1YGOA

Solution structure of the pelle death domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
110
Chain Sequence
GSHMSHLDNTMAIRLLPLPVRAQLCAHLDALDVWQQLATAVKLYPDQVEQISSQKQRGRSASNEFLNIWGGQYNHTVQTLFALFKKLKLHNAMRLIKDYVSEDLHKYIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the isolated Pelle death domain.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
molecule keywords Probable serine/threonine-protein kinase pelle
total genus 23
structure length 110
sequence length 110
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00531 Death Death domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 1ygoA00
2DBHA 4QOBA 4N1JA 4O9LA 2IB1A 3YGSC 4F44A 2N80A 2A9IA 3CRDA 4IZ7B 1D2ZB 4M9XA 2LWDA 2N00A 1DGNA 2OF5H 2N1FA 4UZ0A 1N3KA 4A2QA 4RHWE 2MS7A 1DDFA 2KN6A 1E41A 4I16A 1D2ZA 3LQQA 4O6XA 2DBDA 4IZ5E 3MOPK 2LWEA 1CY5A 2MN4A 4ZBWA 1FADA 2N97A 1PN5A 2YU0A 2NAQA 3EZQB 3J63A 4F42A 2M5VA 1WMGA 2MB9A 2F1SA 3KATA 1WXPA 4NQKA 2MPCA 2VGQA 4DWNA 3MOPG 2P1HA 2O71A 1E3YA 2N7ZA 1A1ZA 3MOPA 2BBRA 1UCPA 2LS7A 2YGSA 4E9MA 2MS8A 2HM2Q 2BBZA 4FH0A 4P4HI 4O9FA 1YGOA 3J6JA 4M9SA 1C15A 4JUPA 2OF5A 2KM6A 2L6AA 4A2WA 4M9ZA 2YVIA 4LWDA 1Z6TA 2L9MA 2GF5A 2G7RA 4IZAB 4P4HA 4D8OA 2DBGA 3LQRA 2B1WA 3EZQA 4O7QA 2A5YB 2YQFA 2NSNA 2NZ7A 4N1KA 1WH4A 4JQWA 1NGRA 2N83A 4RHWA 3YGSP 2DO9A 3T6PA 4EWIA 2DBFA 3CL3A 1A1WA 2D96A 4N1LA 3QF2A 1CWWA 1ICHA
chains in the Genus database with same CATH superfamily
2DBHA 4QOBA 4N1JA 4O9LA 2IB1A 3YGSC 4F44A 2N80A 2A9IA 3CRDA 4IZ7B 1D2ZB 4M9XA 2LWDA 2N00A 1DGNA 2OF5H 2N1FA 4UZ0A 1N3KA 4A2QA 4RHWE 2MS7A 1DDFA 2KN6A 1E41A 4I16A 1D2ZA 3LQQA 4O6XA 2DBDA 2MJMA 4IZ5E 3MOPK 2LWEA 1CY5A 2MN4A 4ZBWA 1FADA 2N97A 1PN5A 2YU0A 2NAQA 3EZQB 3J63A 4F42A 2M5VA 1WMGA 2MB9A 2F1SA 3KATA 1WXPA 4NQKA 2MPCA 2VGQA 4DWNA 3MOPG 2P1HA 2O71A 1E3YA 2N7ZA 1A1ZA 3MOPA 2BBRA 1UCPA 2XV9A 2LS7A 2YGSA 4E9MA 2MS8A 2HM2Q 2BBZA 4FH0A 4P4HI 4O9FA 1YGOA 3J6JA 4M9SA 1C15A 4JUPA 2OF5A 2KM6A 2L6AA 4A2WA 4M9ZA 2YVIA 4LWDA 1Z6TA 2L9MA 2GF5A 2G7RA 4IZAB 4P4HA 4D8OA 2DBGA 3LQRA 2B1WA 3EZQA 4O7QA 2A5YB 2YQFA 2NSNA 2NZ7A 4N1KA 1WH4A 4JQWA 1NGRA 2N83A 4RHWA 3YGSP 2DO9A 3T6PA 4EWIA 2DBFA 3CL3A 1A1WA 2D96A 4N1LA 3QF2A 1CWWA 1ICHA
chains in the Genus database with same CATH topology
2DBHA 4QOBA 4N1JA 4O9LA 2IB1A 3YGSC 4F44A 2N80A 2A9IA 3CRDA 4IZ7B 1D2ZB 4M9XA 2LWDA 2N00A 1DGNA 2OF5H 2N1FA 4UZ0A 1N3KA 4A2QA 4RHWE 2MS7A 1DDFA 2KN6A 1E41A 4I16A 1D2ZA 3LQQA 4O6XA 2DBDA 2MJMA 4IZ5E 3MOPK 2LWEA 1CY5A 2MN4A 4ZBWA 1FADA 2N97A 1PN5A 2YU0A 2NAQA 3EZQB 3J63A 4F42A 2M5VA 1WMGA 2MB9A 2F1SA 3KATA 1WXPA 4NQKA 2MPCA 2VGQA 4DWNA 3MOPG 2P1HA 2O71A 1E3YA 2N7ZA 1A1ZA 3MOPA 2BBRA 1UCPA 2XV9A 2LS7A 2YGSA 4E9MA 2MS8A 2HM2Q 2BBZA 4FH0A 4P4HI 4O9FA 1YGOA 3J6JA 4M9SA 1C15A 4JUPA 2OF5A 2KM6A 2L6AA 4A2WA 4M9ZA 2YVIA 4LWDA 1Z6TA 2L9MA 2GF5A 2G7RA 4IZAB 4P4HA 4D8OA 2DBGA 3LQRA 2B1WA 3EZQA 4O7QA 2A5YB 2YQFA 2NSNA 2NZ7A 4N1KA 1WH4A 4JQWA 1NGRA 2N83A 4RHWA 3YGSP 2DO9A 3T6PA 4EWIA 2DBFA 3CL3A 1A1WA 2D96A 4N1LA 3QF2A 1CWWA 1ICHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DBH A;  4QOB A;  4N1J A;  4O9L A;  2IB1 A;  3YGS C;  4F44 A;  2N80 A;  2A9I A;  3CRD A;  4IZ7 B;  1D2Z B;  4M9X A;  2LWD A;  2N00 A;  1DGN A;  2OF5 H;  2N1F A;  4UZ0 A;  1N3K A;  4A2Q A;  4RHW E;  2MS7 A;  1DDF A;  2KN6 A;  1E41 A;  4I16 A;  1D2Z A;  3LQQ A;  4O6X A;  2DBD A;  4IZ5 E;  3MOP K;  2LWE A;  1CY5 A;  2MN4 A;  4ZBW A;  1FAD A;  2N97 A;  1PN5 A;  2YU0 A;  2NAQ A;  3EZQ B;  3J63 A;  4F42 A;  2M5V A;  1WMG A;  2MB9 A;  2F1S A;  3KAT A;  1WXP A;  4NQK A;  2MPC A;  2VGQ A;  4DWN A;  3MOP G;  2P1H A;  2O71 A;  1E3Y A;  2N7Z A;  1A1Z A;  3MOP A;  2BBR A;  1UCP A;  2LS7 A;  2YGS A;  4E9M A;  2MS8 A;  2HM2 Q;  2BBZ A;  4FH0 A;  4P4H I;  4O9F A;  1YGO A;  3J6J A;  4M9S A;  1C15 A;  4JUP A;  2OF5 A;  2KM6 A;  2L6A A;  4A2W A;  4M9Z A;  2YVI A;  4LWD A;  1Z6T A;  2L9M A;  2GF5 A;  2G7R A;  4IZA B;  4P4H A;  4D8O A;  2DBG A;  3LQR A;  2B1W A;  3EZQ A;  4O7Q A;  2A5Y B;  2YQF A;  2NSN A;  2NZ7 A;  4N1K A;  1WH4 A;  4JQW A;  1NGR A;  2N83 A;  4RHW A;  3YGS P;  2DO9 A;  3T6P A;  4EWI A;  2DBF A;  3CL3 A;  1A1W A;  2D96 A;  4N1L A;  3QF2 A;  1CWW A;  1ICH A; 
#chains in the Genus database with same CATH topology
 2DBH A;  4QOB A;  4N1J A;  4O9L A;  2IB1 A;  3YGS C;  4F44 A;  2N80 A;  2A9I A;  3CRD A;  4IZ7 B;  1D2Z B;  4M9X A;  2LWD A;  2N00 A;  1DGN A;  2OF5 H;  2N1F A;  4UZ0 A;  1N3K A;  4A2Q A;  4RHW E;  2MS7 A;  1DDF A;  2KN6 A;  1E41 A;  4I16 A;  1D2Z A;  3LQQ A;  4O6X A;  2DBD A;  2MJM A;  4IZ5 E;  3MOP K;  2LWE A;  1CY5 A;  2MN4 A;  4ZBW A;  1FAD A;  2N97 A;  1PN5 A;  2YU0 A;  2NAQ A;  3EZQ B;  3J63 A;  4F42 A;  2M5V A;  1WMG A;  2MB9 A;  2F1S A;  3KAT A;  1WXP A;  4NQK A;  2MPC A;  2VGQ A;  4DWN A;  3MOP G;  2P1H A;  2O71 A;  1E3Y A;  2N7Z A;  1A1Z A;  3MOP A;  2BBR A;  1UCP A;  2XV9 A;  2LS7 A;  2YGS A;  4E9M A;  2MS8 A;  2HM2 Q;  2BBZ A;  4FH0 A;  4P4H I;  4O9F A;  1YGO A;  3J6J A;  4M9S A;  1C15 A;  4JUP A;  2OF5 A;  2KM6 A;  2L6A A;  4A2W A;  4M9Z A;  2YVI A;  4LWD A;  1Z6T A;  2L9M A;  2GF5 A;  2G7R A;  4IZA B;  4P4H A;  4D8O A;  2DBG A;  3LQR A;  2B1W A;  3EZQ A;  4O7Q A;  2A5Y B;  2YQF A;  2NSN A;  2NZ7 A;  4N1K A;  1WH4 A;  4JQW A;  1NGR A;  2N83 A;  4RHW A;  3YGS P;  2DO9 A;  3T6P A;  4EWI A;  2DBF A;  3CL3 A;  1A1W A;  2D96 A;  4N1L A;  3QF2 A;  1CWW A;  1ICH A; 
#chains in the Genus database with same CATH homology
 2DBH A;  4QOB A;  4N1J A;  4O9L A;  2IB1 A;  3YGS C;  4F44 A;  2N80 A;  2A9I A;  3CRD A;  4IZ7 B;  1D2Z B;  4M9X A;  2LWD A;  2N00 A;  1DGN A;  2OF5 H;  2N1F A;  4UZ0 A;  1N3K A;  4A2Q A;  4RHW E;  2MS7 A;  1DDF A;  2KN6 A;  1E41 A;  4I16 A;  1D2Z A;  3LQQ A;  4O6X A;  2DBD A;  2MJM A;  4IZ5 E;  3MOP K;  2LWE A;  1CY5 A;  2MN4 A;  4ZBW A;  1FAD A;  2N97 A;  1PN5 A;  2YU0 A;  2NAQ A;  3EZQ B;  3J63 A;  4F42 A;  2M5V A;  1WMG A;  2MB9 A;  2F1S A;  3KAT A;  1WXP A;  4NQK A;  2MPC A;  2VGQ A;  4DWN A;  3MOP G;  2P1H A;  2O71 A;  1E3Y A;  2N7Z A;  1A1Z A;  3MOP A;  2BBR A;  1UCP A;  2XV9 A;  2LS7 A;  2YGS A;  4E9M A;  2MS8 A;  2HM2 Q;  2BBZ A;  4FH0 A;  4P4H I;  4O9F A;  1YGO A;  3J6J A;  4M9S A;  1C15 A;  4JUP A;  2OF5 A;  2KM6 A;  2L6A A;  4A2W A;  4M9Z A;  2YVI A;  4LWD A;  1Z6T A;  2L9M A;  2GF5 A;  2G7R A;  4IZA B;  4P4H A;  4D8O A;  2DBG A;  3LQR A;  2B1W A;  3EZQ A;  4O7Q A;  2A5Y B;  2YQF A;  2NSN A;  2NZ7 A;  4N1K A;  1WH4 A;  4JQW A;  1NGR A;  2N83 A;  4RHW A;  3YGS P;  2DO9 A;  3T6P A;  4EWI A;  2DBF A;  3CL3 A;  1A1W A;  2D96 A;  4N1L A;  3QF2 A;  1CWW A;  1ICH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...