1YHQS

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yhqS00
2MHNA 1U2FA 2G0CA 1F9FA 2DNHA 5IQQA 1WG4A 2KH9A 2VONA 2XNQA 3MD3A 2AD9A 4Y00A 1VQ5S 2CPFA 2JVOA 5GAGU 2LEAA 3RW6A 3NS6A 1R8PA 5IM0A 2M0GB 3N9UC 3J7YU 1K73T 5GMKa 2XS2A 1UAWA 5LJ5Y 3VAFA 2M52A 3CCVS 4IOAQ 1WF2A 2DNRA 3CCRS 1PGZA 2LXUA 2MZSA 2DHXA 1SXLA 2XS5A 1M1KT 2XSFA 1L3KA 3Q2SC 3MURP 3UE2A 2FPHX 3UCUP 3US5A 3VAHA 2F9DA 1WG5A 1SJ4P 1X4CA 2CQ2A 1FO1A 2E5HA 2CPYA 5IFMA 1QVFR 1N54B 4ERDA 1N52B 4LJMA 2D9PA 2MKJA 5DDPC 2N3OA 3CCES 2DITA 3B4MA 2O3DA 2DNNA 2RUGA 3G9CA 2YKAA 2DNZA 2E5IA 5GVQA 1VQNS 4TU7A 2DO4A 5GAEU 2J8AA 2FHOB 2D9OA 3L3CA 2DGUA 2L9WA 5CYJA 2Q79A 2DNMA 2OJ3A 1VQPS 1WEZA 1N8RT 3SXLA 2M2BA 4M5DB 1WHWA 1U1OA 3CC4S 4TU8A 2RVJA 1A7GE 4CQ1A 2VOPA 4WFNQ 2MQNA 2AYEA 3SDEA 1X4DA 3S01A 1BY9A 2DNYA 2LA6A 4TU9A 4WKRA 3VAMA 2DGWA 1FHTA 3I55S 3H2VE 4PR6A 4QQBA 2E44A 2CQIA 2A3JA 2OIHA 3HHNB 3TYTA 2MZRA 4IOCQ 5DDOC 2WBRA 2U1AA 4RU2A 2LECA 2XNRA 1NO8A 2M7SA 1RKJA 2E5GA 3V4MA 1KC8T 2CPJA 2MZJA 3OW2R 2KXHA 2HVZA 2MPUA 2FC8A 5DM6Q 3NS5A 2J0SD 3S7RA 1YIJS 2MY7A 4U67Q 2YH1A 1WWHA 2JVRA 2DHSA 2CQCA 2PE8A 2DGOA 3B4DA 4YB1P 1XN9A 3SDEB 4F26A 2KM8C 2MQPA 1VQOS 1M5VC 3G71S 2CQBA 2OTJS 2MKHA 4Z2XA 2GHPA 1NU4A 1JJ2R 2CQ1A 4IUFA 1X5PA 3EGZA 2DH9A 5ITHA 1JJ4A 2MQOA 3CULA 3NNCA 1VQ7S 3Q2TC 3CC7S 2OTLS 5EN1A 2DNOA 3R27A 2G4BA 1S72S 1URNA 1M5KC 2KHCA 5DDQC 4PKDB 2M8DB 3MUVP 3PIPQ 2CJKA 2B0GA 2HYIB 1G2EA 1U1MA 1X5OA 1K9MT 5HO4A 2L08A 4QPTA 4LMZA 2DO0A 2NLWA 2J0QD 2LQ5A 2N82B 2DNLA 4WF9Q 1UP1A 3G96A 5LXRA 4CIOA 3P6YC 4YUDA 3G8SA 3LQVA 2RNEA 2KU7A 3I56S 3G4SS 1YI2S 1AUDA 2MSSA 2M8HA 1S79A 3EX7B 3S8SA 2KVIA 1Q81T 2DNKA 1FT8A 1VQ4S 2M9KA 2DIUA 2MKKA 5MLCV 1YHQS 1YJWS 4J5OA 4CH1A 2DB1A 1X4GA 2CQDA 1B7FA 1X5SA 4UY8T 1DBDA 2E5JA 1HL6A 4WCEQ 3CC2S 1X5TA 3H2UB 2J76E 3MXHP 3D2WA 1WEXA 1FJEB 3CCSS 3DLLQ 3NNHA 4QU7A 2MZ1A 1H2TZ 2CPEA 1DRZA 1Q7YT 2KXFA 1QM9A 2JX2A 2VODA 1RK8A 3EGNA 1YJNS 1Q86T 5D77A 2CQ4A 1P1TA 3VAIA 1X4BA 2L41A 3CF5Q 3VAKA 1PO6A 1WF1A 2DHGA 2CQ0A 2KI2A 5D78A 4WFAQ 3CMAS 2AYBA 3FEYB 1SJFA 2LXIA 3IRWP 3UCZP 1DHMA 2K8GA 1U1NA 2I2YA 2DISA 1X4AA 4BS2A 3P5TL 1U1RA 2RQCA 4FXWA 2UP1A 1JJHA 1HD1A 1WI6A 1ZH5A 3VAJA 1O0PA 1D8ZA 3UCGA 4A8XA 2M88A 3LPYA 3ULHA 1U6BA 1YJ9S 2RS8A 3CPWR 2CPIA 1SJ3P 3CCLS 1W2BR 2MJNA 3MUTP 4OZ1A 2M4MA 3VF0B 2OSRA 3THPA 5IM0B 3R1LA 3NNAA 1FXLA 2YWKA 3UD4P 2PEHA 5LJ3Y 1WTBA 4YOEA 1SJQA 2MMYA 3DXBA 3MI7X 2KRBA 4Y0FA 2ZJRQ 3MOJB 1VBZA 2QA4S 2HGNA 1OWXA 2HZCA 1IQTA 2CQPA 2DGSA 1FJ7A 3P3DA 2KM8B 2LYVA 4W90B 3R1HA 3BO3A 5LSLA 5H1SV 1VC5A 2MQLA 2RT3A 2YTCA 2MYFA 2FC9A 2MXYA 1K8AT 3K0JA 5DDRC 1X4EA 2DNPA 2VOOA 5FJ4A 4ED5A 3TO8A 5GAHU 1X4FA 2ADBA 1U1LA 1ZZNA 1U1PA 2SXLA 3PIOQ 3BS9A 1M5OC 3MUMP 1HA1A 2NZ4A 2N7CA 3BEGB 3NMRA 2MB0B 2MKSA 3THTA 3ZZZA 2KFYA 4C4WA 4UQTA 2X1BA 1WF0A 2DIVA 2JRSA 1WG1A 4CH0S 3VALA 1OPIA 3MDFA 1CVJA 4QU6A 3CUNA 2RU3A 1QVGR 2X1AA 4C7QA 4WFBQ 2KRRA 2QFJA 1U1QA 5GADU 2CQHA 2MQMA 3CXCR 1N88A 1VQKS 2DH7A 1OO0B 2CPDA 5HL7Q 2M70A 3JB9k 4F25A 2MZTA 2DGQA 1H2VZ 5JVHQ 1X4HA 5CXTA 4F02A 1UFWA 1SJRA 3CMES 2BZ2A 2ZJPQ 1JMTA 1HD0A 5DM7Q 2RRBA 5LXYA 2QEXS 2EK6A 2DK2A 2I38A 2RS2A 3RW7A 4C0OC 3CTRA 3ZZYA 2MQQA 1WI8A 2MZQA 3SMZA 2OSQA 1VC6A 2FY1A 1H6KX 1YITS 3VAGA 2K3KA 2GO9A 2DGVA 2ZJQQ 1U1KA 4W92B 3UWTA 2CPZA 1WHXA 2MSTA 2MGZA 3CCJS 4WIIA 2N3LA 3BO2A 1YWXA 3BO4A 1WEYA 2YH0A 1FJCA 2DNQA 3TP2A 2ERRA 2G1DA 1X0FA 3CCQS 2AYGA 3MD1A 1D9AA 1OIAA 1P27B 3G6ES 2LKZA 1VQ9S 3P49B 1WHYA 2CQGA 4TLQA 1VQLS 2CPHA 2D3OR 1VQ6S 2DHAA 2LMIA 5BJRA 2LEBA 1KQSR 2U2FA 4FXVA 1WHVA 2RQ4A 2KG1A 3HI9A 1WELA 2CQ3A 1UW4A 4P6QA 1KOHA 4OZ0A 2X1FA 1YTYA 2XB2D 3S6EA 2ADCA 3CD6S 2MGZB 1H2UX 3U1MA 1VQMS 1NJIT 3J7ZT 4V19X 4PRFA 1R8HA 2AYMA 2X1GA 1VC0A 3IWNC 2DGTA 2HGMA 2F9JA 1A9NB 4EGLA 2LA4A 3FEXB 5CA5A 3UD3P 4ZKAA 2MKCA 2HGLA 2EK1A 2BOPA 2MJUA 3CCUS 2DGXA 3U1LA 2KT5A 1M90T 1ZZFA 4LIRA 2LCWA 1M5PC 2KN4A 1DZ5A 1U6FA 1Q82T 2KXNB 2MKIA 1VBYA 3CCMS 5LSOA 2MY8A 1KOOA 1VQ8S 2DH8A 1FNXH 3G8TA 5JVGQ 4IO9Q 2F3JA 2RRAA 2XS7A 2V94A 2KYXA 1KD1T 2EVZA 2CPXA 1VBXA 5DETA 2JWNA 2DNGA 2KG0A
chains in the Genus database with same CATH superfamily
3HPOA 1ZETA 4MJKA 5IC4B 1U2FA 2H5IB 3MAAB 2KH9A 1HNXF 1WG4A 3G6VA 3CJRA 2Y1IA 3LWLA 4ELTA 4LQ3A 2ACMA 3UR3C 1RADB 2AD9A 2ZOFA 2KFNA 2OI2A 1Y0HA 2NCKL 4NYZA 4RW7A 4GC7A 2HHHJ 1RAJA 2RD5C 4OYIA 4K5RA 4LIWA 3HVTB 3UDLA 2LEAA 2OD4A 3RW6A 4A47A 5THWA 3NS6A 1R8PA 4DZ6A 4XDCA 1VGYA 1FD2A 1AUSL 4NCGB 1LWCB 4MKBA 1KLNA 4DSJA 4TN2A 3ITHA 3RZAA 1ZAVA 3KJVA 4ED0A 3N9UC 4O3QA 5GMKa 5HMZA 3W8GA 4WFZA 1QD1A 3CE8A 5E2QA 3VAFA 2M52A 4K0KJ 1S6UA 2RILA 2PEBA 2PT0A 2V0NA 3M32A 1QTMA 4F4XA 2H5EA 4IOAQ 4TLRA 2DNRA 2OPQB 4KPCA 3CCRS 1EQ0A 2I0XA 1TZ0A 3H0PA 2LXUA 5EDWA 2XS5A 2DHXA 2HVIA 1R7IA 1X9WA 2B4PA 1DTQA 1ZOTA 1JLEA 3C2PA 4NXNJ 4O3NA 3HVTA 2PFDA 4R8UA 1L3KA 4PABA 4A46A 3KWMA 3MEGA 1YJ7A 4WBFA 1J5OA 2AZ1A 1PC5A 4M5IA 1RXOB 2YNIA 1L3UA 1HQEA 3FGVA 1WG5A 1SJ4P 3OUYA 2PMWA 4KGXB 3QIDA 3J80Y 1S1WB 2Z8QA 3VGUA 2CPYA 5IFMA 1Q95G 1TVRB 5EGYA 1N52B 1XBWA 4DFKA 4KJIA 3C46A 1FE0A 4LJMA 1V3ZA 1SI9A 2D9PA 2MKJA 1X60A 2CG8A 2RE1A 1QDUB 2OPSA 2VB6A 3QLHA 5KFWA 1NK8A 3AD9C 2HHQA 2DITA 2LLZA 3DRSA 1SH0A 3J81j 3DLEB 2XC9A 2HMIB 3KLIB 2O3DA 3CMQA 1T7PA 1TUGB 4DSLA 3KLGB 4RO0A 5AE3A 3KHHA 2YKAA 5CD4A 3MM6B 5B0FA 3M8PA 1F5AA 1RTHA 3KMQA 1JLGA 4O4GB 4OX7A 2OH2A 1HW9A 4B3OA 2WOMB 2HHTA 2OEMA 2W7OA 4HKQA 3MM5A 3V6DA 2QZ8A 1IKYB 1YRTA 4MK7A 2D9OA 1GTHA 3AHPA 4G1IA 5DGAA 3L3CA 2DGUA 5CYJA 2ZUAA 2Q79A 3IAM9 2OJ3A 1HNIB 3MEEA 4ES2A 3HCXA 1QJHA 2L3MA 1R8AA 3QWPA 7AT1B 2XCAA 1UVIA 3OLBA 1SC6A 3KLFB 2W2NP 4IFVB 2YX7A 4PXCA 4OI4A 2AX1A 2WAQD 1VIXA 2YNFA 1HI8A 2RVJA 1SB6A 3GPAA 4CQ1A 2VOPA 1ZM2A 3H4BA 2W7AA 2ASYA 1SKWA 1J2VA 5HMWA 3T6BA 3FUYA 2B4UA 2B7BB 2DCLA 5KFLA 4TU9A 1NHVA 4DUTA 4WKRA 1M1HA 4OZNA 4X65J 2IMOA 1Y11A 1XMOJ 1KNZA 3CJ4A 3OR2A 4OJ1A 1JXVA 1LWFA 2Y1RI 3H7HB 4ZCKA 1WC1A 5F8IA 1I6JA 2E44A 5CYMB 1TL1A 3AFGA 1T3NA 2CQIA 2FJWA 3PJ9A 4EK2A 3NLCA 1H7WA 4IFVA 4HH0A 2VC0A 1TP7A 4F67A 4DX8H 3T5LA 4NZ6A 3EUNA 4LVNP 4J9MA 1MN9A 1KQKA 1ZA1B 4FKXA 3JQJA 4DFJA 3D0HE 4CT8A 4RU2A 2AW0A 3V6JA 5ETSA 1Q16B 2LP4A 2O1PA 2ZOMA 2GVDB 3D1OA 5FIIA 4QIWD 3CDEA 3WX8A 4X4TA 5AXLA 3PR4A 4B9UA 5BR8J 2IAJA 1MMNA 4KO0A 3W1YC 4BCAA 1N32J 3GMGA 2CPJA 2KXHA 2HVZA 4DHVA 2JSXA 1E6YA 1XWLA 4WP3A 5HSPA 4AQYJ 2J0SD 1CULA 3IAS9 4MK8A 1S49A 2CG4A 3W65A 5KT7A 2CJXB 3JSYA 2WK4A 2CQCA 1LEOA 3RB6A 2AJQA 3CJSA 2A6MA 2B3TB 1RT1B 3LO3A 4OI1A 3VZIA 2KM8C 4U8VA 2MQPA 3QJPA 1XR7A 1FX2A 3G71S 1RCXB 2QMUB 2GGPA 5J2MA 1K1SA 2VDIA 1S77D 4WZMA 2MKHA 2HIYA 3NL0A 4NZ0A 4LQ9A 4ED6A 2ZWPA 2PIIA 4HACB 1X5PA 3RBEA 3I31A 4L3KA 4NXMJ 4LF6F 1KQGB 2AKWB 2YPZA 4P73A 4DV2J 1JJ4A 4AFFA 1F9EB 3QMQA 2BKOA 2W7PA 3K7RA 2OTLS 4LREA 3Q24A 2CNNB 3PX4A 5LMUF 5DG8A 3HHDA 2BQUA 2IPOB 3FFIA 4C8LA 1DARA 1RT4B 2XYHB 1DQAA 4ECXA 2PGCA 3ZZOA 3H98A 4F4YA 1T05A 1URNA 1WSRA 2P8IA 2W1BA 2HWTA 4PKDB 4H4MA 4UOHA 3UVJA 4DMZA 3PIPQ 2BM0A 5EHHA 2XLJA 3T5HA 1VIOA 1I94J 2ZOGA 3EVMA 1U1MA 1X5OA 3C3LA 1T9VA 2HIQA 4OI0A 4ZMMA 2NLWA 2J0QD 4DU7A 2IM1A 2N82B 1IBLJ 1B0TA 2QSWA 1NMEB 3G96A 1TV6A 4CIOA 3G8SA 1M5HA 2LU2A 2OPRA 2RNEA 3D7SB 4HLBA 4F3QA 5C2GA 5D8HB 1RT4A 1U09A 2KU7A 3O8WA 2MSSA 2M8HA 2QMWA 4ED1A 2FLLA 4LF9J 3MAHA 3PYGA 3KNAA 2DNKA 3PZPA 4ZP9A 1J5OB 5IT9U 1SKUB 4YR0A 4I2QB 3KTQA 2YY3A 1VQ4S 2GC8A 2BRLA 4ETXA 4KE5A 3KLHA 3GLJA 3DOMA 4NLQA 4WP8A 4WTOB 5E41A 3D67A 3C15A 2GV1A 3EZOA 4J5OA 2IFXA 4USIA 3HHKA 4A8MP 2DXFA 4CH1A 5HBMA 4NEYA 4USVA 2K2PA 4Q8EA 4FBUA 4NLTA 4WCEQ 1OY6A 2QL5B 3H20A 3G6XA 3CC2S 2VC1A 3QLHB 2R7TA 2B51A 4I7FA 5CCMA 2W9BA 1KVJA 4HI2A 5F0WA 2F1FA 2GHWA 2ZH2A 2ZE2B 3D2WA 1HBUB 3AJDA 1D9FA 4BWJA 3CCSS 4ZPAA 3DLLQ 1TMMA 4ZCMA 1H2TZ 2CPEA 4MMOA 3RTVA 1LK5A 3GV5B 3D6MB 2XULA 2Z2LA 3BF4A 5H9FJ 5J2QB 4I1TA 1Q7YT 2VODA 3HK2A 3IP0A 3BZQA 1IXKA 2D1CA 3OFEA 3HO1A 2EBGA 4RJVA 2DT9A 5J2PA 2B4VA 2CQ4A 2FDNA 3VAIA 2EEYA 2G4BA 1UEUA 4O44A 2CZ9A 3NAIA 5ETQA 3I0RA 4M5MA 2ZKTA 5KFIA 1KWMA 1WF1A 2HHPA 1PIEA 2CQ0A 3T1HF 4JI1J 4NXNF 2WVEA 5G0RB 4GRSA 1VCTA 5KFSA 2I9SA 5KFOA 2R8HA 4PQUB 1FCAA 1D0EA 4ILMA 4NXMF 4ZS6A 1CJVA 1RAGB 4JI0F 3R7SB 4K4ZA 2LXIA 3RG6A 3JSRA 1VRTA 1LFWA 1SC1B 1RWNB 4ECTA 2DISA 2Y1LB 2KYZA 4BS2A 2B6AB 3PEHA 3QAEA 2XMAA 5AT1B 3GIRA 1F0XA 2BYCA 1KP6A 3N6NA 3W9IA 4C8ZA 1OQ3A 4X2BA 3GE9A 3PRBA 4HHUA 1FRXA 1WI6A 3X1LB 2NQPA 1O0PA 2YNGA 1D8ZA 2ZD1B 3UCGA 4ANDA 3R2CJ 1RI7A 4DV7J 1U6BA 2D7SA 1YJ9S 1T9UA 2RS8A 4GO5X 4KSEB 3QATA 4Y2AA 2Z2YB 3LTOA 2C3UA 3CCLS 1NSQA 3CJ8A 3HVWA 4MTPA 2R7RA 4DZDA 3OSNA 4KTQA 2HMIA 4OZ1A 4DUYF 3J80U 4K4SA 5A76A 4PG6A 2OSRA 4WU2A 5E7OB 4Y2MA 5C2CA 4ZVFA 1S9EA 3R1LA 2B6AA 1CJUA 3VZHA 4TVAB 3NNAA 2CVEA 1RWWB 1F60B 2B4OA 4F2RA 4Q44A 4OI2A 5CD4H 4YOEA 2HK2A 3CGIA 1S0OA 4K5SA 2CNLB 4PWUA 1UFKA 3PYEA 4J9QA 1BHNA 2KRBA 2YWHA 4J9NA 3MOJB 3CDUA 5EWGA 1UJ5A 3CO0P 3M32B 2NYHA 4C11A 5E33A 4F3MA 4GC6A 4B3SJ 2NXEA 3LH2S 4FYVB 3CD0A 4ATNA 2DGSA 3TA2A 5HATA 3TZXA 5C5JA 3BGFA 4PCQA 4Y3CA 1S1UB 3TZWA 4ZA1A 2NREA 3RR8A 1B7YB 2Q43A 1WORA 3MEGB 1T3OA 2VASA 4PYDA 4GVBB 5U47A 1CJKA 1FNMA 3BH6B 5IXUA 5B0CA 3W9JA 4TY9A 1LW0A 1ZM4A 4IR9A 2HVEA 3HKWA 5K8PA 5IOLA 3OJSA 1N36J 3MECA 1X4EA 5DLFA 1TVRA 4C3MA 3SFGA 3T1AA 3PY8A 1NDLA 2KJVA 4ID8A 2VOOA 2WB1D 1YJRA 1EQMA 2G0IA 1NH8A 4ECRA 2JOQA 4P7VA 3ZXWA 5LM7E 4CO0A 3ICLA 1U1LA 1TK5A 3PIOQ 2G9OA 2I5JB 3OQ2A 1AROP 1RBLA 4DUZF 3MPYA 3QPIA 3AODA 4HHJA 4YDDB 1PILA 5IWAJ 4DR4J 3PO4A 1K0TA 3JTPA 2XMUA 5KOXA 4X84A 3H25A 3SSQA 1V3SA 4I2PB 4I6YA 2MKSA 2RB7A 2KFYA 1NK7A 5D4LA 4J9KA 2MQ8A 2P9CA 3BDEA 4DR7J 3GSIA 4Y2CA 3VALA 1L5UA 2JRSA 1CVJA 1OPIA 2IYIA 3MDFA 1RTDA 3R5GA 2PSZA 3LW5C 4PPZA 2E5LF 1S57A 2XMWA 3K5PA 2IM3A 4NLPA 4PWWA 2WSCC 3MMAB 2QFJA 4OYZA 2YX4A 2ZFHA 8RUCA 2Z0GA 2CQHA 2FJEB 2MQMA 3W66A 4USMA 3W3SA 1S1TB 2CPDA 5HL7Q 1RZMA 4FKYA 1CULB 1RACB 1WOOA 2HBRB 1ZYQA 3OTOJ 2CRLA 4JI4F 1EETB 2RIJA 4JI2F 3FDSA 1S0MA 2OPRB 2QLFB 4NMLA 1UA1A 1UWAA 4NRUA 2J6UA 3PACA 4J90A 1BQNA 1RWUA 1TKTA 3BR9A 1IBMJ 3I82A 2XBPA 4OHXA 1ITPA 5HJXA 2OFGX 2XEXA 1HBMB 2FHKA 5E5NA 4D3HA 3OLAA 2FVSA 2RRBA 1WKJA 2Z57B 2EK6A 3GONA 4R5PB 1GT8A 3MEDA 2VZ9A 1N33J 3KUHA 4WZQA 4RL1A 4WXOA 5JMNA 1S1XA 2IA0A 2E1MC 3ENWA 2IRUA 3ZZYA 2FGOA 4JUZA 4B3MJ 5HVHA 2HZVA 1IJEB 2DPIA 2MZQA 2C3PA 2OSQA 1OPZA 1S4FA 5F3TA 5KFMA 1FE4A 5HROB 3QO9B 1YITS 2K3KA 1TKZB 4ICLA 3W61A 2XMVA 3FEZA 3MPUB 5ETLA 5KFJA 4W92B 1YJUA 4OMFG 3OUYB 2CPZA 4DR2J 1OSCA 3QJJA 3O6QA 3PFOA 4F50A 4ECQA 4QPXA 1OQ6A 1KHVA 4FF2A 1TAQA 3MM9B 2YVSA 3JTNA 3L95X 4M1KA 4CLPA 2X7IA 2NS1B 2WONB 1TV6B 2VKZG 3R3TA 3TJAA 3TOQA 3M9OB 3V81A 3CIMA 3VR1A 2DNQA 4UOFA 2VG5A 2W4CA 2OUGA 3DLEA 2B9EA 4LRDA 2ERRA 3QJLA 1NUEA 5I3QA 1HYSA 1U0HA 2G1HA 4TXSA 4HR2A 1GH8A 2AYGA 1RAFB 3PX0A 3HJFA 1AYEA 2ZVIA 2J9DE 3ENQA 2PMZD 3MAQA 2PFFB 3HHLD 3TVKA 2RDIA 2IBOA 1YRUA 4BHQA 3PHEA 2LKZA 3G6ES 4DR5F 1VQ9S 2CQGA 4UTGA 3PNIA 4TLQA 2EPIA 1R8BA 2V2VA 1I94F 4A48A 3G6YA 3DRPA 4BDPA 4DF8A 2DHAA 1TAUA 2FHJD 2AJ1A 3AB2B 1ZTTA 1NK6A 5BJRA 4C8OA 2FLNA 2XI3A 3VTIA 1N5YB 2VFSA 5FDLB 3MCNA 1JLEB 1GFWB 1K44A 4OHZA 4RNMA 1AZSA 2RQ4A 1Z4UA 1RWVB 1NLKL 4KT0C 5F8JA 1Q78A 1FKPA 1GTEA 3EVWA 4RUBA 3GV7B 4DV6F 2CQ3A 1HHTP 2AP6A 3JXOA 1KOHA 2X1FA 1YTYA 3NBPA 3KUGA 3S6EA 2BX6A 3H59A 4LSLB 4CLSA 1WJ9A 3U1MA 1NK9A 3HJVA 2FZCB 2PO4A 1C1CB 4YY3J 1N34F 1QSYA 4LF6J 1IQZA 3J7ZT 3EPGA 1RLCL 4PWDB 1AW0A 3OFFA 1VC0A 3Q89A 3BGOP 2R3VA 4NA3A 4DCJB 2QMXA 3I4PA 1QTNB 4UT4A 4ZLLA 2JH3A 5A0YB 2XM3A 2UVVA 1KTQA 2G2YA 3AOAA 2HVDA 1IBMF 3W2VB 1A9NB 5DG9A 5E3AA 1N5VA 4J9OA 1U47A 3R9LA 4ED8A 2V34A 1D1UA 2MKCA 2CJ9A 3OJUA 2HGLA 2BOPA 4HTJA 2EFQA 3NBPB 2DGXA 1IR2A 2VJUA 4IRDA 3Q8YA 4LFCF 1M5PC 2LCWA 4XO0A 5KG1A 2FB0A 3Q8QB 3CEDA 2MKIA 1AXQA 4Y65A 4X4NA 4X4QA 3KK1B 1XERA 2RQMA 1G4CA 2IAJB 4KO0B 2NXUA 1BQMB 3PJWA 2OPPA 3MM8B 3ZZRA 4C3LA 4UOGA 3GCWP 1UTAA 4DJBA 3MR2A 3QRPA 1HMVB 1UPPA 2RRAA 1KLMA 2F3JA 3ZNJ1 5GAHI 3GQCA 3X3UA 1WNEA 1N32F 1WKLA 4DV3J 1KD1T 2KYXA 2EVZA 3FK4A 1OJ4A 4USHA 3DC2A 2YNIB 1TK8A 1P9YA 1CJTA 4RBUA 5DETA 3I6PA 5HP1A 3ILJA 4DR6F 2JWNA 2DNGA 3SYZA 3CDAA 2KG0A 2DKOB 1VQSA 3D1HA 2XMJA 2MHNA 4KGKA 5IQQA 3J81U 2DNHA 5GMEA 1F6TA 4DV4J 3O3LA 2WCXA 2XMTA 3ETMA 3KG4A 1FRKA 1H72C 1LFPA 2JFDA 2P9GA 2IBKA 2ZITA 4L73A 1IVZA 1FK9B 2RRNA 1KN6A 3QFWA 1VQ5S 1BQMA 3SEOA 2HNZA 4KAIA 2Z4PA 2CPFA 3QIPA 5FD1A 2I8EA 2IM0A 4USUA 4X65F 3D28A 1FX4A 4KV8B 4LF7F 2FVPA 1HNXJ 4X62F 1CC7A 1UCNA 2J7WA 2W4PA 4FNIA 1JWWA 2M0GB 2K06A 2V69A 3MMCB 4AYBD 4JYAF 2HS4A 2UUWA 2UUCJ 4B3RF 2YBVA 4DUYJ 1Y3JA 3D3CJ 1TKTB 2GA7A 3P8BB 1S7HA 1XNQJ 1UAWA 4MAKA 4PG8A 2BBEA 3M8WA 5LJ5Y 4WJBA 4HYKA 1ZAWA 2DY9A 2PDAA 2WZ1A 4YB6A 2UUBF 5CYQA 1PBAA 5K9FA 1S6OA 2PN6A 3QGGA 1Q1KA 1B99A 5F41A 3UDCA 1SXLA 3QT5A 1KHWA 4ZPVR 1E6YB 3MURP 4YP3A 2FPHX 5KFYA 3WC0A 5C24B 4ECSA 2AU0A 2IM2A 2QL7B 1UWBB 3E01B 7FDRA 4PG7A 2HLUA 1CJUB 2YWFA 3OT9A 1YSJA 1X4CA 2IJFA 4JI3F 2XQCA 2E5HA 4YY3F 4J9VA 1JLCB 1TU0B 4FNHA 4ERDA 2FUG9 4F36A 1TKZA 3SZ2A 2JFKA 1Y7PA 2ACYA 3DYAA 1L3VA 2HHXA 5DDPC 3F0NA 4KHPJ 3PDNA 3C6TA 3MGJA 3PFEA 2N3OA 4DR3J 5L9XA 3GV8B 2WVCA 3PR5B 2RDJA 2DR6A 2DNNA 3CJ5A 3M7VA 3QRQA 4U7UD 3G9CA 4ZP8A 1UVKA 2QT7A 3M4XA 3BQ2A 4C0HA 1RDRA 4DL6A 4OX9J 3C16A 2E5IA 3K17A 5GVQA 5A8RA 3WX4A 4H4OB 4QYZK 4DQQA 1VOMA 1IM6A 3RR7A 3IR7B 3PJXA 5KT5A 5BR8F 4DSKA 3EVOA 2W01A 2JEIA 1SQFA 4ZVUB 4DL4A 2XMKA 3IS9A 4C8KA 3B82A 2DTJA 2C3OA 1UL3A 2KHDA 2P9EA 4PQAA 3BBFA 5AE1A 2BJ9A 2LFVA 3NCRA 4F0KA 4X66F 1CEZA 5L1KA 1W25A 2E9RX 4B3RJ 3TNVA 4HDGA 1HPZA 1RT5A 2EWHA 3R5BA 4GMKA 4FBTA 2FLOA 5I3UB 3W63A 4OV6A 1N8RT 2BE9B 3SXLA 1WHWA 4A4JA 2GIQA 1MWYA 4RX6A 3T5KA 3SI8A 3DRPB 3M2UB 3BKFA 1S1XB 2LQBA 5G0RA 2D3ZA 1CQNA 2GJFA 3OTBA 4KBIA 3W62A 4DX5A 2V4JB 2MQNA 2NSCA 4F2SA 1Q8BA 1SV5B 4A8QA 2GGPB 2LA6A 2C2ZB 3LA0A 4ZLJA 5J2MB 3POTB 2VQEJ 5DG7A 2DGWA 4ZK7M 1FKOA 3UN3A 5HROA 5MAOA 3HDSA 2E9ZA 4ZVGA 2A2DA 3H2VE 2HFOA 4FVMA 5KFDA 4Q45A 3MR3A 5D3GB 3ITHB 3W7BA 2AEJA 1HPZB 1RT5B 4V1Ak 5AJ3J 3DDNA 3HFKA 1YX2A 3QQCD 1EP4A 3DI6B 4NLUA 2Y9HA 4N7TA 3IO1A 1IN0A 1FWPA 2A3JA 3I5BA 4ZN1A 3TYTA 4ZVEA 2BDPA 4HL9A 4U7CA 1X31C 2MZRA 1EHWA 2DRBA 4IOCQ 4LR8A 2Y1JA 4KH1B 1U2RA 5HQMA 2BJ3A 2UXDJ 1I3OB 2FJBB 2U1AA 2W4DA 3KDOA 1N33F 2HAIA 1AT1B 2LU1A 2RQKA 3TVYA 2UU9J 1NO8A 2XNRA 2ILYA 2XLKA 1JLBB 3SSSA 1QUVA 3RU0A 1OY9A 4KYZA 2KT3A 3DHWC 1UVJA 1FNOA 1DFDA 4TY8A 2Y0SD 3ADAC 2MZJA 2ROPA 3OL9A 4NLVA 4M5JA 1HI1A 5DM6Q 3NS5A 2ZM6F 5J1NA 2GMHA 3BGRA 1YIJS 2Q3PA 2MY7A 4AE5A 3M9NB 4B3TJ 4L74A 4F0HA 3ZZPA 3EGWB 2OPQA 3AQOA 1HKAA 2VF3A 3LP1B 1GXUA 3OTCA 1XMQF 5K14B 2NXCA 2PE8A 4YB1P 3IM9A 3SDEB 3OTOF 4WTYA 3OBIA 4F4WA 1RHKB 2JDJA 1M5VC 2ZE2A 3DOLB 4CO5A 4TNOA 2OTJS 4O23A 1N5QA 3P45B 4UUXA 1JLBA 2YWEA 2C42A 1VRQC 2CQ1A 3EGZA 3L9ZA 1LKZA 3PRDA 5L1IA 2FVRA 2C2EA 4WE1A 5E3PA 3C15B 4OJHA 1GAOA 2ZZTA 2JL9A 4WKYA 1IKYA 3U7JA 3VQSA 3CC7S 1T03B 4DV0J 4DR5J 1CQMA 3ELHA 2DNOA 2XG8A 1H3DA 4URSA 2QRRA 1S72S 3PG9A 2Q6BA 3VV2B 3QFHA 5DDQC 4E2FB 3M2VA 2M8DB 2BE2B 2XZWA 3JQMA 3MUVP 2CJKA 2B0GA 4DSFA 3RRHA 3N5FA 1K9MT 3NCPA 1RU1A 2L08A 1H98A 5HO4A 1MW7A 3W2WA 3TZZA 4LMZA 1JLQA 2QSFA 1T11A 4JI0J 3NS7B 2OGUA 2DNLA 2IRYA 3OTEA 2F8MA 1UP1A 3P6YC 4BWMA 1RSCA 4NLGA 4YUDA 1RTIA 1Y5LB 3LQVA 4LR9A 3R8YA 5AXMA 1YBAA 3KK1A 3GYNA 3HM9A 3SV3A 4OL8A 4OFZA 3M2RA 3M6XA 1NSPA 4OYWA 2GS8A 4YFUA 1RBOB 3G4SS 1S79A 6FDRA 3D0GE 3EX7B 2KVIA 1U4BA 3GP9A 3KMSA 2FLPA 4TQRA 4UF4A 3OVSA 2AF6A 4NOHA 4N5SA 2DIUA 3OFGA 1CJTB 3R6GB 1RYRA 1FEEA 4IFYB 1N56A 1NEEA 1ZPWX 2JZ5A 1Z2ZA 2K3IA 3HF5A 1P8GA 3OD2A 2DB1A 2QE5A 2CJBA 4Q2MA 2GVDA 3N28A 1X9SA 1CBKA 3BGLA 4RLEA 1DBDA 2E5JA 1HL6A 5J1PA 1LWFB 4JV5F 2AJ2A 4URQU 1Y3KA 1X5TA 4CYUA 5E3CA 4A8FA 3H2UB 1HQUB 2BJ8A 4J37A 5KT3A 3MF5A 2VPXB 4J9PA 4LFBF 1XQIA 2HKEA 1DTTB 4OX6A 4RW4A 1FJEB 3MXHP 3R5CA 5F8HA 1D3WA 3U1NA 3H4DA 1FFWB 1F9HA 3IRXA 4ECUA 3G8QA 3HT3A 3NNHA 1JLAA 2MZ1A 1XJWB 4QU7A 3A13A 3M05A 2UVRA 3V2UC 4I6WA 4F3OA 2JX2A 2F5GA 4QZVB 2R2UA 2V9KA 4X64F 4IDKB 3EGNA 1WD6A 1YJNS 1S76D 1SBRA 2KKHA 4ZN3A 1U7LA 1HHSA 2HNDB 3FBEA 2AWZA 2GZOA 3PKYA 1R89A 2L41A 1J27A 4L72B 2W9CB 5D78A 4C11B 2DR7A 3TUJC 2AYBA 3OR1B 5FLXU 2ZH1A 5KOWA 3IRWP 4C48A 2K8GA 3A3OB 1FRMA 4I4BA 3MFHA 4QYRA 2I2YA 2V8GA 4L3NA 2R2SA 4HI1A 1IBKF 3IA0A 2EFPA 2RHSB 1R43A 1SUQB 4H54A 4N8OA 1MMDA 1NXIA 3K5LA 2PC6A 3NWGA 1HIYA 1KFSA 2UV8G 1GXTA 1ZH5A 3VAJA 5KG6A 2Q66A 2DPJA 2M88A 4YR2A 2YX1A 4Q7AA 2F40A 2YKMA 3IMQJ 3C6UA 3GFYA 3CCWA 1JXEA 2MJNA 1GMWA 1TUVA 3A1YG 4C8YA 1HLWA 2GJIA 2XGPA 4AQYF 3VF0B 1PYSB 5HJYA 2HLTA 4AXIA 2IJNA 3VVUA 1FXLA 3RUBL 1Q5VA 2RSQA 4RW9A 1SL0A 1WTBA 1N5YA 3DRYA 4ECYA 1SJQA 1QE1A 1RTDB 3BDPA 1FDDA 3J7YI 2COLA 2GX8A 4DLEA 1O8BA 3DOKA 4LF8J 4R0EA 3GJQB 2QA4S 1FKAF 4OJGA 2HZCA 3GIIA 1BMQB 4QWDA 1IQTA 2CQPA 1RA7A 1W26A 2GHVC 2KM8B 4PUOA 4W90B 1C1CA 1Y5NB 1YK9A 2B7CB 2N7YA 3BSAA 3ET6A 2V8PA 4LRBA 5D4OA 6AT1B 4ER8A 2R7QA 4B9SA 4ALZA 3AQPA 2XHWA 1RBAA 4DCPB 2DHHA 2PA8D 4DU8A 4U95A 3WIUA 1R6YA 2BEFA 5L9NA 4RNFA 3Q83A 2MQLA 5L46A 4YHHJ 2YTCA 5CH7B 1ZS6A 2YWGA 5C25A 3WC2A 1HNWJ 5KFBA 2MXYA 1URRA 2HFSA 2QGFB 5DDRC 1C0TB 5AJ3F 4OZJA 2FZKB 3ISND 4RNOA 4DV5J 5DQGA 1SKRA 1V9OA 5FJ4A 3D66A 3EGVA 1SC4B 1X4FA 5D0EA 1Y5IB 1YQHA 4ZJOA 3TO8A 5GAHU 2O01C 3PRVA 5J2NB 4BC7A 1ZZNA 5E3RA 4ED2A 3BSOA 5DZ6A 2ZEJA 3BKTA 3LOUA 1TKXA 1XIQA 3BEGB 4R5PA 2CVIA 3BN4A 2ATCB 3NMRA 3ZZZA 3KFWX 2XO6A 3PYDA 4EEYA 1QAJA 2BKPA 3FZ2A 4KFBA 4UQTA 9ATCB 4CH0S 4R8UB 4OYAA 1NBEB 1HYSB 4QU6A 1ROFA 1REGX 2GAGC 2GQQA 3BPSP 2JLFA 4ZOSA 1BE4A 2RU3A 2X1AA 1QVGR 2MKYA 1Y10A 2BE2A 5HANA 1OYEA 2GW8A 2MLZA 5DS7A 1SIWB 4C7QA 3TX0A 1NAQA 5L8RC 1RTHB 2KRRA 1SQEA 4RPFA 4U6PA 2HVHA 1P9QC 4NA1A 2APOA 3M1VB 5GADU 3AA9A 3SBMA 3CXCR 1VQKS 2V6AA 1JLQB 4DXLA 2LVWA 5HBMB 2O66A 5F8MA 4FYDA 2MZTA 4NA2A 4I56A 1H2VZ 2F4VJ 1X4HA 4CT9A 2XSJA 3TI0A 4F02A 1HBNB 1V6HA 4ED7A 3DRSB 5A0YA 1SJRA 1RLDA 1DTQB 3CMES 1LWEB 4K4TA 2PI4A 2ZJPQ 3DLBA 2R7SA 5KFEA 2YNHA 3NG8A 3I96A 3JSBA 5BYQA 1T9XA 3FJ2A 1BD6A 4NE9C 3KDNA 4QW8A 1PKUA 4K4VA 4K2JA 1IWAA 1CC8A 4K4XA 2QEXS 3LP2A 3TA1A 3UNGC 1WOPA 4Y6IA 5HMXA 2ILZA 1IKXA 4LFAF 1NB2A 2AJ4A 3R7BB 5HVGA 5CAAA 2E9TA 3D9BA 4RNHA 2FVCA 3CTRA 5F9NA 1KDNA 4NRTA 3MM8A 1HBNA 3GZ7A 4UQGA 2MQQA 1FRLA 4EBCA 5KFXA 1JK9B 5AXKA 4C6AA 2CNOB 3M30A 4F8RA 1H6KX 2KZMA 2ZDOA 3OV7A 2DGVA 2WVFA 4ZPWR 2ZJQQ 3T5JA 1U1KA 1RISA 4O3OA 3UWTA 4CNYA 1S6PB 1LV5A 3K5MA 1HBOA 2UUTA 1FWKA 5LMNF 2VG7A 1WHXA 2J9EA 4B3MF 4WIIA 1RAEB 5H9EK 1HHQA 3FZBA 1YWXA 4IG0B 4WPAA 2QYCA 4LT6A 3R7NB 2CNKB 3GIJA 3F41A 3OVBA 1WEYA 2YH0A 5EX0A 5JJBA 1FXRA 4W98A 1SL1A 1FRHA 2ZHBA 1N5TA 1TL1B 3LF0A 1A6LA 2VKRA 3EXCX 1AA1B 1UVLA 2UUAF 3CCQS 2JNJA 1XNRF 2K7JA 3MD1A 4B02A 2X3GA 5DO2A 5EUHA 1D9AA 2YKPA 3P49B 2AJ0A 1C4AA 5T7LB 1AFJA 4X4VA 2L9DA 1VQ6S 1T03A 4C8MA 1UZHA 4CLFA 2CDRB 4PYAA 3QIPB 4K0KF 1MLAA 2LEBA 2BJDA 1TMJA 1KQSR 1KBRA 2MLYA 3G87A 2UUBJ 3U27A 1BWEA 2ABYA 2HHUA 2QJ3A 1O51A 3SCJE 3KLEA 1UW4A 4P6QA 2C2DA 3WBZA 4FN5A 2BQRA 2R8KA 2XB2D 1F2HA 2VA3A 1IUJA 2OKQA 2XTJP 4WU3A 4CP5A 2MGZB 1RAOA 3CNQP 5HP1B 2UXBF 1H2UX 1VQMS 4OYBA 3RAQA 4LF4F 2BE7D 4ZPTR 3MECB 5KFVA 3DRRA 3NXZA 3HXMA 2BVZA 4V19X 1R8HA 2AYMA 4PZVA 4ZLPA 2OHDA 1FVSA 1ZAXA 4JYAJ 2YPYA 3I9V9 2YKNB 4JB8B 4ZP7A 4EMDA 4NLWA 1IBKJ 2LA4A 5ETMA 5KT4A 2OFHX 4KHPF 1Q4RA 3QSYB 3W8PA 5BXIA 3FMBA 3BR8A 4FYXB 3TUPA 4P2FA 3C16B 5HK4A 3CCUS 3U1LA 4EI2A 1M90T 3IG1B 3WQPA 5KG5A 3GILA 2KN4A 5KFGA 1DRZA 3KHGA 4OZ3A 1KR4A 3BGUA 3DMJA 1FRIA 2ROEA 1Y00A 3QO9A 2KXNB 2ZH3A 1YRXA 3CJKB 3CCMS 1VBYA 2HAFA 5LSOA 4LF1A 2WW8A 4ELUA 4O4RA 1CPZA 1VQ8S 2J9CA 1NJZA 4X66J 1FNXH 1T8EA 2E7VA 3DLGA 2IHR1 1S1TA 4LRCA 4P2SA 1QAXA 3AJ2A 2HQGA 4ZCIA 2IDEA 4KB7A 4R0JA 2XCPA 4CLLA 2J6SA 3KKFA 3AAWB 5LMNJ 3ZFVA 3J7YU 3TJ9A 1DLOB 1MWQA 4RW6B 5LT5A 2W9BB 4EO8A 2Z2MA 5ETRA 3H5SA 5I4MA 1F9FA 4DR3F 1NPKA 1QE1B 2G2OA 2QTWA 4DFMA 3CD7A 1OS5A 3L7PA 4NCGA 4X4OA 3J7AN 2XNQA 1NDKA 4X4PA 3SV4A 2F8HA 3P4UB 1HQEB 3F56A 4ZP6A 1WDDA 2HG4A 5KFQA 3AD7C 2J7KA 1TL5A 4B17A 1RT7A 2JJ4D 2WVBA 4DPUA 4QBUA 5GAGU 2AGQA 5J2PB 4DQRA 4B08A 4ES3A 2IC3B 4RR5A 1F2GA 2WONA 4P10A 5IM0A 1GX6A 3C14A 2HBQB 2A18A 2R8JA 1D8YA 4PQUA 1K73T 2BANB 4LSNB 3AT1B 2V2QA 3MCMA 4JI5F 1NKEA 1UETA 3QT8A 4K2XA 1XTZA 2WTFA 1VQYA 2BKNA 2HWIA 1F3VA 3FBFA 3Q8VA 3K58A 1KFDA 3CCVS 3A8IA 2YNHB 1S4EA 3MM6A 5HI7A 5L38A 1WF2A 4ECWA 3OL6A 4OYXA 2LDYA 4I68A 4G1QA 1R6VA 3KK3B 1KS2A 3Q8RB 1M1KT 3T1YJ 2RJZA 4YEAA 1V5VA 2VBYA 4AD6A 3US5A 3MR7A 3MM9A 3OPKA 3VAHA 1R8CA 3K2YA 3DRXA 1DURA 2VPWB 2F9DA 2ZBQA 4LRFA 3SQGA 2XMMA 1U8SA 2QLWA 3FCVA 4XDDA 4EBEA 2CQ2A 4K59A 4FPIA 4DWIA 1LQ9A 1R3NA 5DGBA 2AGOA 1N54B 2OMLA 3QT7A 4I6AA 4ES1A 2YNFB 1VHFA 3GJTB 3GIKA 3ZTQA 3EDRB 3D6FB 1S9EB 3W60A 4TY8B 4MFBB 1B0VA 4IFYA 3J7Z5 2CXEA 4NMXA 3CCES 1YDLA 2M3DA 2FIUA 5T41A 1NJWA 3B4MA 4MIAA 4ZHRB 1O6XA 1KVKA 2W2QP 4GKJJ 2HNYB 2A1BA 2RUGA 3M6UA 4P2MA 1IKVB 3O5TB 2DNZA 2QV6A 2XHCA 2AQ4A 3DDIA 2ALYB 1O5JA 3HHLB 4X62J 1VQNS 1MU2B 2DO4A 5G4DA 2BW7A 3AOBA 3MR6A 4ED3A 4DBQA 2J8AA 2R8GA 1RHQB 4BBYA 4Z37A 3KNGA 2WVDA 4B9MA 5HQLA 4FF1A 2ALZA 2KZZA 2L9WA 4JI6F 3G82B 2DNMA 2ZVSA 2ZUGA 4G3IA 1XR6A 1WEZA 3B6BA 2M2BA 4M5DB 4WFXA 1U1OA 4PXDA 4UUWA 1UPMB 4P71A 4TU8A 1YJTA 4CWBA 2GQCA 1BGXT 2Y3YA 4CTAA 1C2PA 3FNNA 1HFEL 3F44A 4HHHA 2RKIB 2AYEA 2GVZB 1H0HB 2QFIA 1GX5A 2VPYB 3SDEA 3S01A 3KHLA 1BY9A 3LWMA 1I5OB 2DNYA 3DOLA 1REVA 3VAMA 3M2VB 3GFZA 4DQPA 4ELVA 1HNWF 5BYSA 5D6GA 2DEIA 1GNKA 3DLHA 1KRPA 1E6VA 2FYXA 3G82A 4QQBA 3OFHA 1J5EF 4QR0A 3W2WB 1C1BA 1RT6A 1VRUB 3QSIA 3UO0A 3RRKA 1JNRB 5GMDA 5LMUJ 5KFTA 4Q0BB 4AXJA 4CNZA 2XLIA 4D3GA 3W5XA 4TKTA 3KK2B 4ZVTB 1VK3A 3M8ZA 2H9ZA 1JXLA 1NZ8A 4NL5A 2VG6B 3ENAA 3UR0A 2V4QA 2WBRA 3CJ3A 4DL7A 4P74A 1NK0A 4JI5J 2KB2A 2QN6B 2LECA 3GIMA 3DXSX 5LOQA 4KRWA 2M7SA 3LP0A 4ZDNA 4QWEA 3MMBA 3GYXB 2E5GA 2P2CB 2DY1A 3D3BJ 3V4MA 3UNYA 2VFVA 4P2XA 2D3O1 2OMOA 4IDKA 2C3MA 2ZC3A 4Q2LA 3OW2R 1PYTA 2B56A 3RBDA 4DSIA 2MPUA 2NXJA 2V68A 3T1YF 2WBMA 4K4WA 3S7RA 1JQGA 2YH1A 3D0IE 1WWHA 2NXNA 3NAHA 2JVRA 5EWFA 4N76A 4MKAA 2DHSA 4W4MA 2W9CA 2HRTA 4RBVA 2DGOA 3HP6A 1EIYB 4F26A 1VQOS 1DTTA 1VMBA 4CM2A 4HTIA 2CQBA 2NYIA 3T9NA 1S48A 5E3QA 3LP0B 1NZAA 2WSFC 1NH7A 1RT3B 4EBDA 3FRZA 4OZLA 1D9DA 5GAEI 1XNQF 1N0VC 1B0PA 3KG1A 2DH9A 1X8DA 5ITHA 4DR1J 1BQNB 2YWWA 3QRRA 2QLBB 2WSEC 2VQFJ 1JX4A 1VQ7S 2VL1A 1N48A 2HBYB 2LXFA 3LUYA 1PYOB 3UVJB 4EU0A 4QJVA 4Q5VA 1GMVA 2X51A 3M8YA 4YS2A 4XPEA 3HFZB 5D4NA 1SL2A 5EN1A 4NLOA 3OR1A 2CJYB 2DYAA 4F0MA 4X64J 1UFLA 2W25A 4DR7F 2UXDF 1WKKA 4YB7A 4DLGA 1U24A 3H5XA 2R7OA 2F63A 3GR0A 2K7KA 1N0UA 5CQGA 1IR0A 2X3DA 5A8RB 4U96A 4RW7B 1R0CB 2HK3A 1YBUA 2HYIB 1G2EA 3IN5A 3PW7A 5DZ7A 1B4SA 3FCWA 4NLYA 4QPTA 4ZIVA 4DS4A 2KFZA 4H4KC 2EXUA 1HBUA 2LQ5A 1PCAA 2IIHA 1ACMB 3V6KA 4EFAC 4WF9Q 1FF2A 2YKMB 2N4CA 1WACA 4HH1A 2PMHA 4U9RA 3U02A 4XPCA 3BQ1A 1X9MA 5C42A 1HBMA 1YI2S 2KTQA 3IC1A 4DQIA 1BQXA 1S6QA 1DQ9A 3UW1A 1FTRA 2IMWP 1T02A 3S8SA 4M5HA 1Q81T 4OI3A 1S7IA 5DLGA 2UVUA 3CC4S 2E1CA 2F4FA 1QUPA 3I0RB 3ZTPA 4F7VA 1NK4A 1LW2B 2EFOA 3Q22A 4OX9F 2M9KA 3O2IA 2RF2B 4OYMA 1TQLA 2EKNA 5MLCV 2MKKA 3MTJA 5HLFA 4P72A 4XK8C 4DV7F 2CJAA 3DLJA 4DV2F 1X4GA 2D41A 3RB3A 2FQQB 3C8YA 2CQDA 3AB4B 1B7FA 1Q5YA 1X0PA 4YMEA 4DPXA 3C66A 3FC9A 3GU0A 4AT1B 3UFCX 3DU5A 1GXLA 4X4UA 3PXGa 2E29A 5ETKA 2GIFA 3OL7A 1XC9A 2ROGA 4TYBA 1RCOB 2KXFA 1QM9A 1UEKA 2ZH5A 2XY7A 2BACA 1RK8A 2LDIA 4RUCA 3H5YA 2GQ2A 2MDAA 4RKUC 3TQEA 2AHOB 2VG5B 1QSLA 2QL9B 4LFBJ 1RHRB 2KO1A 1SV5A 1P1TA 1VRTB 2E1RA 1X4BA 3M30B 3CF5Q 2FTRA 1H38A 3VAKA 3PX6A 1PO6A 4LBHA 4Q8FA 3EJMA 4JBCA 3CJKA 2KI2A 2A0FB 3WDOA 2BJ1A 4UW2A 2UVWA 2Y8WA 2VH7A 3GR1A 4LSLA 2YXLA 3DGPA 2OP5A 3CVKA 4LF4J 5FLXY 1SJFA 4F04B 3JSMA 2BW2A 3MM5B 3V6DB 4PUOB 2HPUA 4YDXA 1DHMA 3VGTA 3ENVA 1EZZB 1F5BA 1YZ6A 3DGVA 3P5TL 2OAUA 3DU6A 5KFFA 2YKOA 3KOAA 4FXDA 3VHQA 2W2MP 4FXWA 3RGIA 4CLYA 1BLUA 4OV1A 1JJHA 4ID5A 1PAEX 1RE1B 4PXEA 5LSRA 4A8XA 4JOUA 3EXYA 4UZCA 4QW9A 3ZC4A 1S5ZA 1S59A 2CPIA 4LSZB 3M8PB 1RTJA 4MYUA 1SJ3P 4MKYA 3AXKA 3EZ5A 3TW0A 1RT6B 3HZGA 1N5SA 2AX0A 4FPRA 3MUTP 2Y8YA 2B9YA 5SZTA 2AIRB 2UZAA 2M4MA 3I87A 2VU5A 1RAIB 4QIFA 2E7XA 2EI5A 3THPA 1ZM9A 1RTIB 5IM0B 2BM1A 2Z56B 3NOCA 2EFGA 5KFNA 4QIVA 2YWKA 1T9WA 2ZHOA 2GNKA 5KFZA 1QAIA 3UD4P 3R2DJ 2PEHA 5LJ3Y 1Q7LB 4XIUA 5B08A 3BV8A 3LANA 3MI7X 3DXBA 3R5AA 2ZJRQ 2HQ3A 3EMTA 4PXBA 1VFJA 4GVBA 2H54B 1VBZA 3MTKA 2CFXA 1KKHA 1OWXA 2HGNA 4OHVA 2VBZA 4JV0A 1S6PA 2H1YA 1F1BB 5SUHA 3AXMA 2ZNYA 3UN5A 4B3OB 3CO9A 1FJ7A 3HX9A 3LP2B 3G86A 2CJQA 3IR6B 3BO3A 3R1HA 4JI2J 4ZVPB 4C0BA 3BREA 1QAYA 3M8QA 1G7CB 3H8YA 4OLPA 3W9HA 5B0BA 1PJ7A 1TR0A 3DN9A 3GJSB 3O44A 1RGVA 5CYQB 5ETNA 1JLFB 2BOAA 2WB4A 1RUSA 5I42B 1SKSA 2QLJB 4IG3A 5KFRA 1VC5A 5ETPA 3NEKA 4GKJF 1B64A 1MWZA 2FC9A 1HMVA 2RH3A 2XWYA 3K0JA 2ZWOA 4ZPCA 1S1UA 2V8VA 1BXNA 2DNPA 1RWOB 3PTWA 2VBWA 3FKBA 4KQZA 2FZGB 3A8KA 3FMWA 4IH6A 4G1PA 4J9RA 2UUAJ 2C2MB 1ZA2B 4G65A 3L7OA 1M5OC 2K1RB 1UA0A 1PJ5A 1HA1A 1Z2LA 3IM8A 2CIMA 4L6V3 3RB4A 4F4KA 3FQLA 2B8PA 3RBZA 4F4AA 2CZVC 1HWKA 2E1PA 3THTA 3CD5A 4ZIWA 1FK9A 2AEFA 4WK3A 1TKDA 4LR7A 3ZZ0A 2QA4G 4C4WA 2ZH4A 2X1BA 1WF0A 2DIVA 3TAMB 1R0AA 5K5MA 2ASJA 3IFEA 4J9LA 3NP5A 4RBTA 3IRXB 4GO7X 1YJVA 4MT1A 2VPZB 3Q8UA 1B70B 2V2ZA 4MKVA 2IVFB 1VK8A 2LQ8A 2AMCB 3NOGA 3JTOA 3T19A 4KY3A 4WFBQ 4I2PA 1TL7A 1ZTWA 4B3SF 4WIQA 4QYZJ 4OQJA 2HFUA 1GMWD 1HWIA 3FSXA 5J1EA 1SH2A 4DV1J 2GMJA 5KG2A 1U1QA 4B9NA 1N88A 2K1RA 1NPPA 3TR5A 3LPEA 3Q86A 1U25A 3ONQA 2V50A 3A8JA 3OHAA 2CAJA 2XY5A 2OO4A 3EM1A 2HS0A 3RRGA 3C6UB 5CXTA 3HD1A 1UFWA 4KC5A 3K89A 1KONA 1ZPVA 1P1LA 2FVQA 1TFWA 4JP8A 3PYFA 7FD1A 4YHHF 4KGVB 2J7UA 4C97A 3NY0A 1Q79A 4P7TA 5DQHA 2BZ2A 5KFKA 4DR1F 3MM7B 5DRKA 1ICEB 1JMTA 1JLAB 3E3XA 2DXEA 3FRYA 4IKAA 5LXYA 5HN0A 1S9FA 2DK2A 4P9SA 2I38A 3MMJA 1U0HB 4I64A 4J91A 5E0OA 4WWSA 4ZVRB 3RW7A 3G2XA 2R42A 1HR0F 1LWCA 2R7XA 4IH5A 3H5UA 4HACA 3I32A 4USWA 3TRGA 3T1HJ 4J9UE 4JI1F 1S99A 4AUKA 2IA6A 4NLRA 2FJDB 1FFSB 1U1PA 4NYOA 4DPWA 4LF2A 5AXNA 1K0VA 4CLZA 2UXBJ 3FSYA 4MYTA 2L9NA 2JLGA 4C3KA 3KG0A 2GO9A 2QA2A 3MMBB 3V81B 5D0RA 2R7VA 3MFIA 1HNZF 2ZH9A 1NSKL 1WC3A 4XAKA 1NRKA 2MGZA 4DI6A 3CCJS 1PJ6A 1DLOA 2VBXA 2HRYA 2DVIA 2EC0A 5F8NA 4K4UA 2ASDA 2ASLA 3PKMA 3A3PB 3SIPB 3LALA 3I4HX 3SFUA 3QZ7A 4ICLB 3DM2A 4O3PA 5ETTA 1FWLA 4ZITA 4EYHB 4H4KA 3PW0A 3D5MA 1IJFB 5KG7A 4NASA 4X4RA 1EP4B 3DI6A 4NLSA 4KGMA 5RUBA 4PEOA 5D15A 5A2QY 2VICA 2F4VF 2DR9A 3MAAA 4ZVHA 3SQOP 3MEDB 3KLHB 4FZVA 4HT5A 4NEZA 2EBEA 2BXJA 3BBCA 3MHYA 4M63A 2POKA 3QGHA 4LFCJ 1MU2A 2WRMA 4EO6A 3NGUA 3KHRA 4QIGA 1L3SA 2JEJA 4KPYA 4RW6A 1BC6A 3SSRA 5IT9Y 2ZH8A 3EE3A 3BB5A 3ILOA 1Z1ZA 2YQ1A 3PM9A 2C3YA 4CCHA 2UUCF 1FKPB 2IY5B 4RW8B 1B3TA 4HEA9 1VQLS 4Z7YA 1F5CA 5T14A 1WC4A 1RTZA 4ETZA 3DM2B 4KKOB 5D3GA 1VISA 2HFNA 2HFZA 3ETOA 3QNWB 2E5LJ 2FJXA 3IXQA 5KFAA 2U2FA 2RDDA 1U6ZA 4FVCA 1WHVA 2KG1A 2CWKA 1TKXB 3NRBA 1GK8A 3WIVA 1WELA 3PV8A 5B7WA 2VA2A 4OZ0A 2LQ9A 2O67A 4CTAB 3CD6S 2VDHA 4I69A 3TUIC 4TQSA 3TVZA 3K8VA 2B5JB 4J9SA 4OJ3A 1Q8KA 4DN9A 5F9LA 1RYSA 1NCLA 3M8SA 3NMAA 1EB0A 3CJQA 3IBFB 3ZTSA 4HT7A 4K7QA 4KHRA 2VQFF 2HQIA 4WFYA 4G1QB 3DGPB 3IWNC 2HGMA 1CS4B 4QIEA 4EGLA 1RT7B 3HLUA 4MH8A 1UVMA 1OSDA 3FEXB 3KJQB 1TUWA 3D68A 3GG1A 1SPBP 3BM7A 3M8QB 3SCKE 4BLGA 4ZKAA 3UD3P 2VIHA 1ELOA 1XNRJ 2RHQB 2P6TA 4M5LA 4K50A 2DJWA 4WYLA 4QOTA 1OYDA 2KT5A 3D4JA 4IG3B 3E2EA 1CJVB 4LIRA 2H65B 5KG3A 2D74B 1JJCB 1DZ5A 3KLIA 1U6FA 2HQCA 1Q82T 2J6TA 1UEVA 1UJ4A 4KV8A 1I1GA 4DL2A 1UVNA 2CWXA 1EAYC 3H42A 1VHIA 2MY8A 1KOOA 1RABB 1NNDA 3KJNB 2QYGA 5IC6B 5F0UA 3CW2C 1IR1A 2DH8A 3ILIA 3G8TA 1M1GA 5JVGQ 4IO9Q 4OYOA 1GEHA 2ZDPA 2DBBA 1VI7A 4ZHRA 5A6PA 1S1VB 2ZHAA 3PVXA 1XK8A 4JI6J 3L7UA 1KVIA 2V94A 1APSA 3T3FA 3THVA 4JI7J 4IOBA 2H3EB 3SQGB 1R31A 3M2RB 1VBXA 4LF5J 3CT9A 3S1TA 2ZM6J 4GKKF 2KJWA 2W8KA 3NNCA 1HQUA 4NI2A 3RB0A 1T9TA 1ULRA 2FY8A 3W2VA 4FS2A 4CO4A 2VONA 2G0CA 1Q53A 3RAXA 4ZCLA 1N34J 1XMOF 1V3RA 3MD3A 3KYLA 3BSNA 4O3RA 4Y00A 4YR3A 1Q0NA 2E7WA 1C4CA 3PW5A 3TEGA 1NDPA 2JVOA 5LL6d 3K5OA 4JV2A 2HNDA 1PAUB 5K8MA 2AGPA 3I0SB 2C2OB 3GSDA 1NSAA 5A8KB 3FVYA 3LAMA 3OSPA 1UMJA 1HNVB 4LFAJ 2DD8S 4ED4A 3TUZC 1H7XA 5M2RA 3NKYA 2VG6A 1FD8A 4MIWA 2YQ3A 1U8WA 5KFPA 2NR0A 1BUXA 2H4YB 2XS2A 2XYPB 4YN3B 3R5DA 4K8RA 1G1XA 1MG7A 1OMSA 2V2KA 3HKZD 1X7VA 2GJ2A 3BKUA 2HHWA 3LGMA 3E51A 3VQTA 3MMCA 1PGZA 1SUQA 2HSEB 3BYRA 2MZSA 2F65A 3N5BA 2EW9A 2XSFA 3Q2SC 2L48A 4M5DA 4FP9A 1VJQA 3UE2A 4ENOA 3LAKA 3UCUP 5DJBA 1WC0A 1VDHA 1U48A 1TFYA 2QO3A 1Q8IA 4KR0B 3VGSA 2R4FA 4CYUB 1KTVA 2OLWA 3VVTA 1FO1A 2B9WA 1R0AB 3TQ1A 4DEZA 1IM4A 4EZ6A 3CCZA 1QVFR 3FQKA 3ZTOA 4DSEA 3AOCA 1RHMB 4DV4F 2FHMA 4DCOB 5GADI 3N79A 4CH7A 4PAAA 5JXSA 5L1LA 4H4OA 3AD8C 3JAMU 2JEFA 3IWLA 4DFPA 3GWCA 2G0JA 3AY0A 3BQ0A 2B43A 4LVOP 4A8SA 2RU9A 5HVFA 2F8EX 3BPDA 4E98A 4WXWA 2BR0A 1SVDA 1JLCA 2AT1B 5T7LA 1NK5A 3QWUA 3H40A 2WHOA 1V5IB 4FF4A 4V19J 3GB0A 1UKUA 3FCHA 3W5YA 3NGRA 4TU7A 2UU9F 1XMBA 3CSKA 4O3SA 5GAEU 1FFGB 2FGCA 4RWXA 2IRXA 2PA3A 2VFTA 3J81Y 4M5GA 3IBWA 3RYLA 1UZDA 1YZ7A 2FHOB 1TELA 4N8NA 2DR5A 1YVFA 4CI0B 1RT2A 1HR0J 1VQPS 2AV5A 5C25B 4CLUA 2QX0A 3OXLA 3POTA 4HVZA 2CA9A 1ZBTA 5KAKA 2HEKA 2EG1A 3MCSA 5L1JA 1A7GE 3MOZA 1XMQJ 1U0SA 3BJYA 3T41A 2PI5A 5GAGI 4QCLA 1ZM3A 5BYRA 4WFNQ 2ZBPA 1FVQA 3AJ1A 3HHEA 3K8WA 1FDBA 4GKKJ 2NUUG 1S9GB 4OHWA 1X4DA 1C0UA 3ZO7A 2GO8A 4JI3J 1A0OB 2W24A 1N4LA 2ZBCA 1WTFA 4DG1A 2HHSA 3I55S 1I51B 1RWXB 3A4TA 1FHTA 3CJTA 1MROA 2Z30B 2IVYA 2HS3A 2J9DA 2Q1LA 3CIZA 3GCXP 4PR6A 4JI4J 1RHUB 2HW3A 3BH7B 4KFBB 3MPDA 5HLFB 2C28A 4J7CA 4RW9B 1AZSB 3DCAA 1L3TA 1FERA 4S0MA 2XY6A 2OIHA 3HHNB 2XWXA 2F7VA 3ISNC 4QWAA 1FKOB 1NKCA 1P6TA 1HI0P 3D54A 3PCOB 4DPTA 3O1LA 5J2NA 1FA0A 4B9TA 1S6QB 4CM0A 5DDOC 1S9GA 2A2CA 4K4YA 2BQ3A 2V5HG 1S1WA 3QBCA 4RWWA 1NJYA 3UN2A 4EUVA 4IH7A 3DHXA 3GYGA 4O44B 1S97A 4I67A 1CG2A 1HQ2A 5F8LA 3AA8A 2MEWA 5I3PA 1RKJA 5HAOA 1NB7A 1M0SA 4LUBA 6FD1A 1KC8T 1WC5A 3JS9A 1FEHA 2XSJB 1SH3A 4DS5A 3V6HA 3TANA 3BN7A 2FC8A 4DR6J 3Q8SB 3HVAA 1N6QB 4U67Q 4RW8A 1T95A 1RAHB 4IR1A 4USJC 4NCBA 3Q8PB 2ZH6A 3MWBA 4LF9F 3B4DA 2CUYA 3GJRB 1XN9A 3IGNA 4ITSA 4MFBA 1FJGF 5C42B 2WOMA 4EYIB 3HMJG 2C2NA 2YNGB 3UI3A 3BGRB 4NYPA 4Z2XA 1HW8A 4CO1A 2GHPA 1NU4A 2FJAB 2KL8A 1JJ2R 5I42A 4IUFA 1GQEA 3PW4A 4ZPDA 2IYGA 3N6LA 1CSJA 1JKHB 3EPIA 1TK0A 5FDLA 2MQOA 1S0VA 2FD2A 1U02A 2B8QA 3SCLE 2KDOA 1J5EJ 3CULA 3Q2TC 1RJJA 2YQ0A 4JV5J 1JIHA 2ZH7A 1RWPB 1CJKB 2XYGB 1RWKB 3TA0A 4FYYB 4ZJLA 3V5RA 3KJVB 1HBOB 1SCJB 3R27A 3NGKA 5CABA 3JSMB 2RUSA 3IWXA 3M1VA 3SCIE 4JV1A 4DX7A 1M5KC 2RMLA 2KHCA 1D09B 4WE1B 4DV5F 2R7WA 4GVLA 4Y2KA 1MMLA 4DN0A 1IKVA 5ADZA 3HSJA 3HD2A 3HHLA 5K14A 2HNZB 1DQ8A 3KLVA 3RJMB 3OR2B 1HNIA 3MEEB 1VJWA 2RKIA 4ZVSB 1JKHA 2DXDA 3TAMA 5IWAF 2CZ4A 4EZ9A 2HRUA 4JI8J 5KFHA 4R25A 1KLMB 2DO0A 2GCFA 2GFFA 3MR5A 1EJ7L 1REVB 2HZAA 4NPOA 4Y2IA 1R0BG 2R9LA 3D6HB 5LXRA 2QIFA 4Y28C 1TL7B 2DEJA 4B3TF 1M5SA 4KKOA 4DPOA 3B54A 2G13A 4L75A 9RUBA 3M6WA 3I56S 3K59A 2IJRA 4AL7A 1AUDA 4LF8F 2E1AA 3OHBA 3GFXA 5D0GA 3W5ZA 4OLOA 2HNYA 1NJXA 1FT8A 1RQ0A 2NPIA 3N01A 4ECVA 1YG0A 3MMAA 3P96A 2C2RA 1PSDA 4OZ2A 1FI4A 1NPRA 2OPPB 2ZZNA 1HWUA 4CZCA 2OPSB 3TWZA 1TL4A 5CYMA 5KT2A 1RU2A 1YHQS 1YJWS 4ANCA 4ILRA 4ID5B 3CDBA 2ZZMA 3VCDA 4IO1A 2VFUA 1X5SA 1VYAA 4NWBA 4UY8T 1F3FA 1QLNA 2XGQA 1JLGB 1WDTA 2HWHA 4O4GA 2OD6A 1RT1A 2DRAA 3ZZTA 1H74A 1T05B 2J76E 2JHEA 3DLKB 3PHTA 3DDKA 1WEXA 2GMLA 1T9YA 3LGHA 4RUAA 1KSPA 2BV3A 4MK9A 1MN7A 3I0SA 3QZ8A 4B9LA 4IYQA 5KFUA 4ECZA 1JLFA 5B0AA 2EG2A 1HNVA 3K5NA 1WUUA 1IKWA 2CADA 2VD3A 2HQFA 4IQMA 4I0WA 2HBZB 1Q86T 2NPFA 3EDQB 2AEMA 3AH6A 5D77A 1CLFA 1S0NA 2IDLA 4G6VB 5IV3A 2ZBRA 5IZHA 5CHCB 5C24A 3IBCB 3R97A 4EWTA 1RT3A 2DHGA 1EETA 4WFAQ 4RNNA 4DV3F 1Y9OA 4DX6A 3CMAS 2V67A 2XZTB 2C2KB 1WOSA 2J5AA 3FEYB 3IG1A 4CLKA 4A8WA 3EYZA 1IBLF 3DLKA 4ZPBA 1OY8A 3UCZP 4WK1A 3CDWA 5K8NA 1AFIA 3M8RA 1BWVA 5IQ6A 4Q0BA 1U1NA 1X4AA 4DDFA 2VFRA 1U1RA 3KK2A 2RQCA 3B8HA 4AL5A 2N4DA 5L39A 1IKWB 2UP1A 4IRCA 4OYPA 2JC0A 1HD1A 3EICA 2Q6CA 4OX8A 3UQSA 5A2QU 4OHYA 1SC3B 4WYWA 4CO3A 2ZC4A 3IGVA 1LWXA 3LPYA 3ULHA 4LRAA 3WZ0A 3TJ8A 3CPWR 2W2PP 5H9EJ 1XR5A 1MROB 2FJVA 4L76A 4LF7J 4CO2A 1NDCA 4ZVQB 3DKDA 4NX9A 2V4JA 4DUZJ 4DR4F 2ZBIA 1W2BR 3GTYX 2D3UA 4KH0B 2V9WA 1TTHB 4ZVOB 3DMJB 3NWRA 2IVMA 3NGTA 1FXDA 3W64A 5ETVA 4TYAA 1G6BA 2EKYA 2V8HA 1YKWA 4PG4A 4WP9A 3C6TB 1DAXA 4QWBA 3UDEA 5A8WB 2WW4A 3N0VA 5CCLA 3H90A 5HMYA 5DQIA 4DV1F 4JI7F 4LF5F 2VV5A 2MMYA 3MCOA 4Y0FA 1FESA 3A8EA 1JNZB 3A3NB 4PPDA 3M2UA 3KUEA 2AJFE 4UY85 3R6LB 4HDHA 2BANA 4LSNA 3NGSA 3HSZA 3P3DA 4I7FB 3IS9B 2LYVA 3UPFA 3CJ2A 1C0TA 1HNZJ 3KLGA 2HHHF 2LEPA 2G2ZA 3DOKB 1FDAA 5LSLA 5H1SV 4DF4A 3KJFB 2H5JB 2RT3A 2ZNZA 2QC3A 4DV0F 5I3UA 2MYFA 4NCAA 1LK7A 2EFVA 3K57A 1K8AT 1SQGA 2IC3A 2MLXA 2VUGA 2PD1A 1RKIA 1AB8A 3BBBA 3ET6B 1T94A 2O5DA 3KXDA 1LW2A 3HFVA 3I9ZA 4C98A 4DG1B 2OELA 3LP1A 2R2TA 3C14B 4ED5A 1VS3A 2ADBA 3IR5B 3CJ0A 3FFIB 3ISZA 3UD5A 2SXLA 3N6MA 4XTTA 4FF3A 1PBUA 1RAAB 4OIXA 1VLYA 2H48B 3BS9A 3MUMP 2NSBA 4CDIA 2FHJA 3KLFA 2NZ4A 3I5CA 8AT1B 5HQ8A 4N77A 2N7CA 5CZVA 2KT2A 2MB0B 4DOZA 4ZLNA 1KEKA 2M5YA 1QSSA 3I5AA 4KIAA 4C8NA 4M94A 5IV4A 1NHKL 5AE2A 3KK3A 5KG4A 1IBCB 1LXJA 1WG1A 3QAUA 4M5KA 1RWMB 4LBIA 1S1VA 3CUNA 4DQSA 3RBXA 1DJ0A 3LGNA 1RHJB 4DV6J 1SIZA 5CZXA 4NLDA 4O0IA 4M8LA 4RU9A 3OTDA 1GMUA 3FBBA 1SJ1A 4F4ZA 3D1QA 3HZEA 1HWJA 4A8YA 5KT6A 3NGDA 2B5JA 2DH7A 1OO0B 2BABA 2I1RA 3OXFA 1S10A 2M70A 5JUMA 3JB9k 4E8UA 1MNEA 2H4WB 4F25A 3ILLA 3TAQA 2DGQA 4IRKA 5JVHQ 1DY3A 1RTJB 3QGPA 5F3ZA 5H9FK 2Z2ZA 2Y0BB 3GFHA 8ATCB 3OVAA 3CWJA 3TX8A 3JAMY 1C0UB 2KVQE 1VR6A 2R7UA 1HWLA 2ZD1A 2HHVA 3ZNUA 3F73A 1IKXB 4UZBA 4UOCA 4PWDA 1FDNA 3HSGA 3QT6A 5A8KA 3HVRA 3PO5A 1HD0A 1EX8A 5DM7Q 2UXCF 4DL0C 3BYPA 2GAHC 4KHMA 4YQWA 1UJ6A 4M5NA 1N36F 1JB0C 3PW2A 3DFEA 2Z58B 5D4PA 3DNCA 3TEHB 2RS2A 3E8OA 3J7A1 5F8GA 5A6WA 2XI2A 4AL6A 2DRDA 4ILLA 4O0NA 3M6VA 4C0OC 1U2CA 1TL3A 5J2QA 1E6VB 1YBTA 2VG7B 4DR2F 1W7WA 2A10A 1FRJA 4USTA 5C7PA 4IQXA 1WI8A 4FDFA 3QYYA 2P6SA 3SMZA 2FY1A 1VC6A 1T0TV 1Q8LA 2BUNA 3P5BP 5KTQA 2E66A 1KQFB 1G3OA 4QWCA 3Q0AA 3VAGA 1IWGA 4URGA 5IS2A 5EX3A 2BMBA 2NZCA 4KGZB 4ANEA 4P52A 4ZJQA 2MSTA 2I5JA 4NI2B 2OEJA 2J0XA 4CLWA 3VGVA 4RUHA 1U45A 5IT4A 4C9DA 2JEGA 2N3LA 1PG5B 2EFNA 1LWEA 2I6WA 4DPYA 3BO2A 3T6JA 4A8OA 2UV8A 3BO4A 3TARA 1FJCA 3EZUA 3JQKA 1TL3B 3TP2A 2W8LA 3R5JB 4CRJA 4PG5A 1C1BB 1VRUA 1LW0B 3CB4A 3HT0A 5EWEA 4E0DA 2RAQA 1EARA 1CS4A 3GG0A 3B78A 4OZ5A 3M9MB 2G1DA 1X0FA 5M2PA 4USKA 2B9XA 1NM2A 4N47A 4B9VA 2V4RA 2BA9A 4IG0A 3DYAB 2MHEA 3H2LA 3VWSA 5KFCA 1EKRA 2HFVA 1OIAA 4FYWB 3BSCA 3JYTA 4A8KA 4DL3A 2NUHA 2ATLA 3EWGA 1P27B 2GVZA 2YKNA 1WHYA 3MZIA 2CKWA 5B09A 2CPHA 5K8OA 3V4IB 2D3OR 1HARA 3L09A 4U7UK 1UWBA 3E01A 1UW9A 1Y4ZB 2LMIA 2J0WA 1R27B 1WC6A 1W2IA 3OXGA 4QR1A 4JI8F 5J1EB 2VHGA 2R8IA 5B0DA 2P5VA 4Q43A 3OL8A 4FXVA 4M95A 2XO7A 3HI9A 1EKSA 2V63A 1H73A 3FSIA 4I2QA 2BJEA 1FJGJ 2ZKUA 2JC1A 2QLXA 2ADCA 2D69A 3JYTB 3ZTRA 1LXNA 4RW4B 1NJIT 4DL5A 2YKQA 2A6OA 3RAMA 2QA1A 3TAPA 2J8SA 3MM7A 3N4WA 1S12A 1LNQA 2R2RA 3V4IA 2X1GA 4N41A 4PRFA 2MTLA 2CDQA 2H51B 3ZZUA 2DGTA 3C19A 2DR8A 3A12A 2W9AA 1MSWD 2BRKA 4QR2A 2F9JA 5KG0A 4X4SA 4LBPA 2VQEF 2VJVA 3TZYA 5B0GA 5B0EA 2V8DA 4Z7CA 5CA5A 5ETOA 4H4MB 4YB5A 3FBCA 3HULA 1XEZA 3DRRB 3MPWA 4P75A 4CLTA 2W2OP 2EK1A 4NZ7A 1YLXA 2MJUA 4MIBA 4Y34A 1PC4A 2HQDA 4NLXA 3HSDA 1RA6A 3WHIA 5M2UA 3MPVA 2UXCJ 1ZZFA 3DLGB 1WSVA 2LQJA 2GIRA 1NKBA 4U8YA 3PEJA 2HURA 3T9ZA 4BC9A 5IT0A 2XZDB 2CYYA 1RP5A 1LOUA 1U49A 3KLEB 1U26A 2AZ3A 4RZRA 1FTCA 3QGIA 2EC2A 3Q23A 1RB0A 2RF2A 1RT2B 2C1EB 1QY7A 3UDVA 5D0HA 1VLOA 3NCQA 1N6QA 4OI6A 3D6TB 2XS7A 1YGYA 1K47A 1VBKA 1K1QA 2C22A 2JLEA 2OEKA 3CCTA 3MEKA 4FS1A 5K20B 1NHUA 2CPXA 4N56A 3HHLC 4C2MA 3DOMB 5A8WA 3L4BC 2QG9B 2BJ7A 2DCUB
chains in the Genus database with same CATH topology
3HPOA 1ZETA 4MJKA 1U2FA 2KH9A 1HNXF 1WG4A 3G6VA 2Y1IA 3LWLA 4ELTA 3UR3C 2AD9A 2KFNA 2ZOFA 4GC7A 1Y0HA 4NYZA 4RW7A 1RAJA 2RD5C 4K5RA 4LIWA 3HVTB 3UDLA 2LEAA 2OD4A 3RW6A 4A47A 5THWA 3NS6A 1R8PA 3Q8PB 4XDCA 1VGYA 1FD2A 4NCGB 1KLNA 1LWCB 4MKBA 4DSJA 4TN2A 3ITHA 3RZAA 1ZAVA 3KJVA 4ED0A 3N9UC 4O3QA 5GMKa 5HMZA 4WFZA 3CE8A 5E2QA 3VAFA 2M52A 1S6UA 2RILA 2V0NA 2PT0A 3M32A 1QTMA 4F4XA 2H5EA 4IOAQ 4TLRA 2DNRA 2OPQB 3CCRS 2I0XA 1TZ0A 5EDWA 2LXUA 2XS5A 2DHXA 2HVIA 1R7IA 1X9WA 2B4PA 1DTQA 1ZOTA 1JLEA 3C2PA 4O3NA 3HVTA 4R8UA 1L3KA 4A46A 3KWMA 3MEGA 1J5OA 1PC5A 1L3UA 2YNIA 1HQEA 3FGVA 1WG5A 1SJ4P 3OUYA 3QIDA 3J80Y 1S1WB 2Z8QA 2CPYA 5IFMA 1TVRB 5EGYA 1N52B 1XBWA 4KJIA 3C46A 1FE0A 4LJMA 1V3ZA 1SI9A 2D9PA 2MKJA 2RE1A 2VB6A 5KFWA 2OPSA 1NK8A 3QLHA 2HHQA 2DITA 2LLZA 3DRSA 1SH0A 2XC9A 3DLEB 2HMIB 3KLIB 2O3DA 1T7PA 4DSLA 3KLGB 5AE3A 3KHHA 2YKAA 3MM6B 5B0FA 3M8PA 1F5AA 1RTHA 3KMQA 1JLGA 4O4GB 4OX7A 2OH2A 1HW9A 4B3OA 2WOMB 2HHTA 2W7OA 4HKQA 3MM5A 3V6DA 2QZ8A 1IKYB 1YRTA 4MK7A 2D9OA 1GTHA 3AHPA 4G1IA 5DGAA 3L3CA 2DGUA 5CYJA 3IAM9 2Q79A 2OJ3A 1HNIB 3MEEA 4ES2A 1QJHA 2L3MA 1R8AA 3QWPA 2XCAA 1UVIA 3OLBA 1SC6A 3KLFB 4IFVB 4PXCA 2YX7A 3CC4S 4OI4A 2AX1A 2YNFA 1VIXA 2WAQD 1HI8A 2RVJA 1SB6A 4CQ1A 2VOPA 1ZM2A 3H4BA 2W7AA 2ASYA 1SKWA 1J2VA 5HMWA 3T6BA 2B4UA 2B7BB 2DCLA 5KFLA 4TU9A 1NHVA 4OZNA 1KNZA 2IMOA 3CJ4A 3OR2A 4OJ1A 2Y1RI 1LWFA 4ZCKA 5F8IA 4IRKA 1I6JA 2E44A 5CYMB 1TL1A 1T3NA 2FJWA 2CQIA 3NLCA 1H7WA 4IFVA 4HH0A 2VC0A 1TP7A 4F67A 4DX8H 3T5LA 4NZ6A 3EUNA 4LVNP 4J9MA 1KQKA 4DFJA 4RU2A 3D0HE 4CT8A 2AW0A 3V6JA 1Q16B 3D1OA 2O1PA 2ZOMA 5FIIA 4QIWD 3CDEA 3PR4A 4X4TA 5AXLA 4B9UA 2IAJA 1MMNA 4KO0A 4BCAA 3GMGA 2CPJA 2KXHA 2HVZA 4DHVA 2JSXA 1E6YA 1XWLA 2J0SD 3IAS9 4MK8A 1S49A 2CG4A 5KT7A 3JSYA 2WK4A 2CQCA 3RB6A 2AJQA 3LO3A 2B3TB 1RT1B 4OI1A 3VZIA 2KM8C 2MQPA 3QJPA 1XR7A 3G71S 2GGPA 5J2MA 1K1SA 1S77D 4WZMA 2MKHA 3NL0A 4NZ0A 4LQ9A 4ED6A 2PIIA 1X5PA 3RBEA 3I31A 4LF6F 1KQGB 1JJ4A 4AFFA 3QMQA 2W7PA 3K7RA 2OTLS 3Q24A 3PX4A 5LMUF 5DG8A 3HHDA 2BQUA 3FFIA 4C8LA 1DARA 1RT4B 1DQAA 4ECXA 2PGCA 3ZZOA 3H98A 4F4YA 1T05A 1URNA 2HWTA 4PKDB 4H4MA 4DMZA 3PIPQ 2BM0A 5EHHA 2XLJA 3T5HA 1VIOA 2ZOGA 1U1MA 1X5OA 3C3LA 4OI0A 2HIQA 4ZMMA 2NLWA 2J0QD 2IM1A 2N82B 1B0TA 2QSWA 3G96A 1TV6A 4CIOA 3G8SA 1M5HA 2LU2A 2OPRA 2RNEA 4HLBA 4F3QA 5D8HB 1RT4A 1U09A 2KU7A 3O8WA 2MSSA 2M8HA 2QMWA 4ED1A 2FLLA 3MAHA 3KNAA 2DNKA 3PZPA 4ZP9A 1J5OB 4YR0A 4I2QB 3KTQA 2YY3A 1VQ4S 2GC8A 2BRLA 4ETXA 4KE5A 3KLHA 3DOMA 4NLQA 5E41A 4LQ3A 2GV1A 4J5OA 2IFXA 4USIA 3HHKA 4A8MP 4CH1A 5HBMA 2K2PA 4Q8EA 4FBUA 4NLTA 4WCEQ 3H20A 3G6XA 3CC2S 2VC1A 3QLHB 2B51A 4I7FA 5CCMA 2W9BA 1KVJA 4HI2A 5F0WA 2F1FA 2GHWA 2ZH2A 2ZE2B 3D2WA 1HBUB 1D9FA 4BWJA 3CCSS 4ZPAA 3DLLQ 4ZCMA 3RTVA 1H2TZ 2CPEA 4MMOA 1DRZA 1LK5A 3GV5B 1Q7YT 2XULA 3BF4A 2Z2LA 5H9FJ 5J2QB 4I1TA 2VODA 3HK2A 3BZQA 1IXKA 2D1CA 3OFEA 3HO1A 2EBGA 2DT9A 5J2PA 2B4VA 2CQ4A 2FDNA 3VAIA 1UEUA 4O44A 3NAIA 5KFIA 3I0RA 2ZKTA 2HHPA 1WF1A 3T1HF 2CQ0A 4NXNF 5G0RB 5KFSA 5KFOA 2R8HA 2I9SA 4PQUB 1FCAA 1D0EA 4NXMF 4ZS6A 4K4ZA 4JI0F 2LXIA 3JSRA 1VRTA 1LFWA 2DISA 2KYZA 4BS2A 2B6AB 3PEHA 3QAEA 1F0XA 2BYCA 3N6NA 4C8ZA 4X2BA 1OQ3A 3GE9A 3PRBA 1FRXA 1WI6A 2NQPA 1O0PA 2YNGA 1D8ZA 2ZD1B 3UCGA 1RI7A 1U6BA 2D7SA 1YJ9S 2RS8A 4GO5X 4KSEB 4Y2AA 2C3UA 3CCLS 3HVWA 4MTPA 2R7RA 3OSNA 4KTQA 2HMIA 4OZ1A 4DUYF 4K4SA 4PG6A 2OSRA 4WU2A 5E7OB 4Y2MA 4ZVFA 1S9EA 3R1LA 2B6AA 3VZHA 3NNAA 2CVEA 1F60B 2B4OA 4F2RA 4Q44A 4OI2A 5CD4H 4YOEA 3CGIA 1S0OA 4K5SA 4PWUA 4J9QA 3MOJB 2KRBA 2YWHA 4J9NA 3CDUA 5EWGA 1UJ5A 3M32B 4C11A 5E33A 4F3MA 4GC6A 4ATNA 3LH2S 5C5JA 3CD0A 2DGSA 3TA2A 3BGFA 4PCQA 4Y3CA 1S1UB 2NREA 4ZA1A 3RR8A 2Q43A 3MEGB 1T3OA 2VASA 5U47A 1FNMA 5IXUA 5B0CA 4TY9A 1LW0A 1ZM4A 3HKWA 5K8PA 3OJSA 3MECA 1X4EA 5DLFA 1TVRA 4C3MA 3SFGA 3T1AA 3PY8A 4ID8A 2KJVA 2VOOA 2WB1D 1YJRA 1NH8A 4ECRA 2JOQA 4P7VA 4CO0A 1U1LA 1TK5A 3ICLA 4ILMA 3PIOQ 2G9OA 2I5JB 3OQ2A 1AROP 4DUZF 3MPYA 3QPIA 4HHJA 4YDDB 1PILA 3PO4A 1K0TA 3JTPA 2XMUA 5KOXA 4X84A 3H25A 3SSQA 1V3SA 4I2PB 4I6YA 2MKSA 2RB7A 2KFYA 1NK7A 5D4LA 4J9KA 2P9CA 3BDEA 4Y2CA 3VALA 1L5UA 2JRSA 1CVJA 1OPIA 2IYIA 3MDFA 1RTDA 2PSZA 3LW5C 4PPZA 2E5LF 2XMWA 3K5PA 2IM3A 4NLPA 2WSCC 3MMAB 2QFJA 2YX4A 2ZFHA 2Z0GA 2CQHA 2FJEB 2MQMA 3W3SA 1S1TB 2CPDA 5HL7Q 1ZYQA 2CRLA 4JI4F 1EETB 2RIJA 4JI2F 3FDSA 1S0MA 2OPRB 4NMLA 1UA1A 4NRUA 2J6UA 3PACA 1BQNA 1RWUA 1TKTA 3BR9A 3I82A 2XBPA 4OHXA 2OFGX 2XEXA 1HBMB 2FHKA 5E5NA 4D3HA 3OLAA 2FVSA 2RRBA 2EK6A 4R5PB 1GT8A 3MEDA 2VZ9A 4WZQA 4WXOA 1S1XA 2IA0A 2E1MC 3ENWA 2IRUA 3ZZYA 2FGOA 4JUZA 1IJEB 2DPIA 2MZQA 2C3PA 2OSQA 1OPZA 1S4FA 5F3TA 5KFMA 1FE4A 5HROB 3QO9B 1YITS 2K3KA 1TKZB 4ICLA 2XMVA 3FEZA 5KFJA 4W92B 1YJUA 4OMFG 3OUYB 2CPZA 1OSCA