A 3NL5A 1LIOA 1C3QA 4KAHA 1LHPA
chains in the Genus database with same CATH superfamily
3UQEA 5C3YA 3QCZA 2NWHA 3GO6A 3RQ2A 3LKIA 2WJPA 3NL6A 4YWRA 1JXIA 5TQIA 3RM5A 1LIIA 1JXHA 1LIKA 3H74A 3NM3A 4C5NA 2YXUA 5EYNA 3LJSA 1V1AA 5C40A 3HYOA 1RFVA 2GC5A 4C13A 3RTDA 2A9ZA 3K5WA 3RTCA 3FHXA 2AA0A 3LHXA 2JGVA 2QCVA 4O1GA 3RQ5A 3UMOA 3MBJA 3DRWA 4UAGA 5BYFA 2JFFA 4BUCA 1E0DA 4JKSA 4KANA 2Q5RA 4N09A 5CM5A 2F00A 4E3AA 3RPHA 4LBXA 4E8WA 4EOHA 4C5JA 1EKKA 4K9IA 2AJRA 3IE7A 2RBCA 2GCBA 3HN7A 2VTDA 5CGAA 3NL3A 2Y67A 4GM6A 3DZVA 3B1RA 3NBVA 2Y68A 4YL5A 2GCAA 3EAGA 3PL2A 3RREA 4C5LA 4CVLA 4E8ZA 2AB8A 4X8FA 2XJAA 4K8TA 2XTBA 2DDWA 3RPZA 3RSQA 3IQ0A 3B3LA 2YXTA 1ESJA 1JBVA 2R3BA 3RS9A 1TYYA 4K8CA 4QDIA 2WTZA 3RSSA 3RT7A 2DDMA 3KEUA 1W78A 4PVVA 3KTNA 1RFTA 3K9EA 1EEHA 1BX4A 4K93A 1P31A 4U7XA 4LBGA 3RY7A 1VK4A 3N1CA 3GO7A 3PZSA 1YGKA 4XCKA 3IBQA 2UUOA 4S1MA 3IN1A 3ZM5A 1TZ6A 4LC4A 3RU2A 4BUBA 5BYCA 3VASA 3ZS7A 3B1QA 3RTEA 5A5FA 1LHRA 3Q92A 2ABSA 3GBUA 2AX3A 1J6UA 1UB0A 1YGJA 2R3EA 2Y1OA 3HPDA 1GQYA 1UAGA 4CVMA 3BGKA 3NL2A 2I5BA 3Q1YA 3RSGA 5COJA 3CQDA 5C41A 3NRSA 2C49A 2X5OA 3RU3A 3H49A 3NM1A 3LK7A 2AWDA 5B6AA 2GC6A 3RQ8A 1E8CA 3UQ9A 3RTGA 2QHPA 2XPCA 2I6AA 3UMPA 3OTXA 3LOOA 1W7KA 1DGMA 2PKMA 3NC2A 3UQ6A 5TRWA 4XF7A 4HV4A 1WYEA 2DCNA 3RS8A 4XDAA 4DC3A 3RQXA 3BF5A 4S1HA 4KALA 3B1PA 4XF6A 3JULA 1V1BA 2AFBA 1VM7A 3UAGA 1LIJA 3IH0A 1GC5A 4WJMA 4E69A 2AM1A 4S1IA 3ZM6A 4E84A 1RFUA 2C4EA 3RT9A 1UA4A 2JFGA 4UBEA 3W4SA 5EY7A 3HICA 4EN4A 3RQ6A 2V78A 3NBWA 1YHJA 2HQQA 2HW1A 1JBWA 1RKSA 2JFHA 4KBEA 1GG4A 1L2LA 3QAIA 4N08A 3HJ6A 1EKQA 2PKNA 4QF5A 4K8KA 3RRBA 5BYEA 3RO4A 2PKKA 2UAGA 1GQQA 2AJPA 3NC9A 5CGEA 1VI9A 3I3YA 1RKDA 2HLZA 3RTBA 2ABQA 1KYHA 3RQQA 4KADA 2AM2A 4O1LA 3QA2A 5A5EA 4DU5A 2JG1A 1GQTA 4EUMA 3N2AA 3FHYA 4K8PA 1TZ3A 1TD2A 2FV7A 3IKHA 4S1IB 3MBHA 4C5MA 4LCAA 2A9YA 1P3DA 2VORA 4E8YA 4EBUA 3RRFA 5BYDA 3UBOA 2I6BA 3KZHA 2PKFA 2VOSA 2F02A 4ZIYA 3RRJA 2DDOA 2VARA 4B8RA 2F7KA 4C5KA 3B1NA 1RKAA 2JG5A 3RQHA 4CVKA 5C3ZA 2UUPA 1ESQA 3NCAA 3VAQA 3UQDA 3PYZA 1V1SA 3RSFA 3ZL8A 4C12A 4JJPA 1U2XA 2Y66A 3KD6A 4JKUA 1FGSA 1RK2A 5F11A 1V19A 4B8SA 1O5ZA 4K9CA 3B1OA 3EWMA 3RTAA 5F0ZA 2VTEA 3NL5A 1LIOA 1C3QA 4KAHA 1LHPA
chains in the Genus database with same CATH topology
3UQEA 5C3YA 2NWHA 3GO6A 3RQ2A 3LKIA 3NL6A 4YWRA 3RTAA 1JXIA 5TQIA 3RM5A 1LIIA 1JXHA 1LIKA 3H74A 3NM3A 4C5NA 2YXUA 5EYNA 3LJSA 1V1AA 5C40A 3HYOA 1RFVA 3RTDA 2A9ZA 3K5WA 3RTCA 3FHXA 2AA0A 3LHXA 2JGVA 2QCVA 4O1GA 3RQ5A 3UMOA 3MBJA 3DRWA 5BYFA 4JKSA 2Q5RA 4N09A 5CM5A 4E3AA 3RPHA 4LBXA 4EOHA 4C5JA 1EKKA 4K9IA 2AJRA 3IE7A 2RBCA 5CGAA 3NL3A 4GM6A 3DZVA 3B1RA 3NBVA 4YL5A 3RREA 4C5LA 3PL2A 4E8ZA 2AB8A 4X8FA 2XTBA 2DDWA 3RPZA 3RSQA 3IQ0A 3B3LA 2YXTA 1ESJA 2R3BA 3RS9A 1TYYA 4K8CA 3RSSA 3RT7A 2DDMA 3KEUA 4PVVA 3KTNA 1RFTA 3K9EA 4U7XA 1BX4A 4K93A 3RY7A 4LBGA 1VK4A 3N1CA 3GO7A 3PZSA 1YGKA 4XCKA 3IBQA 4S1MA 5BYCA 3IN1A 1TZ6A 4LC4A 3RU2A 3VASA 3ZS7A 3B1QA 3RTEA 1LHRA 3Q92A 2ABSA 3GBUA 2AX3A 1UB0A 2R3EA 1YGJA 3HPDA 4K8TA 5BYDA 3BGKA 3NL2A 2I5BA 3Q1YA 3RSGA 5COJA 3CQDA 5C41A 2C49A 3RU3A 3H49A 3NM1A 2AWDA 5B6AA 3RQ8A 3RTGA 2QHPA 2I6AA 3UMPA 3OTXA 3LOOA 3UQ6A 1DGMA 2PKMA 3NC2A 5TRWA 4XF7A 1WYEA 2DCNA 3RS8A 4XDAA 4DC3A 3RQXA 3BF5A 4S1HA 4KALA 3B1PA 4XF6A 3JULA 1V1BA 2AFBA 1VM7A 1LIJA 3IH0A 1GC5A 4WJMA 4E69A 4S1IA 4E84A 1RFUA 2C4EA 3RT9A 1UA4A 4UBEA 3W4SA 5EY7A 3HICA 4EN4A 3RQ6A 2V78A 3NBWA 1YHJA 2HQQA 2HW1A 4KANA 1RKSA 4KBEA 1L2LA 4N08A 3QAIA 4E8WA 3HJ6A 1EKQA 2PKNA 5BYEA 4K8KA 3RRBA 3RO4A 2PKKA 3NC9A 2AJPA 5CGEA 1VI9A 3I3YA 1RKDA 2HLZA 3RTBA 2ABQA 1KYHA 3RQQA 4KADA 4O1LA 3QA2A 4DU5A 2JG1A 1GQTA 4EUMA 3FHYA 4K8PA 1TZ3A 1TD2A 2FV7A 3IKHA 4S1IB 3MBHA 4C5MA 4LCAA 2A9YA 4E8YA 4EBUA 3RRFA 3UBOA 2I6BA 3KZHA 2PKFA 2F02A 3RRJA 2DDOA 2VARA 4B8RA 2F7KA 4C5KA 3B1NA 1RKAA 2JG5A 3RQHA 5C3ZA 3UQDA 1ESQA 3NCAA 3VAQA 1V1SA 3RSFA 4JJPA 1U2XA 3KD6A 4JKUA 5F11A 1RK2A 1V19A 4B8SA 4K9CA 3B1OA 3EWMA 5F0ZA 3UQ9A 3NL5A 1LIOA 1C3QA 4KAHA 1LHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQE A;  5C3Y A;  2NWH A;  3GO6 A;  3RQ2 A;  3LKI A;  3NL6 A;  4YWR A;  3RTA A;  1JXI A;  5TQI A;  3RM5 A;  1LII A;  1JXH A;  1LIK A;  3H74 A;  3NM3 A;  4C5N A;  2YXU A;  5EYN A;  3LJS A;  1V1A A;  5C40 A;  3HYO A;  1RFV A;  3RTD A;  2A9Z A;  3K5W A;  3RTC A;  3FHX A;  2AA0 A;  3LHX A;  2JGV A;  2QCV A;  4O1G A;  3RQ5 A;  3UMO A;  3MBJ A;  3DRW A;  5BYF A;  4JKS A;  2Q5R A;  4N09 A;  5CM5 A;  4E3A A;  3RPH A;  4LBX A;  4EOH A;  4C5J A;  1EKK A;  4K9I A;  2AJR A;  3IE7 A;  2RBC A;  5CGA A;  3NL3 A;  4GM6 A;  3DZV A;  3B1R A;  3NBV A;  4YL5 A;  3RRE A;  4C5L A;  3PL2 A;  4E8Z A;  2AB8 A;  4X8F A;  2XTB A;  2DDW A;  3RPZ A;  3RSQ A;  3IQ0 A;  3B3L A;  2YXT A;  1ESJ A;  2R3B A;  3RS9 A;  1TYY A;  4K8C A;  3RSS A;  3RT7 A;  2DDM A;  3KEU A;  4PVV A;  3KTN A;  1RFT A;  3K9E A;  4U7X A;  1BX4 A;  4K93 A;  3RY7 A;  4LBG A;  1VK4 A;  3N1C A;  3GO7 A;  3PZS A;  1YGK A;  4XCK A;  3IBQ A;  4S1M A;  5BYC A;  3IN1 A;  1TZ6 A;  4LC4 A;  3RU2 A;  3VAS A;  3ZS7 A;  3B1Q A;  3RTE A;  1LHR A;  3Q92 A;  2ABS A;  3GBU A;  2AX3 A;  1UB0 A;  2R3E A;  1YGJ A;  3HPD A;  4K8T A;  5BYD A;  3BGK A;  3NL2 A;  2I5B A;  3Q1Y A;  3RSG A;  5COJ A;  3CQD A;  5C41 A;  2C49 A;  3RU3 A;  3H49 A;  3NM1 A;  2AWD A;  5B6A A;  3RQ8 A;  3RTG A;  2QHP A;  2I6A A;  3UMP A;  3OTX A;  3LOO A;  3UQ6 A;  1DGM A;  2PKM A;  3NC2 A;  5TRW A;  4XF7 A;  1WYE A;  2DCN A;  3RS8 A;  4XDA A;  4DC3 A;  3RQX A;  3BF5 A;  4S1H A;  4KAL A;  3B1P A;  4XF6 A;  3JUL A;  1V1B A;  2AFB A;  1VM7 A;  1LIJ A;  3IH0 A;  1GC5 A;  4WJM A;  4E69 A;  4S1I A;  4E84 A;  1RFU A;  2C4E A;  3RT9 A;  1UA4 A;  4UBE A;  3W4S A;  5EY7 A;  3HIC A;  4EN4 A;  3RQ6 A;  2V78 A;  3NBW A;  1YHJ A;  2HQQ A;  2HW1 A;  4KAN A;  1RKS A;  4KBE A;  1L2L A;  4N08 A;  3QAI A;  4E8W A;  1EKQ A;  2PKN A;  5BYE A;  4K8K A;  3RRB A;  3RO4 A;  2PKK A;  3NC9 A;  2AJP A;  5CGE A;  1VI9 A;  3I3Y A;  1RKD A;  2HLZ A;  3RTB A;  2ABQ A;  1KYH A;  3RQQ A;  4KAD A;  4O1L A;  3QA2 A;  4DU5 A;  2JG1 A;  1GQT A;  4EUM A;  3FHY A;  4K8P A;  1TZ3 A;  1TD2 A;  2FV7 A;  3IKH A;  4S1I B;  3MBH A;  4C5M A;  4LCA A;  2A9Y A;  4E8Y A;  4EBU A;  3RRF A;  3UBO A;  2I6B A;  3KZH A;  2PKF A;  2F02 A;  3RRJ A;  2DDO A;  2VAR A;  4B8R A;  2F7K A;  4C5K A;  3B1N A;  1RKA A;  2JG5 A;  3RQH A;  5C3Z A;  3UQD A;  1ESQ A;  3NCA A;  3VAQ A;  1V1S A;  3RSF A;  4JJP A;  1U2X A;  3KD6 A;  4JKU A;  5F11 A;  1RK2 A;  1V19 A;  4B8S A;  4K9C A;  3B1O A;  3EWM A;  5F0Z A;  3UQ9 A;  3NL5 A;  1LIO A;  1C3Q A;  4KAH A;  1LHP A; 
#chains in the Genus database with same CATH topology
 3UQE A;  5C3Y A;  3QCZ A;  2NWH A;  3GO6 A;  3RQ2 A;  3LKI A;  2WJP A;  3NL6 A;  4YWR A;  1JXI A;  5TQI A;  3RM5 A;  1LII A;  1JXH A;  1LIK A;  3H74 A;  3NM3 A;  4C5N A;  2YXU A;  5EYN A;  3LJS A;  1V1A A;  5C40 A;  3HYO A;  1RFV A;  2GC5 A;  4C13 A;  3RTD A;  2A9Z A;  3K5W A;  3RTC A;  3FHX A;  2AA0 A;  3LHX A;  2JGV A;  2QCV A;  4O1G A;  3RQ5 A;  3UMO A;  3MBJ A;  3DRW A;  4UAG A;  5BYF A;  2JFF A;  4BUC A;  1E0D A;  4JKS A;  4KAN A;  2Q5R A;  4N09 A;  5CM5 A;  2F00 A;  4E3A A;  3RPH A;  4LBX A;  4E8W A;  4EOH A;  4C5J A;  1EKK A;  4K9I A;  2AJR A;  3IE7 A;  2RBC A;  2GCB A;  3HN7 A;  2VTD A;  5CGA A;  3NL3 A;  2Y67 A;  4GM6 A;  3DZV A;  3B1R A;  3NBV A;  2Y68 A;  4YL5 A;  2GCA A;  3EAG A;  3PL2 A;  3RRE A;  4C5L A;  4CVL A;  4E8Z A;  2AB8 A;  4X8F A;  2XJA A;  4K8T A;  2XTB A;  2DDW A;  3RPZ A;  3RSQ A;  3IQ0 A;  3B3L A;  2YXT A;  1ESJ A;  1JBV A;  2R3B A;  3RS9 A;  1TYY A;  4K8C A;  4QDI A;  2WTZ A;  3RSS A;  3RT7 A;  2DDM A;  3KEU A;  1W78 A;  4PVV A;  3KTN A;  1RFT A;  3K9E A;  1EEH A;  1BX4 A;  4K93 A;  1P31 A;  4U7X A;  4LBG A;  3RY7 A;  1VK4 A;  3N1C A;  3GO7 A;  3PZS A;  1YGK A;  4XCK A;  3IBQ A;  2UUO A;  4S1M A;  3IN1 A;  3ZM5 A;  1TZ6 A;  4LC4 A;  3RU2 A;  4BUB A;  5BYC A;  3VAS A;  3ZS7 A;  3B1Q A;  3RTE A;  5A5F A;  1LHR A;  3Q92 A;  2ABS A;  3GBU A;  2AX3 A;  1J6U A;  1UB0 A;  1YGJ A;  2R3E A;  2Y1O A;  3HPD A;  1GQY A;  1UAG A;  4CVM A;  3BGK A;  3NL2 A;  2I5B A;  3Q1Y A;  3RSG A;  5COJ A;  3CQD A;  5C41 A;  3NRS A;  2C49 A;  2X5O A;  3RU3 A;  3H49 A;  3NM1 A;  3LK7 A;  2AWD A;  5B6A A;  2GC6 A;  3RQ8 A;  1E8C A;  3UQ9 A;  3RTG A;  2QHP A;  2XPC A;  2I6A A;  3UMP A;  3OTX A;  3LOO A;  1W7K A;  1DGM A;  2PKM A;  3NC2 A;  3UQ6 A;  5TRW A;  4XF7 A;  4HV4 A;  1WYE A;  2DCN A;  3RS8 A;  4XDA A;  4DC3 A;  3RQX A;  3BF5 A;  4S1H A;  4KAL A;  3B1P A;  4XF6 A;  3JUL A;  1V1B A;  2AFB A;  1VM7 A;  3UAG A;  1LIJ A;  3IH0 A;  1GC5 A;  4WJM A;  4E69 A;  2AM1 A;  4S1I A;  3ZM6 A;  4E84 A;  1RFU A;  2C4E A;  3RT9 A;  1UA4 A;  2JFG A;  4UBE A;  3W4S A;  5EY7 A;  3HIC A;  4EN4 A;  3RQ6 A;  2V78 A;  3NBW A;  1YHJ A;  2HQQ A;  2HW1 A;  1JBW A;  1RKS A;  2JFH A;  4KBE A;  1GG4 A;  1L2L A;  3QAI A;  4N08 A;  3HJ6 A;  1EKQ A;  2PKN A;  4QF5 A;  4K8K A;  3RRB A;  5BYE A;  3RO4 A;  2PKK A;  2UAG A;  1GQQ A;  2AJP A;  3NC9 A;  5CGE A;  1VI9 A;  3I3Y A;  1RKD A;  2HLZ A;  3RTB A;  2ABQ A;  1KYH A;  3RQQ A;  4KAD A;  2AM2 A;  4O1L A;  3QA2 A;  5A5E A;  4DU5 A;  2JG1 A;  1GQT A;  4EUM A;  3N2A A;  3FHY A;  4K8P A;  1TZ3 A;  1TD2 A;  2FV7 A;  3IKH A;  4S1I B;  3MBH A;  4C5M A;  4LCA A;  2A9Y A;  1P3D A;  2VOR A;  4E8Y A;  4EBU A;  3RRF A;  5BYD A;  3UBO A;  2I6B A;  3KZH A;  2PKF A;  2VOS A;  2F02 A;  4ZIY A;  3RRJ A;  2DDO A;  2VAR A;  4B8R A;  2F7K A;  4C5K A;  3B1N A;  1RKA A;  2JG5 A;  3RQH A;  4CVK A;  5C3Z A;  2UUP A;  1ESQ A;  3NCA A;  3VAQ A;  3UQD A;  3PYZ A;  1V1S A;  3RSF A;  3ZL8 A;  4C12 A;  4JJP A;  1U2X A;  2Y66 A;  3KD6 A;  4JKU A;  1FGS A;  1RK2 A;  5F11 A;  1V19 A;  4B8S A;  1O5Z A;  4K9C A;  3B1O A;  3EWM A;  3RTA A;  5F0Z A;  2VTE A;  3NL5 A;  1LIO A;  1C3Q A;  4KAH A;  1LHP A; 
#chains in the Genus database with same CATH homology
 3UQE A;  5C3Y A;  2NWH A;  3GO6 A;  3RQ2 A;  3LKI A;  3NL6 A;  4YWR A;  3RTA A;  1JXI A;  5TQI A;  3RM5 A;  1LII A;  1JXH A;  1LIK A;  3H74 A;  3NM3 A;  4C5N A;  2YXU A;  5EYN A;  3LJS A;  1V1A A;  5C40 A;  3HYO A;  1RFV A;  3RTD A;  2A9Z A;  3K5W A;  3RTC A;  3FHX A;  2AA0 A;  3LHX A;  2JGV A;  2QCV A;  4O1G A;  3RQ5 A;  3UMO A;  3MBJ A;  3DRW A;  5BYF A;  4JKS A;  2Q5R A;  4N09 A;  5CM5 A;  4E3A A;  3RPH A;  4LBX A;  4EOH A;  4C5J A;  1EKK A;  4K9I A;  2AJR A;  3IE7 A;  2RBC A;  5CGA A;  3NL3 A;  4GM6 A;  3DZV A;  3B1R A;  3NBV A;  4YL5 A;  3RRE A;  4C5L A;  3PL2 A;  4E8Z A;  2AB8 A;  4X8F A;  2XTB A;  2DDW A;  3RPZ A;  3RSQ A;  3IQ0 A;  3B3L A;  2YXT A;  1ESJ A;  2R3B A;  3RS9 A;  1TYY A;  4K8C A;  3RSS A;  3RT7 A;  2DDM A;  3KEU A;  4PVV A;  3KTN A;  1RFT A;  3K9E A;  4U7X A;  1BX4 A;  4K93 A;  3RY7 A;  4LBG A;  1VK4 A;  3N1C A;  3GO7 A;  3PZS A;  1YGK A;  4XCK A;  3IBQ A;  4S1M A;  5BYC A;  3IN1 A;  1TZ6 A;  4LC4 A;  3RU2 A;  3VAS A;  3ZS7 A;  3B1Q A;  3RTE A;  1LHR A;  3Q92 A;  2ABS A;  3GBU A;  2AX3 A;  1UB0 A;  2R3E A;  1YGJ A;  3HPD A;  4K8T A;  5BYD A;  3BGK A;  3NL2 A;  2I5B A;  3Q1Y A;  3RSG A;  5COJ A;  3CQD A;  5C41 A;  2C49 A;  3RU3 A;  3H49 A;  3NM1 A;  2AWD A;  5B6A A;  3RQ8 A;  3RTG A;  2QHP A;  2I6A A;  3UMP A;  3OTX A;  3LOO A;  3UQ6 A;  1DGM A;  2PKM A;  3NC2 A;  5TRW A;  4XF7 A;  1WYE A;  2DCN A;  3RS8 A;  4XDA A;  4DC3 A;  3RQX A;  3BF5 A;  4S1H A;  4KAL A;  3B1P A;  4XF6 A;  3JUL A;  1V1B A;  2AFB A;  1VM7 A;  1LIJ A;  3IH0 A;  1GC5 A;  4WJM A;  4E69 A;  4S1I A;  4E84 A;  1RFU A;  2C4E A;  3RT9 A;  1UA4 A;  4UBE A;  3W4S A;  5EY7 A;  3HIC A;  4EN4 A;  3RQ6 A;  2V78 A;  3NBW A;  1YHJ A;  2HQQ A;  2HW1 A;  4KAN A;  1RKS A;  4KBE A;  1L2L A;  4N08 A;  3QAI A;  4E8W A;  3HJ6 A;  1EKQ A;  2PKN A;  5BYE A;  4K8K A;  3RRB A;  3RO4 A;  2PKK A;  3NC9 A;  2AJP A;  5CGE A;  1VI9 A;  3I3Y A;  1RKD A;  2HLZ A;  3RTB A;  2ABQ A;  1KYH A;  3RQQ A;  4KAD A;  4O1L A;  3QA2 A;  4DU5 A;  2JG1 A;  1GQT A;  4EUM A;  3FHY A;  4K8P A;  1TZ3 A;  1TD2 A;  2FV7 A;  3IKH A;  4S1I B;  3MBH A;  4C5M A;  4LCA A;  2A9Y A;  4E8Y A;  4EBU A;  3RRF A;  3UBO A;  2I6B A;  3KZH A;  2PKF A;  2F02 A;  3RRJ A;  2DDO A;  2VAR A;  4B8R A;  2F7K A;  4C5K A;  3B1N A;  1RKA A;  2JG5 A;  3RQH A;  5C3Z A;  3UQD A;  1ESQ A;  3NCA A;  3VAQ A;  1V1S A;  3RSF A;  4JJP A;  1U2X A;  3KD6 A;  4JKU A;  5F11 A;  1RK2 A;  1V19 A;  4B8S A;  4K9C A;  3B1O A;  3EWM A;  5F0Z A;  3UQ9 A;  3NL5 A;  1LIO A;  1C3Q A;  4KAH A;  1LHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...