1YHQP

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yhqP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yhqP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yhqP02
3CC4P 1YHQP 1VQKP 3CCJP 1K8AQ 1Q82Q 1K73Q 3G6EP 3CPWO 2QA4P 1VQ4P 1VQOP 1YJ9P 1QVGO 1VQ6P 1VQPP 3CCLP 1S72P 1N8RQ 1JJ2O 3I55P 3CCUP 3CCVP 1YITP 1Q81Q 3G71P 3CCMP 1YJWP 1KQSO 1YIJP 3CCRP 3CMEP 1VQ9P 1VQNP 3CCQP 3G4SP 3CC7P 3CCSP 1KC8Q 1M1KQ 3CXCO 1Q7YQ 2OTJP 2OTLP 3CCEP 2QEXP 1QVFO 1VQLP 3I56P 1VQ8P 3OW2O 1VQ7P 1Q86Q 1NJIQ 3CMAP 1YJNP 1K9MQ 3CD6P 1M90Q 1YI2P 1W2BO 1KD1Q 1VQ5P 3CC2P 1VQMP
chains in the Genus database with same CATH superfamily
2PY8A 3DS1A 1LTSC 1JMMA 3KZIH 3G3ZA 1NKNA 1PV3A 4W80A 2N6YA 2XZRA 1LGHB 2B87B 4UB8E 1M56D 2ONTA 1T8KA 4XFYA 1OVRA 3CL3D 1L4AD 1FZCC 2E76C 2QJPC 1KMIZ 3H25A 5EJDA 2ZXXA 2BCCE 1U7JA 2QIWA 3N7NA 2WSSH 1L0LG 2IFMA 3LIDA 1L4AC 2N6ZA 3E7KA 4BXLA 1GU4A 4CA3A 3HRNA 2CWOA 5CBOA 2EIAA 3SFEC 3U43A 2L6EA 4L73A 4QMAA 3BRVB 2CGQA 3A0HE 1MV8A 2KOQA 1SLQA 3CXHI 2AVAA 4GKGA 3CX5H 3NMDA 3AECC 1L0LD 2A06G 2WPSA 2JYLA 3BASA 1K05A 1OW8A 1J1DB 2DNWA 2WMMA 1HGVA 1LTAC 2IBZE 3F89A 3EWKA 3M0DC 2ZYDA 1VL2A 5JPAA 4IL6E 3KXDA 2JB0A 3FGAD 2OYHB 2E76B 2GZIA 3RL0g 1KYOI 2JO1A 4PV1B 4JQ0D 1A02J 2I8DA 2ZT9C 3Q2YA 2WSFJ 1JTHB 4PD4H 1SQXE 1PPJG 1VQ6P 1EIAA 3MTUE 1YJ9P 2R44A 2NPSA 1Q2NA 5KAFE 1IK9A 3EQ2A 2KWLA 2OTKE 1VQ9P 2I1KA 4WVZA 2VLOA 1QVFO 1RO2A 2WVRA 2O01H 5AVUB 4H0LB 2CQ8A 3NXSA 2ZVOB 3DS5A 2FXMA 2FYNC 3P8CE 1PPJD 3E2DA 1SQBK 1X8YA 3CI9A 5F2KA 1IJDB 1SQPE 5KLVG 1L0HA 1YTZI 4OGQD 2MD9A 3G21A 2BEQD 1Z56A 5AW2B 4IOIH 5E79E 4PJ0E 4ASVA 2CNRA 2QSIA 3L74J 4QKOA 3CCSP 2ZT9B 3GKLC 2Y0CA 4OGQC 4BPGA 2WPRA 1GL2D 2QRXA 2IZ0A 3Q5SA 2YXRB 2FFDB 1IFPA 3IR9A 5KLVD 2IX7C 2B89A 1CI6B 3MUDA 4HYTB 4RO0A 2Q9IA 3DS3A 2WT7B 1M1JB 1CSBA 4LGDE 1GL2C 4XFXA 2Q3EA 3MGNA 2W27A 2N5IA 2HG5D 2N1TD 5CCHD 1HVVA 3R2PA 2PNGA 4EYYQ 1BSHA 4LC1A 3DS2A 3VMXA 1S1CX 1HJ0A 5EW5E 2N1TC 1QEXA 3A3YB 3AE8C 4NPEA 1FU1A 5APWA 3QH9A 1K30A 3VYIA 2KORA 3CCEP 4UB6H 4XRQA 4MN4C 4C7RA 1GXGA 1H8AA 1FDIA 4N6JA 1GD2E 2OYHA 2K3RA 2DW3A 4TLFA 1BGYE 1RHZB 2CG5B 4OGQB 1NO4A 1R5SA 2EHSA 1WT6A 3B8EB 1IFJA 3CMAP 3VMZA 2QM8A 1PGQA 2KW2A 1ZXGA 1YHQP 1RF1C 4ASWA 1LTBC 3PJSK 1JJ2O 2K0DX 1LTJC 1GW3A 2JU1A 1VF5D 3LRYA 3G4SP 1DEBA 2OYIB 1NAYA 2JBGA 2L91A 3TF5A 4ZKUA 2W90A 3G0VA 3CX5D 1H88A 2YNYA 1VF5C 3G6EP 2BASA 1SQPK 1AA0A 4GT1A 3RK3B 2D2CD 2N9BA 2P9XA 1YI2P 1ACPA 2ZYGA 3A0BE 3H1LE 4GR2A 4JF7A 2D2CC 1Q82Q 4DJGA 2KZIA 1VQPP 3B71A 3JCUH 1N73B 4YTPC 2K92A 2GDWA 3A0HH 3L35A 1KQFB 2PEOA 4YPCA 5KP7B 4PD4D 1PIXA 1DV5A 3KHUA 1Q86Q 2FFDA 1KB9D 2H8PD 3LIEA 2LXBA 1CI6A 3L74E 5CCGA 2LL8A 1AVOA 1M1JA 2VLQA 3B5NA 5BU8B 3VN0A 2KNCB 4LLHA 1MUUA 1S2EA 1L2PA 1RE3A 4XA4A 2KG9A 1IFNA 2FYUG 1E79H 3GLMA 3M9HA 5APVA 5GTHH 3HYBA 4HH2A 3H1KJ 2E5YA 1SQVJ 1W5CE 3GMAA 2J58A 2HFED 4IL6X 5F2NA 4AQRD 2LPKA 1GMJA 2GYKA 1JCCA 2MVUA 1J1EC 3AEFC 5APUA 5GTIH 1KZUB 1IMPA 1NKZB 1JY2O 4DZOA 2G3AA 2WQYC 2JAZA 4R0MA 1T6AA 2FYUD 1P84D 1AF8A 3TSIA 3G1IA 2AXTE 1MFZA 5F2OA 4U7JA 2FBWC 3A5TA 1M90Q 1W2BO 4K3AA 1M57D 2NPSD 3U1CA 1L0IA 2O01N 1DNYA 2Y9YA 2QJYB 2FYZA 2MR7A 1NU1E 2OYIA 1PL5A 2IYPA 3KPEA 3ITKA 4OWFA 5AW1B 3W68A 2NPSC 1EZVG 3WUVA 1FZFA 1LNQA 2K9YA 2H7HA 2KG6A 2JJLA 1BDDA 3BCCG 2YKPA 3EFFK 1CZQA 3ZDMA 5HV8A 1NTZJ 3H1KG 1SQVG 1SP4A 1FOSF 1KTMA 4HB1A 2R5BA 3CX5I 5AVTB 3U1AA 1M7LA 1ZW0A 3DS4A 2C9LY 1A43A 1QL2A 2Z5IA 3WBHA 5AW5B 2A45H 1EZVD 3Q5PA 1D7MA 2JWAA 4DCKA 1QRJA 1P84E 5C39A 4R4LA 3H32B 3D6ZA 1N73A 3TGUE 3BCCD 1LTTC 3H1KD 2VSQA 1SQVD 1JOCA 1KILE 2HYNA 3H1IG 2O3JA 2LOLA 4WY4B 2K88A 2MVVA 1VQLP 1EOQA 1JCDA 2N50A 1OVUA 3HE4A 1DIPA 5TISH 1NTME 2H89C 3NTNA 3P8MC 2KNCA 1S5LH 4PD4I 4RESB 1L0NG 2QVAA 3CXHE 1KB9I 1YITP 2KGAA 2ERHA 2WPQA 1LT9A 1L0LJ 2EFJA 3H1JJ 5L8RJ 4L75A 3MUDC 3H1ID 2XDJA 5CJ4A 3L36A 1YYCA 3M9QA 2HPCB 2R3SA 2ZXEB 2ZAEB 2KXPB 4IFFA 4DOJA 1N8RQ 2FHSC 2K0YA 1L0ND 4MRTC 3CCRP 3CMEP 1FZGA 2HODB 2Z44A 3A7OA 1AYIA 3M1MA 5HGOA 3FXEA 2FACA 1KYOE 4QNBA 2QJKB 1SQBE 1J1DC 1PP9E 2E76D 1N2DC 4H2XC 4PV1D 2C9NY 1JO5A 4H2WC 1LT1A 5CMZA 3BATA 5APQA 3MIWA 1U57A 2E75B 1S9KE 2QM7A 2OYHC 4IPYA 1KORA 1NU1K 3N4XA 1UIXA 4PV1C 1NAFA 1P84I 1PEOA 1VKUA 2KG8A 2AEJA 3SWYA 1R8EA 3H1JG 3HE5B 1DX7A 3L72G 3A0BH 2YXQB 2FAEA 4H0LD 2GA1A 5KAIH 1NTKE 2X2BA 3B4SA 1JY2P 3VRLC 4WYMA 3CC2P 2I1JA 2LR2A 3USSA 2GUVA 2Q7CA 2PFXA 1G1JA 3RG2A 4H0LC 3S9OA 1T2KD 7CEIA 4KHXA 3H1JD 2K9JB 1NTZE 3L72D 1JB0J 4KJMA 5CZDB 4BPFA 2KK7A 1JY2N 3JC22 4YXWH 3H32A 3LW5H 1T2KC 5AVYB 3P32A 1YQ3C 3IF4A 4CPGA 2ZT9D 3MHVA 5KLVJ 1QL1A 1GXHA 5AW8B 3WU2H 4WY4A 1EZVI 3FWLA 4JPZB 1HTLC 1NTMK 1RE4A 1EC5A 1G1IA 4XFJA 2A06D 2GDXA 5CCGD 3AEDC 3S4RA 3B5ND 2JGPA 1PZQA 3CPWO 2FFDC 4COPA 2K0XA 4U0EA 5CCGC 4D6TG 1M1JC 3B5NC 1URQB 2L4BA 1KLPA 3VMAA 2HPCA 5AVSB 1KD1Q 1ZP0C 2GZGA 3G1GA 2Z46A 1EXJA 3V2PA 2XKMA 2GZJA 1L0LE 1BCCJ 2K94A 1RE3C 3GZMA 3TYYA 2HODA 1SFCB 1FDOA 1M74A 1N7SC 2QEXP 2WITA 1QLED 4D6TD 2RKLA 2JR8A 3SWKA 2JDIH 2O1JA 2KYVA 3PHLA 3T97B 1GW4A 2KR5A 2A06E 1LJ2A 2CK3H 5HGMA 2YMKA 3ABVC 1BE3J 4NPDA 2W6BA 4XFZA 1JNMA 2JYGA 2XU6A 2R5DA 2ZYAA 1A02F 3HE5A 2N5HA 2Q3IA 1NTKK 3CCVP 1HY8A 3VTPC 2PEKA 2CPBA 3B5NB 1Z6MA 4HJGH 4ZMDA 2Y0DA 4R4MA 2OYIC 1QGKB 1BCCG 3RK3D 1ZR4A 1EQ7A 2GUSA 1NTZK 1PPJE 2OQQA 5B5EE 1GDTA 3V2QA 4BRYB 2K9JA 4W7ZA 3V6IA 1N7SB 2K1AA 3H0DA 1VQNP 1IK7A 3RK3C 3GZLA 3WUTA 1S4XA 4H13B 2IPPA 5B66E 3SFDC 1NHLA 2KLUA 1OX3A 4JBZA 2FVFA 1BCCD 1EDLA 1ZMEC 3PH0A 1SQQJ 4W7YA 4N3YB 3AEEC 4PWVB 1BE3G 1X9VA 4JYBA 5H2FH 1N73C 2O01J 2M8RA 2LIWA 1BSNA 2BEZF 5KLVE 3M06A 1EDJA 1HQBA 2MF4A 1UNKA 1NQ4A 4ZKPA 1HGZA 4GR6A 1EMVA 3HUSB 3CCLP 1GU5A 3OAKA 1KFNA 1URQA 4IFDK 1EDIA 2WSEH 1L0LK 1BE3D 2JWDA 3C9IA 2H43A 4HKZH 1OIPA 1LT9C 4UB8H 1FR2A 1AFOA 1S72P 1SFCA 3I5CA 2LIUA 2KSJA 4XROA 2FYUJ 1N7LA 4WB4A 5BVZA 3KZIE 2AFEA 5I4TG 4KT0J 2KGDA 2KSEA 2P10A 3CD6P 4WBAA 2OARA 4C7NB 1JUNA 1FAVA 3T97A 3P7KA 1SQQG 4IFMA 2GDYA 3EJEA 3L75G 4JYCA 2PEQA 5AVVB 5KTBA 2JO0A 5AW0B 3L37A 1TU3F 1EDKA 2VRSA 5KKZB 4YXDC 1DEEG 1RY3A 1K04A 1JM0A 2M3BA 2W83C 1G2CB 2KZJA 3CCJP 5BS1A 3L71G 3DS0A 3HE4B 1SQQD 5TJHA 2BHVA 4U0DA 1OXZA 3FWNA 2QJYC 3V4WA 1SS1A 4U0AA 4U3FG 3CX5E 4UHPB 1VQ8P 2PAJA 1M6EX 1LT9B 3UIAA 3HD7B 4IL6H 3TNUA 2UWJE 1X22A 4BRYA 4EDFA 3HTKA 1VQOP 1N7SA 3H1HJ 1GTWA 3Q3DA 3BCCJ 3L73J 3CCUP 2KUBA 3NFQA 3GF7A 5AW6B 1X3OA 4OVNF 4NEOA 2M8PA 2ROQA 2C0XA 4U3FD 2MJZA 2E1MA 3E1RA 5KAFH 4WY4D 5KLVK 1E0HA 3AE7C 2WSEJ 2WSCH 1AV1A 4PD4E 3B4QA 1NWQA 1KB9E 2NRGA 4WY4C 2WWWA 2KGCA 5KLIC 3H1IJ 4N78D 4Z1MH 3BRTB 1RE4C 3AE4C 3G28A 3HUSA 2WPVB 2G8YA 1YBKA 1FS0E 2BCCJ 3V5BA 3EFGA 1IZNB 3VP9A 2E74B 3RBZA 1HF9A 5DJUB 1L0NJ 3EJBA 2YIUB 3H1HG 5E79H 4PJ0H 1ZRTD 5CJ0A 3JSVC 2QNWA 3L73G 2L0QA 1KN7A 5EFWB 4H44B 2GM4A 4EIJA 5CHXA 4OH8B 2WPTA 1SVFA 3KYQA 1ZNVA 4BWNA 4C7NA 4ZNCA 1JY3O 3R4YA 1U7MA 1A8OA 2KB7P 3MP7B 2GZEA 2FYUE 2E75D 3H1HD 2QJKC 1GK4A 5KJ7A 2FADA 3L73D 2FVAA 2EG5A 2XV5A 3V4QA 1ZLLA 2VLNA 3GJNA 4NPFX 5KLIB 2E75C 3OW2O 1G2CA 2BCCG 2PEIA 3AE3C 1X79B 2ZFCA 1IFDA 1W2EA 3Q5RA 3P05A 4M3LA 2R32A 5APYA 2L9FA 1MFTA 1KFMA 1SQXJ 1HH0A 3M0AA 3M9BA 4IZ6A 4I6MC 1RF0A 3AEAC 1AQ5A 1OWAA 3HD7A 3L72J 2CPSA 2OYOA 2WSCJ 1LWUB 1KILB 1GPJA 4UB6E 2BCCD 2IFNA 2XZ1C 5HGLA 2E42A 2PENA 1OZHA 1EZVE 2M8NA 1XTGB 3DTJA 3AEGC 2KI7B 2W8ZA 1USDA 3BCCE 3L73E 3H1KE 2M5RA 1SQVE 2IBZG 3KQGA 2K37A 1N86A 1SQPJ 3BVHA 1ZMBA 1Y8AA 3B5IA 4TT3H 1SQQK 5DCKA 3PLNA 3G26A 2Y0EA 3VOPA 3G71P 2WZ7A 3RL0B 2JP3A 3GF3A 3O6QB 1HJBA 1EXIA 3AE1C 3G29A 2EHTA 3MZWB 5AW9B 2BQ1E 2J59M 4PXHB 1RO0A 1RQVA 1UJZA 4I7ZB 3WMM0 3FXDA 1SQXG 2QA4P 3GHGC 1URQD 2IBZD 3H1IE 1FC2C 4DG9A 1Q7YQ 1Y9BA 2AF8A 1VHNA 1URQC 3Q1MA 4D6TJ 2E5TA 1T8ZA 5AVRB 5HGNA 1SFCD 3RK2B 1KV4A 1L0NE 2RN0A 3O8ZA 2K5XA 3NTEA 1SQXD 2PP6A 5K5GB 4L74A 4O9BA 2FYUK 3CC7P 2YKOA 3JCUE 3PP5A 1SFCC 2XV6A 3I56P 3PRJA 5M1BA 3DPHA 1SQPG 2Z5HA 5BU5A 2YKQA 1H0TB 2LKIA 4GDOA 1NGMB 2NZ2A 3GW6A 2NO8A 3GG2A 2MR8A 2IDBA 2OTJP 3P8CD 1CEIA 2KOSA 1BGYJ 2W6JH 2L5GB 3U59A 2RH0A 1YQ4C 1IUQA 3GHGB 3AE6C 1SQPD 1MKMA 3C1LA 2FQ0A 1T3JA 2A45G 1ZV8A 1FZCB 1AUMA 3K5BA 2QJPB 3CWBJ 3CCQP 1OW7A 2JU2A 5GTHE 3MD0A 1JY3P 3WUUA 1QX8A 1IMQA 2K93A 1LWUA 1E5WA 3W67A 1KILA 1N7SD 1L4AB 4XE5B 1KB9H 2JEEA 4I2LC 1OMIA 3H1JE 4H13D 5GTIE 2PGDA 2AXTH 3L72E 1PFIA 2AEFA 4L76A 1SQVK 1YJWP 2M5AA 3IN6A 1J2JB 1JMBA 2GZFA 1BXIA 1JY3N 2KIKA 2Z45A 4H13C 5AVXB 1VQ5P 3VMYA 2W6AA 1HBWA 1VQKP 3AE2C 3O6QA 3L70J 3H1LJ 5AVWB 3EJDA 2FXPA 1BGYG 3G9RA 4EOTA 2M0BA 4AYCA 2V4HA 2P1JA 2RMZA 1DD4A 2B87A 1GK6A 1GZLA 3CWBG 1D1DA 1AJYA 4AUWA 1Q81Q 1ZR2A 3CCMP 3HUSC 2KLVA 2AFDA 1L0NK 1LTIC 3D71A 3LW5J 1P84H 1BGYD 2PEMA 2IBZI 1KQLA 5KP6B 1LP1B 2C0WA 5AVZB 3CC4P 3QWOC 3D6YA 3TNUB 3HTKB 2Q5UA 3CWBD 4D6TE 3KDPB 2HR3A 2SPZA 2JQ4A 1VPCA 1JEKA 3Q20A 3CXHH 5KJ7D 2Z4EA 2POHA 1H0TA 3L70G 3H1LG 2KOPA 3SSUA 2P58A 2QE7H 2FYNB 3SWFA 1PGOA 5TISE 5CCHC 2LXCB 4U0CA 2K2QA 5APTA 3L75J 1S5LE 2FQ2A 5AVQB 1M1KQ 5KJ7C 1OW6A 3PTZA 1M6NA 3AEBC 2WTYA 3GHGA 5KKZC 2KS1B 3IFMA 1WRGA 3L74G 2QG4A 1BAJA 1FZCA 1R5LA 3L70D 2V7QH 3H1LD 1M8OB 1Y47A 3CLQA 3I55P 1SQXK 3HD7D 1KYOH 3L71J 1ZN5A 3RK3E 1JTHA 2DGYA 1NU1J 3OJAB 1L4AA 2XZ0D 1Q90D 4U3FJ 1VQMP 1RF0C 3HD7C 1K8AQ 3CWBE 4M0IA 1F80D 1S3JA 4EI2A 1GL2B 2IYOA 2ZJSE 3L74D 1NOHA 3IAOA 2YO2A 2O1KA 3HZQA 3E1IA 1BCCE 1K9MQ 4A7PA 4GOEA 2XNXA 2A45I 2YMYA 2LTEA 2N1TB 2AXCA 1AVYA 4PH1A 4DT0A 5APSA 3TGUJ 2Y9ZA 2FKWB 2HLOA 3M0DA 2J5UA 1YJNP 3L70E 1ZOYC 2E74D 2IZ1A 1DD3A 5KAIE 3RBXA 5APXA 1FJPA 3H4EA 2N98A 4WWIA 1BE3E 1NTMJ 3L75D 1NU1G 1KQGB 4K35A 4U0BA 1HUCA 1LP1A 1RNIA 3M91A 2E74C 2VLPA 4H44D 5CBNA 2MKVA 2FXOA 3H6PA 2YIUC 1RF1B 2LKMA 2WT7A 1LTJB 2P67A 2B88A 2YO3A 3NY7B 4H44C 3L71D 1PGPA 4I1LA 2PRRA 5DJTB 1KQSO 2JKVA 2Q1KA 2XNDH 1NU1D 3WU2E 4HKGA 1VF5B 2V7QJ 3CE7A 1T3UA 3TK1A 2KGEA 3II6A 3L4FA 1NH4A 3TGUG 2H88C 1SQBJ 3VP8A 4F37A 1PP9J 1FZEA 1IFIA 1H89A 2OTLP 2M8LA 1NYHA 2AEMA 2KS1A 1LTGC 2D2CB 1SQQE 2B9BA 1IC2A 1XTCC 3L75E 1NTMG 3AE5C 5BS2A 2FVEA 1RQUA 1HWTC 3FX0A 3TGUD 2LMLA 3CXCO 4PH0A 1KILD 4BPHA 3S1KA 2PEJA 1RH5B 1GL2A 3L71E 2FY8A 1YTZT 1K73Q 3V2NA 3MGEA 1NTKJ 1LWUC 1KILC 1NTMD 2E43A 3RGUA 4COCA 4U3FE 1KC8Q 3CXHD 1FDMA 4B86A 1VQ7P 1FE6A 2XT1A 3F5HA 1NJIQ 2N1TA 3RL0D 5CCHA 1SQBG 2KP8A 1PP9G 2FQ1A 1X0TA 3D70A 1FZBA 2KOGA 2ITAA 4Y99C 1YIJP 2P2UA 4N78E 1J1EB 3RL0C 2L22A 3A2AA 5HVCA 5B5EH 1WMKA 1IO4A 4GIFA 1E6JP 3RG6C 1PEQA 1MZ9A 3TDKA 1MZ8A 4I7ZC 2KODA 2Q6QA 1KYOD 2M3EA 5B66H 1SQBD 3V2RA 3OA7A 1PP9D 4Y28J 1UIIA 4GODA 2XXMA 1PGJA 1ZRTE 3RK2D 2R3CA 3LMOA 1RF1A 1S9KD 1OR5A 1NTKG 1IFMA 1LTJA 3AE9C 2N9YB 1FJKA 2P7JA 1VQ4P 1CW5A 1BDCA 1AQTA 5AW3B 1FBMA 3RK2C 1OVVA 2NPSB 1USEA 4RKUJ 1VDFA 1PEUA 2OGUA 1DH3A 1NTZG 1OFCX 1S5LX 1PEMA 4GOFA 2M5AB 5KP8B 4RJTA 3H1HE 5H2FE 2BUOA 2MY5A 1NTKD 2WSFH 1QVGO 4Y99B 4C46A 2KOOA 1NVOA 1FOSE 4U0FA 3H47A 5AW7B 2LF4A 4H2YC 1FZAA 3C8VA 2ZVNB 5AW4B 1NTZD
chains in the Genus database with same CATH topology
4GR2A 2PY8A 2JYGA 2PEIA 3DS2A 5HGNA 3DS1A 1VQKP 1Q82Q 1VQ6P 1EIAA 1BAJA 1YJ9P 1VQPP 3P05A 1S72P 3NTEA 1N8RQ 3I55P 3CCVP 2PEKA 4XROA 1KQSO 1YIJP 2ONTA 3CCRP 1VQ9P 3CMEP 3CC7P 4XFYA 2Z44A 5I4TG 1K30A 2PEOA 3CCEP 3M1MA 5HGOA 2XV6A 2DGYA 1QVFO 1RO2A 3I56P 4XRQA 1Q86Q 3CD6P 1E6JP 3RG6C 2OARA 3DPHA 1PEQA 4QNBA 3G28A 1VQMP 2KODA 1K8AQ 2PEQA 3CPWO 4M0IA 3DS5A 4COPA 1D1DA 2JO0A 3E2DA 4U0EA 1Q81Q 5HGLA 3CCMP 2PENA 3H0DA 1VQNP 3DS4A 2CWOA 2XXMA 2OTJP 2M8NA 2OTLP 1A43A 4IPYA 2M8LA 3HZQA 2EIAA 2PEMA 3DTJA 5F2KA 3WBHA 3CMAP 1K9MQ 2L6EA 1KD1Q 3G1GA 1PEOA 2Z46A 3CC4P 1YHQP 1IUQA 1QRJA 3CCJP 5BS1A 1VQ4P 3DS0A 3G21A 1ZMBA 3B5IA 3HYBA 5BS2A 1JJ2O 5DCKA 3G26A 2BHVA 4U0DA 4PH1A 3G71P 1AUMA 2JYLA 1M74A 3LRYA 3G4SP 3G29A 4U0AA 5F2NA 3CCQP 3CXCO 3CCSP 4PH0A 1PEUA 2BQ1E 2QEXP 2PEJA 1VQLP 1EOQA 1RO0A 1PEMA 1VQ8P 1M6EX 1YJNP 3Q20A 1A8OA 3VRLC 4WYMA 3G0VA 3CC2P 2BUOA 4GR6A 3G6EP 2QA4P 1K73Q 1VQOP 3MGEA 1QVGO 5JPAA 3CCLP 2EG5A 3H4EA 3CCUP 3DS3A 1YITP 4U0CA 4COCA 1YJWP 4U0BA 5HGMA 2P9XA 4XFXA 3G1IA 4U0FA 1KC8Q 2EFJA 1Q7YQ 3H47A 1M1KQ 1RNIA 2LF4A 2M8PA 1M6NA 5F2OA 3OW2O 1VQ7P 2Z45A 4XFZA 1YI2P 1W2BO 1M90Q 2E1MA 1VQ5P 2XT1A 1NJIQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 P;  1YHQ P;  1VQK P;  3CCJ P;  1K8A Q;  1Q82 Q;  1K73 Q;  3G6E P;  3CPW O;  2QA4 P;  1VQ4 P;  1VQO P;  1YJ9 P;  1QVG O;  1VQ6 P;  1VQP P;  3CCL P;  1S72 P;  1N8R Q;  1JJ2 O;  3I55 P;  3CCU P;  3CCV P;  1YIT P;  1Q81 Q;  3G71 P;  3CCM P;  1YJW P;  1KQS O;  1YIJ P;  3CCR P;  3CME P;  1VQ9 P;  1VQN P;  3CCQ P;  3G4S P;  3CC7 P;  3CCS P;  1KC8 Q;  1M1K Q;  3CXC O;  1Q7Y Q;  2OTJ P;  2OTL P;  3CCE P;  2QEX P;  1QVF O;  1VQL P;  3I56 P;  1VQ8 P;  3OW2 O;  1VQ7 P;  1Q86 Q;  1NJI Q;  3CMA P;  1YJN P;  1K9M Q;  3CD6 P;  1M90 Q;  1YI2 P;  1W2B O;  1KD1 Q;  1VQ5 P;  3CC2 P;  1VQM P; 
#chains in the Genus database with same CATH topology
 2PY8 A;  3DS1 A;  1LTS C;  1JMM A;  3KZI H;  3G3Z A;  1NKN A;  1PV3 A;  4W80 A;  2N6Y A;  2XZR A;  1LGH B;  2B87 B;  4UB8 E;  1M56 D;  2ONT A;  1T8K A;  4XFY A;  1OVR A;  3CL3 D;  1L4A D;  1FZC C;  2E76 C;  2QJP C;  1KMI Z;  3H25 A;  5EJD A;  2ZXX A;  2BCC E;  1U7J A;  2QIW A;  3N7N A;  2WSS H;  1L0L G;  2IFM A;  3LID A;  1L4A C;  2N6Z A;  3E7K A;  4BXL A;  1GU4 A;  4CA3 A;  3HRN A;  2CWO A;  5CBO A;  2EIA A;  3SFE C;  3U43 A;  2L6E A;  4L73 A;  4QMA A;  3BRV B;  2CGQ A;  3A0H E;  1MV8 A;  2KOQ A;  1SLQ A;  3CXH I;  2AVA A;  4GKG A;  3CX5 H;  3NMD A;  3AEC C;  1L0L D;  2A06 G;  2WPS A;  2JYL A;  3BAS A;  1K05 A;  1OW8 A;  1J1D B;  2DNW A;  2WMM A;  1HGV A;  1LTA C;  2IBZ E;  3F89 A;  3EWK A;  3M0D C;  2ZYD A;  1VL2 A;  5JPA A;  4IL6 E;  3KXD A;  2JB0 A;  3FGA D;  2OYH B;  2E76 B;  2GZI A;  3RL0 g;  1KYO I;  2JO1 A;  4PV1 B;  4JQ0 D;  1A02 J;  2I8D A;  2ZT9 C;  3Q2Y A;  2WSF J;  1JTH B;  4PD4 H;  1SQX E;  1PPJ G;  1VQ6 P;  1EIA A;  3MTU E;  1YJ9 P;  2R44 A;  2NPS A;  1Q2N A;  5KAF E;  1IK9 A;  3EQ2 A;  2KWL A;  2OTK E;  1VQ9 P;  2I1K A;  4WVZ A;  2VLO A;  1QVF O;  1RO2 A;  2WVR A;  2O01 H;  5AVU B;  4H0L B;  2CQ8 A;  3NXS A;  2ZVO B;  3DS5 A;  2FXM A;  2FYN C;  3P8C E;  1PPJ D;  3E2D A;  1SQB K;  1X8Y A;  3CI9 A;  5F2K A;  1IJD B;  1SQP E;  5KLV G;  1L0H A;  1YTZ I;  4OGQ D;  2MD9 A;  3G21 A;  2BEQ D;  1Z56 A;  5AW2 B;  4IOI H;  5E79 E;  4PJ0 E;  4ASV A;  2CNR A;  2QSI A;  3L74 J;  4QKO A;  3CCS P;  2ZT9 B;  3GKL C;  2Y0C A;  4OGQ C;  4BPG A;  2WPR A;  1GL2 D;  2QRX A;  2IZ0 A;  3Q5S A;  2YXR B;  2FFD B;  1IFP A;  3IR9 A;  5KLV D;  2IX7 C;  2B89 A;  1CI6 B;  3MUD A;  4HYT B;  4RO0 A;  2Q9I A;  3DS3 A;  2WT7 B;  1M1J B;  1CSB A;  4LGD E;  1GL2 C;  4XFX A;  2Q3E A;  3MGN A;  2W27 A;  2N5I A;  2HG5 D;  2N1T D;  5CCH D;  1HVV A;  3R2P A;  2PNG A;  4EYY Q;  1BSH A;  4LC1 A;  3DS2 A;  3VMX A;  1S1C X;  1HJ0 A;  5EW5 E;  2N1T C;  1QEX A;  3A3Y B;  3AE8 C;  4NPE A;  1FU1 A;  5APW A;  3QH9 A;  1K30 A;  3VYI A;  2KOR A;  3CCE P;  4UB6 H;  4XRQ A;  4MN4 C;  4C7R A;  1GXG A;  1H8A A;  1FDI A;  4N6J A;  1GD2 E;  2OYH A;  2K3R A;  2DW3 A;  4TLF A;  1BGY E;  1RHZ B;  2CG5 B;  4OGQ B;  1NO4 A;  1R5S A;  2EHS A;  1WT6 A;  3B8E B;  1IFJ A;  3CMA P;  3VMZ A;  2QM8 A;  1PGQ A;  2KW2 A;  1ZXG A;  1YHQ P;  1RF1 C;  4ASW A;  1LTB C;  3PJS K;  1JJ2 O;  2K0D X;  1LTJ C;  1GW3 A;  2JU1 A;  1VF5 D;  3LRY A;  3G4S P;  1DEB A;  2OYI B;  1NAY A;  2JBG A;  2L91 A;  3TF5 A;  4ZKU A;  2W90 A;  3G0V A;  3CX5 D;  1H88 A;  2YNY A;  1VF5 C;  3G6E P;  2BAS A;  1SQP K;  1AA0 A;  4GT1 A;  3RK3 B;  2D2C D;  2N9B A;  2P9X A;  1YI2 P;  1ACP A;  2ZYG A;  3A0B E;  3H1L E;  4GR2 A;  4JF7 A;  2D2C C;  1Q82 Q;  4DJG A;  2KZI A;  1VQP P;  3B71 A;  3JCU H;  1N73 B;  4YTP C;  2K92 A;  2GDW A;  3A0H H;  3L35 A;  1KQF B;  2PEO A;  4YPC A;  5KP7 B;  4PD4 D;  1PIX A;  1DV5 A;  3KHU A;  1Q86 Q;  2FFD A;  1KB9 D;  2H8P D;  3LIE A;  2LXB A;  1CI6 A;  3L74 E;  5CCG A;  2LL8 A;  1AVO A;  1M1J A;  2VLQ A;  3B5N A;  5BU8 B;  3VN0 A;  2KNC B;  4LLH A;  1MUU A;  1S2E A;  1L2P A;  1RE3 A;  4XA4 A;  2KG9 A;  1IFN A;  2FYU G;  1E79 H;  3GLM A;  3M9H A;  5APV A;  5GTH H;  3HYB A;  4HH2 A;  3H1K J;  2E5Y A;  1SQV J;  1W5C E;  3GMA A;  2J58 A;  2HFE D;  4IL6 X;  5F2N A;  4AQR D;  2LPK A;  1GMJ A;  2GYK A;  1JCC A;  2MVU A;  1J1E C;  3AEF C;  5APU A;  5GTI H;  1KZU B;  1IMP A;  1NKZ B;  1JY2 O;  4DZO A;  2G3A A;  2WQY C;  2JAZ A;  4R0M A;  1T6A A;  2FYU D;  1P84 D;  1AF8 A;  3TSI A;  3G1I A;  2AXT E;  1MFZ A;  5F2O A;  4U7J A;  2FBW C;  3A5T A;  1M90 Q;  1W2B O;  4K3A A;  1M57 D;  2NPS D;  3U1C A;  1L0I A;  2O01 N;  1DNY A;  2Y9Y A;  2QJY B;  2FYZ A;  2MR7 A;  1NU1 E;  2OYI A;  1PL5 A;  2IYP A;  3KPE A;  3ITK A;  4OWF A;  5AW1 B;  3W68 A;  2NPS C;  1EZV G;  3WUV A;  1FZF A;  1LNQ A;  2K9Y A;  2H7H A;  2KG6 A;  2JJL A;  1BDD A;  3BCC G;  2YKP A;  3EFF K;  1CZQ A;  3ZDM A;  5HV8 A;  1NTZ J;  3H1K G;  1SQV G;  1SP4 A;  1FOS F;  1KTM A;  4HB1 A;  2R5B A;  3CX5 I;  5AVT B;  3U1A A;  1M7L A;  1ZW0 A;  3DS4 A;  2C9L Y;  1A43 A;  1QL2 A;  2Z5I A;  3WBH A;  5AW5 B;  2A45 H;  1EZV D;  3Q5P A;  1D7M A;  2JWA A;  4DCK A;  1QRJ A;  1P84 E;  5C39 A;  4R4L A;  3H32 B;  3D6Z A;  1N73 A;  3TGU E;  3BCC D;  1LTT C;  3H1K D;  2VSQ A;  1SQV D;  1JOC A;  1KIL E;  2HYN A;  3H1I G;  2O3J A;  2LOL A;  4WY4 B;  2K88 A;  2MVV A;  1VQL P;  1EOQ A;  1JCD A;  2N50 A;  1OVU A;  3HE4 A;  1DIP A;  5TIS H;  1NTM E;  2H89 C;  3NTN A;  3P8M C;  2KNC A;  1S5L H;  4PD4 I;  4RES B;  1L0N G;  2QVA A;  3CXH E;  1KB9 I;  1YIT P;  2KGA A;  2ERH A;  2WPQ A;  1LT9 A;  1L0L J;  2EFJ A;  3H1J J;  5L8R J;  4L75 A;  3MUD C;  3H1I D;  2XDJ A;  5CJ4 A;  3L36 A;  1YYC A;  3M9Q A;  2HPC B;  2R3S A;  2ZXE B;  2ZAE B;  2KXP B;  4IFF A;  4DOJ A;  1N8R Q;  2FHS C;  2K0Y A;  1L0N D;  4MRT C;  3CCR P;  3CME P;  1FZG A;  2HOD B;  2Z44 A;  3A7O A;  1AYI A;  3M1M A;  5HGO A;  3FXE A;  2FAC A;  1KYO E;  4QNB A;  2QJK B;  1SQB E;  1J1D C;  1PP9 E;  2E76 D;  1N2D C;  4H2X C;  4PV1 D;  2C9N Y;  1JO5 A;  4H2W C;  1LT1 A;  5CMZ A;  3BAT A;  5APQ A;  3MIW A;  1U57 A;  2E75 B;  1S9K E;  2QM7 A;  2OYH C;  4IPY A;  1KOR A;  1NU1 K;  3N4X A;  1UIX A;  4PV1 C;  1NAF A;  1P84 I;  1PEO A;  1VKU A;  2KG8 A;  2AEJ A;  3SWY A;  1R8E A;  3H1J G;  3HE5 B;  1DX7 A;  3L72 G;  3A0B H;  2YXQ B;  2FAE A;  4H0L D;  2GA1 A;  5KAI H;  1NTK E;  2X2B A;  3B4S A;  1JY2 P;  3VRL C;  4WYM A;  3CC2 P;  2I1J A;  2LR2 A;  3USS A;  2GUV A;  2Q7C A;  2PFX A;  1G1J A;  3RG2 A;  4H0L C;  3S9O A;  1T2K D;  7CEI A;  4KHX A;  3H1J D;  2K9J B;  1NTZ E;  3L72 D;  1JB0 J;  4KJM A;  5CZD B;  4BPF A;  2KK7 A;  1JY2 N;  3JC2 2;  4YXW H;  3H32 A;  3LW5 H;  1T2K C;  5AVY B;  3P32 A;  1YQ3 C;  3IF4 A;  4CPG A;  2ZT9 D;  3MHV A;  5KLV J;  1QL1 A;  1GXH A;  5AW8 B;  3WU2 H;  4WY4 A;  1EZV I;  3FWL A;  4JPZ B;  1HTL C;  1NTM K;  1RE4 A;  1EC5 A;  1G1I A;  4XFJ A;  2A06 D;  2GDX A;  5CCG D;  3AED C;  3S4R A;  3B5N D;  2JGP A;  1PZQ A;  3CPW O;  2FFD C;  4COP A;  2K0X A;  4U0E A;  5CCG C;  4D6T G;  1M1J C;  3B5N C;  1URQ B;  2L4B A;  1KLP A;  3VMA A;  2HPC A;  5AVS B;  1KD1 Q;  1ZP0 C;  2GZG A;  3G1G A;  2Z46 A;  1EXJ A;  3V2P A;  2XKM A;  2GZJ A;  1L0L E;  1BCC J;  2K94 A;  1RE3 C;  3GZM A;  3TYY A;  2HOD A;  1SFC B;  1FDO A;  1M74 A;  1N7S C;  2QEX P;  2WIT A;  1QLE D;  4D6T D;  2RKL A;  2JR8 A;  3SWK A;  2JDI H;  2O1J A;  2KYV A;  3PHL A;  3T97 B;  1GW4 A;  2KR5 A;  2A06 E;  1LJ2 A;  2CK3 H;  5HGM A;  2YMK A;  3ABV C;  1BE3 J;  4NPD A;  2W6B A;  4XFZ A;  1JNM A;  2JYG A;  2XU6 A;  2R5D A;  2ZYA A;  1A02 F;  3HE5 A;  2N5H A;  2Q3I A;  1NTK K;  3CCV P;  1HY8 A;  3VTP C;  2PEK A;  2CPB A;  3B5N B;  1Z6M A;  4HJG H;  4ZMD A;  2Y0D A;  4R4M A;  2OYI C;  1QGK B;  1BCC G;  3RK3 D;  1ZR4 A;  1EQ7 A;  2GUS A;  1NTZ K;  1PPJ E;  2OQQ A;  5B5E E;  1GDT A;  3V2Q A;  4BRY B;  2K9J A;  4W7Z A;  3V6I A;  1N7S B;  2K1A A;  3H0D A;  1VQN P;  1IK7 A;  3RK3 C;  3GZL A;  3WUT A;  1S4X A;  4H13 B;  2IPP A;  5B66 E;  3SFD C;  1NHL A;  2KLU A;  1OX3 A;  4JBZ A;  2FVF A;  1BCC D;  1EDL A;  1ZME C;  3PH0 A;  1SQQ J;  4W7Y A;  4N3Y B;  3AEE C;  4PWV B;  1BE3 G;  1X9V A;  4JYB A;  5H2F H;  1N73 C;  2O01 J;  2M8R A;  2LIW A;  1BSN A;  2BEZ F;  5KLV E;  3M06 A;  1EDJ A;  1HQB A;  2MF4 A;  1UNK A;  1NQ4 A;  4ZKP A;  1HGZ A;  4GR6 A;  1EMV A;  3HUS B;  3CCL P;  1GU5 A;  3OAK A;  1KFN A;  1URQ A;  4IFD K;  1EDI A;  2WSE H;  1L0L K;  1BE3 D;  2JWD A;  3C9I A;  2H43 A;  4HKZ H;  1OIP A;  1LT9 C;  4UB8 H;  1FR2 A;  1AFO A;  1S72 P;  1SFC A;  3I5C A;  2LIU A;  2KSJ A;  4XRO A;  2FYU J;  1N7L A;  4WB4 A;  5BVZ A;  3KZI E;  2AFE A;  5I4T G;  4KT0 J;  2KGD A;  2KSE A;  2P10 A;  3CD6 P;  4WBA A;  2OAR A;  4C7N B;  1JUN A;  1FAV A;  3T97 A;  3P7K A;  1SQQ G;  4IFM A;  2GDY A;  3EJE A;  3L75 G;  4JYC A;  2PEQ A;  5AVV B;  5KTB A;  2JO0 A;  5AW0 B;  3L37 A;  1TU3 F;  1EDK A;  2VRS A;  5KKZ B;  4YXD C;  1DEE G;  1RY3 A;  1K04 A;  1JM0 A;  2M3B A;  2W83 C;  1G2C B;  2KZJ A;  3CCJ P;  5BS1 A;  3L71 G;  3DS0 A;  3HE4 B;  1SQQ D;  5TJH A;  2BHV A;  4U0D A;  1OXZ A;  3FWN A;  2QJY C;  3V4W A;  1SS1 A;  4U0A A;  4U3F G;  3CX5 E;  4UHP B;  1VQ8 P;  2PAJ A;  1M6E X;  1LT9 B;  3UIA A;  3HD7 B;  4IL6 H;  3TNU A;  2UWJ E;  1X22 A;  4BRY A;  4EDF A;  3HTK A;  1VQO P;  1N7S A;  3H1H J;  1GTW A;  3Q3D A;  3BCC J;  3L73 J;  3CCU P;  2KUB A;  3NFQ A;  3GF7 A;  5AW6 B;  1X3O A;  4OVN F;  4NEO A;  2M8P A;  2ROQ A;  2C0X A;  4U3F D;  2MJZ A;  2E1M A;  3E1R A;  5KAF H;  4WY4 D;  5KLV K;  1E0H A;  3AE7 C;  2WSE J;  2WSC H;  1AV1 A;  4PD4 E;  3B4Q A;  1NWQ A;  1KB9 E;  2NRG A;  4WY4 C;  2WWW A;  2KGC A;  5KLI C;  3H1I J;  4N78 D;  4Z1M H;  3BRT B;  1RE4 C;  3AE4 C;  3G28 A;  3HUS A;  2WPV B;  2G8Y A;  1YBK A;  1FS0 E;  2BCC J;  3V5B A;  3EFG A;  1IZN B;  3VP9 A;  2E74 B;  3RBZ A;  1HF9 A;  5DJU B;  1L0N J;  3EJB A;  2YIU B;  3H1H G;  5E79 H;  4PJ0 H;  1ZRT D;  5CJ0 A;  3JSV C;  2QNW A;  3L73 G;  2L0Q A;  1KN7 A;  5EFW B;  4H44 B;  2GM4 A;  4EIJ A;  5CHX A;  4OH8 B;  2WPT A;  1SVF A;  3KYQ A;  1ZNV A;  4BWN A;  4C7N A;  4ZNC A;  1JY3 O;  3R4Y A;  1U7M A;  1A8O A;  2KB7 P;  3MP7 B;  2GZE A;  2FYU E;  2E75 D;  3H1H D;  2QJK C;  1GK4 A;  5KJ7 A;  2FAD A;  3L73 D;  2FVA A;  2EG5 A;  2XV5 A;  3V4Q A;  1ZLL A;  2VLN A;  3GJN A;  4NPF X;  5KLI B;  2E75 C;  3OW2 O;  1G2C A;  2BCC G;  2PEI A;  3AE3 C;  1X79 B;  2ZFC A;  1IFD A;  1W2E A;  3Q5R A;  3P05 A;  4M3L A;  2R32 A;  5APY A;  2L9F A;  1MFT A;  1KFM A;  1SQX J;  1HH0 A;  3M0A A;  3M9B A;  4IZ6 A;  4I6M C;  1RF0 A;  3AEA C;  1AQ5 A;  1OWA A;  3HD7 A;  3L72 J;  2CPS A;  2OYO A;  2WSC J;  1LWU B;  1KIL B;  1GPJ A;  4UB6 E;  2BCC D;  2IFN A;  2XZ1 C;  5HGL A;  2E42 A;  2PEN A;  1OZH A;  1EZV E;  2M8N A;  1XTG B;  3DTJ A;  3AEG C;  2KI7 B;  2W8Z A;  1USD A;  3BCC E;  3L73 E;  3H1K E;  2M5R A;  1SQV E;  2IBZ G;  3KQG A;  2K37 A;  1N86 A;  1SQP J;  3BVH A;  1ZMB A;  1Y8A A;  3B5I A;  4TT3 H;  1SQQ K;  5DCK A;  3PLN A;  3G26 A;  2Y0E A;  3VOP A;  3G71 P;  2WZ7 A;  3RL0 B;  2JP3 A;  3GF3 A;  3O6Q B;  1HJB A;  1EXI A;  3AE1 C;  3G29 A;  2EHT A;  3MZW B;  5AW9 B;  2BQ1 E;  2J59 M;  4PXH B;  1RO0 A;  1RQV A;  1UJZ A;  4I7Z B;  3WMM 0;  3FXD A;  1SQX G;  2QA4 P;  3GHG C;  1URQ D;  2IBZ D;  3H1I E;  1FC2 C;  4DG9 A;  1Q7Y Q;  1Y9B A;  2AF8 A;  1VHN A;  1URQ C;  3Q1M A;  4D6T J;  2E5T A;  1T8Z A;  5AVR B;  5HGN A;  1SFC D;  3RK2 B;  1KV4 A;  1L0N E;  2RN0 A;  3O8Z A;  2K5X A;  3NTE A;  1SQX D;  2PP6 A;  5K5G B;  4L74 A;  4O9B A;  2FYU K;  3CC7 P;  2YKO A;  3JCU E;  3PP5 A;  1SFC C;  2XV6 A;  3I56 P;  3PRJ A;  5M1B A;  3DPH A;  1SQP G;  2Z5H A;  5BU5 A;  2YKQ A;  1H0T B;  2LKI A;  4GDO A;  1NGM B;  2NZ2 A;  3GW6 A;  2NO8 A;  3GG2 A;  2MR8 A;  2IDB A;  2OTJ P;  3P8C D;  1CEI A;  2KOS A;  1BGY J;  2W6J H;  2L5G B;  3U59 A;  2RH0 A;  1YQ4 C;  1IUQ A;  3GHG B;  3AE6 C;  1SQP D;  1MKM A;  3C1L A;  2FQ0 A;  1T3J A;  2A45 G;  1ZV8 A;  1FZC B;  1AUM A;  3K5B A;  2QJP B;  3CWB J;  3CCQ P;  1OW7 A;  2JU2 A;  5GTH E;  3MD0 A;  1JY3 P;  3WUU A;  1QX8 A;  1IMQ A;  2K93 A;  1LWU A;  1E5W A;  3W67 A;  1KIL A;  1N7S D;  1L4A B;  4XE5 B;  1KB9 H;  2JEE A;  4I2L C;  1OMI A;  3H1J E;  4H13 D;  5GTI E;  2PGD A;  2AXT H;  3L72 E;  1PFI A;  2AEF A;  4L76 A;  1SQV K;  1YJW P;  2M5A A;  3IN6 A;  1J2J B;  1JMB A;  2GZF A;  1BXI A;  1JY3 N;  2KIK A;  2Z45 A;  4H13 C;  5AVX B;  1VQ5 P;  3VMY A;  2W6A A;  1HBW A;  1VQK P;  3AE2 C;  3O6Q A;  3L70 J;  3H1L J;  5AVW B;  3EJD A;  2FXP A;  1BGY G;  3G9R A;  4EOT A;  2M0B A;  4AYC A;  2V4H A;  2P1J A;  2RMZ A;  1DD4 A;  2B87 A;  1GK6 A;  1GZL A;  3CWB G;  1D1D A;  1AJY A;  4AUW A;  1Q81 Q;  1ZR2 A;  3CCM P;  3HUS C;  2KLV A;  2AFD A;  1L0N K;  1LTI C;  3D71 A;  3LW5 J;  1P84 H;  1BGY D;  2PEM A;  2IBZ I;  1KQL A;  5KP6 B;  1LP1 B;  2C0W A;  5AVZ B;  3CC4 P;  3QWO C;  3D6Y A;  3TNU B;  3HTK B;  2Q5U A;  3CWB D;  4D6T E;  3KDP B;  2HR3 A;  2SPZ A;  2JQ4 A;  1VPC A;  1JEK A;  3Q20 A;  3CXH H;  5KJ7 D;  2Z4E A;  2POH A;  1H0T A;  3L70 G;  3H1L G;  2KOP A;  3SSU A;  2P58 A;  2QE7 H;  2FYN B;  3SWF A;  1PGO A;  5TIS E;  5CCH C;  2LXC B;  4U0C A;  2K2Q A;  5APT A;  3L75 J;  1S5L E;  2FQ2 A;  5AVQ B;  1M1K Q;  5KJ7 C;  1OW6 A;  3PTZ A;  1M6N A;  3AEB C;  2WTY A;  3GHG A;  5KKZ C;  2KS1 B;  3IFM A;  1WRG A;  3L74 G;  2QG4 A;  1BAJ A;  1FZC A;  1R5L A;  3L70 D;  2V7Q H;  3H1L D;  1M8O B;  1Y47 A;  3CLQ A;  3I55 P;  1SQX K;  3HD7 D;  1KYO H;  3L71 J;  1ZN5 A;  3RK3 E;  1JTH A;  2DGY A;  1NU1 J;  3OJA B;  1L4A A;  2XZ0 D;  1Q90 D;  4U3F J;  1VQM P;  1RF0 C;  3HD7 C;  1K8A Q;  3CWB E;  4M0I A;  1F80 D;  1S3J A;  4EI2 A;  1GL2 B;  2IYO A;  2ZJS E;  3L74 D;  1NOH A;  3IAO A;  2YO2 A;  2O1K A;  3HZQ A;  3E1I A;  1BCC E;  1K9M Q;  4A7P A;  4GOE A;  2XNX A;  2A45 I;  2YMY A;  2LTE A;  2N1T B;  2AXC A;  1AVY A;  4PH1 A;  4DT0 A;  5APS A;  3TGU J;  2Y9Z A;  2FKW B;  2HLO A;  3M0D A;  2J5U A;  1YJN P;  3L70 E;  1ZOY C;  2E74 D;  2IZ1 A;  1DD3 A;  5KAI E;  3RBX A;  5APX A;  1FJP A;  3H4E A;  2N98 A;  4WWI A;  1BE3 E;  1NTM J;  3L75 D;  1NU1 G;  1KQG B;  4K35 A;  4U0B A;  1HUC A;  1LP1 A;  1RNI A;  3M91 A;  2E74 C;  2VLP A;  4H44 D;  5CBN A;  2MKV A;  2FXO A;  3H6P A;  2YIU C;  1RF1 B;  2LKM A;  2WT7 A;  1LTJ B;  2P67 A;  2B88 A;  2YO3 A;  3NY7 B;  4H44 C;  3L71 D;  1PGP A;  4I1L A;  2PRR A;  5DJT B;  1KQS O;  2JKV A;  2Q1K A;  2XND H;  1NU1 D;  3WU2 E;  4HKG A;  1VF5 B;  2V7Q J;  3CE7 A;  1T3U A;  3TK1 A;  2KGE A;  3II6 A;  3L4F A;  1NH4 A;  3TGU G;  2H88 C;  1SQB J;  3VP8 A;  4F37 A;  1PP9 J;  1FZE A;  1IFI A;  1H89 A;  2OTL P;  2M8L A;  1NYH A;  2AEM A;  2KS1 A;  1LTG C;  2D2C B;  1SQQ E;  2B9B A;  1IC2 A;  1XTC C;  3L75 E;  1NTM G;  3AE5 C;  5BS2 A;  2FVE A;  1RQU A;  1HWT C;  3FX0 A;  3TGU D;  2LML A;  3CXC O;  4PH0 A;  1KIL D;  4BPH A;  3S1K A;  2PEJ A;  1RH5 B;  1GL2 A;  3L71 E;  2FY8 A;  1YTZ T;  1K73 Q;  3V2N A;  3MGE A;  1NTK J;  1LWU C;  1KIL C;  1NTM D;  2E43 A;  3RGU A;  4COC A;  4U3F E;  1KC8 Q;  3CXH D;  1FDM A;  4B86 A;  1VQ7 P;  1FE6 A;  2XT1 A;  3F5H A;  1NJI Q;  2N1T A;  3RL0 D;  5CCH A;  1SQB G;  2KP8 A;  1PP9 G;  2FQ1 A;  1X0T A;  3D70 A;  1FZB A;  2KOG A;  2ITA A;  4Y99 C;  1YIJ P;  2P2U A;  4N78 E;  1J1E B;  3RL0 C;  2L22 A;  3A2A A;  5HVC A;  5B5E H;  1WMK A;  1IO4 A;  4GIF A;  1E6J P;  3RG6 C;  1PEQ A;  1MZ9 A;  3TDK A;  1MZ8 A;  4I7Z C;  2KOD A;  2Q6Q A;  1KYO D;  2M3E A;  5B66 H;  1SQB D;  3V2R A;  3OA7 A;  1PP9 D;  4Y28 J;  1UII A;  4GOD A;  2XXM A;  1PGJ A;  1ZRT E;  3RK2 D;  2R3C A;  3LMO A;  1RF1 A;  1S9K D;  1OR5 A;  1NTK G;  1IFM A;  1LTJ A;  3AE9 C;  2N9Y B;  1FJK A;  2P7J A;  1VQ4 P;  1CW5 A;  1BDC A;  1AQT A;  5AW3 B;  1FBM A;  3RK2 C;  1OVV A;  2NPS B;  1USE A;  4RKU J;  1VDF A;  1PEU A;  2OGU A;  1DH3 A;  1NTZ G;  1OFC X;  1S5L X;  1PEM A;  4GOF A;  2M5A B;  5KP8 B;  4RJT A;  3H1H E;  5H2F E;  2BUO A;  2MY5 A;  1NTK D;  2WSF H;  1QVG O;  4Y99 B;  4C46 A;  2KOO A;  1NVO A;  1FOS E;  4U0F A;  3H47 A;  5AW7 B;  2LF4 A;  4H2Y C;  1FZA A;  3C8V A;  2ZVN B;  5AW4 B;  1NTZ D; 
#chains in the Genus database with same CATH homology
 4GR2 A;  2PY8 A;  2JYG A;  2PEI A;  3DS2 A;  5HGN A;  3DS1 A;  1VQK P;  1Q82 Q;  1VQ6 P;  1EIA A;  1BAJ A;  1YJ9 P;  1VQP P;  3P05 A;  1S72 P;  3NTE A;  1N8R Q;  3I55 P;  3CCV P;  2PEK A;  4XRO A;  1KQS O;  1YIJ P;  2ONT A;  3CCR P;  1VQ9 P;  3CME P;  3CC7 P;  4XFY A;  2Z44 A;  5I4T G;  1K30 A;  2PEO A;  3CCE P;  3M1M A;  5HGO A;  2XV6 A;  2DGY A;  1QVF O;  1RO2 A;  3I56 P;  4XRQ A;  1Q86 Q;  3CD6 P;  1E6J P;  3RG6 C;  2OAR A;  3DPH A;  1PEQ A;  4QNB A;  3G28 A;  1VQM P;  2KOD A;  1K8A Q;  2PEQ A;  3CPW O;  4M0I A;  3DS5 A;  4COP A;  1D1D A;  2JO0 A;  3E2D A;  4U0E A;  1Q81 Q;  5HGL A;  3CCM P;  2PEN A;  3H0D A;  1VQN P;  3DS4 A;  2CWO A;  2XXM A;  2OTJ P;  2M8N A;  2OTL P;  1A43 A;  4IPY A;  2M8L A;  3HZQ A;  2EIA A;  2PEM A;  3DTJ A;  5F2K A;  3WBH A;  3CMA P;  1K9M Q;  2L6E A;  1KD1 Q;  3G1G A;  1PEO A;  2Z46 A;  3CC4 P;  1YHQ P;  1IUQ A;  1QRJ A;  3CCJ P;  5BS1 A;  1VQ4 P;  3DS0 A;  3G21 A;  1ZMB A;  3B5I A;  3HYB A;  5BS2 A;  1JJ2 O;  5DCK A;  3G26 A;  2BHV A;  4U0D A;  4PH1 A;  3G71 P;  1AUM A;  2JYL A;  1M74 A;  3LRY A;  3G4S P;  3G29 A;  4U0A A;  5F2N A;  3CCQ P;  3CXC O;  3CCS P;  4PH0 A;  1PEU A;  2BQ1 E;  2QEX P;  2PEJ A;  1VQL P;  1EOQ A;  1RO0 A;  1PEM A;  1VQ8 P;  1M6E X;  1YJN P;  3Q20 A;  1A8O A;  3VRL C;  4WYM A;  3G0V A;  3CC2 P;  2BUO A;  4GR6 A;  3G6E P;  2QA4 P;  1K73 Q;  1VQO P;  3MGE A;  1QVG O;  5JPA A;  3CCL P;  2EG5 A;  3H4E A;  3CCU P;  3DS3 A;  1YIT P;  4U0C A;  4COC A;  1YJW P;  4U0B A;  5HGM A;  2P9X A;  4XFX A;  3G1I A;  4U0F A;  1KC8 Q;  2EFJ A;  1Q7Y Q;  3H47 A;  1M1K Q;  1RNI A;  2LF4 A;  2M8P A;  1M6N A;  5F2O A;  3OW2 O;  1VQ7 P;  2Z45 A;  4XFZ A;  1YI2 P;  1W2B O;  1M90 Q;  2E1M A;  1VQ5 P;  2XT1 A;  1NJI Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...