1YHQP

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yhqP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yhqP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yhqP02
3CC2P 3CC7P 1KC8Q 3CD6P 3G4SP 3G6EP 3CCUP 1VQNP 3CCEP 1KQSO 3I55P 1YI2P 1YIJP 3CC4P 3CCMP 1K9MQ 1VQ7P 3I56P 1VQ5P 1M90Q 1VQMP 1YJ9P 3CMEP 1KD1Q 1K8AQ 1Q82Q 1QVFO 3CCVP 3CCRP 3CCQP 3OW2O 2QA4P 1K73Q 1JJ2O 1VQ8P 1VQLP 1Q81Q 1Q86Q 1VQKP 1N8RQ 1YITP 3CCSP 1NJIQ 3CCJP 3CCLP 1YJWP 1YJNP 1VQ4P 3CMAP 1VQ6P 3CPWO 1Q7YQ 2OTJP 1YHQP 1VQ9P 3CXCO 2QEXP 3G71P 1QVGO 2OTLP 1S72P 1VQOP 1VQPP 1W2BO 1M1KQ
chains in the Genus database with same CATH superfamily
5GTHE 1FZCB 1EDLA 2Q3EA 3RGUA 1N86A 2PEQA 2K37A 1M57D 1FC2C 1CW5A 4ZKUA 3IN6A 2WPVB 1L0IA 4HKGA 5AW3B 2FQ0A 2NPSA 1BGYD 2ZAEB 3CX5D 2X2BA 1CZQA 3C9IA 2FYUK 2YKPA 3SSUA 2BHVA 3N7NA 2OTKE 1W2EA 1VHNA 2H88C 2VSQA 1JB0J 1YITP 2G8YA 1ZRTE 3S4RA 1RE4A 3RG6C 2RH0A 3LIDA 3Q20A 1P84D 3N4XA 1PEMA 5AVXB 1K04A 1DEBA 1RQVA 1OXZA 3G4SP 1EZVD 1OW6A 1GL2D 2WSFH 1IMQA 1KQGB 2N1TD 4OGQC 3H1ID 3MZWB 5HV8A 1JUNA 2ZT9D 3WU2H 4H44D 3F89A 1SP4A 3H25A 2Q3IA 4WWIA 3BVHA 2N9BA 2WSCJ 1Q2NA 2R5BA 1ZR2A 1KB9I 3B8EB 1JNMA 3TGUD 2JB0A 3A0BH 1T2KC 1PP9D 3GG2A 1N7LA 3E1IA 2BEZF 2PP6A 5KAIE 1EDJA 4UHPB 2NPSC 3G29A 1FOSF 2BQ1E 1LT9B 3CL3D 1AUMA 1BSNA 2JO1A 2L22A 1VF5C 3RBZA 1NH4A 3NXSA 1CEIA 2GUSA 3BCCE 2DGYA 1L0LJ 4YXWH 1KILD 3AEEC 1Q82Q 2YXQB 1SQQJ 1RE4C 1IFIA 3AECC 1H0TB 2FY8A 2WSFJ 1FR2A 1PGJA 5CJ4A 2J5UA 3B4SA 2E42A 1YI2P 4PD4I 1NTME 1RF1C 2I1KA 1QVFO 1KB9E 1K05A 1BGYE 3B71A 3M1MA 1SLQA 1GDTA 1NU1D 2KS1B 1OVRA 5HVCA 1RF0A 1DD3A 3P8CD 1JM0A 3IFMA 3HUSB 5CCGD 1DEEG 4F37A 4PH0A 3PJSK 2N1TC 3GF7A 3WUUA 5APQA 2PY8A 1XTCC 1G2CA 2KK7A 3AEGC 3GZMA 1KQLA 3O6QB 1HGZA 5B5EE 2Q1KA 4B86A 4HYTB 1L0LK 2A06D 2FVAA 2IYPA 4JF7A 2PFXA 2LL8A 1ZN5A 2RN0A 5AVSB 4U0FA 1VQ6P 2Z5HA 3OA7A 1L4AC 5F2OA 1JY2N 2E5TA 3L36A 3TGUE 1F80D 2B89A 3CX5H 3L75D 2ZYDA 2MY5A 1S4XA 1ZMEC 3MHVA 2Z4EA 4DOJA 2QM7A 2YNYA 2P67A 1M74A 3MIWA 3FXDA 5TISE 1QEXA 2FAEA 3H1IJ 2MF4A 3CXHI 1M8OB 1M6NA 1N7SA 3A7OA 1HQBA 4U7JA 1JTHB 2ZVNB 3P32A 2WSEJ 3TK1A 5K5GB 2K93A 4HH2A 5AVZB 3TSIA 2OYHB 2KOOA 2GZFA 2JYLA 1JO5A 2CGQA 3RG2A 2MJZA 3BATA 1SQBK 1YHQP 2H43A 2KR5A 4A7PA 1CI6B 3C1LA 2K92A 3QH9A 3H6PA 5TISH 4OGQD 2AFDA 2D2CB 2GZJA 3RL0D 3HD7C 5GTIE 2LIWA 1U7MA 2R5DA 1SFCA 3H0DA 2CG5B 4LGDE 3L75G 2M0BA 2ITAA 3CD6P 1NTMJ 2M3EA 1LT1A 2Q6QA 2O3JA 3U1CA 1S3JA 1Y47A 2Y9YA 3L73D 2BCCD 2CNRA 3CXHH 1YTZI 5HGLA 1LTBC 5KKZC 1VQNP 1NTMG 2GDYA 5KLVG 3CC4P 2XDJA 3EJBA 3UIAA 4I2LC 3RL0C 3O8ZA 4RJTA 1JJ2O 3SWFA 3H1KJ 2PGDA 1CI6A 1NU1E 4PXHB 3Q5PA 2QJPB 5KLVJ 2IX7C 1X9VA 3FGAD 3H1KE 3A0HE 3L70J 2LMLA 2I8DA 2KOSA 2W83C 1Q81Q 3M0DA 2AXCA 2HG5D 2MD9A 1PEUA 2EIAA 1A02J 3H1HD 3H1KG 1J1DB 1MZ9A 4U0EA 1S9KD 2K5XA 1USDA 2KXPB 2M5AB 3B4QA 3T97B 1M1JB 4PJ0E 3H32B 5APYA 2L4BA 1USEA 3L72E 4XROA 3HD7D 4XFYA 2LKMA 3H1JD 1KILA 4HJGH 1FZGA 2HFED 5CCGA 1N73A 1PV3A 4Y28J 1EIAA 2RMZA 5KAFE 4U0BA 1ZR4A 2M8NA 1R8EA 2PEOA 4U3FG 2EHSA 1ZMBA 1SQQK 3MUDA 4KJMA 1RHZB 1EQ7A 3RK2D 3C8VA 2OQQA 5L8RJ 2O1KA 5HGMA 2K1AA 3HTKA 1A43A 1N7SB 1ZP0C 2K94A 2JAZA 1URQB 2WPQA 2FACA 2IBZG 3FWLA 1DX7A 1KC8Q 2FXMA 5KTBA 3CCUP 3GHGC 2N6ZA 1R5LA 1GPJA 2YO3A 4W7YA 1SQVG 2JWDA 2ZVOB 2NPSD 5KP6B 2N5HA 1L0LG 2ZXEB 2PEKA 4UB6E 4C7NB 2KI7B 2ERHA 1SQQG 3L71D 1N73C 3IR9A 1RE3C 1GU4A 2MR8A 2IZ0A 1YIJP 1LJ2A 1VQ7P 1NWQA 5BS2A 2E74D 2A45H 3BASA 2QA4P 3B5NC 4EYYQ 1N8RQ 4IL6X 3LRYA 3ITKA 1FZAA 1HJ0A 1SQXG 3G6EP 1AJYA 4H2XC 3EWKA 1OW7A 3HE5A 5KLVD 2OYHA 1LWUC 3L72D 4WB4A 3VMZA 2WSSH 4GT1A 1ZOYC 2WPSA 4IZ6A 2AXTE 1BE3D 1N7SD 2N9YB 5EJDA 1PEQA 1KZUB 3DS1A 1FU1A 2K0XA 2BASA 3CCVP 3CCQP 2LPKA 3RL0g 3L72J 3V4WA 3SWKA 4NPEA 4DT0A 2BUOA 3L74G 3Q1MA 4M3LA 1GL2B 4WY4A 1H8AA 2JR8A 1IFDA 2XU6A 2PENA 1GTWA 1VQOP 2CPSA 1KFNA 5B66H 1P84I 2HODB 3VRLC 5B66E 3H1JE 2KNCA 3H1IE 3L71G 1ZV8A 2CPBA 3PRJA 1L0HA 3KHUA 2KSJA 3F5HA 2C0XA 1VF5D 3CWBG 1NO4A 2Y0CA 1J1EB 1SQBD 1BCCD 2FFDC 3VTPC 3I56P 1KB9D 3CMEP 2ROQA 2KGEA 1HJBA 4U3FE 1L0NG 2JU2A 5CCHD 1BCCJ 1NTKJ 1DD4A 3L4FA 3AEDC 3GJNA 4PD4H 1N73B 4H13C 1G1IA 3CE7A 2V7QJ 3NMDA 2K9JA 3A0BE 3BCCJ 1BE3J 5GTHH 1GL2A 5APTA 2KG6A 5APWA 2WPRA 2KZJA 4IFFA 1YQ4C 1T3UA 1BCCG 5AW8B 1EMVA 2AF8A 1NAFA 1QVGO 4D6TG 1PGOA 2ZXXA 3RK2B 1BXIA 3VN0A 4EDFA 3VP9A 1GMJA 3HE4B 1HF9A 4HB1A 1BE3G 1IFMA 3AE9C 4DZOA 2IDBA 4JYBA 2WVRA 1EDKA 2KYVA 1SQXK 1X8YA 5KLIB 3U43A 4XFJA 1SQQE 1TU3F 1KQFB 4Z1MH 2QEXP 3M0AA 1RF0C 2GDWA 3R4YA 2LF4A 4MN4C 3MP7B 5BU8B 1X22A 4AQRD 4CPGA 2POHA 3SFEC 1KTMA 2W8ZA 2FVEA 1GXGA 1J2JB 1PIXA 3H1HG 1AVOA 1KORA 3G71P 3A0HH 3B5NB 3G21A 1ZRTD 1GL2C 2LIUA 3AE6C 4W80A 5DJUB 1FOSE 1DH3A 1E6JP 2M5AA 2GM4A 2IFNA 1M1JC 2HPCA 1E79H 3EJEA 3IAOA 4N6JA 4C46A 1FE6A 3B5ND 2W6BA 3H32A 3VYIA 2XV5A 2B87B 1RNIA 1VQPP 2N5IA 1T6AA 2JWAA 1Y9BA 1GU5A 3G1IA 3GW6A 4BPHA 2PEIA 2KP8A 4TT3H 5AW2B 1SQPD 1OMIA 1IFJA 3D6ZA 5KAFH 4COCA 1JEKA 2Q5UA 1URQC 4PD4E 2P7JA 2PNGA 1N7SC 2K9JB 2R3SA 4XFZA 4GKGA 2E76D 2JO0A 3L73G 1SQQD 5KP8B 1UJZA 1PP9G 4OWFA 3KPEA 1NTKE 1FDOA 1VQKP 4XFXA 4AUWA 1OFCX 3M06A 3CPWO 1SQVE 3OJAB 3L73J 2PEMA 1M1JA 3L37A 1L4AA 4UB8H 1NKZB 2MVUA 1ACPA 3BCCD 2YKOA 2XT1A 5AVWB 1OZHA 3A5TA 2HR3A 3L75J 1KB9H 1URQD 1S5LH 3FWNA 1GK4A 2WTYA 3G3ZA 1FBMA 2AFEA 4UB8E 5APXA 3DS0A 2E76C 2AEMA 5CZDB 1HUCA 2K9YA 5DCKA 1PP9E 1A02F 2XZ0D 1NTZG 1SQPJ 2YMKA 4PV1B 2IPPA 1JY3N 1QLED 3AE3C 3KXDA 1BGYG 4ZNCA 2R44A 1JY3P 1LGHB 1FJPA 3BRVB 2KUBA 1NGMB 2FYNC 1W2BO 3H4EA 3CC7P 1JY3O 3A3YB 3H1LD 1FAVA 1KLPA 3R2PA 2KORA 1IK9A 4WBAA 4ZKPA 3P8CE 1JY2O 1D1DA 3CXHE 4MRTC 2FKWB 2GYKA 3DTJA 3PP5A 2GZEA 2FYUD 4I7ZB 5AVTB 1EC5A 2N1TB 3GF3A 2WQYC 2VLPA 1NTMD 1CSBA 3HUSC 2QG4A 2P1JA 2E1MA 3U59A 5I4TG 2ZT9C 4GIFA 2K88A 3G0VA 3Q2YA 2Y9ZA 3KZIE 4K35A 3EFGA 2Z44A 2HLOA 3H1JJ 3SFDC 5CBOA 1LTTC 3L74D 1AA0A 1M90Q 3CI9A 4IL6E 1PL5A 1LP1B 4EIJA 1SS1A 1ZLLA 2KOGA 5CMZA 1SQPK 1VL2A 2QJPC 3KZIH 4KHXA 3VP8A 2M8PA 3CWBD 2OYIC 4R0MA 1A8OA 4ZMDA 2XZ1C 5CCGC 1AVYA 2ONTA 1UNKA 1L0NE 2D2CC 3CXHD 3GMAA 1RQUA 1VQMP 4BRYB 1KD1Q 1HWTC 1IMPA 2LXBA 5TJHA 3L70D 4N78E 5AW0B 3OW2O 2IBZD 1FZBA 3TF5A 3M0DC 2VLQA 3L70E 4N78D 1X3OA 1WRGA 3DS2A 1ZW0A 4JBZA 4GR6A 2K0YA 1IZNB 2NRGA 2N98A 5HGNA 1OIPA 2L91A 1EXJA 1VQ5P 5APSA 1JY2P 1K8AQ 2YIUC 1NTKK 1X0TA 2C9LY 5F2NA 3CCLP 2E76B 2QJYB 1S1CX 2QJYC 3TYYA 1GK6A 3AEBC 4WYMA 2WT7A 4M0IA 2WMMA 4KT0J 3E2DA 1NU1K 5AVYB 1MFTA 1IK7A 2LOLA 2VLNA 1S2EA 3S9OA 2FVFA 4R4LA 1SQXD 5KJ7A 4H13D 2VRSA 2WSEH 1KYOE 1OX3A 3MD0A 3H1HE 5AW7B 3Q3DA 3KQGA 3NTEA 2NPSB 4D6TJ 1SQXJ 1M6EX 2ZFCA 4QMAA 5AVUB 4IFDK 1DNYA 1E0HA 3W67A 4JPZB 2OYIB 1YJWP 2W6JH 2KS1A 5CCHA 3P05A 2FQ1A 1HH0A 4D6TE 1M1KQ 1ZXGA 1UIIA 2B9BA 3TGUG 2YKQA 3PLNA 1L0LD 3I55P 1M56D 1YBKA 1BAJA 2WT7B 1NTMK 3AE1C 1K30A 2EHTA 1JMMA 1VDFA 1KMIZ 4OGQB 3RK3E 5BU5A 2C9NY 2XKMA 3HE4A 4XRQA 1G1JA 2LR2A 2FYUG 2M8LA 1KN7A 2KLUA 1L4AB 1LTJA 1SQVK 2OGUA 3TGUJ 3FXEA 1T3JA 2ZT9B 1PFIA 2A45G 3DS3A 3L74J 1RO0A 4U0CA 2Z5IA 1KYOI 2J58A 3H1LG 1H89A 5KJ7C 1LTSC 2OTJP 5AW6B 2DW3A 4CA3A 2MR7A 2WPTA 2FADA 3TNUB 1QL2A 4AYCA 1RO2A 4U3FD 1AF8A 3JSVC 3B5IA 4RKUJ 2KG8A 2W90A 2PRRA 3CWBJ 1S5LE 4N3YB 3Q5SA 1FS0E 5CCHC 2KGCA 3H1LJ 1ZNVA 1NJIQ 2JYGA 1LT9A 1EOQA 3CMAP 1NHLA 4YXDC 1S5LX 4L73A 1L0NJ 1FZFA 4QNBA 1NKNA 2HPCB 5AW5B 1GZLA 2J59M 3BRTB 2E75D 5BS1A 1IUQA 1IFNA 3CCSP 3KDPB 3CCJP 1NTKD 2DNWA 1MV8A 1LTJC 3G26A 3MTUE 2N50A 3H1IG 1LTJB 1QX8A 3CCEP 3W68A 2D2CD 2I1JA 2P2UA 4C7RA 2E74C 1W5CE 1S9KE 1NVOA 3MUDC 1KYOD 1PZQA 2P58A 1L0LE 1VF5B 3DS5A 3PTZA 2O01H 1WT6A 5HGOA 5H2FH 3NFQA 2UWJE 2FFDB 2KB7P 1E5WA 2AXTH 2M5RA 1SQBE 3LW5J 4IFMA 3HE5B 4I6MC 1P84H 1OVVA 3O6QA 3E7KA 2EFJA 3GHGA 1SQBG 2Z46A 2KIKA 3KYQA 2CQ8A 1L4AD 2MKVA 1MUUA 1L0NK 2GDXA 4H0LD 2FBWC 2P9XA 5AVQB 2KGAA 2Q9IA 1RE3A 3JCUH 3VOPA 4OH8B 1NAYA 3II6A 2HYNA 2LXCB 3EJDA 1BSHA 4C7NA 2BCCE 1IFPA 2VLOA 3D71A 1PPJD 4PV1D 2M8RA 1UIXA 2O1JA 4H2YC 1YJNP 2M3BA 4TLFA 3V2PA 4RO0A 5AW4B 1NTZD 1FDIA 3WUVA 1S72P 1LTGC 5KLVE 2KGDA 1LWUA 2ZJSE 3M9BA 2N6YA 1URQA 1JOCA 2BEQD 3GZLA 3L70G 2H7HA 1OWAA 1GD2E 4U3FJ 2OARA 1JCCA 1FZCC 3E1RA 1XTGB 3RK3C 1KILB 2K2QA 2BCCG 4BPGA 1Q90D 5CHXA 2JJLA 7CEIA 5APVA 1IC2A 2P10A 5AVVB 4WY4C 2QIWA 2WWWA 5KJ7D 4R4MA 3AE7C 2XNXA 2V7QH 1RF1A 2BCCJ 3G28A 1WMKA 2YIUB 4NPFX 2QJKB 2Q7CA 3GHGB 2GUVA 2IZ1A 3HTKB 4UB6H 1HGVA 4H44B 4PH1A 2OYOA 4DG9A 1H88A 1KYOH 2AEFA 2FFDA 1AYIA 5KP7B 3RBXA 3CLQA 3QWOC 5BVZA 1IO4A 1NU1J 1AV1A 2XNDH 2N1TA 2WZ7A 2SPZA 2LTEA 1YTZT 1FZCA 4U0DA 3L75E 1J1EC 2FXOA 2W6AA 1VQ4P 3TNUA 4YPCA 5KLVK 4DJGA 2A45I 5AVRB 4L76A 1SQVJ 1NU1G 5APUA 1EDIA 1Z6MA 2FYZA 1L0ND 2EG5A 4QKOA 2K3RA 1NTZE 4COPA 1QGKB 1RH5B 3LW5H 4GDOA 5AW1B 3L74E 1MFZA 2MVVA 4Y99B 1YQ3C 4BPFA 3ABVC 4BXLA 4NEOA 1GXHA 3T97A 2QSIA 2B87A 1SQVD 4IPYA 2W27A 4WVZA 3H1JG 4L74A 3V2QA 3L71E 4Y99C 1OVUA 5GTIH 3CX5I 4OVNF 2QM8A 4JYCA 1SQPE 3AE5C 4BRYA 1Q7YQ 4PJ0H 2KSEA 5EW5E 5C39A 4I7ZC 2K0DX 1M7LA 1NTZK 4NPDA 3WUTA 3H1KD 2LKIA 3V4QA 2A06E 2L6EA 2FYUJ 4H0LC 2JGPA 2V4HA 1PPJG 3AE2C 2JKVA 2OYIA 3H1LE 3NY7B 2FYNB 3VMXA 3L73E 2QNWA 1PEOA 1LP1A 2E75C 1YYCA 2HODA 5E79H 1AQ5A 3RL0B 2AVAA 3HUSA 1N2DC 4PV1C 3DS4A 3VMAA 4I1LA 3L72G 2QE7H 2ZYAA 1NTKG 3RK2C 3H47A 2QVAA 1LTIC 2Y0EA 1K73Q 3CX5E 4JQ0D 2QJKC 3JCUE 3BCCG 1IJDB 1VPCA 1LTAC 2KLVA 2JP3A 2H8PD 2JEEA 3L71J 4EI2A 3K5BA 5EFWB 2KWLA 4H13B 5B5EH 1Z56A 1BDDA 3M9QA 5AW9B 2XZRA 3VMYA 4WY4B 1SFCB 3FX0A 3RK3D 1K9MQ 3P8MC 3PH0A 2C0WA 1EZVI 2YXRB 2E75B 3HD7A 3HYBA 3B5NA 1SFCC 2E5YA 1SVFA 3LMOA 2KOQA 4H0LB 1JTHA 2JU1A 1VKUA 2RKLA 1EZVG 2KZIA 4RESB 2IYOA 5JPAA 1U57A 5E79E 2FYUE 1L2PA 1D7MA 3A2AA 4IL6H 3WBHA 2R3CA 3EQ2A 4YTPC 2L5GB 3AEAC 2KODA 2FXPA 5M1BA 5CJ0A 1KILE 1X79B 2GZIA 1FZEA 3EFFK 3USSA 1SQXE 1J1DC 3S1KA 1KILC 1PPJE 1SFCD 2KW2A 2CK3H 2OTLP 3SWYA 1MKMA 2L0QA 1AQTA 2GA1A 3L35A 1LWUB 4DCKA 1EXIA 4W7ZA 1R5SA 4GODA 2O01N 2WSCH 5KAIH 1HBWA 3H1HJ 4GR2A 1G2CB 3AE4C 1HY8A 2A06G 2PEJA 1PGQA 5KLIC 3D6YA 1T2KD 3GKLC 1NYHA 1T8ZA 1OR5A 2H89C 2Z45A 2XV6A 4D6TD 1Y8AA 4O9BA 3I5CA 2FQ2A 2B88A 3P7KA 1JCDA 5KKZB 4EOTA 5F2KA 3AEFC 3V2RA 3V6IA 2IBZI 2IFMA 4U0AA 3M9HA 2PAJA 1KFMA 2O01J 2E74B 1KQSO 1LNQA 1HTLC 1RY3A 2Y0DA 2KNCB 2L9FA 1RF1B 2JBGA 2JQ4A 1NOHA 2KOPA 1VQLP 1OW8A 3PHLA 3CWBE 1DV5A 1MZ8A 4IOIH 3LIEA 1NQ4A 3ZDMA 2AEJA 3CC2P 4BWNA 3G9RA 3G1GA 1JMBA 3HD7B 1PP9J 3M91A 3NTNA 1YJ9P 1FJKA 4LLHA 5CBNA 3TDKA 1T8KA 3IF4A 4K3AA 4LC1A 4H2WC 1Q86Q 4L75A 4WY4D 5DJTB 3WMM0 3DPHA 4HKZH 3U1AA 2E43A 3CXCO 3HRNA 1GW3A 2NO8A 2YO2A 4GOEA 2XXMA 1LT9C 4H44C 2R32A 4PD4D 1AFOA 1BDCA 2IBZE 2OYHC 4XA4A 2G3AA 3CCMP 4XE5B 3GLMA 2NZ2A 3AE8C 2WITA 1SQBJ 2CWOA 1BCCE 3OAKA 1KV4A 3V5BA 1P84E 1U7JA 3MGEA 3MGNA 1QRJA 1QL1A 1BE3E 2KG9A 1H0TA 1GW4A 5H2FE 1EZVE 4ASVA 1PGPA 1DIPA 1NTZJ 1SQPG 3D70A 3JC22 3CCRP 3V2NA 4PWVB 1VQ8P 2FHSC 2ZYGA 4GOFA 3HZQA 1FDMA 4ASWA 2JDIH 2GZGA 1BGYJ 3Q5RA 1HVVA 1VQ9P 3RK3B 2QRXA 2YMYA 3WU2E
chains in the Genus database with same CATH topology
1RO2A 1VQNP 4WYMA 1KQSO 2Z46A 3B5IA 2DGYA 3CC4P 4M0IA 3G28A 1PEQA 2E1MA 3DS1A 2PEQA 2L6EA 5I4TG 1Q82Q 3E2DA 3CCVP 1VQLP 3CCQP 1JJ2O 1M74A 3G0VA 2P9XA 5HGMA 1VQKP 1NJIQ 4XFXA 2JYGA 1A43A 2BUOA 2Z44A 5JPAA 1EOQA 3CMAP 3CPWO 4PH1A 2QEXP 2PENA 1VQOP 3CC2P 1KC8Q 1M6NA 2PEMA 3CCUP 3G1GA 1PEOA 1YI2P 3WBHA 2LF4A 3VRLC 2BHVA 2KODA 1M90Q 1YJ9P 4QNBA 2XT1A 3NTEA 1QVFO 3DS4A 1Q81Q 1M6EX 5BS1A 1Q86Q 1IUQA 2JYLA 4U0DA 1YITP 3CCSP 1PEUA 2PEKA 2EIAA 3M1MA 3CCJP 3DPHA 1YJWP 3RG6C 1YJNP 1VQ4P 3H47A 3G26A 3Q20A 3P05A 1YHQP 2M8PA 3DS0A 3CXCO 3G71P 1A8OA 1S72P 2OTLP 1K73Q 2XXMA 1M1KQ 1PEMA 3G21A 3G4SP 2ONTA 5DCKA 3CCEP 4U0EA 3I55P 1YIJP 3CCMP 1BAJA 1VQ7P 1E6JP 3I56P 3CMEP 1VQMP 1KD1Q 5BS2A 1K30A 3OW2O 2QA4P 2CWOA 4PH0A 1N8RQ 2EG5A 3LRYA 2OARA 4COPA 4XRQA 4XROA 3H0DA 2PY8A 3MGEA 4GR2A 4XFYA 1QRJA 2M8LA 1RNIA 1VQPP 3DS2A 1W2BO 3H4EA 3DS5A 3CC7P 4GR6A 2PEJA 3G6EP 3CD6P 3G1IA 1K9MQ 2PEIA 5HGNA 1VQ5P 3DS3A 4IPYA 5HGOA 1RO0A 2Z45A 1K8AQ 1EIAA 2XV6A 1D1DA 4U0CA 3CCRP 4U0BA 3G29A 1VQ8P 4COCA 2M8NA 3DTJA 2BQ1E 3HZQA 2PEOA 5F2KA 1ZMBA 1AUMA 3HYBA 5HGLA 5F2NA 3CCLP 4U0FA 1VQ6P 1Q7YQ 2OTJP 1VQ9P 4XFZA 2EFJA 4U0AA 2JO0A 1QVGO 5F2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 P;  3CC7 P;  1KC8 Q;  3CD6 P;  3G4S P;  3G6E P;  3CCU P;  1VQN P;  3CCE P;  1KQS O;  3I55 P;  1YI2 P;  1YIJ P;  3CC4 P;  3CCM P;  1K9M Q;  1VQ7 P;  3I56 P;  1VQ5 P;  1M90 Q;  1VQM P;  1YJ9 P;  3CME P;  1KD1 Q;  1K8A Q;  1Q82 Q;  1QVF O;  3CCV P;  3CCR P;  3CCQ P;  3OW2 O;  2QA4 P;  1K73 Q;  1JJ2 O;  1VQ8 P;  1VQL P;  1Q81 Q;  1Q86 Q;  1VQK P;  1N8R Q;  1YIT P;  3CCS P;  1NJI Q;  3CCJ P;  3CCL P;  1YJW P;  1YJN P;  1VQ4 P;  3CMA P;  1VQ6 P;  3CPW O;  1Q7Y Q;  2OTJ P;  1YHQ P;  1VQ9 P;  3CXC O;  2QEX P;  3G71 P;  1QVG O;  2OTL P;  1S72 P;  1VQO P;  1VQP P;  1W2B O;  1M1K Q; 
#chains in the Genus database with same CATH topology
 5GTH E;  1FZC B;  1EDL A;  2Q3E A;  3RGU A;  1N86 A;  2PEQ A;  2K37 A;  1M57 D;  1FC2 C;  1CW5 A;  4ZKU A;  3IN6 A;  2WPV B;  1L0I A;  4HKG A;  5AW3 B;  2FQ0 A;  2NPS A;  1BGY D;  2ZAE B;  3CX5 D;  2X2B A;  1CZQ A;  3C9I A;  2FYU K;  2YKP A;  3SSU A;  2BHV A;  3N7N A;  2OTK E;  1W2E A;  1VHN A;  2H88 C;  2VSQ A;  1JB0 J;  1YIT P;  2G8Y A;  1ZRT E;  3S4R A;  1RE4 A;  3RG6 C;  2RH0 A;  3LID A;  3Q20 A;  1P84 D;  3N4X A;  1PEM A;  5AVX B;  1K04 A;  1DEB A;  1RQV A;  1OXZ A;  3G4S P;  1EZV D;  1OW6 A;  1GL2 D;  2WSF H;  1IMQ A;  1KQG B;  2N1T D;  4OGQ C;  3H1I D;  3MZW B;  5HV8 A;  1JUN A;  2ZT9 D;  3WU2 H;  4H44 D;  3F89 A;  1SP4 A;  3H25 A;  2Q3I A;  4WWI A;  3BVH A;  2N9B A;  2WSC J;  1Q2N A;  2R5B A;  1ZR2 A;  1KB9 I;  3B8E B;  1JNM A;  3TGU D;  2JB0 A;  3A0B H;  1T2K C;  1PP9 D;  3GG2 A;  1N7L A;  3E1I A;  2BEZ F;  2PP6 A;  5KAI E;  1EDJ A;  4UHP B;  2NPS C;  3G29 A;  1FOS F;  2BQ1 E;  1LT9 B;  3CL3 D;  1AUM A;  1BSN A;  2JO1 A;  2L22 A;  1VF5 C;  3RBZ A;  1NH4 A;  3NXS A;  1CEI A;  2GUS A;  3BCC E;  2DGY A;  1L0L J;  4YXW H;  1KIL D;  3AEE C;  1Q82 Q;  2YXQ B;  1SQQ J;  1RE4 C;  1IFI A;  3AEC C;  1H0T B;  2FY8 A;  2WSF J;  1FR2 A;  1PGJ A;  5CJ4 A;  2J5U A;  3B4S A;  2E42 A;  1YI2 P;  4PD4 I;  1NTM E;  1RF1 C;  2I1K A;  1QVF O;  1KB9 E;  1K05 A;  1BGY E;  3B71 A;  3M1M A;  1SLQ A;  1GDT A;  1NU1 D;  2KS1 B;  1OVR A;  5HVC A;  1RF0 A;  1DD3 A;  3P8C D;  1JM0 A;  3IFM A;  3HUS B;  5CCG D;  1DEE G;  4F37 A;  4PH0 A;  3PJS K;  2N1T C;  3GF7 A;  3WUU A;  5APQ A;  2PY8 A;  1XTC C;  1G2C A;  2KK7 A;  3AEG C;  3GZM A;  1KQL A;  3O6Q B;  1HGZ A;  5B5E E;  2Q1K A;  4B86 A;  4HYT B;  1L0L K;  2A06 D;  2FVA A;  2IYP A;  4JF7 A;  2PFX A;  2LL8 A;  1ZN5 A;  2RN0 A;  5AVS B;  4U0F A;  1VQ6 P;  2Z5H A;  3OA7 A;  1L4A C;  5F2O A;  1JY2 N;  2E5T A;  3L36 A;  3TGU E;  1F80 D;  2B89 A;  3CX5 H;  3L75 D;  2ZYD A;  2MY5 A;  1S4X A;  1ZME C;  3MHV A;  2Z4E A;  4DOJ A;  2QM7 A;  2YNY A;  2P67 A;  1M74 A;  3MIW A;  3FXD A;  5TIS E;  1QEX A;  2FAE A;  3H1I J;  2MF4 A;  3CXH I;  1M8O B;  1M6N A;  1N7S A;  3A7O A;  1HQB A;  4U7J A;  1JTH B;  2ZVN B;  3P32 A;  2WSE J;  3TK1 A;  5K5G B;  2K93 A;  4HH2 A;  5AVZ B;  3TSI A;  2OYH B;  2KOO A;  2GZF A;  2JYL A;  1JO5 A;  2CGQ A;  3RG2 A;  2MJZ A;  3BAT A;  1SQB K;  1YHQ P;  2H43 A;  2KR5 A;  4A7P A;  1CI6 B;  3C1L A;  2K92 A;  3QH9 A;  3H6P A;  5TIS H;  4OGQ D;  2AFD A;  2D2C B;  2GZJ A;  3RL0 D;  3HD7 C;  5GTI E;  2LIW A;  1U7M A;  2R5D A;  1SFC A;  3H0D A;  2CG5 B;  4LGD E;  3L75 G;  2M0B A;  2ITA A;  3CD6 P;  1NTM J;  2M3E A;  1LT1 A;  2Q6Q A;  2O3J A;  3U1C A;  1S3J A;  1Y47 A;  2Y9Y A;  3L73 D;  2BCC D;  2CNR A;  3CXH H;  1YTZ I;  5HGL A;  1LTB C;  5KKZ C;  1VQN P;  1NTM G;  2GDY A;  5KLV G;  3CC4 P;  2XDJ A;  3EJB A;  3UIA A;  4I2L C;  3RL0 C;  3O8Z A;  4RJT A;  1JJ2 O;  3SWF A;  3H1K J;  2PGD A;  1CI6 A;  1NU1 E;  4PXH B;  3Q5P A;  2QJP B;  5KLV J;  2IX7 C;  1X9V A;  3FGA D;  3H1K E;  3A0H E;  3L70 J;  2LML A;  2I8D A;  2KOS A;  2W83 C;  1Q81 Q;  3M0D A;  2AXC A;  2HG5 D;  2MD9 A;  1PEU A;  2EIA A;  1A02 J;  3H1H D;  3H1K G;  1J1D B;  1MZ9 A;  4U0E A;  1S9K D;  2K5X A;  1USD A;  2KXP B;  2M5A B;  3B4Q A;  3T97 B;  1M1J B;  4PJ0 E;  3H32 B;  5APY A;  2L4B A;  1USE A;  3L72 E;  4XRO A;  3HD7 D;  4XFY A;  2LKM A;  3H1J D;  1KIL A;  4HJG H;  1FZG A;  2HFE D;  5CCG A;  1N73 A;  1PV3 A;  4Y28 J;  1EIA A;  2RMZ A;  5KAF E;  4U0B A;  1ZR4 A;  2M8N A;  1R8E A;  2PEO A;  4U3F G;  2EHS A;  1ZMB A;  1SQQ K;  3MUD A;  4KJM A;  1RHZ B;  1EQ7 A;  3RK2 D;  3C8V A;  2OQQ A;  5L8R J;  2O1K A;  5HGM A;  2K1A A;  3HTK A;  1A43 A;  1N7S B;  1ZP0 C;  2K94 A;  2JAZ A;  1URQ B;  2WPQ A;  2FAC A;  2IBZ G;  3FWL A;  1DX7 A;  1KC8 Q;  2FXM A;  5KTB A;  3CCU P;  3GHG C;  2N6Z A;  1R5L A;  1GPJ A;  2YO3 A;  4W7Y A;  1SQV G;  2JWD A;  2ZVO B;  2NPS D;  5KP6 B;  2N5H A;  1L0L G;  2ZXE B;  2PEK A;  4UB6 E;  4C7N B;  2KI7 B;  2ERH A;  1SQQ G;  3L71 D;  1N73 C;  3IR9 A;  1RE3 C;  1GU4 A;  2MR8 A;  2IZ0 A;  1YIJ P;  1LJ2 A;  1VQ7 P;  1NWQ A;  5BS2 A;  2E74 D;  2A45 H;  3BAS A;  2QA4 P;  3B5N C;  4EYY Q;  1N8R Q;  4IL6 X;  3LRY A;  3ITK A;  1FZA A;  1HJ0 A;  1SQX G;  3G6E P;  1AJY A;  4H2X C;  3EWK A;  1OW7 A;  3HE5 A;  5KLV D;  2OYH A;  1LWU C;  3L72 D;  4WB4 A;  3VMZ A;  2WSS H;  4GT1 A;  1ZOY C;  2WPS A;  4IZ6 A;  2AXT E;  1BE3 D;  1N7S D;  2N9Y B;  5EJD A;  1PEQ A;  1KZU B;  3DS1 A;  1FU1 A;  2K0X A;  2BAS A;  3CCV P;  3CCQ P;  2LPK A;  3RL0 g;  3L72 J;  3V4W A;  3SWK A;  4NPE A;  4DT0 A;  2BUO A;  3L74 G;  3Q1M A;  4M3L A;  1GL2 B;  4WY4 A;  1H8A A;  2JR8 A;  1IFD A;  2XU6 A;  2PEN A;  1GTW A;  1VQO P;  2CPS A;  1KFN A;  5B66 H;  1P84 I;  2HOD B;  3VRL C;  5B66 E;  3H1J E;  2KNC A;  3H1I E;  3L71 G;  1ZV8 A;  2CPB A;  3PRJ A;  1L0H A;  3KHU A;  2KSJ A;  3F5H A;  2C0X A;  1VF5 D;  3CWB G;  1NO4 A;  2Y0C A;  1J1E B;  1SQB D;  1BCC D;  2FFD C;  3VTP C;  3I56 P;  1KB9 D;  3CME P;  2ROQ A;  2KGE A;  1HJB A;  4U3F E;  1L0N G;  2JU2 A;  5CCH D;  1BCC J;  1NTK J;  1DD4 A;  3L4F A;  3AED C;  3GJN A;  4PD4 H;  1N73 B;  4H13 C;  1G1I A;  3CE7 A;  2V7Q J;  3NMD A;  2K9J A;  3A0B E;  3BCC J;  1BE3 J;  5GTH H;  1GL2 A;  5APT A;  2KG6 A;  5APW A;  2WPR A;  2KZJ A;  4IFF A;  1YQ4 C;  1T3U A;  1BCC G;  5AW8 B;  1EMV A;  2AF8 A;  1NAF A;  1QVG O;  4D6T G;  1PGO A;  2ZXX A;  3RK2 B;  1BXI A;  3VN0 A;  4EDF A;  3VP9 A;  1GMJ A;  3HE4 B;  1HF9 A;  4HB1 A;  1BE3 G;  1IFM A;  3AE9 C;  4DZO A;  2IDB A;  4JYB A;  2WVR A;  1EDK A;  2KYV A;  1SQX K;  1X8Y A;  5KLI B;  3U43 A;  4XFJ A;  1SQQ E;  1TU3 F;  1KQF B;  4Z1M H;  2QEX P;  3M0A A;  1RF0 C;  2GDW A;  3R4Y A;  2LF4 A;  4MN4 C;  3MP7 B;  5BU8 B;  1X22 A;  4AQR D;  4CPG A;  2POH A;  3SFE C;  1KTM A;  2W8Z A;  2FVE A;  1GXG A;  1J2J B;  1PIX A;  3H1H G;  1AVO A;  1KOR A;  3G71 P;  3A0H H;  3B5N B;  3G21 A;  1ZRT D;  1GL2 C;  2LIU A;  3AE6 C;  4W80 A;  5DJU B;  1FOS E;  1DH3 A;  1E6J P;  2M5A A;  2GM4 A;  2IFN A;  1M1J C;  2HPC A;  1E79 H;  3EJE A;  3IAO A;  4N6J A;  4C46 A;  1FE6 A;  3B5N D;  2W6B A;  3H32 A;  3VYI A;  2XV5 A;  2B87 B;  1RNI A;  1VQP P;  2N5I A;  1T6A A;  2JWA A;  1Y9B A;  1GU5 A;  3G1I A;  3GW6 A;  4BPH A;  2PEI A;  2KP8 A;  4TT3 H;  5AW2 B;  1SQP D;  1OMI A;  1IFJ A;  3D6Z A;  5KAF H;  4COC A;  1JEK A;  2Q5U A;  1URQ C;  4PD4 E;  2P7J A;  2PNG A;  1N7S C;  2K9J B;  2R3S A;  4XFZ A;  4GKG A;  2E76 D;  2JO0 A;  3L73 G;  1SQQ D;  5KP8 B;  1UJZ A;  1PP9 G;  4OWF A;  3KPE A;  1NTK E;  1FDO A;  1VQK P;  4XFX A;  4AUW A;  1OFC X;  3M06 A;  3CPW O;  1SQV E;  3OJA B;  3L73 J;  2PEM A;  1M1J A;  3L37 A;  1L4A A;  4UB8 H;  1NKZ B;  2MVU A;  1ACP A;  3BCC D;  2YKO A;  2XT1 A;  5AVW B;  1OZH A;  3A5T A;  2HR3 A;  3L75 J;  1KB9 H;  1URQ D;  1S5L H;  3FWN A;  1GK4 A;  2WTY A;  3G3Z A;  1FBM A;  2AFE A;  4UB8 E;  5APX A;  3DS0 A;  2E76 C;  2AEM A;  5CZD B;  1HUC A;  2K9Y A;  5DCK A;  1PP9 E;  1A02 F;  2XZ0 D;  1NTZ G;  1SQP J;  2YMK A;  4PV1 B;  2IPP A;  1JY3 N;  1QLE D;  3AE3 C;  3KXD A;  1BGY G;  4ZNC A;  2R44 A;  1JY3 P;  1LGH B;  1FJP A;  3BRV B;  2KUB A;  1NGM B;  2FYN C;  1W2B O;  3H4E A;  3CC7 P;  1JY3 O;  3A3Y B;  3H1L D;  1FAV A;  1KLP A;  3R2P A;  2KOR A;  1IK9 A;  4WBA A;  4ZKP A;  3P8C E;  1JY2 O;  1D1D A;  3CXH E;  4MRT C;  2FKW B;  2GYK A;  3DTJ A;  3PP5 A;  2GZE A;  2FYU D;  4I7Z B;  5AVT B;  1EC5 A;  2N1T B;  3GF3 A;  2WQY C;  2VLP A;  1NTM D;  1CSB A;  3HUS C;  2QG4 A;  2P1J A;  2E1M A;  3U59 A;  5I4T G;  2ZT9 C;  4GIF A;  2K88 A;  3G0V A;  3Q2Y A;  2Y9Z A;  3KZI E;  4K35 A;  3EFG A;  2Z44 A;  2HLO A;  3H1J J;  3SFD C;  5CBO A;  1LTT C;  3L74 D;  1AA0 A;  1M90 Q;  3CI9 A;  4IL6 E;  1PL5 A;  1LP1 B;  4EIJ A;  1SS1 A;  1ZLL A;  2KOG A;  5CMZ A;  1SQP K;  1VL2 A;  2QJP C;  3KZI H;  4KHX A;  3VP8 A;  2M8P A;  3CWB D;  2OYI C;  4R0M A;  1A8O A;  4ZMD A;  2XZ1 C;  5CCG C;  1AVY A;  2ONT A;  1UNK A;  1L0N E;  2D2C C;  3CXH D;  3GMA A;  1RQU A;  1VQM P;  4BRY B;  1KD1 Q;  1HWT C;  1IMP A;  2LXB A;  5TJH A;  3L70 D;  4N78 E;  5AW0 B;  3OW2 O;  2IBZ D;  1FZB A;  3TF5 A;  3M0D C;  2VLQ A;  3L70 E;  4N78 D;  1X3O A;  1WRG A;  3DS2 A;  1ZW0 A;  4JBZ A;  4GR6 A;  2K0Y A;  1IZN B;  2NRG A;  2N98 A;  5HGN A;  1OIP A;  2L91 A;  1EXJ A;  1VQ5 P;  5APS A;  1JY2 P;  1K8A Q;  2YIU C;  1NTK K;  1X0T A;  2C9L Y;  5F2N A;  3CCL P;  2E76 B;  2QJY B;  1S1C X;  2QJY C;  3TYY A;  1GK6 A;  3AEB C;  4WYM A;  2WT7 A;  4M0I A;  2WMM A;  4KT0 J;  3E2D A;  1NU1 K;  5AVY B;  1MFT A;  1IK7 A;  2LOL A;  2VLN A;  1S2E A;  3S9O A;  2FVF A;  4R4L A;  1SQX D;  5KJ7 A;  4H13 D;  2VRS A;  2WSE H;  1KYO E;  1OX3 A;  3MD0 A;  3H1H E;  5AW7 B;  3Q3D A;  3KQG A;  3NTE A;  2NPS B;  4D6T J;  1SQX J;  1M6E X;  2ZFC A;  4QMA A;  5AVU B;  4IFD K;  1DNY A;  1E0H A;  3W67 A;  4JPZ B;  2OYI B;  1YJW P;  2W6J H;  2KS1 A;  5CCH A;  3P05 A;  2FQ1 A;  1HH0 A;  4D6T E;  1M1K Q;  1ZXG A;  1UII A;  2B9B A;  3TGU G;  2YKQ A;  3PLN A;  1L0L D;  3I55 P;  1M56 D;  1YBK A;  1BAJ A;  2WT7 B;  1NTM K;  3AE1 C;  1K30 A;  2EHT A;  1JMM A;  1VDF A;  1KMI Z;  4OGQ B;  3RK3 E;  5BU5 A;  2C9N Y;  2XKM A;  3HE4 A;  4XRQ A;  1G1J A;  2LR2 A;  2FYU G;  2M8L A;  1KN7 A;  2KLU A;  1L4A B;  1LTJ A;  1SQV K;  2OGU A;  3TGU J;  3FXE A;  1T3J A;  2ZT9 B;  1PFI A;  2A45 G;  3DS3 A;  3L74 J;  1RO0 A;  4U0C A;  2Z5I A;  1KYO I;  2J58 A;  3H1L G;  1H89 A;  5KJ7 C;  1LTS C;  2OTJ P;  5AW6 B;  2DW3 A;  4CA3 A;  2MR7 A;  2WPT A;  2FAD A;  3TNU B;  1QL2 A;  4AYC A;  1RO2 A;  4U3F D;  1AF8 A;  3JSV C;  3B5I A;  4RKU J;  2KG8 A;  2W90 A;  2PRR A;  3CWB J;  1S5L E;  4N3Y B;  3Q5S A;  1FS0 E;  5CCH C;  2KGC A;  3H1L J;  1ZNV A;  1NJI Q;  2JYG A;  1LT9 A;  1EOQ A;  3CMA P;  1NHL A;  4YXD C;  1S5L X;  4L73 A;  1L0N J;  1FZF A;  4QNB A;  1NKN A;  2HPC B;  5AW5 B;  1GZL A;  2J59 M;  3BRT B;  2E75 D;  5BS1 A;  1IUQ A;  1IFN A;  3CCS P;  3KDP B;  3CCJ P;  1NTK D;  2DNW A;  1MV8 A;  1LTJ C;  3G26 A;  3MTU E;  2N50 A;  3H1I G;  1LTJ B;  1QX8 A;  3CCE P;  3W68 A;  2D2C D;  2I1J A;  2P2U A;  4C7R A;  2E74 C;  1W5C E;  1S9K E;  1NVO A;  3MUD C;  1KYO D;  1PZQ A;  2P58 A;  1L0L E;  1VF5 B;  3DS5 A;  3PTZ A;  2O01 H;  1WT6 A;  5HGO A;  5H2F H;  3NFQ A;  2UWJ E;  2FFD B;  2KB7 P;  1E5W A;  2AXT H;  2M5R A;  1SQB E;  3LW5 J;  4IFM A;  3HE5 B;  4I6M C;  1P84 H;  1OVV A;  3O6Q A;  3E7K A;  2EFJ A;  3GHG A;  1SQB G;  2Z46 A;  2KIK A;  3KYQ A;  2CQ8 A;  1L4A D;  2MKV A;  1MUU A;  1L0N K;  2GDX A;  4H0L D;  2FBW C;  2P9X A;  5AVQ B;  2KGA A;  2Q9I A;  1RE3 A;  3JCU H;  3VOP A;  4OH8 B;  1NAY A;  3II6 A;  2HYN A;  2LXC B;  3EJD A;  1BSH A;  4C7N A;  2BCC E;  1IFP A;  2VLO A;  3D71 A;  1PPJ D;  4PV1 D;  2M8R A;  1UIX A;  2O1J A;  4H2Y C;  1YJN P;  2M3B A;  4TLF A;  3V2P A;  4RO0 A;  5AW4 B;  1NTZ D;  1FDI A;  3WUV A;  1S72 P;  1LTG C;  5KLV E;  2KGD A;  1LWU A;  2ZJS E;  3M9B A;  2N6Y A;  1URQ A;  1JOC A;  2BEQ D;  3GZL A;  3L70 G;  2H7H A;  1OWA A;  1GD2 E;  4U3F J;  2OAR A;  1JCC A;  1FZC C;  3E1R A;  1XTG B;  3RK3 C;  1KIL B;  2K2Q A;  2BCC G;  4BPG A;  1Q90 D;  5CHX A;  2JJL A;  7CEI A;  5APV A;  1IC2 A;  2P10 A;  5AVV B;  4WY4 C;  2QIW A;  2WWW A;  5KJ7 D;  4R4M A;  3AE7 C;  2XNX A;  2V7Q H;  1RF1 A;  2BCC J;  3G28 A;  1WMK A;  2YIU B;  4NPF X;  2QJK B;  2Q7C A;  3GHG B;  2GUV A;  2IZ1 A;  3HTK B;  4UB6 H;  1HGV A;  4H44 B;  4PH1 A;  2OYO A;  4DG9 A;  1H88 A;  1KYO H;  2AEF A;  2FFD A;  1AYI A;  5KP7 B;  3RBX A;  3CLQ A;  3QWO C;  5BVZ A;  1IO4 A;  1NU1 J;  1AV1 A;  2XND H;  2N1T A;  2WZ7 A;  2SPZ A;  2LTE A;  1YTZ T;  1FZC A;  4U0D A;  3L75 E;  1J1E C;  2FXO A;  2W6A A;  1VQ4 P;  3TNU A;  4YPC A;  5KLV K;  4DJG A;  2A45 I;  5AVR B;  4L76 A;  1SQV J;  1NU1 G;  5APU A;  1EDI A;  1Z6M A;  2FYZ A;  1L0N D;  2EG5 A;  4QKO A;  2K3R A;  1NTZ E;  4COP A;  1QGK B;  1RH5 B;  3LW5 H;  4GDO A;  5AW1 B;  3L74 E;  1MFZ A;  2MVV A;  4Y99 B;  1YQ3 C;  4BPF A;  3ABV C;  4BXL A;  4NEO A;  1GXH A;  3T97 A;  2QSI A;  2B87 A;  1SQV D;  4IPY A;  2W27 A;  4WVZ A;  3H1J G;  4L74 A;  3V2Q A;  3L71 E;  4Y99 C;  1OVU A;  5GTI H;  3CX5 I;  4OVN F;  2QM8 A;  4JYC A;  1SQP E;  3AE5 C;  4BRY A;  1Q7Y Q;  4PJ0 H;  2KSE A;  5EW5 E;  5C39 A;  4I7Z C;  2K0D X;  1M7L A;  1NTZ K;  4NPD A;  3WUT A;  3H1K D;  2LKI A;  3V4Q A;  2A06 E;  2L6E A;  2FYU J;  4H0L C;  2JGP A;  2V4H A;  1PPJ G;  3AE2 C;  2JKV A;  2OYI A;  3H1L E;  3NY7 B;  2FYN B;  3VMX A;  3L73 E;  2QNW A;  1PEO A;  1LP1 A;  2E75 C;  1YYC A;  2HOD A;  5E79 H;  1AQ5 A;  3RL0 B;  2AVA A;  3HUS A;  1N2D C;  4PV1 C;  3DS4 A;  3VMA A;  4I1L A;  3L72 G;  2QE7 H;  2ZYA A;  1NTK G;  3RK2 C;  3H47 A;  2QVA A;  1LTI C;  2Y0E A;  1K73 Q;  3CX5 E;  4JQ0 D;  2QJK C;  3JCU E;  3BCC G;  1IJD B;  1VPC A;  1LTA C;  2KLV A;  2JP3 A;  2H8P D;  2JEE A;  3L71 J;  4EI2 A;  3K5B A;  5EFW B;  2KWL A;  4H13 B;  5B5E H;  1Z56 A;  1BDD A;  3M9Q A;  5AW9 B;  2XZR A;  3VMY A;  4WY4 B;  1SFC B;  3FX0 A;  3RK3 D;  1K9M Q;  3P8M C;  3PH0 A;  2C0W A;  1EZV I;  2YXR B;  2E75 B;  3HD7 A;  3HYB A;  3B5N A;  1SFC C;  2E5Y A;  1SVF A;  3LMO A;  2KOQ A;  4H0L B;  1JTH A;  2JU1 A;  1VKU A;  2RKL A;  1EZV G;  2KZI A;  4RES B;  2IYO A;  5JPA A;  1U57 A;  5E79 E;  2FYU E;  1L2P A;  1D7M A;  3A2A A;  4IL6 H;  3WBH A;  2R3C A;  3EQ2 A;  4YTP C;  2L5G B;  3AEA C;  2KOD A;  2FXP A;  5M1B A;  5CJ0 A;  1KIL E;  1X79 B;  2GZI A;  1FZE A;  3EFF K;  3USS A;  1SQX E;  1J1D C;  3S1K A;  1KIL C;  1PPJ E;  1SFC D;  2KW2 A;  2CK3 H;  2OTL P;  3SWY A;  1MKM A;  2L0Q A;  1AQT A;  2GA1 A;  3L35 A;  1LWU B;  4DCK A;  1EXI A;  4W7Z A;  1R5S A;  4GOD A;  2O01 N;  2WSC H;  5KAI H;  1HBW A;  3H1H J;  4GR2 A;  1G2C B;  3AE4 C;  1HY8 A;  2A06 G;  2PEJ A;  1PGQ A;  5KLI C;  3D6Y A;  1T2K D;  3GKL C;  1NYH A;  1T8Z A;  1OR5 A;  2H89 C;  2Z45 A;  2XV6 A;  4D6T D;  1Y8A A;  4O9B A;  3I5C A;  2FQ2 A;  2B88 A;  3P7K A;  1JCD A;  5KKZ B;  4EOT A;  5F2K A;  3AEF C;  3V2R A;  3V6I A;  2IBZ I;  2IFM A;  4U0A A;  3M9H A;  2PAJ A;  1KFM A;  2O01 J;  2E74 B;  1KQS O;  1LNQ A;  1HTL C;  1RY3 A;  2Y0D A;  2KNC B;  2L9F A;  1RF1 B;  2JBG A;  2JQ4 A;  1NOH A;  2KOP A;  1VQL P;  1OW8 A;  3PHL A;  3CWB E;  1DV5 A;  1MZ8 A;  4IOI H;  3LIE A;  1NQ4 A;  3ZDM A;  2AEJ A;  3CC2 P;  4BWN A;  3G9R A;  3G1G A;  1JMB A;  3HD7 B;  1PP9 J;  3M91 A;  3NTN A;  1YJ9 P;  1FJK A;  4LLH A;  5CBN A;  3TDK A;  1T8K A;  3IF4 A;  4K3A A;  4LC1 A;  4H2W C;  1Q86 Q;  4L75 A;  4WY4 D;  5DJT B;  3WMM 0;  3DPH A;  4HKZ H;  3U1A A;  2E43 A;  3CXC O;  3HRN A;  1GW3 A;  2NO8 A;  2YO2 A;  4GOE A;  2XXM A;  1LT9 C;  4H44 C;  2R32 A;  4PD4 D;  1AFO A;  1BDC A;  2IBZ E;  2OYH C;  4XA4 A;  2G3A A;  3CCM P;  4XE5 B;  3GLM A;  2NZ2 A;  3AE8 C;  2WIT A;  1SQB J;  2CWO A;  1BCC E;  3OAK A;  1KV4 A;  3V5B A;  1P84 E;  1U7J A;  3MGE A;  3MGN A;  1QRJ A;  1QL1 A;  1BE3 E;  2KG9 A;  1H0T A;  1GW4 A;  5H2F E;  1EZV E;  4ASV A;  1PGP A;  1DIP A;  1NTZ J;  1SQP G;  3D70 A;  3JC2 2;  3CCR P;  3V2N A;  4PWV B;  1VQ8 P;  2FHS C;  2ZYG A;  4GOF A;  3HZQ A;  1FDM A;  4ASW A;  2JDI H;  2GZG A;  1BGY J;  3Q5R A;  1HVV A;  1VQ9 P;  3RK3 B;  2QRX A;  2YMY A;  3WU2 E; 
#chains in the Genus database with same CATH homology
 1RO2 A;  1VQN P;  4WYM A;  1KQS O;  2Z46 A;  3B5I A;  2DGY A;  3CC4 P;  4M0I A;  3G28 A;  1PEQ A;  2E1M A;  3DS1 A;  2PEQ A;  2L6E A;  5I4T G;  1Q82 Q;  3E2D A;  3CCV P;  1VQL P;  3CCQ P;  1JJ2 O;  1M74 A;  3G0V A;  2P9X A;  5HGM A;  1VQK P;  1NJI Q;  4XFX A;  2JYG A;  1A43 A;  2BUO A;  2Z44 A;  5JPA A;  1EOQ A;  3CMA P;  3CPW O;  4PH1 A;  2QEX P;  2PEN A;  1VQO P;  3CC2 P;  1KC8 Q;  1M6N A;  2PEM A;  3CCU P;  3G1G A;  1PEO A;  1YI2 P;  3WBH A;  2LF4 A;  3VRL C;  2BHV A;  2KOD A;  1M90 Q;  1YJ9 P;  4QNB A;  2XT1 A;  3NTE A;  1QVF O;  3DS4 A;  1Q81 Q;  1M6E X;  5BS1 A;  1Q86 Q;  1IUQ A;  2JYL A;  4U0D A;  1YIT P;  3CCS P;  1PEU A;  2PEK A;  2EIA A;  3M1M A;  3CCJ P;  3DPH A;  1YJW P;  3RG6 C;  1YJN P;  1VQ4 P;  3H47 A;  3G26 A;  3Q20 A;  3P05 A;  1YHQ P;  2M8P A;  3DS0 A;  3CXC O;  3G71 P;  1A8O A;  1S72 P;  2OTL P;  1K73 Q;  2XXM A;  1M1K Q;  1PEM A;  3G21 A;  3G4S P;  2ONT A;  5DCK A;  3CCE P;  4U0E A;  3I55 P;  1YIJ P;  3CCM P;  1BAJ A;  1VQ7 P;  1E6J P;  3I56 P;  3CME P;  1VQM P;  1KD1 Q;  5BS2 A;  1K30 A;  3OW2 O;  2QA4 P;  2CWO A;  4PH0 A;  1N8R Q;  2EG5 A;  3LRY A;  2OAR A;  4COP A;  4XRQ A;  4XRO A;  3H0D A;  2PY8 A;  3MGE A;  4GR2 A;  4XFY A;  1QRJ A;  2M8L A;  1RNI A;  1VQP P;  3DS2 A;  1W2B O;  3H4E A;  3DS5 A;  3CC7 P;  4GR6 A;  2PEJ A;  3G6E P;  3CD6 P;  3G1I A;  1K9M Q;  2PEI A;  5HGN A;  1VQ5 P;  3DS3 A;  4IPY A;  5HGO A;  1RO0 A;  2Z45 A;  1K8A Q;  1EIA A;  2XV6 A;  1D1D A;  4U0C A;  3CCR P;  4U0B A;  3G29 A;  1VQ8 P;  4COC A;  2M8N A;  3DTJ A;  2BQ1 E;  3HZQ A;  2PEO A;  5F2K A;  1ZMB A;  1AUM A;  3HYB A;  5HGL A;  5F2N A;  3CCL P;  4U0F A;  1VQ6 P;  1Q7Y Q;  2OTJ P;  1VQ9 P;  4XFZ A;  2EFJ A;  4U0A A;  2JO0 A;  1QVG O;  5F2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...