1YHQO

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1yhqO00
1VQ4O 1S72L 3CCRL 1Q81P 3CCEO 1KD1M 1VQMO 3CMAL 1QVGN 1VQ9L 1YJWO 1Q86P 2OTLL 1VQ5L 3CC4L 3CC7O 1YIJL 1NJIM 3CPWK 1VQPO 3OW2K 3CCRO 3G4SL 1VQNL 3CCLL 3CMEL 3CMAO 1VQ9O 3CCSL 1YITL 1M1KM 3CPWN 1QVGK 3CC4O 3CD6O 1VQPL 1YIJO 3I55L 3G4SO 1VQNO 3CCLO 3CMEO 1KC8P 1Q82P 1M90M 3CCSO 1YITO 3CC2L 3CD6L 1KD1P 1VQLO 3I55O 1Q81M 1YI2O 1QVFN 2QA4L 1NJIP 1N8RM 3CCVO 3CC2O 1K9MM 1VQLL 1Q7YM 3CXCN 1YI2L 3CCUL 1YJNL 1K73P 1KQSN 1M1KP 3I56L 1QVFK 1JJ2K 1W2BN 2QA4O 3CCVL 1K8AM 1VQ7L 1VQKL 3CCJO 1VQOL 1VQ8L 3CCUO 3G71O 1JJ2N 1YJNO 1M90P 3CXCK 1Q86M 3I56O 1YJ9O 2QEXL 1VQ6O 1KQSK 3CCQL 1VQ7O 3CCJL 1VQKO 1VQOO 1W2BK 1VQ8O 3CCML 2OTJL 1YHQL 3G71L 3G6EL 1N8RP 1YJ9L 2QEXO 1VQ6L 1VQ4L 1K9MP 1S72O 1Q7YP 3CCEL 3CCQO 1VQML 1YJWL 3CCMO 2OTJO 1YHQO 1K73M 2OTLO 1VQ5O 3G6EO 3OW2N 1KC8M 1K8AP 1Q82M 3CC7L
chains in the Genus database with same CATH superfamily
1VQ4O 1S72L 3CCRL 4WJ0A 1Q81P 3CCEO 1KD1M 1VQMO 3CMAL 1QVGN 1VQ9L 1YJWO 5DS5A 1Q86P 2OTLL 1VQ5L 3CC4L 5DLJA 5DQZA 3CC7O 1YIJL 1NJIM 3CPWK 1VQPO 3OW2K 3CCRO 3G4SL 1VQNL 3CCLL 3CMEL 3CMAO 1VQ9O 3CCSL 1YITL 1M1KM 3CPWN 1QVGK 3CC4O 3CD6O 1VQPL 1YIJO 3I55L 3G4SO 1VQNO 3CCLO 3CMEO 1KC8P 1Q82P 1M90M 3CCSO 1YITO 3CC2L 3CD6L 1KD1P 1VQLO 3I55O 1Q81M 1YI2O 4QDLA 1QVFN 3NKDA 5FCLA 2QA4L 5DQTA 1NJIP 1N8RM 3CCVO 3CC2O 1K9MM 1VQLL 1Q7YM 3CXCN 1YI2L 3CCUL 1YJNL 1K73P 4N06A 1KQSN 1M1KP 3I56L 1QVFK 1JJ2K 1W2BN 2QA4O 3CCVL 1K8AM 1VQ7L 1VQKL 3CCJO 1VQOL 1VQ8L 3CCUO 3G71O 1JJ2N 1YJNO 1M90P 3CXCK 1Q86M 3I56O 1YJ9O 2QEXL 1VQ6O 1KQSK 3CCQL 1VQ7O 3CCJL 1VQKO 3GODA 1VQOO 1W2BK 1VQ8O 3CCML 4P6IC 2OTJL 1YHQL 5DS6A 3G71L 3G6EL 1N8RP 5DS4A 1YJ9L 4W8KA 2QEXO 1VQ6L 1VQ4L 4XTKA 1K9MP 1S72O 2YZSA 1Q7YP 3CCEL 3CCQO 1VQML 1YJWL 3CCMO 2OTJO 1YHQO 1K73M 2OTLO 1VQ5O 3G6EO 3OW2N 1KC8M 1K8AP 1Q82M 3CC7L
chains in the Genus database with same CATH topology
1VQ4O 1S72L 3CCRL 4WJ0A 1Q81P 3CCEO 1KD1M 1VQMO 3CMAL 1QVGN 1VQ9L 1YJWO 5DS5A 1Q86P 2OTLL 1VQ5L 3CC4L 5DLJA 5DQZA 3CC7O 1YIJL 1NJIM 3CPWK 1VQPO 3OW2K 3CCRO 3G4SL 1VQNL 3CCLL 3CMEL 3CMAO 1VQ9O 3CCSL 1YITL 1M1KM 3CPWN 1QVGK 3CC4O 3CD6O 1VQPL 1YIJO 3I55L 3G4SO 1VQNO 3CCLO 3CMEO 1KC8P 1Q82P 1M90M 3CCSO 1YITO 3CC2L 3CD6L 1KD1P 1VQLO 3I55O 1Q81M 1YI2O 4QDLA 1QVFN 3NKDA 5FCLA 2QA4L 5DQTA 1NJIP 1N8RM 3CCVO 3CC2O 1K9MM 1VQLL 1Q7YM 3CXCN 1YI2L 3CCUL 1YJNL 1K73P 4N06A 1KQSN 1M1KP 3I56L 1QVFK 1JJ2K 1W2BN 2QA4O 3CCVL 1K8AM 1VQ7L 1VQKL 3CCJO 1VQOL 1VQ8L 3CCUO 3G71O 1JJ2N 1YJNO 1M90P 3CXCK 1Q86M 3I56O 1YJ9O 2QEXL 1VQ6O 1KQSK 3CCQL 1VQ7O 3CCJL 1VQKO 3GODA 1VQOO 1W2BK 1VQ8O 3CCML 4P6IC 2OTJL 1YHQL 5DS6A 3G71L 3G6EL 1N8RP 5DS4A 1YJ9L 4W8KA 2QEXO 1VQ6L 1VQ4L 4XTKA 1K9MP 1S72O 2YZSA 1Q7YP 3CCEL 3CCQO 1VQML 1YJWL 3CCMO 2OTJO 1YHQO 1K73M 2OTLO 1VQ5O 3G6EO 3OW2N 1KC8M 1K8AP 1Q82M 3CC7L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 O;  1S72 L;  3CCR L;  1Q81 P;  3CCE O;  1KD1 M;  1VQM O;  3CMA L;  1QVG N;  1VQ9 L;  1YJW O;  1Q86 P;  2OTL L;  1VQ5 L;  3CC4 L;  3CC7 O;  1YIJ L;  1NJI M;  3CPW K;  1VQP O;  3OW2 K;  3CCR O;  3G4S L;  1VQN L;  3CCL L;  3CME L;  3CMA O;  1VQ9 O;  3CCS L;  1YIT L;  1M1K M;  3CPW N;  1QVG K;  3CC4 O;  3CD6 O;  1VQP L;  1YIJ O;  3I55 L;  3G4S O;  1VQN O;  3CCL O;  3CME O;  1KC8 P;  1Q82 P;  1M90 M;  3CCS O;  1YIT O;  3CC2 L;  3CD6 L;  1KD1 P;  1VQL O;  3I55 O;  1Q81 M;  1YI2 O;  1QVF N;  2QA4 L;  1NJI P;  1N8R M;  3CCV O;  3CC2 O;  1K9M M;  1VQL L;  1Q7Y M;  3CXC N;  1YI2 L;  3CCU L;  1YJN L;  1K73 P;  1KQS N;  1M1K P;  3I56 L;  1QVF K;  1JJ2 K;  1W2B N;  2QA4 O;  3CCV L;  1K8A M;  1VQ7 L;  1VQK L;  3CCJ O;  1VQO L;  1VQ8 L;  3CCU O;  3G71 O;  1JJ2 N;  1YJN O;  1M90 P;  3CXC K;  1Q86 M;  3I56 O;  1YJ9 O;  2QEX L;  1VQ6 O;  1KQS K;  3CCQ L;  1VQ7 O;  3CCJ L;  1VQK O;  1VQO O;  1W2B K;  1VQ8 O;  3CCM L;  2OTJ L;  1YHQ L;  3G71 L;  3G6E L;  1N8R P;  1YJ9 L;  2QEX O;  1VQ6 L;  1VQ4 L;  1K9M P;  1S72 O;  1Q7Y P;  3CCE L;  3CCQ O;  1VQM L;  1YJW L;  3CCM O;  2OTJ O;  1YHQ O;  1K73 M;  2OTL O;  1VQ5 O;  3G6E O;  3OW2 N;  1KC8 M;  1K8A P;  1Q82 M;  3CC7 L; 
#chains in the Genus database with same CATH topology
 1VQ4 O;  1S72 L;  3CCR L;  4WJ0 A;  1Q81 P;  3CCE O;  1KD1 M;  1VQM O;  3CMA L;  1QVG N;  1VQ9 L;  1YJW O;  5DS5 A;  1Q86 P;  2OTL L;  1VQ5 L;  3CC4 L;  5DLJ A;  5DQZ A;  3CC7 O;  1YIJ L;  1NJI M;  3CPW K;  1VQP O;  3OW2 K;  3CCR O;  3G4S L;  1VQN L;  3CCL L;  3CME L;  3CMA O;  1VQ9 O;  3CCS L;  1YIT L;  1M1K M;  3CPW N;  1QVG K;  3CC4 O;  3CD6 O;  1VQP L;  1YIJ O;  3I55 L;  3G4S O;  1VQN O;  3CCL O;  3CME O;  1KC8 P;  1Q82 P;  1M90 M;  3CCS O;  1YIT O;  3CC2 L;  3CD6 L;  1KD1 P;  1VQL O;  3I55 O;  1Q81 M;  1YI2 O;  4QDL A;  1QVF N;  3NKD A;  5FCL A;  2QA4 L;  5DQT A;  1NJI P;  1N8R M;  3CCV O;  3CC2 O;  1K9M M;  1VQL L;  1Q7Y M;  3CXC N;  1YI2 L;  3CCU L;  1YJN L;  1K73 P;  4N06 A;  1KQS N;  1M1K P;  3I56 L;  1QVF K;  1JJ2 K;  1W2B N;  2QA4 O;  3CCV L;  1K8A M;  1VQ7 L;  1VQK L;  3CCJ O;  1VQO L;  1VQ8 L;  3CCU O;  3G71 O;  1JJ2 N;  1YJN O;  1M90 P;  3CXC K;  1Q86 M;  3I56 O;  1YJ9 O;  2QEX L;  1VQ6 O;  1KQS K;  3CCQ L;  1VQ7 O;  3CCJ L;  1VQK O;  3GOD A;  1VQO O;  1W2B K;  1VQ8 O;  3CCM L;  4P6I C;  2OTJ L;  1YHQ L;  5DS6 A;  3G71 L;  3G6E L;  1N8R P;  5DS4 A;  1YJ9 L;  4W8K A;  2QEX O;  1VQ6 L;  1VQ4 L;  4XTK A;  1K9M P;  1S72 O;  2YZS A;  1Q7Y P;  3CCE L;  3CCQ O;  1VQM L;  1YJW L;  3CCM O;  2OTJ O;  1YHQ O;  1K73 M;  2OTL O;  1VQ5 O;  3G6E O;  3OW2 N;  1KC8 M;  1K8A P;  1Q82 M;  3CC7 L; 
#chains in the Genus database with same CATH homology
 1VQ4 O;  1S72 L;  3CCR L;  4WJ0 A;  1Q81 P;  3CCE O;  1KD1 M;  1VQM O;  3CMA L;  1QVG N;  1VQ9 L;  1YJW O;  5DS5 A;  1Q86 P;  2OTL L;  1VQ5 L;  3CC4 L;  5DLJ A;  5DQZ A;  3CC7 O;  1YIJ L;  1NJI M;  3CPW K;  1VQP O;  3OW2 K;  3CCR O;  3G4S L;  1VQN L;  3CCL L;  3CME L;  3CMA O;  1VQ9 O;  3CCS L;  1YIT L;  1M1K M;  3CPW N;  1QVG K;  3CC4 O;  3CD6 O;  1VQP L;  1YIJ O;  3I55 L;  3G4S O;  1VQN O;  3CCL O;  3CME O;  1KC8 P;  1Q82 P;  1M90 M;  3CCS O;  1YIT O;  3CC2 L;  3CD6 L;  1KD1 P;  1VQL O;  3I55 O;  1Q81 M;  1YI2 O;  4QDL A;  1QVF N;  3NKD A;  5FCL A;  2QA4 L;  5DQT A;  1NJI P;  1N8R M;  3CCV O;  3CC2 O;  1K9M M;  1VQL L;  1Q7Y M;  3CXC N;  1YI2 L;  3CCU L;  1YJN L;  1K73 P;  4N06 A;  1KQS N;  1M1K P;  3I56 L;  1QVF K;  1JJ2 K;  1W2B N;  2QA4 O;  3CCV L;  1K8A M;  1VQ7 L;  1VQK L;  3CCJ O;  1VQO L;  1VQ8 L;  3CCU O;  3G71 O;  1JJ2 N;  1YJN O;  1M90 P;  3CXC K;  1Q86 M;  3I56 O;  1YJ9 O;  2QEX L;  1VQ6 O;  1KQS K;  3CCQ L;  1VQ7 O;  3CCJ L;  1VQK O;  3GOD A;  1VQO O;  1W2B K;  1VQ8 O;  3CCM L;  4P6I C;  2OTJ L;  1YHQ L;  5DS6 A;  3G71 L;  3G6E L;  1N8R P;  5DS4 A;  1YJ9 L;  4W8K A;  2QEX O;  1VQ6 L;  1VQ4 L;  4XTK A;  1K9M P;  1S72 O;  2YZS A;  1Q7Y P;  3CCE L;  3CCQ O;  1VQM L;  1YJW L;  3CCM O;  2OTJ O;  1YHQ O;  1K73 M;  2OTL O;  1VQ5 O;  3G6E O;  3OW2 N;  1KC8 M;  1K8A P;  1Q82 M;  3CC7 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...