1YHQP

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yhqP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yhqP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yhqP02
3CCVP 1YI2P 1VQ6P 1YJNP 3CXCO 1M90Q 3CCMP 1KQSO 3CCEP 1VQ4P 3G71P 1QVGO 1KC8Q 3CC2P 3CCQP 1Q81Q 1KD1Q 1YIJP 3CPWO 1VQ7P 1JJ2O 2OTJP 1K8AQ 3CCLP 3CC7P 1K73Q 3G4SP 1VQMP 1Q82Q 3CMAP 1Q86Q 3CMEP 1S72P 1YJWP 1VQNP 3I55P 3CCJP 1Q7YQ 1N8RQ 3CCRP 3CC4P 1VQPP 3CCSP 3CD6P 1M1KQ 1W2BO 1NJIQ 3OW2O 3I56P 1VQLP 2QA4P 1QVFO 2QEXP 1VQ9P 3G6EP 1VQ5P 1K9MQ 1VQ8P 1VQKP 1YJ9P 1YITP 1YHQP 2OTLP 3CCUP 1VQOP
chains in the Genus database with same CATH superfamily
1BCCE 1MFTA 2J59M 1AV1A 2MD9A 3JCUE 3V2NA 2FXOA 1E79H 2BHVA 3ABVC 1CI6B 2MR8A 1DD3A 2JJLA 2KSEA 2P67A 4M0IA 2K94A 4GODA 2OGUA 2Z4EA 1VQ6P 3CX5E 2D2CB 2WPTA 2KXPB 4H13C 2CG5B 2KI7B 1U57A 2XT1A 1OIPA 3L75G 2CWOA 2K88A 1L0IA 1QRJA 3AE6C 1NQ4A 1GL2C 1PGOA 2N6YA 1MFZA 2YMYA 3OW2O 2N5HA 3GLMA 2QSIA 4N6JA 3S9OA 1J1EB 2NPSC 4XRQA 2ZVNB 2L6EA 2QVAA 1PL5A 4LGDE 1HGZA 3O6QA 1KYOI 2LF4A 1LTSC 2YO2A 3DS2A 3DS0A 1VQNP 1JY2P 4U3FD 1FOSF 2WPVB 3IN6A 5AVRB 5HGOA 1ZP0C 1ZN5A 3PRJA 1GTWA 5GTIH 2L9FA 2M8NA 3QH9A 3NFQA 3FX0A 2KR5A 2LR2A 4LLHA 2KORA 4UB6E 4XE5B 2HFED 5KLVD 1BGYG 2Y0DA 2K9JA 1T3JA 2XZ1C 2P7JA 4MRTC 2Z46A 1PZQA 3M06A 1AFOA 3E7KA 1ZXGA 2FBWC 1M90Q 4DOJA 2GYKA 1X3OA 1TU3F 2VLNA 5KKZC 2Q6QA 3HD7C 2ROQA 3GJNA 2M5AA 2PEMA 1EXIA 4UHPB 1LTJB 2WPRA 2OQQA 5APSA 2LXCB 1GW4A 4KHXA 5KLIB 1PP9D 1NTMD 2HODA 1EDJA 3HTKB 3CXHI 2KZJA 3NY7B 4M3LA 1PPJG 2R3CA 5B5EE 1NTKG 1KQLA 1RO2A 1NOHA 1S4XA 3DS5A 3A7OA 4Y28J 2P2UA 3AEFC 1BE3D 5DCKA 3Q2YA 1SQQK 1N73B 3L36A 2C9NY 3C8VA 3D6ZA 2N98A 2OYHB 3QWOC 3L70J 1LWUB 1URQA 2Z45A 3L72J 3VMAA 1NH4A 4EDFA 1GXHA 3TSIA 1Y9BA 1ZMBA 2ZVOB 3G1IA 2AXCA 1RF1A 3RK2C 1RNIA 2IBZG 2GZJA 1L0LD 3M0DA 2FQ1A 3BVHA 5AW5B 5APTA 1GMJA 1SQQE 3ITKA 4MN4C 3BATA 1K30A 1JB0J 3H1KE 1SFCA 1T3UA 1G2CB 3USSA 3VOPA 1J2JB 3CCUP 3L71D 3L72G 3SWFA 1AUMA 4ZKUA 4XFZA 2A45H 2P10A 1GL2B 3JC22 1T2KD 1NTZE 1NU1J 1XTGB 1URQD 1NKNA 1BCCG 4C7RA 3VP8A 5KAIH 2NPSB 1AJYA 2QEXP 1NHLA 1JUNA 2MKVA 1VQKP 3KYQA 2CK3H 1LTBC 3V2RA 5DJTB 4CA3A 2XKMA 1Q81Q 5AVSB 2YO3A 1AF8A 3CWBE 2W8ZA 3RL0g 2JP3A 3H32B 2WZ7A 1SFCD 5M1BA 1IMPA 2CPSA 5TISE 4PD4E 1SQXK 5F2OA 3CL3D 3Q3DA 1P84D 3CCRP 1LT9A 1SQBK 1VKUA 1FAVA 2KLVA 4N3YB 5HVCA 3C1LA 5KKZB 2WPSA 3HD7B 1BXIA 1KILA 1AQTA 2R5DA 4ZMDA 1JJ2O 2BCCD 1FJKA 3RG2A 4IFFA 2LL8A 3M1MA 2KGCA 3H1HE 2A06G 3TGUD 2ZJSE 5AVUB 2QJKC 3B5IA 1ZR4A 3HZQA 3MUDC 1KFMA 3AE5C 1SQXE 4H44B 3CX5I 3S4RA 3L75D 2NZ2A 1L0ND 3RL0D 2H8PD 1KB9D 1AQ5A 1S1CX 1RHZB 5HGLA 4U7JA 3M0DC 2LOLA 3CCJP 1DNYA 3LIDA 3PH0A 1DV5A 3B71A 3FGAD 4U0BA 2QJYC 1FZAA 1OW8A 2FADA 1IJDB 4YPCA 4EIJA 1DH3A 4D6TE 2X2BA 3EJEA 3CCEP 3PTZA 3B5NC 4EYYQ 2FXMA 1KD1Q 2JWAA 2D2CD 2KG9A 2LMLA 1KILD 3A3YB 2KOPA 1H89A 1T8KA 1QX8A 1LJ2A 3HYBA 3RK2B 2M5RA 1MV8A 1Q90D 3P32A 3CPWO 1L4AB 5AVYB 3AE8C 1KN7A 4RJTA 1GK4A 3CLQA 2E5TA 5TJHA 4PH1A 3Q5PA 1IK9A 4U0DA 1RE3C 2JU2A 3HTKA 2J58A 1FE6A 2BQ1E 2FYZA 2GDYA 4PV1D 3KDPB 1IFIA 4UB8E 1S9KE 3MD0A 1K73Q 5EW5E 1P84H 3B8EB 2XZRA 1GU4A 4TT3H 2JWDA 2B89A 2Z5IA 3L74J 5KP8B 1KORA 2KG6A 4JF7A 2UWJE 1GK6A 4F37A 1PPJD 3GHGA 1NAYA 3GMAA 1IFMA 1OW7A 1SQQG 2AEMA 2SPZA 1NTKK 3EJBA 4H0LB 2JQ4A 5C39A 3H1KG 2KG8A 3GKLC 1MKMA 3M0AA 1AYIA 5CHXA 2KIKA 1JCDA 1M1JB 2WVRA 4IL6H 2RMZA 2H89C 2L91A 1SQPE 2W27A 2PFXA 3AECC 2V7QJ 3PP5A 1SQVE 1NTZG 2IPPA 5HGMA 1WT6A 3KZIE 2I1KA 2VLQA 4PWVB 1PEMA 5CCGD 1OR5A 2FYUK 5KJ7C 4I6MC 1VQPP 1ZV8A 2B9BA 2IBZD 2KK7A 2LIUA 4L74A 3AE4C 2K5XA 2OTLP 3BCCE 3W68A 2KZIA 3N7NA 3CWBG 2YKPA 1BSNA 1JMBA 1YBKA 2E76C 5DJUB 2CQ8A 3CMAP 1IMQA 3L70D 1GU5A 2QJKB 1N7SB 3L72D 1JEKA 3HE5A 4H2XC 5KAFH 5EFWB 1YHQP 3CCVP 3EWKA 1JTHA 2JBGA 1S3JA 2FFDA 1SQBJ 3WU2H 4K3AA 3EJDA 2NRGA 1VF5C 4OVNF 2N9YB 1N7LA 3VMYA 1IO4A 2QJYB 1A02J 4I7ZC 2KOSA 2GZFA 4Z1MH 1JY3P 3B5NB 4HKGA 3IAOA 1UIXA 3CCMP 3UIAA 2LTEA 1S5LH 1AVYA 1E6JP 2WPQA 4YTPC 1HJ0A 2R3SA 4A7PA 4IOIH 1ZNVA 3VMZA 3DPHA 1SQXG 1HQBA 2V4HA 3N4XA 5APUA 1Z56A 1NU1D 2PEKA 2QJPC 4H2WC 2N1TC 3L73E 4BXLA 1UJZA 1G1IA 1EXJA 1FZBA 2Z44A 1DX7A 1UIIA 4W80A 5GTHH 3VYIA 3HUSA 5BU8B 4OGQD 1R5SA 2BEQD 3CCSP 5E79E 4D6TG 1QL2A 1W2BO 5GTIE 2ERHA 2ZYDA 3OA7A 2C0WA 3GG2A 1FDMA 2Q3EA 3G29A 2A06D 1AA0A 1PEUA 3WUTA 4WY4C 3H1JE 1EOQA 1MUUA 1NKZB 1DIPA 1GW3A 2LPKA 1BGYJ 1EZVD 3ZDMA 3H1IE 3HD7D 3S1KA 1M74A 5AVQB 4N78D 3W67A 1FR2A 3SFDC 2CGQA 1H0TA 4NEOA 1DEBA 1M8OB 3A0BH 5I4TG 4DJGA 3BRVB 3NTEA 1L0HA 4W7YA 3HE4A 3RK3D 1MZ9A 4H44D 2OYIB 1A02F 3A2AA 2OTJP 2E42A 1IFJA 4BRYA 2N5IA 4I2LC 2Q7CA 4AUWA 3WUVA 2WMMA 1NTKJ 3WUUA 2BASA 1J1DC 3EFFK 1YYCA 3GF3A 2MVUA 1KQGB 1FJPA 2FQ0A 1KB9I 4WYMA 1OVUA 3Q5RA 1M6NA 4WVZA 1VQ5P 5APQA 1EDLA 4PD4I 2YXRB 3GW6A 2IFNA 4CPGA 1NAFA 2DW3A 1FZCB 3G71P 2FYUJ 1VF5B 5AVVB 3P8CD 4U3FE 1MZ8A 1RE4A 1RF0A 3DS1A 2AFEA 4R4LA 5F2NA 4I7ZB 1L4AD 3HUSC 2KGEA 3AEDC 5JPAA 3MTUE 2W6JH 2JO0A 1YITP 1CZQA 5KLVE 2GDXA 4WB4A 5CMZA 3VTPC 1H8AA 1K8AQ 1LP1B 1HWTC 1M6EX 2R5BA 1Q86Q 1GPJA 1Z6MA 2B87B 3F89A 4PJ0E 2Q1KA 5KAIE 1NGMB 3D70A 2QJPB 2N1TB 3T97A 3MZWB 2FYUG 1LTIC 4AYCA 3L74D 3EQ2A 1NTZK 4L76A 1BCCJ 2WSCJ 2MR7A 3G3ZA 1SVFA 2GDWA 2O01J 3L4FA 2FXPA 2KOGA 5B66H 2K0YA 1EDKA 1ZRTD 4H0LD 1NTME 2GZGA 2N9BA 1Y8AA 2XU6A 2IX7C 1SLQA 2KS1A 1YTZI 1VQ9P 3G6EP 2K93A 2ONTA 4H13B 4DT0A 5H2FH 2IYOA 1VDFA 4WY4B 4Y99C 2YMKA 5AW2B 5CBNA 3HRNA 1BE3E 5B5EH 2G3AA 3L73G 2QG4A 4WWIA 2MJZA 2WSEJ 3B4QA 1X8YA 2OTKE 3F5HA 3A0HE 3OAKA 2WT7B 4C46A 1ACPA 4C7NA 2JAZA 2J5UA 1ZMEC 2W6AA 3GZMA 2KODA 2HPCB 1HVVA 4H2YC 2QIWA 5AW7B 2O3JA 3P7KA 2POHA 5CCHA 1N7SD 4HYTB 2XV6A 4NPDA 1L0LE 1SP4A 1VPCA 1RO0A 3H1JG 1PGQA 3M9QA 3U1CA 7CEIA 2KWLA 4NPEA 1SQBD 2XV5A 1RF0C 2KGAA 1KYOD 1CI6A 3L71E 1KLPA 3I56P 1JCCA 3V4QA 4GOEA 1BDCA 3H1IG 1CEIA 1JOCA 1RY3A 1FDIA 3IFMA 2O01N 3H0DA 2EHSA 2RH0A 2PGDA 2W6BA 3TNUB 1LTGC 2GA1A 1GD2E 1URQC 3E1RA 5KTBA 2KOOA 2JEEA 2WSSH 1KZUB 2VLPA 1YQ4C 1QGKB 1WRGA 2Q5UA 1NO4A 3FWLA 2K9YA 5CCHD 3H47A 1RF1C 2XNXA 2EFJA 3P05A 1HTLC 1QL1A 4COCA 3G0VA 3A5TA 4ZKPA 3R2PA 1JY2O 2QNWA 2FQ2A 2RN0A 3H4EA 1IZNB 2C9LY 1SFCC 1JY3N 3TK1A 5BS1A 2OYIA 1L0NK 1FDOA 1FOSE 3WMM0 2V7QH 3M9BA 2N50A 1ZR2A 4PD4H 2AXTH 3GZLA 2L5GB 3L37A 2QRXA 3CXHD 5APXA 3FXEA 3V2QA 1FBMA 3AEGC 1FZGA 1UNKA 4XFXA 1RQUA 1BGYD 2BCCE 2GUVA 2JU1A 3O6QB 2KUBA 1K04A 1LTJA 1Q82Q 3TGUE 1SQQJ 4IL6E 1W2EA 3RG6C 3H1KJ 2AFDA 3L75E 5KLVG 1L0NE 2XNDH 3V6IA 1KB9E 2QA4P 2A45G 4U0AA 2BEZF 2KNCB 3KQGA 3RL0C 2ZFCA 1PEQA 1FZCA 1OW6A 5CCGA 1SQPK 3CC2P 4JYCA 2PNGA 1YIJP 1A8OA 5CJ4A 4RO0A 4QKOA 1M56D 2FVAA 1EZVI 1BDDA 1KYOH 1OZHA 1RH5B 1NTZJ 4DG9A 2K9JB 2E75C 1SQVK 3CC4P 2L0QA 1BSHA 3NMDA 5BVZA 1LT9C 1N73A 3NTNA 3VMXA 1M7LA 2OYHA 2K0XA 1NTKD 2PEJA 2AEJA 2GZIA 1S2EA 1KILE 1LP1A 1LWUA 2JO1A 2IZ1A 3VP9A 2M5AB 1KILC 4GR2A 3CWBJ 4B86A 2PEOA 1X22A 3U43A 1FZEA 1JY2N 5KAFE 5AW4B 2PRRA 1J1EC 2HODB 2A45I 3LRYA 1PFIA 2QE7H 1ZW0A 2M8PA 3E1IA 4EOTA 2FYUD 4PH0A 2K2QA 3DS4A 2ZXXA 3LW5J 1PEOA 3SFEC 2E43A 1IUQA 1G2CA 1FS0E 2W83C 3KXDA 4BPGA 2ZT9C 2M0BA 1PV3A 4PV1C 2B88A 2BUOA 4KT0J 5AW9B 1URQB 3PLNA 2AVAA 2KSJA 1KFNA 5CZDB 3CXHH 1GL2A 2L4BA 1H88A 3H1HJ 1XTCC 1PPJE 2GM4A 3H1LE 2NPSA 2E74C 2WT7A 1SQXJ 4U0CA 2ZAEB 4HH2A 2JDIH 4JYBA 3PJSK 2CNRA 5GTHE 3L71G 1BCCD 3M91A 3JSVC 3U1AA 3G9RA 2YXQB 3RBXA 1SFCB 4DCKA 5AVTB 3H32A 3MIWA 4D6TJ 2GZEA 4L73A 3K5BA 2O1JA 1KC8Q 2P58A 4JQ0D 4H13D 4JBZA 3H1HG 3CX5D 3R4YA 2IBZE 3Q5SA 3B4SA 1EQ7A 4L75A 3AEAC 1GL2D 2Y9YA 3AEEC 1IFNA 1IFDA 3HD7A 2NPSD 2ITAA 1F80D 3DS3A 3GHGC 3IF4A 4QNBA 3L70E 2OYHC 2IDBA 3L72E 1LWUC 2JB0A 2QM8A 5AW8B 1KTMA 2M8LA 3RL0B 1FU1A 3NXSA 1PIXA 2HYNA 1K9MQ 2XXMA 5CJ0A 4HKZH 1AVOA 1LTAC 3CXCO 2EG5A 2P9XA 2O1KA 1LT1A 2E75B 2Y9ZA 4ASVA 2PEQA 1LT9B 2BCCG 4LC1A 2KP8A 1VQ8P 3C9IA 1HY8A 3GF7A 3TGUG 4JPZB 1KILB 4AQRD 1L0NG 1Q2NA 5AW3B 4OWFA 1NU1E 2EIAA 2WSFJ 1SQPJ 1FC2C 1GXGA 5AVXB 4YXDC 2OARA 1VQOP 4RKUJ 4U0FA 2WITA 1SQVJ 2JGPA 1P84I 2WSCH 1EMVA 2VSQA 1L4AA 2O01H 4OGQC 2FFDC 3LMOA 3JCUH 4GOFA 2E5YA 1LNQA 4KJMA 1R8EA 2Y0CA 2ZT9B 5E79H 2KNCA 4PV1B 3BCCJ 2A06E 2M3EA 2E76B 3O8ZA 3CX5H 2VRSA 1KQFB 2MY5A 1SQPG 5KLVK 1HH0A 1OX3A 1RQVA 2E74B 2K37A 1EZVE 3H1LJ 1HF9A 2WSEH 1SQVG 2HG5D 1KV4A 5L8RJ 5B66E 3II6A 4N78E 3RK2D 2M8RA 4XFYA 2WWWA 1M1JA 4IZ6A 5AW0B 1N8RQ 4EI2A 3BCCG 1SS1A 4YXWH 3RK3E 3VRLC 1SQQD 2AEFA 4XA4A 2H43A 3RK3C 3H1KD 1NTMK 2KB7P 1YI2P 4H44C 5H2FE 1QLED 5AVWB 3FWNA 3OJAB 4OH8B 1JO5A 2KOQA 2IZ0A 1DD4A 3H1LG 4UB6H 1CSBA 4PXHB 3MGNA 1NYHA 1QEXA 1NTZD 2KGDA 3L73J 2E1MA 3GHGB 4U0EA 5AVZB 3TF5A 3AE2C 2FVEA 3KPEA 2GUSA 1LGHB 2N6ZA 2QM7A 2I1JA 1N7SA 2JYGA 1Q7YQ 1PP9E 3MUDA 1M1KQ 2JR8A 3CWBD 1G1JA 1PGPA 2YIUC 1YJ9P 3DTJA 1BAJA 3P8CE 4GT1A 3V4WA 3CCQP 1D7MA 2HR3A 1L0LK 3H1JJ 1L4AC 4PD4D 2K3RA 4BPFA 2FACA 1HUCA 3CD6P 2XDJA 2H7HA 5F2KA 3L70G 4NPFX 3B5NA 1JY3O 1X79B 2JKVA 2FY8A 1PGJA 2JYLA 1HJBA 3H1IJ 2ZYGA 3H6PA 3RGUA 2PY8A 1OVRA 4DZOA 3L74E 4PJ0H 1ZLLA 5BS2A 2LKIA 3HE5B 3H1HD 2PP6A 3TYYA 4IPYA 1ZRTE 1JTHB 1SQXD 4OGQB 2FFDB 5EJDA 3LIEA 2R32A 2K0DX 2IBZI 4H0LC 2DNWA 1S72P 3E2DA 2ZYAA 3G26A 1RE4C 1M1JC 1RE3A 1YQ3C 4R0MA 4BPHA 1EDIA 1GDTA 1EC5A 2VLOA 3AE7C 1J1DB 3AE3C 1NU1G 2W90A 2AXTE 1ZOYC 3B5ND 3SSUA 3Q1MA 1VQ7P 4D6TD 2YNYA 2WQYC 2EHTA 1T2KC 2WTYA 3MHVA 3EFGA 4ASWA 4I1LA 3D71A 3IR9A 3G1GA 2FYNC 2IFMA 3Q20A 5AW6B 3A0HH 4GDOA 3CI9A 4GIFA 4BWNA 1K05A 1QVGO 4U3FJ 2NO8A 2LIWA 3HUSB 2PAJA 1IK7A 1N7SC 3RK3B 2AF8A 4W7ZA 3V2PA 1JNMA 5KLVJ 3PHLA 1SQBE 1EZVG 5TISH 1KYOE 1P84E 1VQMP 5KJ7A 1E5WA 1CW5A 2M3BA 2FVFA 2I8DA 3I5CA 3CMEP 1S9KD 2Y0EA 1Y47A 2E75D 3LW5H 1KMIZ 3V5BA 1FZFA 4U3FG 5KP7B 3WBHA 2H88C 1EIAA 4IFDK 1OXZA 3RBZA 5APWA 2DGYA 1YJWP 1PP9J 1NTMJ 3I55P 1H0TB 3AE9C 2YIUB 2OYOA 3HE4B 1SQPD 5CCHC 1KQSO 4Y99B 3CCLP 1L2PA 4HB1A 2G8YA 1T8ZA 1X0TA 1SQVD 4BRYB 1BE3J 3SWYA 5CBOA 5K5GB 5KJ7D 1NJIQ 3H25A 4O9BA 4ZNCA 2ZT9D 1HBWA 4IL6X 3BASA 1PP9G 1NTMG 2D2CC 3M9HA 3BCCD 1N86A 3CXHE 4GR6A 2E76D 3AEBC 1DEEG 2MVVA 1E0HA 2HLOA 2B87A 3P8MC 2Q3IA 5KP6B 2P1JA 2PEIA 1BGYE 2N1TA 1USEA 1QVFO 1R5LA 2E74D 1L0LJ 1W5CE 3TDKA 3H1LD 1LTTC 1JM0A 1HGVA 5AW1B 3WU2E 1VL2A 1BE3G 3KHUA 5APYA 3CC7P 4WBAA 1VHNA 1JMMA 2LKMA 2FKWB 3AE1C 2KW2A 1VF5D 2K1AA 3L71J 2K92A 1KB9H 3CE7A 4XROA 5HV8A 2KLUA 1NVOA 1S5LE 3MGEA 1GZLA 4WY4A 1U7JA 3L74G 2OYIC 4UB8H 4QMAA 2CPBA 2Z5HA 1U7MA 2FHSC 3SWKA 1L0LG 2FYNB 2KYVA 2RKLA 1OWAA 2PENA 1NTKE 3T97B 2YKQA 2N1TD 1N2DC 5APVA 1RF1B 3L73D 2C0XA 5HGNA 4IFMA 4RESB 4HJGH 3G4SP 2R44A 2MF4A 2FAEA 2HPCA 1T6AA 2YKOA 1LTJC 4XFJA 3G21A 1S5LX 1YTZT 2WSFH 2KS1B 4K35A 4GKGA 5KLIC 1YJNP 1VQ4P 2FYUE 2LXBA 3U59A 1FZCC 1IC2A 2IYPA 2L22A 5CCGC 4R4MA 3KZIH 2Q9IA 4WY4D 1IFPA 1OMIA 3D6YA 4COPA 3H1JD 1VQLP 3L35A 1OFCX 2BCCJ 1USDA 1NWQA 4C7NB 1N73C 1X9VA 3G28A 4TLFA 3MP7B 3TGUJ 1WMKA 3TNUA 1M57D 2ZXEB 3FXDA 2XZ0D 3H1ID 1OVVA 3VN0A 3A0BE 3L75J 3BRTB 1L0NJ 1A43A 1SQBG 5BU5A 1D1DA 1NU1K
chains in the Genus database with same CATH topology
1YI2P 3WBHA 3MGEA 3CCMP 1AUMA 4IPYA 3H0DA 3CC2P 1E6JP 1EIAA 1YIJP 4XFZA 2OTJP 1A8OA 2PEMA 2BHVA 5HGLA 1S72P 2DGYA 3DPHA 3E2DA 1YJWP 3I55P 3CCJP 3G26A 2EIAA 3CC4P 4U0BA 2PENA 2QEXP 1VQ9P 3G6EP 4M0IA 1VQKP 2PEKA 2ONTA 2OARA 1VQOP 2E1MA 4U0FA 1VQ6P 4U0EA 3CCEP 1KQSO 2PEJA 1KC8Q 3H47A 2XT1A 5HGMA 1Q81Q 1KD1Q 5HGNA 1VQ7P 3CCLP 2Z44A 2EFJA 3G4SP 1PEMA 2CWOA 3P05A 4GR2A 4COCA 1RO2A 3G0VA 2JYGA 3DS5A 2PEOA 1Q7YQ 1QRJA 4WYMA 1VQPP 3CCSP 3G21A 1M1KQ 1W2BO 1NJIQ 3OW2O 3G1GA 1M6NA 5DCKA 3H4EA 1VQ5P 3HYBA 3Q20A 1YJ9P 3DTJA 1BAJA 2OTLP 4XRQA 5BS1A 1YJNP 2L6EA 3LRYA 1VQ4P 3G71P 1QVGO 3DS3A 2LF4A 3CCQP 4QNBA 3G29A 3CPWO 2M8PA 2Z45A 5F2OA 1PEUA 4GR6A 3CMAP 3DS1A 3DS2A 1EOQA 2KODA 4PH0A 3DS0A 3DS4A 1VQNP 5F2NA 1PEOA 3CCRP 2PEIA 3CD6P 5HGOA 2M8LA 4COPA 1IUQA 4PH1A 5F2KA 5JPAA 1VQLP 1QVFO 1K9MQ 2XXMA 2M8NA 1ZMBA 2JO0A 4U0DA 2XV6A 1YITP 1YHQP 4XFXA 3CCVP 3G1IA 2BQ1E 3CXCO 1RO0A 2BUOA 1RNIA 2EG5A 2JYLA 3G28A 2P9XA 4XFYA 1JJ2O 1K8AQ 3CC7P 1M6EX 1K73Q 1VQMP 1Q82Q 2PY8A 1M74A 1Q86Q 3CMEP 3M1MA 1N8RQ 2PEQA 1K30A 3RG6C 5I4TG 1A43A 3B5IA 3I56P 3HZQA 2Z46A 3VRLC 5BS2A 3NTEA 2QA4P 4U0AA 1VQ8P 4U0CA 4XROA 1PEQA 1D1DA 3CCUP 1M90Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV P;  1YI2 P;  1VQ6 P;  1YJN P;  3CXC O;  1M90 Q;  3CCM P;  1KQS O;  3CCE P;  1VQ4 P;  3G71 P;  1QVG O;  1KC8 Q;  3CC2 P;  3CCQ P;  1Q81 Q;  1KD1 Q;  1YIJ P;  3CPW O;  1VQ7 P;  1JJ2 O;  2OTJ P;  1K8A Q;  3CCL P;  3CC7 P;  1K73 Q;  3G4S P;  1VQM P;  1Q82 Q;  3CMA P;  1Q86 Q;  3CME P;  1S72 P;  1YJW P;  1VQN P;  3I55 P;  3CCJ P;  1Q7Y Q;  1N8R Q;  3CCR P;  3CC4 P;  1VQP P;  3CCS P;  3CD6 P;  1M1K Q;  1W2B O;  1NJI Q;  3OW2 O;  3I56 P;  1VQL P;  2QA4 P;  1QVF O;  2QEX P;  1VQ9 P;  3G6E P;  1VQ5 P;  1K9M Q;  1VQ8 P;  1VQK P;  1YJ9 P;  1YIT P;  1YHQ P;  2OTL P;  3CCU P;  1VQO P; 
#chains in the Genus database with same CATH topology
 1BCC E;  1MFT A;  2J59 M;  1AV1 A;  2MD9 A;  3JCU E;  3V2N A;  2FXO A;  1E79 H;  2BHV A;  3ABV C;  1CI6 B;  2MR8 A;  1DD3 A;  2JJL A;  2KSE A;  2P67 A;  4M0I A;  2K94 A;  4GOD A;  2OGU A;  2Z4E A;  1VQ6 P;  3CX5 E;  2D2C B;  2WPT A;  2KXP B;  4H13 C;  2CG5 B;  2KI7 B;  1U57 A;  2XT1 A;  1OIP A;  3L75 G;  2CWO A;  2K88 A;  1L0I A;  1QRJ A;  3AE6 C;  1NQ4 A;  1GL2 C;  1PGO A;  2N6Y A;  1MFZ A;  2YMY A;  3OW2 O;  2N5H A;  3GLM A;  2QSI A;  4N6J A;  3S9O A;  1J1E B;  2NPS C;  4XRQ A;  2ZVN B;  2L6E A;  2QVA A;  1PL5 A;  4LGD E;  1HGZ A;  3O6Q A;  1KYO I;  2LF4 A;  1LTS C;  2YO2 A;  3DS2 A;  3DS0 A;  1VQN P;  1JY2 P;  4U3F D;  1FOS F;  2WPV B;  3IN6 A;  5AVR B;  5HGO A;  1ZP0 C;  1ZN5 A;  3PRJ A;  1GTW A;  5GTI H;  2L9F A;  2M8N A;  3QH9 A;  3NFQ A;  3FX0 A;  2KR5 A;  2LR2 A;  4LLH A;  2KOR A;  4UB6 E;  4XE5 B;  2HFE D;  5KLV D;  1BGY G;  2Y0D A;  2K9J A;  1T3J A;  2XZ1 C;  2P7J A;  4MRT C;  2Z46 A;  1PZQ A;  3M06 A;  1AFO A;  3E7K A;  1ZXG A;  2FBW C;  1M90 Q;  4DOJ A;  2GYK A;  1X3O A;  1TU3 F;  2VLN A;  5KKZ C;  2Q6Q A;  3HD7 C;  2ROQ A;  3GJN A;  2M5A A;  2PEM A;  1EXI A;  4UHP B;  1LTJ B;  2WPR A;  2OQQ A;  5APS A;  2LXC B;  1GW4 A;  4KHX A;  5KLI B;  1PP9 D;  1NTM D;  2HOD A;  1EDJ A;  3HTK B;  3CXH I;  2KZJ A;  3NY7 B;  4M3L A;  1PPJ G;  2R3C A;  5B5E E;  1NTK G;  1KQL A;  1RO2 A;  1NOH A;  1S4X A;  3DS5 A;  3A7O A;  4Y28 J;  2P2U A;  3AEF C;  1BE3 D;  5DCK A;  3Q2Y A;  1SQQ K;  1N73 B;  3L36 A;  2C9N Y;  3C8V A;  3D6Z A;  2N98 A;  2OYH B;  3QWO C;  3L70 J;  1LWU B;  1URQ A;  2Z45 A;  3L72 J;  3VMA A;  1NH4 A;  4EDF A;  1GXH A;  3TSI A;  1Y9B A;  1ZMB A;  2ZVO B;  3G1I A;  2AXC A;  1RF1 A;  3RK2 C;  1RNI A;  2IBZ G;  2GZJ A;  1L0L D;  3M0D A;  2FQ1 A;  3BVH A;  5AW5 B;  5APT A;  1GMJ A;  1SQQ E;  3ITK A;  4MN4 C;  3BAT A;  1K30 A;  1JB0 J;  3H1K E;  1SFC A;  1T3U A;  1G2C B;  3USS A;  3VOP A;  1J2J B;  3CCU P;  3L71 D;  3L72 G;  3SWF A;  1AUM A;  4ZKU A;  4XFZ A;  2A45 H;  2P10 A;  1GL2 B;  3JC2 2;  1T2K D;  1NTZ E;  1NU1 J;  1XTG B;  1URQ D;  1NKN A;  1BCC G;  4C7R A;  3VP8 A;  5KAI H;  2NPS B;  1AJY A;  2QEX P;  1NHL A;  1JUN A;  2MKV A;  1VQK P;  3KYQ A;  2CK3 H;  1LTB C;  3V2R A;  5DJT B;  4CA3 A;  2XKM A;  1Q81 Q;  5AVS B;  2YO3 A;  1AF8 A;  3CWB E;  2W8Z A;  3RL0 g;  2JP3 A;  3H32 B;  2WZ7 A;  1SFC D;  5M1B A;  1IMP A;  2CPS A;  5TIS E;  4PD4 E;  1SQX K;  5F2O A;  3CL3 D;  3Q3D A;  1P84 D;  3CCR P;  1LT9 A;  1SQB K;  1VKU A;  1FAV A;  2KLV A;  4N3Y B;  5HVC A;  3C1L A;  5KKZ B;  2WPS A;  3HD7 B;  1BXI A;  1KIL A;  1AQT A;  2R5D A;  4ZMD A;  1JJ2 O;  2BCC D;  1FJK A;  3RG2 A;  4IFF A;  2LL8 A;  3M1M A;  2KGC A;  3H1H E;  2A06 G;  3TGU D;  2ZJS E;  5AVU B;  2QJK C;  3B5I A;  1ZR4 A;  3HZQ A;  3MUD C;  1KFM A;  3AE5 C;  1SQX E;  4H44 B;  3CX5 I;  3S4R A;  3L75 D;  2NZ2 A;  1L0N D;  3RL0 D;  2H8P D;  1KB9 D;  1AQ5 A;  1S1C X;  1RHZ B;  5HGL A;  4U7J A;  3M0D C;  2LOL A;  3CCJ P;  1DNY A;  3LID A;  3PH0 A;  1DV5 A;  3B71 A;  3FGA D;  4U0B A;  2QJY C;  1FZA A;  1OW8 A;  2FAD A;  1IJD B;  4YPC A;  4EIJ A;  1DH3 A;  4D6T E;  2X2B A;  3EJE A;  3CCE P;  3PTZ A;  3B5N C;  4EYY Q;  2FXM A;  1KD1 Q;  2JWA A;  2D2C D;  2KG9 A;  2LML A;  1KIL D;  3A3Y B;  2KOP A;  1H89 A;  1T8K A;  1QX8 A;  1LJ2 A;  3HYB A;  3RK2 B;  2M5R A;  1MV8 A;  1Q90 D;  3P32 A;  3CPW O;  1L4A B;  5AVY B;  3AE8 C;  1KN7 A;  4RJT A;  1GK4 A;  3CLQ A;  2E5T A;  5TJH A;  4PH1 A;  3Q5P A;  1IK9 A;  4U0D A;  1RE3 C;  2JU2 A;  3HTK A;  2J58 A;  1FE6 A;  2BQ1 E;  2FYZ A;  2GDY A;  4PV1 D;  3KDP B;  1IFI A;  4UB8 E;  1S9K E;  3MD0 A;  1K73 Q;  5EW5 E;  1P84 H;  3B8E B;  2XZR A;  1GU4 A;  4TT3 H;  2JWD A;  2B89 A;  2Z5I A;  3L74 J;  5KP8 B;  1KOR A;  2KG6 A;  4JF7 A;  2UWJ E;  1GK6 A;  4F37 A;  1PPJ D;  3GHG A;  1NAY A;  3GMA A;  1IFM A;  1OW7 A;  1SQQ G;  2AEM A;  2SPZ A;  1NTK K;  3EJB A;  4H0L B;  2JQ4 A;  5C39 A;  3H1K G;  2KG8 A;  3GKL C;  1MKM A;  3M0A A;  1AYI A;  5CHX A;  2KIK A;  1JCD A;  1M1J B;  2WVR A;  4IL6 H;  2RMZ A;  2H89 C;  2L91 A;  1SQP E;  2W27 A;  2PFX A;  3AEC C;  2V7Q J;  3PP5 A;  1SQV E;  1NTZ G;  2IPP A;  5HGM A;  1WT6 A;  3KZI E;  2I1K A;  2VLQ A;  4PWV B;  1PEM A;  5CCG D;  1OR5 A;  2FYU K;  5KJ7 C;  4I6M C;  1VQP P;  1ZV8 A;  2B9B A;  2IBZ D;  2KK7 A;  2LIU A;  4L74 A;  3AE4 C;  2K5X A;  2OTL P;  3BCC E;  3W68 A;  2KZI A;  3N7N A;  3CWB G;  2YKP A;  1BSN A;  1JMB A;  1YBK A;  2E76 C;  5DJU B;  2CQ8 A;  3CMA P;  1IMQ A;  3L70 D;  1GU5 A;  2QJK B;  1N7S B;  3L72 D;  1JEK A;  3HE5 A;  4H2X C;  5KAF H;  5EFW B;  1YHQ P;  3CCV P;  3EWK A;  1JTH A;  2JBG A;  1S3J A;  2FFD A;  1SQB J;  3WU2 H;  4K3A A;  3EJD A;  2NRG A;  1VF5 C;  4OVN F;  2N9Y B;  1N7L A;  3VMY A;  1IO4 A;  2QJY B;  1A02 J;  4I7Z C;  2KOS A;  2GZF A;  4Z1M H;  1JY3 P;  3B5N B;  4HKG A;  3IAO A;  1UIX A;  3CCM P;  3UIA A;  2LTE A;  1S5L H;  1AVY A;  1E6J P;  2WPQ A;  4YTP C;  1HJ0 A;  2R3S A;  4A7P A;  4IOI H;  1ZNV A;  3VMZ A;  3DPH A;  1SQX G;  1HQB A;  2V4H A;  3N4X A;  5APU A;  1Z56 A;  1NU1 D;  2PEK A;  2QJP C;  4H2W C;  2N1T C;  3L73 E;  4BXL A;  1UJZ A;  1G1I A;  1EXJ A;  1FZB A;  2Z44 A;  1DX7 A;  1UII A;  4W80 A;  5GTH H;  3VYI A;  3HUS A;  5BU8 B;  4OGQ D;  1R5S A;  2BEQ D;  3CCS P;  5E79 E;  4D6T G;  1QL2 A;  1W2B O;  5GTI E;  2ERH A;  2ZYD A;  3OA7 A;  2C0W A;  3GG2 A;  1FDM A;  2Q3E A;  3G29 A;  2A06 D;  1AA0 A;  1PEU A;  3WUT A;  4WY4 C;  3H1J E;  1EOQ A;  1MUU A;  1NKZ B;  1DIP A;  1GW3 A;  2LPK A;  1BGY J;  1EZV D;  3ZDM A;  3H1I E;  3HD7 D;  3S1K A;  1M74 A;  5AVQ B;  4N78 D;  3W67 A;  1FR2 A;  3SFD C;  2CGQ A;  1H0T A;  4NEO A;  1DEB A;  1M8O B;  3A0B H;  5I4T G;  4DJG A;  3BRV B;  3NTE A;  1L0H A;  4W7Y A;  3HE4 A;  3RK3 D;  1MZ9 A;  4H44 D;  2OYI B;  1A02 F;  3A2A A;  2OTJ P;  2E42 A;  1IFJ A;  4BRY A;  2N5I A;  4I2L C;  2Q7C A;  4AUW A;  3WUV A;  2WMM A;  1NTK J;  3WUU A;  2BAS A;  1J1D C;  3EFF K;  1YYC A;  3GF3 A;  2MVU A;  1KQG B;  1FJP A;  2FQ0 A;  1KB9 I;  4WYM A;  1OVU A;  3Q5R A;  1M6N A;  4WVZ A;  1VQ5 P;  5APQ A;  1EDL A;  4PD4 I;  2YXR B;  3GW6 A;  2IFN A;  4CPG A;  1NAF A;  2DW3 A;  1FZC B;  3G71 P;  2FYU J;  1VF5 B;  5AVV B;  3P8C D;  4U3F E;  1MZ8 A;  1RE4 A;  1RF0 A;  3DS1 A;  2AFE A;  4R4L A;  5F2N A;  4I7Z B;  1L4A D;  3HUS C;  2KGE A;  3AED C;  5JPA A;  3MTU E;  2W6J H;  2JO0 A;  1YIT P;  1CZQ A;  5KLV E;  2GDX A;  4WB4 A;  5CMZ A;  3VTP C;  1H8A A;  1K8A Q;  1LP1 B;  1HWT C;  1M6E X;  2R5B A;  1Q86 Q;  1GPJ A;  1Z6M A;  2B87 B;  3F89 A;  4PJ0 E;  2Q1K A;  5KAI E;  1NGM B;  3D70 A;  2QJP B;  2N1T B;  3T97 A;  3MZW B;  2FYU G;  1LTI C;  4AYC A;  3L74 D;  3EQ2 A;  1NTZ K;  4L76 A;  1BCC J;  2WSC J;  2MR7 A;  3G3Z A;  1SVF A;  2GDW A;  2O01 J;  3L4F A;  2FXP A;  2KOG A;  5B66 H;  2K0Y A;  1EDK A;  1ZRT D;  4H0L D;  1NTM E;  2GZG A;  2N9B A;  1Y8A A;  2XU6 A;  2IX7 C;  1SLQ A;  2KS1 A;  1YTZ I;  1VQ9 P;  3G6E P;  2K93 A;  2ONT A;  4H13 B;  4DT0 A;  5H2F H;  2IYO A;  1VDF A;  4WY4 B;  4Y99 C;  2YMK A;  5AW2 B;  5CBN A;  3HRN A;  1BE3 E;  5B5E H;  2G3A A;  3L73 G;  2QG4 A;  4WWI A;  2MJZ A;  2WSE J;  3B4Q A;  1X8Y A;  2OTK E;  3F5H A;  3A0H E;  3OAK A;  2WT7 B;  4C46 A;  1ACP A;  4C7N A;  2JAZ A;  2J5U A;  1ZME C;  2W6A A;  3GZM A;  2KOD A;  2HPC B;  1HVV A;  4H2Y C;  2QIW A;  5AW7 B;  2O3J A;  3P7K A;  2POH A;  5CCH A;  1N7S D;  4HYT B;  2XV6 A;  4NPD A;  1L0L E;  1SP4 A;  1VPC A;  1RO0 A;  3H1J G;  1PGQ A;  3M9Q A;  3U1C A;  7CEI A;  2KWL A;  4NPE A;  1SQB D;  2XV5 A;  1RF0 C;  2KGA A;  1KYO D;  1CI6 A;  3L71 E;  1KLP A;  3I56 P;  1JCC A;  3V4Q A;  4GOE A;  1BDC A;  3H1I G;  1CEI A;  1JOC A;  1RY3 A;  1FDI A;  3IFM A;  2O01 N;  3H0D A;  2EHS A;  2RH0 A;  2PGD A;  2W6B A;  3TNU B;  1LTG C;  2GA1 A;  1GD2 E;  1URQ C;  3E1R A;  5KTB A;  2KOO A;  2JEE A;  2WSS H;  1KZU B;  2VLP A;  1YQ4 C;  1QGK B;  1WRG A;  2Q5U A;  1NO4 A;  3FWL A;  2K9Y A;  5CCH D;  3H47 A;  1RF1 C;  2XNX A;  2EFJ A;  3P05 A;  1HTL C;  1QL1 A;  4COC A;  3G0V A;  3A5T A;  4ZKP A;  3R2P A;  1JY2 O;  2QNW A;  2FQ2 A;  2RN0 A;  3H4E A;  1IZN B;  2C9L Y;  1SFC C;  1JY3 N;  3TK1 A;  5BS1 A;  2OYI A;  1L0N K;  1FDO A;  1FOS E;  3WMM 0;  2V7Q H;  3M9B A;  2N50 A;  1ZR2 A;  4PD4 H;  2AXT H;  3GZL A;  2L5G B;  3L37 A;  2QRX A;  3CXH D;  5APX A;  3FXE A;  3V2Q A;  1FBM A;  3AEG C;  1FZG A;  1UNK A;  4XFX A;  1RQU A;  1BGY D;  2BCC E;  2GUV A;  2JU1 A;  3O6Q B;  2KUB A;  1K04 A;  1LTJ A;  1Q82 Q;  3TGU E;  1SQQ J;  4IL6 E;  1W2E A;  3RG6 C;  3H1K J;  2AFD A;  3L75 E;  5KLV G;  1L0N E;  2XND H;  3V6I A;  1KB9 E;  2QA4 P;  2A45 G;  4U0A A;  2BEZ F;  2KNC B;  3KQG A;  3RL0 C;  2ZFC A;  1PEQ A;  1FZC A;  1OW6 A;  5CCG A;  1SQP K;  3CC2 P;  4JYC A;  2PNG A;  1YIJ P;  1A8O A;  5CJ4 A;  4RO0 A;  4QKO A;  1M56 D;  2FVA A;  1EZV I;  1BDD A;  1KYO H;  1OZH A;  1RH5 B;  1NTZ J;  4DG9 A;  2K9J B;  2E75 C;  1SQV K;  3CC4 P;  2L0Q A;  1BSH A;  3NMD A;  5BVZ A;  1LT9 C;  1N73 A;  3NTN A;  3VMX A;  1M7L A;  2OYH A;  2K0X A;  1NTK D;  2PEJ A;  2AEJ A;  2GZI A;  1S2E A;  1KIL E;  1LP1 A;  1LWU A;  2JO1 A;  2IZ1 A;  3VP9 A;  2M5A B;  1KIL C;  4GR2 A;  3CWB J;  4B86 A;  2PEO A;  1X22 A;  3U43 A;  1FZE A;  1JY2 N;  5KAF E;  5AW4 B;  2PRR A;  1J1E C;  2HOD B;  2A45 I;  3LRY A;  1PFI A;  2QE7 H;  1ZW0 A;  2M8P A;  3E1I A;  4EOT A;  2FYU D;  4PH0 A;  2K2Q A;  3DS4 A;  2ZXX A;  3LW5 J;  1PEO A;  3SFE C;  2E43 A;  1IUQ A;  1G2C A;  1FS0 E;  2W83 C;  3KXD A;  4BPG A;  2ZT9 C;  2M0B A;  1PV3 A;  4PV1 C;  2B88 A;  2BUO A;  4KT0 J;  5AW9 B;  1URQ B;  3PLN A;  2AVA A;  2KSJ A;  1KFN A;  5CZD B;  3CXH H;  1GL2 A;  2L4B A;  1H88 A;  3H1H J;  1XTC C;  1PPJ E;  2GM4 A;  3H1L E;  2NPS A;  2E74 C;  2WT7 A;  1SQX J;  4U0C A;  2ZAE B;  4HH2 A;  2JDI H;  4JYB A;  3PJS K;  2CNR A;  5GTH E;  3L71 G;  1BCC D;  3M91 A;  3JSV C;  3U1A A;  3G9R A;  2YXQ B;  3RBX A;  1SFC B;  4DCK A;  5AVT B;  3H32 A;  3MIW A;  4D6T J;  2GZE A;  4L73 A;  3K5B A;  2O1J A;  1KC8 Q;  2P58 A;  4JQ0 D;  4H13 D;  4JBZ A;  3H1H G;  3CX5 D;  3R4Y A;  2IBZ E;  3Q5S A;  3B4S A;  1EQ7 A;  4L75 A;  3AEA C;  1GL2 D;  2Y9Y A;  3AEE C;  1IFN A;  1IFD A;  3HD7 A;  2NPS D;  2ITA A;  1F80 D;  3DS3 A;  3GHG C;  3IF4 A;  4QNB A;  3L70 E;  2OYH C;  2IDB A;  3L72 E;  1LWU C;  2JB0 A;  2QM8 A;  5AW8 B;  1KTM A;  2M8L A;  3RL0 B;  1FU1 A;  3NXS A;  1PIX A;  2HYN A;  1K9M Q;  2XXM A;  5CJ0 A;  4HKZ H;  1AVO A;  1LTA C;  3CXC O;  2EG5 A;  2P9X A;  2O1K A;  1LT1 A;  2E75 B;  2Y9Z A;  4ASV A;  2PEQ A;  1LT9 B;  2BCC G;  4LC1 A;  2KP8 A;  1VQ8 P;  3C9I A;  1HY8 A;  3GF7 A;  3TGU G;  4JPZ B;  1KIL B;  4AQR D;  1L0N G;  1Q2N A;  5AW3 B;  4OWF A;  1NU1 E;  2EIA A;  2WSF J;  1SQP J;  1FC2 C;  1GXG A;  5AVX B;  4YXD C;  2OAR A;  1VQO P;  4RKU J;  4U0F A;  2WIT A;  1SQV J;  2JGP A;  1P84 I;  2WSC H;  1EMV A;  2VSQ A;  1L4A A;  2O01 H;  4OGQ C;  2FFD C;  3LMO A;  3JCU H;  4GOF A;  2E5Y A;  1LNQ A;  4KJM A;  1R8E A;  2Y0C A;  2ZT9 B;  5E79 H;  2KNC A;  4PV1 B;  3BCC J;  2A06 E;  2M3E A;  2E76 B;  3O8Z A;  3CX5 H;  2VRS A;  1KQF B;  2MY5 A;  1SQP G;  5KLV K;  1HH0 A;  1OX3 A;  1RQV A;  2E74 B;  2K37 A;  1EZV E;  3H1L J;  1HF9 A;  2WSE H;  1SQV G;  2HG5 D;  1KV4 A;  5L8R J;  5B66 E;  3II6 A;  4N78 E;  3RK2 D;  2M8R A;  4XFY A;  2WWW A;  1M1J A;  4IZ6 A;  5AW0 B;  1N8R Q;  4EI2 A;  3BCC G;  1SS1 A;  4YXW H;  3RK3 E;  3VRL C;  1SQQ D;  2AEF A;  4XA4 A;  2H43 A;  3RK3 C;  3H1K D;  1NTM K;  2KB7 P;  1YI2 P;  4H44 C;  5H2F E;  1QLE D;  5AVW B;  3FWN A;  3OJA B;  4OH8 B;  1JO5 A;  2KOQ A;  2IZ0 A;  1DD4 A;  3H1L G;  4UB6 H;  1CSB A;  4PXH B;  3MGN A;  1NYH A;  1QEX A;  1NTZ D;  2KGD A;  3L73 J;  2E1M A;  3GHG B;  4U0E A;  5AVZ B;  3TF5 A;  3AE2 C;  2FVE A;  3KPE A;  2GUS A;  1LGH B;  2N6Z A;  2QM7 A;  2I1J A;  1N7S A;  2JYG A;  1Q7Y Q;  1PP9 E;  3MUD A;  1M1K Q;  2JR8 A;  3CWB D;  1G1J A;  1PGP A;  2YIU C;  1YJ9 P;  3DTJ A;  1BAJ A;  3P8C E;  4GT1 A;  3V4W A;  3CCQ P;  1D7M A;  2HR3 A;  1L0L K;  3H1J J;  1L4A C;  4PD4 D;  2K3R A;  4BPF A;  2FAC A;  1HUC A;  3CD6 P;  2XDJ A;  2H7H A;  5F2K A;  3L70 G;  4NPF X;  3B5N A;  1JY3 O;  1X79 B;  2JKV A;  2FY8 A;  1PGJ A;  2JYL A;  1HJB A;  3H1I J;  2ZYG A;  3H6P A;  3RGU A;  2PY8 A;  1OVR A;  4DZO A;  3L74 E;  4PJ0 H;  1ZLL A;  5BS2 A;  2LKI A;  3HE5 B;  3H1H D;  2PP6 A;  3TYY A;  4IPY A;  1ZRT E;  1JTH B;  1SQX D;  4OGQ B;  2FFD B;  5EJD A;  3LIE A;  2R32 A;  2K0D X;  2IBZ I;  4H0L C;  2DNW A;  1S72 P;  3E2D A;  2ZYA A;  3G26 A;  1RE4 C;  1M1J C;  1RE3 A;  1YQ3 C;  4R0M A;  4BPH A;  1EDI A;  1GDT A;  1EC5 A;  2VLO A;  3AE7 C;  1J1D B;  3AE3 C;  1NU1 G;  2W90 A;  2AXT E;  1ZOY C;  3B5N D;  3SSU A;  3Q1M A;  1VQ7 P;  4D6T D;  2YNY A;  2WQY C;  2EHT A;  1T2K C;  2WTY A;  3MHV A;  3EFG A;  4ASW A;  4I1L A;  3D71 A;  3IR9 A;  3G1G A;  2FYN C;  2IFM A;  3Q20 A;  5AW6 B;  3A0H H;  4GDO A;  3CI9 A;  4GIF A;  4BWN A;  1K05 A;  1QVG O;  4U3F J;  2NO8 A;  2LIW A;  3HUS B;  2PAJ A;  1IK7 A;  1N7S C;  3RK3 B;  2AF8 A;  4W7Z A;  3V2P A;  1JNM A;  5KLV J;  3PHL A;  1SQB E;  1EZV G;  5TIS H;  1KYO E;  1P84 E;  1VQM P;  5KJ7 A;  1E5W A;  1CW5 A;  2M3B A;  2FVF A;  2I8D A;  3I5C A;  3CME P;  1S9K D;  2Y0E A;  1Y47 A;  2E75 D;  3LW5 H;  1KMI Z;  3V5B A;  1FZF A;  4U3F G;  5KP7 B;  3WBH A;  2H88 C;  1EIA A;  4IFD K;  1OXZ A;  3RBZ A;  5APW A;  2DGY A;  1YJW P;  1PP9 J;  1NTM J;  3I55 P;  1H0T B;  3AE9 C;  2YIU B;  2OYO A;  3HE4 B;  1SQP D;  5CCH C;  1KQS O;  4Y99 B;  3CCL P;  1L2P A;  4HB1 A;  2G8Y A;  1T8Z A;  1X0T A;  1SQV D;  4BRY B;  1BE3 J;  3SWY A;  5CBO A;  5K5G B;  5KJ7 D;  1NJI Q;  3H25 A;  4O9B A;  4ZNC A;  2ZT9 D;  1HBW A;  4IL6 X;  3BAS A;  1PP9 G;  1NTM G;  2D2C C;  3M9H A;  3BCC D;  1N86 A;  3CXH E;  4GR6 A;  2E76 D;  3AEB C;  1DEE G;  2MVV A;  1E0H A;  2HLO A;  2B87 A;  3P8M C;  2Q3I A;  5KP6 B;  2P1J A;  2PEI A;  1BGY E;  2N1T A;  1USE A;  1QVF O;  1R5L A;  2E74 D;  1L0L J;  1W5C E;  3TDK A;  3H1L D;  1LTT C;  1JM0 A;  1HGV A;  5AW1 B;  3WU2 E;  1VL2 A;  1BE3 G;  3KHU A;  5APY A;  3CC7 P;  4WBA A;  1VHN A;  1JMM A;  2LKM A;  2FKW B;  3AE1 C;  2KW2 A;  1VF5 D;  2K1A A;  3L71 J;  2K92 A;  1KB9 H;  3CE7 A;  4XRO A;  5HV8 A;  2KLU A;  1NVO A;  1S5L E;  3MGE A;  1GZL A;  4WY4 A;  1U7J A;  3L74 G;  2OYI C;  4UB8 H;  4QMA A;  2CPB A;  2Z5H A;  1U7M A;  2FHS C;  3SWK A;  1L0L G;  2FYN B;  2KYV A;  2RKL A;  1OWA A;  2PEN A;  1NTK E;  3T97 B;  2YKQ A;  2N1T D;  1N2D C;  5APV A;  1RF1 B;  3L73 D;  2C0X A;  5HGN A;  4IFM A;  4RES B;  4HJG H;  3G4S P;  2R44 A;  2MF4 A;  2FAE A;  2HPC A;  1T6A A;  2YKO A;  1LTJ C;  4XFJ A;  3G21 A;  1S5L X;  1YTZ T;  2WSF H;  2KS1 B;  4K35 A;  4GKG A;  5KLI C;  1YJN P;  1VQ4 P;  2FYU E;  2LXB A;  3U59 A;  1FZC C;  1IC2 A;  2IYP A;  2L22 A;  5CCG C;  4R4M A;  3KZI H;  2Q9I A;  4WY4 D;  1IFP A;  1OMI A;  3D6Y A;  4COP A;  3H1J D;  1VQL P;  3L35 A;  1OFC X;  2BCC J;  1USD A;  1NWQ A;  4C7N B;  1N73 C;  1X9V A;  3G28 A;  4TLF A;  3MP7 B;  3TGU J;  1WMK A;  3TNU A;  1M57 D;  2ZXE B;  3FXD A;  2XZ0 D;  3H1I D;  1OVV A;  3VN0 A;  3A0B E;  3L75 J;  3BRT B;  1L0N J;  1A43 A;  1SQB G;  5BU5 A;  1D1D A;  1NU1 K; 
#chains in the Genus database with same CATH homology
 1YI2 P;  3WBH A;  3MGE A;  3CCM P;  1AUM A;  4IPY A;  3H0D A;  3CC2 P;  1E6J P;  1EIA A;  1YIJ P;  4XFZ A;  2OTJ P;  1A8O A;  2PEM A;  2BHV A;  5HGL A;  1S72 P;  2DGY A;  3DPH A;  3E2D A;  1YJW P;  3I55 P;  3CCJ P;  3G26 A;  2EIA A;  3CC4 P;  4U0B A;  2PEN A;  2QEX P;  1VQ9 P;  3G6E P;  4M0I A;  1VQK P;  2PEK A;  2ONT A;  2OAR A;  1VQO P;  2E1M A;  4U0F A;  1VQ6 P;  4U0E A;  3CCE P;  1KQS O;  2PEJ A;  1KC8 Q;  3H47 A;  2XT1 A;  5HGM A;  1Q81 Q;  1KD1 Q;  5HGN A;  1VQ7 P;  3CCL P;  2Z44 A;  2EFJ A;  3G4S P;  1PEM A;  2CWO A;  3P05 A;  4GR2 A;  4COC A;  1RO2 A;  3G0V A;  2JYG A;  3DS5 A;  2PEO A;  1Q7Y Q;  1QRJ A;  4WYM A;  1VQP P;  3CCS P;  3G21 A;  1M1K Q;  1W2B O;  1NJI Q;  3OW2 O;  3G1G A;  1M6N A;  5DCK A;  3H4E A;  1VQ5 P;  3HYB A;  3Q20 A;  1YJ9 P;  3DTJ A;  1BAJ A;  2OTL P;  4XRQ A;  5BS1 A;  1YJN P;  2L6E A;  3LRY A;  1VQ4 P;  3G71 P;  1QVG O;  3DS3 A;  2LF4 A;  3CCQ P;  4QNB A;  3G29 A;  3CPW O;  2M8P A;  2Z45 A;  5F2O A;  1PEU A;  4GR6 A;  3CMA P;  3DS1 A;  3DS2 A;  1EOQ A;  2KOD A;  4PH0 A;  3DS0 A;  3DS4 A;  1VQN P;  5F2N A;  1PEO A;  3CCR P;  2PEI A;  3CD6 P;  5HGO A;  2M8L A;  4COP A;  1IUQ A;  4PH1 A;  5F2K A;  5JPA A;  1VQL P;  1QVF O;  1K9M Q;  2XXM A;  2M8N A;  1ZMB A;  2JO0 A;  4U0D A;  2XV6 A;  1YIT P;  1YHQ P;  4XFX A;  3CCV P;  3G1I A;  2BQ1 E;  3CXC O;  1RO0 A;  2BUO A;  1RNI A;  2EG5 A;  2JYL A;  3G28 A;  2P9X A;  4XFY A;  1JJ2 O;  1K8A Q;  3CC7 P;  1M6E X;  1K73 Q;  1VQM P;  1Q82 Q;  2PY8 A;  1M74 A;  1Q86 Q;  3CME P;  3M1M A;  1N8R Q;  2PEQ A;  1K30 A;  3RG6 C;  5I4T G;  1A43 A;  3B5I A;  3I56 P;  3HZQ A;  2Z46 A;  3VRL C;  5BS2 A;  3NTE A;  2QA4 P;  4U0A A;  1VQ8 P;  4U0C A;  4XRO A;  1PEQ A;  1D1D A;  3CCU P;  1M90 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...