1YHQP

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yhqP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yhqP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yhqP02
1YITP 3CCMP 1VQ4P 3I55P 1N8RQ 3CCRP 1M90Q 1Q81Q 1QVFO 3CMAP 1VQOP 1Q86Q 1VQPP 1K9MQ 1YI2P 1YIJP 1Q7YQ 1QVGO 3CXCO 2QA4P 3CCJP 1VQNP 2OTJP 1VQ5P 3CCVP 2QEXP 1VQ9P 1W2BO 3CCSP 1YHQP 3OW2O 3CC2P 3G4SP 3CCQP 1YJWP 3G71P 1Q82Q 1YJNP 1VQ8P 3CC7P 3CC4P 3CCUP 1KD1Q 3CPWO 3CCEP 2OTLP 3I56P 1YJ9P 1M1KQ 1K8AQ 1VQ7P 1VQ6P 1K73Q 1KC8Q 1VQMP 1NJIQ 3G6EP 1KQSO 1JJ2O 1VQKP 3CMEP 3CD6P 1VQLP 3CCLP 1S72P
chains in the Genus database with same CATH superfamily
5KP7B 1PGQA 2E75B 4D6TE 2IBZE 1SQXG 1SQQE 2MY5A 2FYZA 3F89A 3CXCO 1S5LX 2XXMA 1FC2C 1SQVD 1BDDA 1QGKB 2P10A 2JP3A 3JC22 4UB6H 1KD1Q 2PEOA 1GDTA 3AE2C 3S9OA 1UIIA 3BRVB 1HUCA 3C1LA 4IOIH 3L72G 3MUDC 1GL2C 2LTEA 1GMJA 2XT1A 3RG2A 4L75A 1NU1K 3RGUA 1LT1A 2EHTA 4RJTA 3NTEA 1AA0A 3C9IA 1ZRTE 1L4AD 1HTLC 2A45H 2QJYB 2N1TB 1PPJG 3H1IE 3LRYA 2ZT9B 2O3JA 4DJGA 1OVRA 1Y9BA 1OMIA 1D7MA 3HE5A 1FOSF 2E43A 1CW5A 2K9JB 3V4WA 3RBXA 4EOTA 4PXHB 1T2KC 1LP1B 3H1ID 1JY2O 1JM0A 3L71G 5KLIB 1WT6A 2LPKA 4WVZA 1LTTC 1R5SA 1NU1D 2YKQA 3FX0A 4KJMA 2K93A 1KYOE 2FQ1A 1KMIZ 1KLPA 1N73C 2E76D 5KLVE 1M57D 1Z6MA 4R4MA 2WSFJ 3CD6P 2Y9YA 4HH2A 5DCKA 2AEJA 2M8NA 1SQBE 4L76A 2FAEA 2MF4A 3MIWA 1RQVA 2FADA 1ZOYC 4EDFA 1LJ2A 1EZVE 1AYIA 2V4HA 1L0NK 1URQD 4LGDE 2QM7A 1OVVA 2D2CB 3JCUE 1KQGB 2Z5HA 2JO1A 3L74D 4WY4B 1JNMA 3BASA 3CCUP 1WMKA 2L4BA 1TU3F 5CJ0A 3UIAA 1LTAC 4RESB 4OVNF 4CPGA 3KDPB 3M9BA 1BCCJ 4H0LB 1QRJA 3VMYA 3L71J 3BCCD 3CC2P 4U3FD 5BU5A 1Q82Q 5APXA 4COCA 1PFIA 5AVQB 3RL0B 2KGCA 4AUWA 1NHLA 2C0XA 3B5IA 1X22A 1L0HA 5DJTB 1IMPA 3IF4A 1VQOP 3L70J 1ZN5A 2KP8A 1FZEA 1DEBA 3ABVC 1FE6A 2YNYA 2FXOA 2P1JA 2NPSA 3AEBC 1MZ8A 4GKGA 1YJWP 2ZAEB 3HE4A 2A06D 3G6EP 1BSNA 2N98A 1JCCA 3VYIA 1Z56A 5DJUB 1NU1G 1KTMA 2M5RA 3Q20A 4N3YB 5APTA 4PH1A 4UB6E 4BXLA 2KG8A 1OFCX 4IFMA 5B66E 2KI7B 4YPCA 2H88C 1E79H 2YXRB 5CCHD 1VQLP 1J2JB 2CK3H 2YXQB 3E1IA 2PEMA 1N7SC 3S1KA 5AW2B 1SFCA 1PZQA 4GT1A 1OW7A 3P05A 1E5WA 5APVA 4C7NA 3MUDA 2O01H 1L4AB 3M0DC 1DIPA 3RK3B 1IJDB 5KAFH 2WZ7A 2OYIB 3P8MC 1L0NJ 2N50A 1RH5B 1PEUA 4JYCA 3TGUE 3L73E 2JO0A 2W8ZA 3AE3C 1FDIA 1CI6B 2Q6QA 1K30A 5EW5E 4QMAA 1RQUA 2FYUJ 1A8OA 3DS2A 4UB8H 2N5HA 4PD4H 4BPFA 2QEXP 1ZRTD 3RL0C 1PP9G 2MR7A 3G0VA 1FJPA 1NTKK 2LXCB 2VRSA 3AE6C 1JOCA 1NWQA 3QWOC 5AVYB 4H44B 3USSA 3H1HE 2GYKA 3CXHE 2GZJA 1HGZA 2YMYA 2E5YA 2LKMA 1SQPK 2BEQD 1GU5A 3L75E 4B86A 1T2KD 2KZJA 2K9JA 1PIXA 2LOLA 2C9LY 5CBOA 2BQ1E 2Q1KA 4D6TD 2K37A 3L74E 4C46A 5TJHA 1MFTA 4BPHA 1RNIA 1E6JP 3E2DA 2K1AA 1SQQJ 1L4AC 1DEEG 1N7LA 4WWIA 2GA1A 1SQVK 3B4QA 3CCQP 2E76B 1EZVG 1HWTC 1FOSE 1JEKA 1ZW0A 2W6AA 1JTHB 2JKVA 1JUNA 1OWAA 2BEZF 3VOPA 3HZQA 1H0TA 2QNWA 4PJ0E 2YKPA 4XA4A 3L74J 3P8CD 1LTGC 1GD2E 3L70E 1DD3A 1LT9A 1FZFA 4R0MA 4H13D 2N9BA 5KLVJ 1VDFA 1ZMEC 2P7JA 1NTKD 1KB9D 2KGEA 4U3FJ 2A06G 2KSJA 2ITAA 3VMZA 1AQ5A 2SPZA 1AQTA 4ZKPA 1RF1A 3H0DA 4U0DA 2FYUE 2FKWB 4PV1D 2M8LA 1VHNA 5AVVB 1YITP 1KILC 1GL2B 3JCUH 2FQ0A 3VMXA 2WPVB 2WPRA 1JMMA 3TGUJ 5APUA 3WUUA 5AW8B 2R44A 3MD0A 2XKMA 1K8AQ 1URQC 5GTIH 1ZP0C 2AFDA 5AW3B 2OGUA 3PRJA 2L6EA 2N6ZA 4U7JA 5AVSB 3H47A 1GK4A 2E75C 1USDA 2MVVA 2ZXXA 5M1BA 2FFDA 3RG6C 4I7ZC 2HFED 2BUOA 4OGQC 2WSSH 2ONTA 4IL6H 3AE1C 3CX5D 2D2CC 1HBWA 4QKOA 2A45I 1NTZK 2YIUB 3A0BE 5CZDB 1MFZA 2AVAA 4JQ0D 3L73D 1FU1A 1FZCA 1GPJA 2HPCA 1BXIA 2ERHA 1VQ5P 1KORA 1RF0C 4M0IA 3BCCE 1S3JA 2Q3IA 2Y0EA 1G1IA 4WB4A 1SQVG 3CPWO 2PEQA 1NTMG 3FWNA 1RY3A 3R2PA 1VQKP 1U57A 2JB0A 5CMZA 2VSQA 3GW6A 2QJKB 4GOEA 2Z44A 1GXHA 4Y99C 1YTZT 1L4AA 2WSEH 2B87A 1PL5A 2IPPA 2ZJSE 1YI2P 3CXHI 1EOQA 4XRQA 1DD4A 4GR6A 2N9YB 2FVFA 3U43A 1F80D 1SQXJ 1LTJA 2J5UA 1KB9I 3G29A 4HKZH 1AV1A 3H1HG 1SS1A 1BAJA 3H1KG 3H1IJ 2KXPB 3CX5H 5AW1B 1LTIC 3C8VA 1MKMA 2KB7P 2QJKC 1NYHA 1M6EX 5AVXB 1P84D 2N1TC 2FFDB 2WPQA 2WSCH 2QE7H 1NAFA 5AW5B 2B88A 3L70D 3CC4P 3L74G 1VQMP 1VF5B 1KILE 1SQBD 2KLVA 4GODA 4WY4A 1JY3O 3GHGB 1T6AA 2NPSC 1X8YA 2P2UA 1CEIA 4H0LD 1LNQA 2OTJP 2GZIA 3H6PA 1NTZD 1EIAA 2AF8A 4U0CA 2JWDA 4OGQB 1JJ2O 1R8EA 1ZLLA 1SQXD 2KOQA 2JAZA 1J1DC 2OARA 2YO3A 3D6YA 1OR5A 1KILA 1QX8A 2JEEA 3AEAC 2PEKA 4XFYA 5KJ7A 1NTZG 3DS3A 1QLED 1PP9D 1Y47A 1FDMA 1NVOA 3MP7B 5F2NA 3RK2D 1SFCC 2GZEA 2IFMA 4D6TG 5HVCA 3RK2C 2GDYA 2FYNC 2JYGA 3L35A 5BVZA 3CI9A 3O8ZA 3PHLA 2WTYA 2OTLP 5AW0B 3V2PA 4ASVA 1KC8Q 1E0HA 2CQ8A 5TISH 2VLNA 1S2EA 2IFNA 1AFOA 1LTJC 2R3SA 3R4YA 3Q5PA 3U59A 1IFJA 2A45G 1MZ9A 4OWFA 2FXPA 1EXJA 2LL8A 2J59M 1L0LE 1SLQA 3LIDA 2KG9A 3A0HH 2XNDH 1M90Q 4DOJA 1LT9C 2ZYGA 2W6JH 3CX5I 1SQQG 1YJNP 2KUBA 4AYCA 2WSEJ 2N1TD 5H2FE 4BRYB 2QM8A 3DPHA 2P9XA 4KHXA 1L0LJ 1P84H 1H89A 1OW6A 3L75J 5APYA 2ZXEB 1H88A 1JY2P 1IK7A 1KYOD 3SWKA 1IFDA 2HPCB 3TNUA 3B5NB 2FVAA 1GL2A 2JBGA 4D6TJ 3M9QA 3LMOA 2G3AA 3II6A 3H1LJ 1Y8AA 2H7HA 4F37A 2QIWA 2WT7B 1LWUC 1W5CE 4IFDK 3HTKA 2IDBA 1RO2A 2IZ0A 3CXHD 1SQXE 2L9FA 1QVFO 5GTHH 1Q86Q 2HLOA 1SQBK 3PLNA 3CCJP 4UB8E 1FBMA 1W2BO 3KZIH 1EXIA 1SP4A 1OZHA 2Q7CA 3A0BH 4BPGA 3H1LE 1IMQA 4JPZB 4H0LC 2PAJA 1SQXK 2XU6A 3PP5A 1S4XA 1J1DB 3H1KE 2NPSD 4XROA 2LXBA 1BCCD 3EFGA 2MJZA 3TNUB 4DCKA 1Q90D 1AVYA 4RKUJ 3B4SA 3IFMA 1NTME 1NTZE 2O01J 3BATA 1R5LA 1VQ6P 1G2CB 2ZFCA 1D1DA 2XZRA 4BRYA 2WPSA 2J58A 1USEA 2OYIC 1BGYE 2NPSB 4DG9A 4EI2A 1L0LK 3KYQA 1SQQD 2WWWA 5KLVK 2KOSA 5AVTB 1FZCB 3CWBE 3TF5A 2AXCA 3NFQA 3CCLP 3TGUD 5AW7B 4UHPB 5CJ4A 5CHXA 1JY3N 4XE5B 2PRRA 4U0EA 3Q2YA 2Y0CA 4NPEA 1M1JC 4ZNCA 2RN0A 1HY8A 2OYOA 1NTMJ 4PV1B 1U7JA 3PJSK 3T97B 2AEFA 4HB1A 2GDWA 1BE3G 3DS4A 2NRGA 2BASA 2QJYC 2MVUA 1EDLA 2BHVA 1NAYA 2OYIA 1VQ7P 1KB9H 4BWNA 5CCHA 2E5TA 2GM4A 2PP6A 1G2CA 1LTBC 2JU1A 2PGDA 1EQ7A 3RK2B 2VLOA 5AVRB 2K0YA 3EJBA 3M9HA 3H4EA 3HRNA 3L71D 4LLHA 2KW2A 2NZ2A 3AECC 3CC7P 4ZKUA 2E74C 3FXDA 3Q5SA 2YO2A 3G28A 1JO5A 1VKUA 3EFFK 2AEMA 1KILD 2JJLA 2ZYAA 1K05A 3P32A 3CXHH 1ZXGA 3H25A 4YTPC 3SFEC 4AQRD 3M06A 4JF7A 1FDOA 2GZGA 2YMKA 3EWKA 5CCGD 1N7SD 2BCCE 1ZR4A 3VRLC 2MR8A 5BS2A 3L73G 3L72D 2OYHA 1GW3A 5HGLA 2DGYA 4QNBA 2K3RA 3NTNA 2K2QA 4H13C 4WYMA 2IYPA 2KOGA 2KS1A 2Y0DA 1EMVA 2YKOA 3DS0A 3WUTA 3TSIA 3HD7B 3TYYA 1DV5A 1KQLA 4W7ZA 3V2RA 2O1KA 3G3ZA 1BGYD 2MD9A 1URQA 3P8CE 2EHSA 5KLIC 3ZDMA 1YTZI 3H1KD 4EYYQ 3U1CA 3P7KA 5KKZB 2V7QJ 2M8PA 4N6JA 2W6BA 2B87B 3LIEA 3B8EB 4W7YA 1PEQA 1L0NG 1PP9E 2R5BA 2WSFH 2ZT9C 3VP8A 1A02J 3HD7C 2H8PD 2W27A 1U7MA 1XTCC 2WITA 1FZBA 3G71P 4OH8B 5BS1A 1NJIQ 1KQSO 3W67A 5KP6B 2K0DX 3IN6A 2N1TA 1X9VA 4A7PA 5KJ7C 1UJZA 2N6YA 1ZR2A 2YIUC 5APWA 1NKNA 5CCHC 3WMM0 1RO0A 2I1KA 2O01N 1VQ8P 1EC5A 1WRGA 2JDIH 4I7ZB 3RL0D 1NOHA 1BCCG 3GJNA 1T3UA 3I55P 2Y9ZA 2CPSA 1URQB 1M7LA 2FYUK 3L75G 2GUVA 1FAVA 1HVVA 3LW5H 4U3FE 1EDKA 3PH0A 1PGOA 2LMLA 3AE9C 4ZMDA 4MRTC 1PP9J 3E7KA 1ZV8A 1GU4A 2UWJE 3L4FA 3VMAA 3G1IA 3G21A 1VQ4P 3LW5J 2IBZG 3SFDC 1UIXA 4Y28J 4YXWH 1PV3A 2FYUG 1LWUB 5CCGC 2WSCJ 2PEJA 5L8RJ 1NTMD 1KFNA 5KAIH 1M56D 2VLPA 5AW4B 3OA7A 3Q3DA 1LP1A 1S1CX 1S72P 1OIPA 2XV5A 3L72E 5BU8B 2IBZI 1YIJP 3H32B 3L73J 2KNCA 1YHQP 3OW2O 4HJGH 3V2QA 1EZVI 2K9YA 1GZLA 3Q1MA 1S9KE 1K73Q 4O9BA 1T8KA 2GUSA 1N7SB 2BCCJ 4KT0J 1IFPA 2C0WA 1JY3P 3CX5E 1N8RQ 4K35A 1GL2D 1VQPP 2HODA 1RF1C 1AUMA 3B5ND 4PD4I 1LWUA 2E76C 2L0QA 1FZCC 2M5AB 4LC1A 1JTHA 2WMMA 5APSA 5KTBA 2POHA 1S5LH 3N7NA 2K94A 3AE4C 5C39A 1A02F 3WU2H 1LTSC 1LTJB 2G8YA 2R3CA 1Q7YQ 2KSEA 3A7OA 1NU1J 3H32A 2BCCG 4C7RA 4TT3H 2AXTH 3DS5A 1RHZB 1M6NA 1HJ0A 1DNYA 3NY7B 3H1LD 1NKZB 3M0AA 1NQ4A 2FYUD 1J1EB 4TLFA 3M1MA 5KJ7D 2QG4A 3D71A 3OJAB 3TK1A 5TISE 3CL3D 1M74A 3BCCJ 4K3AA 1HF9A 2H43A 2KODA 5GTHE 1L2PA 3HUSA 4XFXA 3GHGA 1JCDA 1YJ9P 1GK6A 5HGNA 3HD7D 5B5EE 2M0BA 3D70A 3H1JE 1EDIA 1N7SA 3SWYA 3HE4B 4U0AA 5GTIE 1HGVA 3EJEA 1RE4C 3B71A 1J1EC 3O6QA 1IK9A 1L0NE 1VQNP 1IC2A 2M3BA 1KB9E 4PJ0H 1VL2A 1JB0J 1RE3C 2FXMA 2FACA 3B5NC 2EG5A 1CI6A 1OW8A 4NPDA 1M1JA 5APQA 1K9MQ 3G1GA 3SSUA 3RK3C 2XZ1C 1N86A 2IZ1A 2M3EA 1IFNA 2KLUA 2B89A 5E79E 4HKGA 1N73B 3CCEP 2JGPA 1EDJA 2FFDC 3CWBJ 3NXSA 3AEEC 1IFMA 1BE3D 3KXDA 1NTZJ 1K04A 2JYLA 2KG6A 1X3OA 1PGPA 3G4SP 1IFIA 3GLMA 1SQBJ 3IAOA 1BDCA 2CNRA 1FR2A 3A5TA 1G1JA 1RF0A 1ACPA 2K92A 3NMDA 4Y99B 2KR5A 4GOFA 2E74D 2IX7C 5KP8B 3AE5C 1M1KQ 3WUVA 3KHUA 4I1LA 3HUSB 5F2KA 2IBZD 2WPTA 1UNKA 3D6ZA 3I5CA 2Z46A 2V7QH 2LF4A 3GZMA 5EJDA 1P84E 3BVHA 3S4RA 1L0LG 2HYNA 4MN4C 1X79B 2LR2A 1DH3A 4U3FG 2FY8A 2FQ2A 3HYBA 5B5EH 5KAFE 1FZAA 3I56P 3FXEA 1KFMA 2WVRA 2CPBA 4I2LC 3OAKA 2P67A 4PD4D 2JWAA 3SWFA 2L5GB 5KAIE 3VN0A 5JPAA 1SQVJ 2P58A 4H2XC 4WY4C 2JR8A 3HTKB 3KZIE 2RKLA 1BSHA 3H1JD 2ZT9D 2EIAA 3RBZA 2Z5IA 2CG5B 2E75D 3GHGC 2GDXA 1KILB 1QVGO 1MUUA 1VF5C 2E1MA 4HYTB 2Z4EA 3H1KJ 4N78D 1H0TB 2KIKA 3HE5B 2K5XA 1IZNB 4GDOA 1X0TA 4Z1MH 1LGHB 3V4QA 3AEDC 2R32A 1IO4A 3MGEA 2QVAA 3GG2A 1YYCA 5HGOA 5B66H 2JQ4A 4PV1C 2KYVA 3H1JG 3L72J 5I4TG 4W80A 1KN7A 3T97A 4CA3A 3GZLA 1KYOI 3JSVC 2LIWA 3QH9A 1S9KD 2XV6A 7CEIA 1KZUB 1NH4A 5CBNA 2ZYDA 3K5BA 1Q81Q 2M8RA 2AXTE 2PFXA 3TGUG 2QA4P 3H1LG 1HJBA 3CCSP 2W90A 1N2DC 2QRXA 1AVOA 4PH0A 2NO8A 2HG5D 4DZOA 4N78E 3L37A 3CWBG 1NGMB 2Q5UA 2QJPC 2IYOA 2XNXA 2XDJA 4I6MC 1BE3J 5EFWB 3M0DA 2ZVOB 2CWOA 3O6QB 1GTWA 3V2NA 1SQQK 1PEMA 4XFJA 1YBKA 3GKLC 2OQQA 3G26A 2H89C 4WBAA 3TDKA 4COPA 4PD4E 2MKVA 3B5NA 3CLQA 3AE8C 1W2EA 2B9BA 4IL6E 1NTKJ 4H44C 1EZVD 2E74B 5HV8A 4WY4D 4L74A 1S5LE 2O1JA 2KGAA 2Z45A 3IR9A 4IL6X 1RE4A 3RL0g 1SQPG 1N73A 2PNGA 3EJDA 1BGYG 3W68A 5F2OA 3HUSC 3VP9A 1SVFA 2FBWC 2ROQA 1NTMK 3H1HJ 1CSBA 1NTKE 4IFFA 5HGMA 3G9RA 1CZQA 4DT0A 2OYHB 2A06E 2WT7A 1YQ4C 2BCCD 3M91A 4U0BA 2RH0A 1FZGA 2JU2A 2LIUA 1T8ZA 3CCVP 2I8DA 2KOPA 3H1HD 1M1JB 3DS1A 3BCCG 2HODB 3L70G 1QEXA 2VLQA 3GF7A 5CCGA 1KQFB 1Q2NA 2KOOA 3Q5RA 1LT9B 1RF1B 2KS1B 4R4LA 1BE3E 4L73A 1T3JA 4GR2A 2PEIA 1H8AA 2GZFA 5AW6B 4IPYA 1IUQA 2Q9IA 4NEOA 4PWVB 1L0LD 2AFEA 1M8OB 2WQYC 1OVUA 3A3YB 3CCMP 3N4XA 2QSIA 4M3LA 3CMAP 1SQVE 1RE3A 3AE7C 4C7NB 3KPEA 1DX7A 3V5BA 3L36A 2C9NY 1PPJD 2OYHC 3AEGC 3BRTB 1HQBA 3H1JJ 4NPFX 3A0HE 4H44D 1OX3A 3A2AA 3RK3E 3RK3D 2LKIA 2FYNB 3E1RA 4H2YC 2K0XA 1OXZA 1L0ND 3MTUE 1QL2A 3V6IA 1PPJE 3H1IG 2R5DA 2KK7A 2I1JA 3WBHA 3DTJA 3FGAD 1VF5D 2RMZA 1HH0A 1ZNVA 3ITKA 2FHSC 5KLVG 5AVWB 3L71E 1AJYA 3PTZA 2EFJA 3F5HA 4RO0A 1FS0E 2W83C 2ZVNB 2KZIA 2QJPB 1JY2N 1PGJA 1P84I 2X2BA 3MHVA 1SQBG 1KV4A 1BCCE 1PEOA 4YXDC 2FVEA 2HR3A 2XZ0D 5E79H 2KORA 3GF3A 1L0IA 2E42A 2KWLA 1AF8A 3CCRP 1JMBA 2M5AA 1XTGB 1GW4A 2D2CD 1SQPE 1BGYJ 1SQPD 2DW3A 3MZWB 2PY8A 1A43A 3KQGA 4ASWA 5KKZC 3U1AA 4OGQD 3GMAA 4JYBA 3L75D 3CWBD 2L91A 2DNWA 1SFCD 4GIFA 4IZ6A 2OTKE 1VQ9P 1SQPJ 4H2WC 1KYOH 3CE7A 3EQ2A 3MGNA 2K88A 1YQ3C 2Q3EA 4XFZA 3HD7A 1NO4A 5AW9B 4H13B 2N5IA 1VPCA 5KLVD 1NTKG 4EIJA 1QL1A 2PENA 1MV8A 1SFCB 2KGDA 5AVZB 1ZMBA 2L22A 2KNCB 5AVUB 3WU2E 4U0FA 1NU1E 5H2FH 3VTPC 2CGQA 3CMEP 3AEFC 1GXGA 5K5GB 1FJKA 3FWLA 4JBZA
chains in the Genus database with same CATH topology
2BQ1E 4PH0A 2L6EA 1N8RQ 1M90Q 3H47A 1VQPP 1K9MQ 3G1GA 3CXCO 1RNIA 1AUMA 3RG6C 2XXMA 1E6JP 3E2DA 5JPAA 2OTJP 4GR2A 2BUOA 1EIAA 1RO0A 2ONTA 2CWOA 2PEIA 1PEOA 3P05A 3CCQP 1YJNP 1VQ8P 4IPYA 3CCEP 3CCUP 1KD1Q 2PEOA 4U0CA 1PEMA 1JJ2O 1IUQA 3G26A 2EIAA 3CCLP 3VRLC 3DPHA 2P9XA 4COPA 5BS2A 3CCMP 3I55P 5HGLA 2OARA 2DGYA 2XT1A 3CCRP 4QNBA 3CMAP 3HZQA 1Q7YQ 1QVGO 1PEUA 1QRJA 2E1MA 4WYMA 2JYLA 1VQ5P 2PY8A 3NTEA 4M0IA 2JO0A 4U0EA 2PEKA 3CC2P 1A43A 4XFYA 3G4SP 1Q82Q 3DS5A 3DS0A 4COCA 1M6NA 3DS3A 2Z45A 2PEQA 3CPWO 1VQKP 3LRYA 1K30A 3B5IA 2Z44A 1A8OA 5F2NA 1RO2A 3DS2A 3G1IA 3M1MA 3G21A 1VQ4P 1QVFO 3MGEA 1VQOP 1Q86Q 1YI2P 2JYGA 3DS4A 5F2OA 1M74A 5HGOA 1EOQA 4XRQA 3CCJP 4GR6A 2KODA 2QEXP 1VQ9P 1W2BO 2PEJA 3G29A 5I4TG 5HGMA 3G0VA 1YJWP 2BHVA 2M8PA 3WBHA 3DTJA 1BAJA 3H0DA 4XFXA 2OTLP 1YJ9P 1M1KQ 1VQ7P 4XFZA 5HGNA 1PEQA 1KC8Q 4U0DA 3G6EP 2XV6A 2M8LA 5F2KA 1S72P 1YITP 4U0AA 4U0BA 2PENA 2Z46A 1Q81Q 2LF4A 3Q20A 1ZMBA 1YIJP 3H4EA 4XROA 1M6EX 4PH1A 2QA4P 2EFJA 4U0FA 1VQNP 3CCVP 3CCSP 3DS1A 1YHQP 3OW2O 3HYBA 3G71P 3CC7P 3CC4P 3I56P 5BS1A 1K8AQ 1VQ6P 1K73Q 3CMEP 1VQMP 1NJIQ 1KQSO 3CD6P 5DCKA 2EG5A 2M8NA 1VQLP 1D1DA 3G28A 2PEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT P;  3CCM P;  1VQ4 P;  3I55 P;  1N8R Q;  3CCR P;  1M90 Q;  1Q81 Q;  1QVF O;  3CMA P;  1VQO P;  1Q86 Q;  1VQP P;  1K9M Q;  1YI2 P;  1YIJ P;  1Q7Y Q;  1QVG O;  3CXC O;  2QA4 P;  3CCJ P;  1VQN P;  2OTJ P;  1VQ5 P;  3CCV P;  2QEX P;  1VQ9 P;  1W2B O;  3CCS P;  1YHQ P;  3OW2 O;  3CC2 P;  3G4S P;  3CCQ P;  1YJW P;  3G71 P;  1Q82 Q;  1YJN P;  1VQ8 P;  3CC7 P;  3CC4 P;  3CCU P;  1KD1 Q;  3CPW O;  3CCE P;  2OTL P;  3I56 P;  1YJ9 P;  1M1K Q;  1K8A Q;  1VQ7 P;  1VQ6 P;  1K73 Q;  1KC8 Q;  1VQM P;  1NJI Q;  3G6E P;  1KQS O;  1JJ2 O;  1VQK P;  3CME P;  3CD6 P;  1VQL P;  3CCL P;  1S72 P; 
#chains in the Genus database with same CATH topology
 5KP7 B;  1PGQ A;  2E75 B;  4D6T E;  2IBZ E;  1SQX G;  1SQQ E;  2MY5 A;  2FYZ A;  3F89 A;  3CXC O;  1S5L X;  2XXM A;  1FC2 C;  1SQV D;  1BDD A;  1QGK B;  2P10 A;  2JP3 A;  3JC2 2;  4UB6 H;  1KD1 Q;  2PEO A;  1GDT A;  3AE2 C;  3S9O A;  1UII A;  3BRV B;  1HUC A;  3C1L A;  4IOI H;  3L72 G;  3MUD C;  1GL2 C;  2LTE A;  1GMJ A;  2XT1 A;  3RG2 A;  4L75 A;  1NU1 K;  3RGU A;  1LT1 A;  2EHT A;  4RJT A;  3NTE A;  1AA0 A;  3C9I A;  1ZRT E;  1L4A D;  1HTL C;  2A45 H;  2QJY B;  2N1T B;  1PPJ G;  3H1I E;  3LRY A;  2ZT9 B;  2O3J A;  4DJG A;  1OVR A;  1Y9B A;  1OMI A;  1D7M A;  3HE5 A;  1FOS F;  2E43 A;  1CW5 A;  2K9J B;  3V4W A;  3RBX A;  4EOT A;  4PXH B;  1T2K C;  1LP1 B;  3H1I D;  1JY2 O;  1JM0 A;  3L71 G;  5KLI B;  1WT6 A;  2LPK A;  4WVZ A;  1LTT C;  1R5S A;  1NU1 D;  2YKQ A;  3FX0 A;  4KJM A;  2K93 A;  1KYO E;  2FQ1 A;  1KMI Z;  1KLP A;  1N73 C;  2E76 D;  5KLV E;  1M57 D;  1Z6M A;  4R4M A;  2WSF J;  3CD6 P;  2Y9Y A;  4HH2 A;  5DCK A;  2AEJ A;  2M8N A;  1SQB E;  4L76 A;  2FAE A;  2MF4 A;  3MIW A;  1RQV A;  2FAD A;  1ZOY C;  4EDF A;  1LJ2 A;  1EZV E;  1AYI A;  2V4H A;  1L0N K;  1URQ D;  4LGD E;  2QM7 A;  1OVV A;  2D2C B;  3JCU E;  1KQG B;  2Z5H A;  2JO1 A;  3L74 D;  4WY4 B;  1JNM A;  3BAS A;  3CCU P;  1WMK A;  2L4B A;  1TU3 F;  5CJ0 A;  3UIA A;  1LTA C;  4RES B;  4OVN F;  4CPG A;  3KDP B;  3M9B A;  1BCC J;  4H0L B;  1QRJ A;  3VMY A;  3L71 J;  3BCC D;  3CC2 P;  4U3F D;  5BU5 A;  1Q82 Q;  5APX A;  4COC A;  1PFI A;  5AVQ B;  3RL0 B;  2KGC A;  4AUW A;  1NHL A;  2C0X A;  3B5I A;  1X22 A;  1L0H A;  5DJT B;  1IMP A;  3IF4 A;  1VQO P;  3L70 J;  1ZN5 A;  2KP8 A;  1FZE A;  1DEB A;  3ABV C;  1FE6 A;  2YNY A;  2FXO A;  2P1J A;  2NPS A;  3AEB C;  1MZ8 A;  4GKG A;  1YJW P;  2ZAE B;  3HE4 A;  2A06 D;  3G6E P;  1BSN A;  2N98 A;  1JCC A;  3VYI A;  1Z56 A;  5DJU B;  1NU1 G;  1KTM A;  2M5R A;  3Q20 A;  4N3Y B;  5APT A;  4PH1 A;  4UB6 E;  4BXL A;  2KG8 A;  1OFC X;  4IFM A;  5B66 E;  2KI7 B;  4YPC A;  2H88 C;  1E79 H;  2YXR B;  5CCH D;  1VQL P;  1J2J B;  2CK3 H;  2YXQ B;  3E1I A;  2PEM A;  1N7S C;  3S1K A;  5AW2 B;  1SFC A;  1PZQ A;  4GT1 A;  1OW7 A;  3P05 A;  1E5W A;  5APV A;  4C7N A;  3MUD A;  2O01 H;  1L4A B;  3M0D C;  1DIP A;  3RK3 B;  1IJD B;  5KAF H;  2WZ7 A;  2OYI B;  3P8M C;  1L0N J;  2N50 A;  1RH5 B;  1PEU A;  4JYC A;  3TGU E;  3L73 E;  2JO0 A;  2W8Z A;  3AE3 C;  1FDI A;  1CI6 B;  2Q6Q A;  1K30 A;  5EW5 E;  4QMA A;  1RQU A;  2FYU J;  1A8O A;  3DS2 A;  4UB8 H;  2N5H A;  4PD4 H;  4BPF A;  2QEX P;  1ZRT D;  3RL0 C;  1PP9 G;  2MR7 A;  3G0V A;  1FJP A;  1NTK K;  2LXC B;  2VRS A;  3AE6 C;  1JOC A;  1NWQ A;  3QWO C;  5AVY B;  4H44 B;  3USS A;  3H1H E;  2GYK A;  3CXH E;  2GZJ A;  1HGZ A;  2YMY A;  2E5Y A;  2LKM A;  1SQP K;  2BEQ D;  1GU5 A;  3L75 E;  4B86 A;  1T2K D;  2KZJ A;  2K9J A;  1PIX A;  2LOL A;  2C9L Y;  5CBO A;  2BQ1 E;  2Q1K A;  4D6T D;  2K37 A;  3L74 E;  4C46 A;  5TJH A;  1MFT A;  4BPH A;  1RNI A;  1E6J P;  3E2D A;  2K1A A;  1SQQ J;  1L4A C;  1DEE G;  1N7L A;  4WWI A;  2GA1 A;  1SQV K;  3B4Q A;  3CCQ P;  2E76 B;  1EZV G;  1HWT C;  1FOS E;  1JEK A;  1ZW0 A;  2W6A A;  1JTH B;  2JKV A;  1JUN A;  1OWA A;  2BEZ F;  3VOP A;  3HZQ A;  1H0T A;  2QNW A;  4PJ0 E;  2YKP A;  4XA4 A;  3L74 J;  3P8C D;  1LTG C;  1GD2 E;  3L70 E;  1DD3 A;  1LT9 A;  1FZF A;  4R0M A;  4H13 D;  2N9B A;  5KLV J;  1VDF A;  1ZME C;  2P7J A;  1NTK D;  1KB9 D;  2KGE A;  4U3F J;  2A06 G;  2KSJ A;  2ITA A;  3VMZ A;  1AQ5 A;  2SPZ A;  1AQT A;  4ZKP A;  1RF1 A;  3H0D A;  4U0D A;  2FYU E;  2FKW B;  4PV1 D;  2M8L A;  1VHN A;  5AVV B;  1YIT P;  1KIL C;  1GL2 B;  3JCU H;  2FQ0 A;  3VMX A;  2WPV B;  2WPR A;  1JMM A;  3TGU J;  5APU A;  3WUU A;  5AW8 B;  2R44 A;  3MD0 A;  2XKM A;  1K8A Q;  1URQ C;  5GTI H;  1ZP0 C;  2AFD A;  5AW3 B;  2OGU A;  3PRJ A;  2L6E A;  2N6Z A;  4U7J A;  5AVS B;  3H47 A;  1GK4 A;  2E75 C;  1USD A;  2MVV A;  2ZXX A;  5M1B A;  2FFD A;  3RG6 C;  4I7Z C;  2HFE D;  2BUO A;  4OGQ C;  2WSS H;  2ONT A;  4IL6 H;  3AE1 C;  3CX5 D;  2D2C C;  1HBW A;  4QKO A;  2A45 I;  1NTZ K;  2YIU B;  3A0B E;  5CZD B;  1MFZ A;  2AVA A;  4JQ0 D;  3L73 D;  1FU1 A;  1FZC A;  1GPJ A;  2HPC A;  1BXI A;  2ERH A;  1VQ5 P;  1KOR A;  1RF0 C;  4M0I A;  3BCC E;  1S3J A;  2Q3I A;  2Y0E A;  1G1I A;  4WB4 A;  1SQV G;  3CPW O;  2PEQ A;  1NTM G;  3FWN A;  1RY3 A;  3R2P A;  1VQK P;  1U57 A;  2JB0 A;  5CMZ A;  2VSQ A;  3GW6 A;  2QJK B;  4GOE A;  2Z44 A;  1GXH A;  4Y99 C;  1YTZ T;  1L4A A;  2WSE H;  2B87 A;  1PL5 A;  2IPP A;  2ZJS E;  1YI2 P;  3CXH I;  1EOQ A;  4XRQ A;  1DD4 A;  4GR6 A;  2N9Y B;  2FVF A;  3U43 A;  1F80 D;  1SQX J;  1LTJ A;  2J5U A;  1KB9 I;  3G29 A;  4HKZ H;  1AV1 A;  3H1H G;  1SS1 A;  1BAJ A;  3H1K G;  3H1I J;  2KXP B;  3CX5 H;  5AW1 B;  1LTI C;  3C8V A;  1MKM A;  2KB7 P;  2QJK C;  1NYH A;  1M6E X;  5AVX B;  1P84 D;  2N1T C;  2FFD B;  2WPQ A;  2WSC H;  2QE7 H;  1NAF A;  5AW5 B;  2B88 A;  3L70 D;  3CC4 P;  3L74 G;  1VQM P;  1VF5 B;  1KIL E;  1SQB D;  2KLV A;  4GOD A;  4WY4 A;  1JY3 O;  3GHG B;  1T6A A;  2NPS C;  1X8Y A;  2P2U A;  1CEI A;  4H0L D;  1LNQ A;  2OTJ P;  2GZI A;  3H6P A;  1NTZ D;  1EIA A;  2AF8 A;  4U0C A;  2JWD A;  4OGQ B;  1JJ2 O;  1R8E A;  1ZLL A;  1SQX D;  2KOQ A;  2JAZ A;  1J1D C;  2OAR A;  2YO3 A;  3D6Y A;  1OR5 A;  1KIL A;  1QX8 A;  2JEE A;  3AEA C;  2PEK A;  4XFY A;  5KJ7 A;  1NTZ G;  3DS3 A;  1QLE D;  1PP9 D;  1Y47 A;  1FDM A;  1NVO A;  3MP7 B;  5F2N A;  3RK2 D;  1SFC C;  2GZE A;  2IFM A;  4D6T G;  5HVC A;  3RK2 C;  2GDY A;  2FYN C;  2JYG A;  3L35 A;  5BVZ A;  3CI9 A;  3O8Z A;  3PHL A;  2WTY A;  2OTL P;  5AW0 B;  3V2P A;  4ASV A;  1KC8 Q;  1E0H A;  2CQ8 A;  5TIS H;  2VLN A;  1S2E A;  2IFN A;  1AFO A;  1LTJ C;  2R3S A;  3R4Y A;  3Q5P A;  3U59 A;  1IFJ A;  2A45 G;  1MZ9 A;  4OWF A;  2FXP A;  1EXJ A;  2LL8 A;  2J59 M;  1L0L E;  1SLQ A;  3LID A;  2KG9 A;  3A0H H;  2XND H;  1M90 Q;  4DOJ A;  1LT9 C;  2ZYG A;  2W6J H;  3CX5 I;  1SQQ G;  1YJN P;  2KUB A;  4AYC A;  2WSE J;  2N1T D;  5H2F E;  4BRY B;  2QM8 A;  3DPH A;  2P9X A;  4KHX A;  1L0L J;  1P84 H;  1H89 A;  1OW6 A;  3L75 J;  5APY A;  2ZXE B;  1H88 A;  1JY2 P;  1IK7 A;  1KYO D;  3SWK A;  1IFD A;  2HPC B;  3TNU A;  3B5N B;  2FVA A;  1GL2 A;  2JBG A;  4D6T J;  3M9Q A;  3LMO A;  2G3A A;  3II6 A;  3H1L J;  1Y8A A;  2H7H A;  4F37 A;  2QIW A;  2WT7 B;  1LWU C;  1W5C E;  4IFD K;  3HTK A;  2IDB A;  1RO2 A;  2IZ0 A;  3CXH D;  1SQX E;  2L9F A;  1QVF O;  5GTH H;  1Q86 Q;  2HLO A;  1SQB K;  3PLN A;  3CCJ P;  4UB8 E;  1FBM A;  1W2B O;  3KZI H;  1EXI A;  1SP4 A;  1OZH A;  2Q7C A;  3A0B H;  4BPG A;  3H1L E;  1IMQ A;  4JPZ B;  4H0L C;  2PAJ A;  1SQX K;  2XU6 A;  3PP5 A;  1S4X A;  1J1D B;  3H1K E;  2NPS D;  4XRO A;  2LXB A;  1BCC D;  3EFG A;  2MJZ A;  3TNU B;  4DCK A;  1Q90 D;  1AVY A;  4RKU J;  3B4S A;  3IFM A;  1NTM E;  1NTZ E;  2O01 J;  3BAT A;  1R5L A;  1VQ6 P;  1G2C B;  2ZFC A;  1D1D A;  2XZR A;  4BRY A;  2WPS A;  2J58 A;  1USE A;  2OYI C;  1BGY E;  2NPS B;  4DG9 A;  4EI2 A;  1L0L K;  3KYQ A;  1SQQ D;  2WWW A;  5KLV K;  2KOS A;  5AVT B;  1FZC B;  3CWB E;  3TF5 A;  2AXC A;  3NFQ A;  3CCL P;  3TGU D;  5AW7 B;  4UHP B;  5CJ4 A;  5CHX A;  1JY3 N;  4XE5 B;  2PRR A;  4U0E A;  3Q2Y A;  2Y0C A;  4NPE A;  1M1J C;  4ZNC A;  2RN0 A;  1HY8 A;  2OYO A;  1NTM J;  4PV1 B;  1U7J A;  3PJS K;  3T97 B;  2AEF A;  4HB1 A;  2GDW A;  1BE3 G;  3DS4 A;  2NRG A;  2BAS A;  2QJY C;  2MVU A;  1EDL A;  2BHV A;  1NAY A;  2OYI A;  1VQ7 P;  1KB9 H;  4BWN A;  5CCH A;  2E5T A;  2GM4 A;  2PP6 A;  1G2C A;  1LTB C;  2JU1 A;  2PGD A;  1EQ7 A;  3RK2 B;  2VLO A;  5AVR B;  2K0Y A;  3EJB A;  3M9H A;  3H4E A;  3HRN A;  3L71 D;  4LLH A;  2KW2 A;  2NZ2 A;  3AEC C;  3CC7 P;  4ZKU A;  2E74 C;  3FXD A;  3Q5S A;  2YO2 A;  3G28 A;  1JO5 A;  1VKU A;  3EFF K;  2AEM A;  1KIL D;  2JJL A;  2ZYA A;  1K05 A;  3P32 A;  3CXH H;  1ZXG A;  3H25 A;  4YTP C;  3SFE C;  4AQR D;  3M06 A;  4JF7 A;  1FDO A;  2GZG A;  2YMK A;  3EWK A;  5CCG D;  1N7S D;  2BCC E;  1ZR4 A;  3VRL C;  2MR8 A;  5BS2 A;  3L73 G;  3L72 D;  2OYH A;  1GW3 A;  5HGL A;  2DGY A;  4QNB A;  2K3R A;  3NTN A;  2K2Q A;  4H13 C;  4WYM A;  2IYP A;  2KOG A;  2KS1 A;  2Y0D A;  1EMV A;  2YKO A;  3DS0 A;  3WUT A;  3TSI A;  3HD7 B;  3TYY A;  1DV5 A;  1KQL A;  4W7Z A;  3V2R A;  2O1K A;  3G3Z A;  1BGY D;  2MD9 A;  1URQ A;  3P8C E;  2EHS A;  5KLI C;  3ZDM A;  1YTZ I;  3H1K D;  4EYY Q;  3U1C A;  3P7K A;  5KKZ B;  2V7Q J;  2M8P A;  4N6J A;  2W6B A;  2B87 B;  3LIE A;  3B8E B;  4W7Y A;  1PEQ A;  1L0N G;  1PP9 E;  2R5B A;  2WSF H;  2ZT9 C;  3VP8 A;  1A02 J;  3HD7 C;  2H8P D;  2W27 A;  1U7M A;  1XTC C;  2WIT A;  1FZB A;  3G71 P;  4OH8 B;  5BS1 A;  1NJI Q;  1KQS O;  3W67 A;  5KP6 B;  2K0D X;  3IN6 A;  2N1T A;  1X9V A;  4A7P A;  5KJ7 C;  1UJZ A;  2N6Y A;  1ZR2 A;  2YIU C;  5APW A;  1NKN A;  5CCH C;  3WMM 0;  1RO0 A;  2I1K A;  2O01 N;  1VQ8 P;  1EC5 A;  1WRG A;  2JDI H;  4I7Z B;  3RL0 D;  1NOH A;  1BCC G;  3GJN A;  1T3U A;  3I55 P;  2Y9Z A;  2CPS A;  1URQ B;  1M7L A;  2FYU K;  3L75 G;  2GUV A;  1FAV A;  1HVV A;  3LW5 H;  4U3F E;  1EDK A;  3PH0 A;  1PGO A;  2LML A;  3AE9 C;  4ZMD A;  4MRT C;  1PP9 J;  3E7K A;  1ZV8 A;  1GU4 A;  2UWJ E;  3L4F A;  3VMA A;  3G1I A;  3G21 A;  1VQ4 P;  3LW5 J;  2IBZ G;  3SFD C;  1UIX A;  4Y28 J;  4YXW H;  1PV3 A;  2FYU G;  1LWU B;  5CCG C;  2WSC J;  2PEJ A;  5L8R J;  1NTM D;  1KFN A;  5KAI H;  1M56 D;  2VLP A;  5AW4 B;  3OA7 A;  3Q3D A;  1LP1 A;  1S1C X;  1S72 P;  1OIP A;  2XV5 A;  3L72 E;  5BU8 B;  2IBZ I;  1YIJ P;  3H32 B;  3L73 J;  2KNC A;  1YHQ P;  3OW2 O;  4HJG H;  3V2Q A;  1EZV I;  2K9Y A;  1GZL A;  3Q1M A;  1S9K E;  1K73 Q;  4O9B A;  1T8K A;  2GUS A;  1N7S B;  2BCC J;  4KT0 J;  1IFP A;  2C0W A;  1JY3 P;  3CX5 E;  1N8R Q;  4K35 A;  1GL2 D;  1VQP P;  2HOD A;  1RF1 C;  1AUM A;  3B5N D;  4PD4 I;  1LWU A;  2E76 C;  2L0Q A;  1FZC C;  2M5A B;  4LC1 A;  1JTH A;  2WMM A;  5APS A;  5KTB A;  2POH A;  1S5L H;  3N7N A;  2K94 A;  3AE4 C;  5C39 A;  1A02 F;  3WU2 H;  1LTS C;  1LTJ B;  2G8Y A;  2R3C A;  1Q7Y Q;  2KSE A;  3A7O A;  1NU1 J;  3H32 A;  2BCC G;  4C7R A;  4TT3 H;  2AXT H;  3DS5 A;  1RHZ B;  1M6N A;  1HJ0 A;  1DNY A;  3NY7 B;  3H1L D;  1NKZ B;  3M0A A;  1NQ4 A;  2FYU D;  1J1E B;  4TLF A;  3M1M A;  5KJ7 D;  2QG4 A;  3D71 A;  3OJA B;  3TK1 A;  5TIS E;  3CL3 D;  1M74 A;  3BCC J;  4K3A A;  1HF9 A;  2H43 A;  2KOD A;  5GTH E;  1L2P A;  3HUS A;  4XFX A;  3GHG A;  1JCD A;  1YJ9 P;  1GK6 A;  5HGN A;  3HD7 D;  5B5E E;  2M0B A;  3D70 A;  3H1J E;  1EDI A;  1N7S A;  3SWY A;  3HE4 B;  4U0A A;  5GTI E;  1HGV A;  3EJE A;  1RE4 C;  3B71 A;  1J1E C;  3O6Q A;  1IK9 A;  1L0N E;  1VQN P;  1IC2 A;  2M3B A;  1KB9 E;  4PJ0 H;  1VL2 A;  1JB0 J;  1RE3 C;  2FXM A;  2FAC A;  3B5N C;  2EG5 A;  1CI6 A;  1OW8 A;  4NPD A;  1M1J A;  5APQ A;  1K9M Q;  3G1G A;  3SSU A;  3RK3 C;  2XZ1 C;  1N86 A;  2IZ1 A;  2M3E A;  1IFN A;  2KLU A;  2B89 A;  5E79 E;  4HKG A;  1N73 B;  3CCE P;  2JGP A;  1EDJ A;  2FFD C;  3CWB J;  3NXS A;  3AEE C;  1IFM A;  1BE3 D;  3KXD A;  1NTZ J;  1K04 A;  2JYL A;  2KG6 A;  1X3O A;  1PGP A;  3G4S P;  1IFI A;  3GLM A;  1SQB J;  3IAO A;  1BDC A;  2CNR A;  1FR2 A;  3A5T A;  1G1J A;  1RF0 A;  1ACP A;  2K92 A;  3NMD A;  4Y99 B;  2KR5 A;  4GOF A;  2E74 D;  2IX7 C;  5KP8 B;  3AE5 C;  1M1K Q;  3WUV A;  3KHU A;  4I1L A;  3HUS B;  5F2K A;  2IBZ D;  2WPT A;  1UNK A;  3D6Z A;  3I5C A;  2Z46 A;  2V7Q H;  2LF4 A;  3GZM A;  5EJD A;  1P84 E;  3BVH A;  3S4R A;  1L0L G;  2HYN A;  4MN4 C;  1X79 B;  2LR2 A;  1DH3 A;  4U3F G;  2FY8 A;  2FQ2 A;  3HYB A;  5B5E H;  5KAF E;  1FZA A;  3I56 P;  3FXE A;  1KFM A;  2WVR A;  2CPB A;  4I2L C;  3OAK A;  2P67 A;  4PD4 D;  2JWA A;  3SWF A;  2L5G B;  5KAI E;  3VN0 A;  5JPA A;  1SQV J;  2P58 A;  4H2X C;  4WY4 C;  2JR8 A;  3HTK B;  3KZI E;  2RKL A;  1BSH A;  3H1J D;  2ZT9 D;  2EIA A;  3RBZ A;  2Z5I A;  2CG5 B;  2E75 D;  3GHG C;  2GDX A;  1KIL B;  1QVG O;  1MUU A;  1VF5 C;  2E1M A;  4HYT B;  2Z4E A;  3H1K J;  4N78 D;  1H0T B;  2KIK A;  3HE5 B;  2K5X A;  1IZN B;  4GDO A;  1X0T A;  4Z1M H;  1LGH B;  3V4Q A;  3AED C;  2R32 A;  1IO4 A;  3MGE A;  2QVA A;  3GG2 A;  1YYC A;  5HGO A;  5B66 H;  2JQ4 A;  4PV1 C;  2KYV A;  3H1J G;  3L72 J;  5I4T G;  4W80 A;  1KN7 A;  3T97 A;  4CA3 A;  3GZL A;  1KYO I;  3JSV C;  2LIW A;  3QH9 A;  1S9K D;  2XV6 A;  7CEI A;  1KZU B;  1NH4 A;  5CBN A;  2ZYD A;  3K5B A;  1Q81 Q;  2M8R A;  2AXT E;  2PFX A;  3TGU G;  2QA4 P;  3H1L G;  1HJB A;  3CCS P;  2W90 A;  1N2D C;  2QRX A;  1AVO A;  4PH0 A;  2NO8 A;  2HG5 D;  4DZO A;  4N78 E;  3L37 A;  3CWB G;  1NGM B;  2Q5U A;  2QJP C;  2IYO A;  2XNX A;  2XDJ A;  4I6M C;  1BE3 J;  5EFW B;  3M0D A;  2ZVO B;  2CWO A;  3O6Q B;  1GTW A;  3V2N A;  1SQQ K;  1PEM A;  4XFJ A;  1YBK A;  3GKL C;  2OQQ A;  3G26 A;  2H89 C;  4WBA A;  3TDK A;  4COP A;  4PD4 E;  2MKV A;  3B5N A;  3CLQ A;  3AE8 C;  1W2E A;  2B9B A;  4IL6 E;  1NTK J;  4H44 C;  1EZV D;  2E74 B;  5HV8 A;  4WY4 D;  4L74 A;  1S5L E;  2O1J A;  2KGA A;  2Z45 A;  3IR9 A;  4IL6 X;  1RE4 A;  3RL0 g;  1SQP G;  1N73 A;  2PNG A;  3EJD A;  1BGY G;  3W68 A;  5F2O A;  3HUS C;  3VP9 A;  1SVF A;  2FBW C;  2ROQ A;  1NTM K;  3H1H J;  1CSB A;  1NTK E;  4IFF A;  5HGM A;  3G9R A;  1CZQ A;  4DT0 A;  2OYH B;  2A06 E;  2WT7 A;  1YQ4 C;  2BCC D;  3M91 A;  4U0B A;  2RH0 A;  1FZG A;  2JU2 A;  2LIU A;  1T8Z A;  3CCV P;  2I8D A;  2KOP A;  3H1H D;  1M1J B;  3DS1 A;  3BCC G;  2HOD B;  3L70 G;  1QEX A;  2VLQ A;  3GF7 A;  5CCG A;  1KQF B;  1Q2N A;  2KOO A;  3Q5R A;  1LT9 B;  1RF1 B;  2KS1 B;  4R4L A;  1BE3 E;  4L73 A;  1T3J A;  4GR2 A;  2PEI A;  1H8A A;  2GZF A;  5AW6 B;  4IPY A;  1IUQ A;  2Q9I A;  4NEO A;  4PWV B;  1L0L D;  2AFE A;  1M8O B;  2WQY C;  1OVU A;  3A3Y B;  3CCM P;  3N4X A;  2QSI A;  4M3L A;  3CMA P;  1SQV E;  1RE3 A;  3AE7 C;  4C7N B;  3KPE A;  1DX7 A;  3V5B A;  3L36 A;  2C9N Y;  1PPJ D;  2OYH C;  3AEG C;  3BRT B;  1HQB A;  3H1J J;  4NPF X;  3A0H E;  4H44 D;  1OX3 A;  3A2A A;  3RK3 E;  3RK3 D;  2LKI A;  2FYN B;  3E1R A;  4H2Y C;  2K0X A;  1OXZ A;  1L0N D;  3MTU E;  1QL2 A;  3V6I A;  1PPJ E;  3H1I G;  2R5D A;  2KK7 A;  2I1J A;  3WBH A;  3DTJ A;  3FGA D;  1VF5 D;  2RMZ A;  1HH0 A;  1ZNV A;  3ITK A;  2FHS C;  5KLV G;  5AVW B;  3L71 E;  1AJY A;  3PTZ A;  2EFJ A;  3F5H A;  4RO0 A;  1FS0 E;  2W83 C;  2ZVN B;  2KZI A;  2QJP B;  1JY2 N;  1PGJ A;  1P84 I;  2X2B A;  3MHV A;  1SQB G;  1KV4 A;  1BCC E;  1PEO A;  4YXD C;  2FVE A;  2HR3 A;  2XZ0 D;  5E79 H;  2KOR A;  3GF3 A;  1L0I A;  2E42 A;  2KWL A;  1AF8 A;  3CCR P;  1JMB A;  2M5A A;  1XTG B;  1GW4 A;  2D2C D;  1SQP E;  1BGY J;  1SQP D;  2DW3 A;  3MZW B;  2PY8 A;  1A43 A;  3KQG A;  4ASW A;  5KKZ C;  3U1A A;  4OGQ D;  3GMA A;  4JYB A;  3L75 D;  3CWB D;  2L91 A;  2DNW A;  1SFC D;  4GIF A;  4IZ6 A;  2OTK E;  1VQ9 P;  1SQP J;  4H2W C;  1KYO H;  3CE7 A;  3EQ2 A;  3MGN A;  2K88 A;  1YQ3 C;  2Q3E A;  4XFZ A;  3HD7 A;  1NO4 A;  5AW9 B;  4H13 B;  2N5I A;  1VPC A;  5KLV D;  1NTK G;  4EIJ A;  1QL1 A;  2PEN A;  1MV8 A;  1SFC B;  2KGD A;  5AVZ B;  1ZMB A;  2L22 A;  2KNC B;  5AVU B;  3WU2 E;  4U0F A;  1NU1 E;  5H2F H;  3VTP C;  2CGQ A;  3CME P;  3AEF C;  1GXG A;  5K5G B;  1FJK A;  3FWL A;  4JBZ A; 
#chains in the Genus database with same CATH homology
 2BQ1 E;  4PH0 A;  2L6E A;  1N8R Q;  1M90 Q;  3H47 A;  1VQP P;  1K9M Q;  3G1G A;  3CXC O;  1RNI A;  1AUM A;  3RG6 C;  2XXM A;  1E6J P;  3E2D A;  5JPA A;  2OTJ P;  4GR2 A;  2BUO A;  1EIA A;  1RO0 A;  2ONT A;  2CWO A;  2PEI A;  1PEO A;  3P05 A;  3CCQ P;  1YJN P;  1VQ8 P;  4IPY A;  3CCE P;  3CCU P;  1KD1 Q;  2PEO A;  4U0C A;  1PEM A;  1JJ2 O;  1IUQ A;  3G26 A;  2EIA A;  3CCL P;  3VRL C;  3DPH A;  2P9X A;  4COP A;  5BS2 A;  3CCM P;  3I55 P;  5HGL A;  2OAR A;  2DGY A;  2XT1 A;  3CCR P;  4QNB A;  3CMA P;  3HZQ A;  1Q7Y Q;  1QVG O;  1PEU A;  1QRJ A;  2E1M A;  4WYM A;  2JYL A;  1VQ5 P;  2PY8 A;  3NTE A;  4M0I A;  2JO0 A;  4U0E A;  2PEK A;  3CC2 P;  1A43 A;  4XFY A;  3G4S P;  1Q82 Q;  3DS5 A;  3DS0 A;  4COC A;  1M6N A;  3DS3 A;  2Z45 A;  2PEQ A;  3CPW O;  1VQK P;  3LRY A;  1K30 A;  3B5I A;  2Z44 A;  1A8O A;  5F2N A;  1RO2 A;  3DS2 A;  3G1I A;  3M1M A;  3G21 A;  1VQ4 P;  1QVF O;  3MGE A;  1VQO P;  1Q86 Q;  1YI2 P;  2JYG A;  3DS4 A;  5F2O A;  1M74 A;  5HGO A;  1EOQ A;  4XRQ A;  3CCJ P;  4GR6 A;  2KOD A;  2QEX P;  1VQ9 P;  1W2B O;  2PEJ A;  3G29 A;  5I4T G;  5HGM A;  3G0V A;  1YJW P;  2BHV A;  2M8P A;  3WBH A;  3DTJ A;  1BAJ A;  3H0D A;  4XFX A;  2OTL P;  1YJ9 P;  1M1K Q;  1VQ7 P;  4XFZ A;  5HGN A;  1PEQ A;  1KC8 Q;  4U0D A;  3G6E P;  2XV6 A;  2M8L A;  5F2K A;  1S72 P;  1YIT P;  4U0A A;  4U0B A;  2PEN A;  2Z46 A;  1Q81 Q;  2LF4 A;  3Q20 A;  1ZMB A;  1YIJ P;  3H4E A;  4XRO A;  1M6E X;  4PH1 A;  2QA4 P;  2EFJ A;  4U0F A;  1VQN P;  3CCV P;  3CCS P;  3DS1 A;  1YHQ P;  3OW2 O;  3HYB A;  3G71 P;  3CC7 P;  3CC4 P;  3I56 P;  5BS1 A;  1K8A Q;  1VQ6 P;  1K73 Q;  3CME P;  1VQM P;  1NJI Q;  1KQS O;  3CD6 P;  5DCK A;  2EG5 A;  2M8N A;  1VQL P;  1D1D A;  3G28 A;  2PEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...