1YHTA

Crystal structure analysis of dispersin b
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
344
structure length
344
Chain Sequence
TKQTGLMLDIARHFYSPEVIKSFIDTISLSGGNFLHLHFSDHENYAIESHLLNQRAENAVQGKDGIYINPYTGKPFLSYRQLDDIKAYAKAKGIELIPELDSPNHMTAIFKLVQKDRGVKYLQGLKSRQVDDEIDITNADSITFMQSLMSEVIDIFGDTSQHFHIGGDEFGYSVESNHEFITYANKLSYFLEKKGLKTRMWNDGLIKNTFEQINPNIEITYWSYDGDTQDKNEAAERRDMRVSLPELLAKGFTVLNYNSYYLYIVPKASPTFSQDAAFAAKDVIKNWDLGVWDGRNTKNRVQNTHEIAGAALSIWGEDAKALKDETIQKNTKSLLEAVIHKTNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Dispersin B, a Biofilm-releasing Glycoside Hydrolase from the Periodontopathogen Actinobacillus actinomycetemcomitans.
pubmed doi rcsb
source organism Aggregatibacter actinomycetemcomitans
molecule tags Hydrolase
molecule keywords DspB
total genus 139
structure length 344
sequence length 344
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1yhtA00
3W38A 1W9BM 1ZBCA 2WLYA 4HU0A 1CEOA 5BRQA 3ZJ7A 5DO8A 2JF6A 1OSEA 4CN6A 1H09A 1FP8A 2GUYA 2VURA 3GBEA 3NSNA 1DEDA 4FMVA 1B31A 2FGLA 1JAKA 1V6XA 2VC9A 2X8RA 1TCMA 5CPQA 1OGBA 4D6FA 2BFGA 1KFWA 2DT3A 1W3JA 5LA1A 2VZOA 3ZR6A 1J0YA 4JFWA 3MU7A 3THDA 1SYTA 3L4WA 4PRWA 1WDPA 2XWDA 1JDDA 3CZEA 1E6ZA 1UKSA 1W3LA 4GQQA 3NSMA 2ZXQA 2J78A 3MMDA 1XYFA 1ECEA 3PHAA 4W5ZA 4M29A 3IJ7A 2WZIA 1W3HA 4UQDA 4JHZA 2PF0A 3K1DA 3TA9A 1HP4A 4AZIA 4WF7A 4D1JA 5CQ1A 5A3HA 1UWIA 4PMRA 1X6LA 5GPRA 1EDGA 1PAMA 2XM1A 1B3YA 4R27A 4IPNB 3ALFA 1FOBA 3THCA 4PTVA 2EBNA 1HKJA 1W9DM 4M8UA 3ZSSA 1BYAA 4PTWA 3AIRA 3B8SA 4Z2JA 3WMBA 2BVDA 1PIFA 1W2VA 5DEZA 3RJXA 3M46A 2CHOA 1G5AA 5C70A 3VGGA 2ZUVA 4MJ2A 3PZNA 1WPCA 4H7VA 4PTXA 3K46A 6A3HA 3TTQA 5A2AA 3VMPA 3SIMA 1FH9A 5KZ6A 4UOQA 4ATDA 2F2HA 1UWTA 1GVYA 2VO5A 4BQ3A 2D2OA 2ZOXA 1W1YA 3T09A 4CKQA 1G94A 3KL5A 1MQPA 2XWEA 5JBDA 1E4LA 3HMCA 2YLLA 5BCAA 3MS8A 1OIMA 3VIGA 5I3DA 5GNYA 3POCA 1H1NA 5D9NA 2VCCA 4J3WA 3VIJA 3VIKA 4W84A 3GH7A 1OT1A 1Y7VA 4PMVA 3WUEA 2W63A 1KWGA 3ARYA 4ZEPA 2HISA 2QPSA 1JDCA 2XIBA 2XG9A 5HDRA 3SUSA 1TE1A 4W8LA 1UWRA 3SCRA 1J0IA 3ZSTA 2WCGA 3FY1A 4GI9A 2BXZA 2UY5A 3L4YA 4PEEA 5IFTA 2Z1SA 1NM9A 1A47A 2JF7A 4L4OA 1KBKA 4E8DA 1QBBA 1UR2A 5C71A 3JUGA 2WWDA 3QHMA 3KL3A 3BAKA 5AYIA 5F7UA 5IFPA 3VGFA 2QPUA 1V08A 3L4VA 1I1XA 1VB9A 2CIPA 3GXIA 2OSXA 3UEQA 2VX6A 4U33A 3A3HA 4A4AA 4AIEA 4MTVA 2E0PA 4MDPA 2XJ7A 2JIEA 2AOSA 1E4NA 2ZWZA 3W37A 1NQ6A 1CTNA 4RE2A 3UERA 3GTNA 3CH9A 3WQ6A 5A2CA 4FK9A 1BGAA 4W88A 3AMLA 3F5LA 1ISZA 3ECQA 2WVVA 1UD4A 1EDTA 1GONA 5JIWA 4Z2GA 1SFSA 1XD1A 1CXEA 1CYGA 4ZXOA 1HJSA 4PCTA 4GPNA 5BXSA 1JZ6A 4CD6A 1CLXA 1Q6FA 3EMZA 2V38A 5IHSA 1UWQA 1GNXA 2JEQA 5D8ZA 1H2JA 3WDHA 5EFDA 5A95A 2BS9A 1XCWA 4TVDA 2CNCA 5ABHA 3PBGA 1WO2A 3ZO9A 1UQYA 2HVMA 1WCGA 1JL8A 3LPPA 5CSUA 1EOKA 2VR4A 1A3HA 3AZTA 4Z2KA 2AMGA 3K8LA 5A6JA 3S2CA 3WUBA 3M6DA 4QCFA 1R87A 1TVNA 5E0CA 2V3EA 2D22A 4A3HA 3BAJA 3EYPA 1JI2A 2BVTA 1E3XA 1DWJM 3A47A 5CPSA 2VQUA 2WMIA 4JL2A 4H8VA 3WF0A 4WKHA 4Q22A 3MUZ1 1V3KA 1DWGM 3WF4A 2PWDA 1MQRA 1MW3A 3NDZA 3OIHA 1E0XA 4F9JA 1B3XA 3N12A 1O6IA 3W26A 3EDFA 2WSKA 2J8FA 2QLYA 4MJ4A 1BYDA 3AISA 3OLIA 2WMKA 2DEPA 4QP0A 4M56A 3U5YA 2XSAA 5I2UA 1E3ZA 1OWQA 5A6BD 4JFVA 2VRJA 1VEPA 7CGTA 2WKGA 4B15A 1G0CA 1F4HA 3OGRA 1HXJA 4MAZA 4M82A 3VNYA 5EFFA 5FIPA 1H0IA 3NSXA 3PN8A 1QI3A 3ARQA 4M1RA 3WFZA 4K68A 1JNDA 1X6NA 1MXGA 4B9ZA 1VFOA 2BHUA 2IXUA 3AIQA 4J3VA 4AZCA 2YDSA 4QLJA 1D7FA 2X0YA 4F9DA 3BH4A 1TR1A 1V02A 3WELA 1ZBWA 2XFFA 4BQ5A 2J62A 4JZ5A 1J18A 1LG1A 1E6PA 3ARRA 5E09A 3VIIA 2WPGA 4LYPA 2VL4A 2WC3A 1GQKA 4PMXA 1VBRA 1TFVA 2GSJA 5I0DA 1M7XA 3NDYA 3DHPA 2WMJA 2ZUUA 1MFUA 2FHBA 4HU8A 4D6DA 1H5VA 1DWAM 2VZUA 3WNNA 2PI6A 3UG3A 1XD0A 1ISXA 1FH8A 1EXPA 3GYCA 3PZGA 5CJ5A 1E6RA 1ESWA 1JYNA 2W91A 3CZJA 2WBGA 1V3LA 5IXEA 4YN5A 1IT0A 3EBVA 4AD5A 1ZBKA 5A6LA 2YOCA 3MSGA 4KRUA 1JD9A 3WDIA 3AHXA 1AVAA 4ATLA 1UD3A 1QW9A 1V0MA 2VR5A 4W8AA 2TAAA 5ECUA 3VIOA 1B1YA 5BXRA 8A3HA 1NWUA 4BQ4A 4KWUA 1XGZA 4AD4A 2D3LA 4OOUA 2WVSA 2D0HA 2WMFA 3SEPA 1JYXA 3WL1A 1VFMA 2XHYA 1JIBA 3AFBA 1BHGA 2E9MA 1V3MA 4OKDA 3II1A 2WHMA 3AIWA 3DC0A 1W1VA 1BVNP 3T0BA 1JZ8A 1HVQA 1VF8A 3AS1A 1MW1A 3EDJA 4QFUA 3GM8A 4HZ6A 4CN1A 5AYBA 3BSHA 1E70M 2DSZA 3EMQA 2DSKA 3EDEA 1BTCA 1WB0A 2XVKA 4PCSA 4P7LA 1B90A 3CLWA 1PX3A 4FLSA 4S3KA 4IUGA 1NH6A 1NWSA 1OIFA 2CPUA 1UR0A 3RILA 2CKSA 4P8VA 1UD8A 1GOIA 1N82A 2OWWA 1SR0A 1XSJA 5BWFA 3CTTA 3AMCA 2VZTA 2YL5A 1JXKA 1G9HA 4ACZB 2XSBA 1JFXA 1GQLA 2CESA 1H11A 1PX4A 2CKRA 3WQ4A 3WKZA 2BVYA 2GK1B 2V5CA 9CGTA 3WEMA 1EDQA 3GXMA 1OD8A 3OLEA 3UG4A 4JKLA 4JFTA 3WD4A 1E1EA 5LA2A 1LJYA 3PZUA 1BF2A 1MVYA 2PBOA 2A3CA 1R86A 3PZMA 3L4UA 1J0JA 1ODZA 4OOZA 4AZGA 4MNJA 4CD4A 1RD6A 2JE8A 4ZXLA 3WQ5A 2GJPA 4JAWA 2NSXA 4HA3A 2EO7A 3VX0A 3SCTA 1TUXA 1J0ZA 1KQZA 2C0HA 3GNOA 2C8NA 1QNOA 2CEQA 3WEZA 1V02E 1KBBA 1JF5A 5IHRA 3CBWA 3VMOA 2ZXDA 4UQCA 5A6MA 2E40A 4H04A 1J10A 1JZ7A 3WBEA 5A8QA 1HJQA 2BY3A 3ZJ6A 2G4FA 1GOWA 2GJXA 3ZM8A 1QI5A 3AJ7A 1UKTA 4XZBA 2UY3A 2WMHA 2WW5A 2QMJA 1GJWA 2D23A 1KQYA 1E0VA 3DYPA 4PSRA 3RMEA 5D4YA 4WK9A 4V28A 2VZVA 1TA3A 1XYZA 3L2LA 4FLQA 2DT0A 4TOQA 1I1WA 3L4XA 4TXEA 2BHYA 3TTOA 4MB5A 1DWHM 1RPKA 4QLKA 4S3JA 3TP4A 1QHOA 2NT0A 4QLLA 2XIIA 2VT0A 1KGUA 5JBEA 3E1F1 1W1TA 2WMGA 1BPLB 4GZEA 4CU8A 1CZ1A 4YPJA 4BZYA 1UYQA 4PYSA 4J3XA 2DPEA 4AYSA 1EO7A 4W7WA 3U7BA 1B2YA 1KGWA 5C8BB 3PZIA 2XVNA 3CGTA 2XYLA 2YA2A 4OZOA 4AZCB 3ARSA 4UOZA 1L8NA 1ZJBA 1K9DA 1XH0A 1X1NA 2YL6A 4X9YA 2G8ZA 1UKPA 2WANA 1PPIA 1ZL1A 3NYDA 2WBKA 4EANA 4PMQA 4L4PA 1C93A 4NRSA 1E5NA 1QNQA 3GNPA 4WKFA 1OT2A 1CPUA 1AQMA 1UR9A 2OSYA 1E6XM 2PWEA 5ABGA 2ZUTA 3J7HA 3AZRA 4WSKA 3VILA 4LXFA 3ZT5A 1CGYA 3RDKA 1GOKA 3MV11 4W87A 3VD4A 3BCFA 4UZSA 1E9LA 4TVUA 2YBUA 4AEEA 2O92A 4P8UA 4PTMA 1TG7A 3KWXA 2G3MA 1GOQA 5FKYA 3WD1A 2A3HA 2E4TA 2CBJA 2YBTA 3T2QA 3BLKA 1HJVA 2Y4SA 3ARVA 3AICA 3PZOA 2Y2WA 1GW1A 3BMWA 4W89A 5CPTA 3AOFA 3APGA 3BAYA 2XFYA 4HPGA 4EKJA 5HPCA 3BAXA 4URIA 4CD8A 2AAAA 1H4PA 1VJSA 3ALGA 4UZUA 1BAGA 1QNSA 1NOUA 4KGLA 2B31A 2J7CA 4F79A 3D3AA 4FLOA 1WZKA 4GXPA 2PB1A 4CCDA 4R5EA 1J12A 3EDKA 3ARTA 4ML4A 3GZAA 1XSKA 1HJWA 1JYWA 3HJEA 2WVUA 3SURA 1UH2A 4WKAA 1IZJA 1HJXA 4PMNA 2DIJA 3AIUA 5EBAA 1JYVA 3T0AA 3ZQ9A 1HJUA 4E8CA 3PTMA 1EO5A 2XGBA 4DUVA 3N17A 2QV4A 5E9AA 4UFHA 1UOKA 2VX4A 2JIWA 4X0VA 4XZWA 4XX6A 4H8UA 3WNLA 4RE3A 1OB0A 4A3YA 2OYKA 1VIWA 3SUWA 3VX1A 1WZLA 1R85A 1B30A 4D1IA 3MMUA 3PZ9A 5I77A 4LGXA 1CIUA 3CUFA 3WY1A 1MWOA 2EPKX 2OYLA 3KEHA 2W92A 3FHAA 2WB5A 3ZIZA 4BF7A 1NWRA 5CLTA 2X2YA 3WDPP 3CIVA 3WD2A 3U57A 1HKMA 3VGEA 2WCAA 5HXMA 1VJZA 5IDIA 1BQCA 3CUHA 1ZBVA 3AYRA 3AHVA 4D6HA 3VU2A 4AY1A 1C91A 5CGMA 3DYMA 1HX0A 1B9ZA 4AZ5A 1C7TA 5D9PA 3AZSA 4PMUA 5A6KA 4P7QA 3VNZA 1UA3A 3WQ8A 3O2LA 2G3JA 2J7EA 2Y24A 2QMKA 1CECA 1WP6A 3WDRA 3LPOA 2WCSA 4M80A 2EJ1A 3RM8A 4DM1A 3W27A 5A8OA 4Z2IA 1O7AA 3SCUA 4NSBA 4W93A 1VBUA 1HF6A 5A8NA 4JCLA 2PC8A 2VNCA 3WIJA 3AS0A 3TOPA 5KEZA 1UUQA 2D0GA 3IK2A 3QGVA 2VVNA 4PUEA 3VOCA 1EGZA 1UR1A 2D0FA 4FLRA 5FD0A 1OBAA 2WZHA 2WVTA 1RP9A 2WAGA 3FAWA 4B16A 1LWJA 4OBRA 3AMKA 1NOFA 4NI3A 2V3FA 1ISWA 1U30A 4XB3A 3CHCA 1JNEA 1GVIA 2GDVA 4DUXA 5BYWA 4IM4A 1Q4NX 2WK2A 3CHEA 4GINA 2XVPA 5GNXA 2WXDM 4M81A 1CGWA 1EIBA 1W1PA 1WDQA 1CXIA 1GHSA 4EE9A 4KH2A 3CMJA 2VCAA 1GCYA 1MW0A 2YJQA 4UR9A 3QHOA 4OJYA 4NZCA 3BAIA 5GNZA 1XSIA 2E9BA 5I23A 3F4VA 4AZ7A 1QHZA 3CHDA 3SCSA 5GQBA 1B3VA 4QCEA 1HN1A 5ABEA 1NP0A 4AZ6A 4JIEA 4GIAA 4H41A 1VFUA 1W91A 1L0PA 3PTKA 2PWGA 4GZIA 4U5KA 2D20A 4U5IA 3WFLA 3K4AA 2GFTA 1EOMA 1VFFA 3MUAA 1CGVA 1U2YA 1BG4A 1KXQA 5JUVA 1TZ7A 3OZOA 4OBSA 4U2YA 1DTUA 1ZJAA 4F66A 1QBAA 4P8WA 4TVCA 4AD3A 3IANA 4PN2A 1EA9C 1CNVA 1WE5A 1Z32X 2WMIB 3VTRA 4P7RA 2W61A 1E6QM 3SUVA 1OINA 2VQTA 3OB8A 4HMDA 3M07A 3VDBA 5ABFA 5HBFA 1VEMA 1GOMA 1PX8A 1GQIA 4BCEA 4GQRA 1HP5A 3GH4A 4DUWA 1H49A 2UWFA 2OLHA 3QHNA 4AIOA 4Q7NA 3FXYA 3MUIA 5A94A 3D5HA 1QHPA 4CCEA 1QI4A 1UA7A 5I6SA 1KCLA 2VZSA 1GHRA 3RPMA 1CLVA 2WZEA 4X0NA 3ZT6A 1XH2A 3WQWA 3WQVA 3OBAA 3WNPA 5I79A 2VX7A 4QDMA 4F8XA 2PWHA 3DECA 3OGSA 4U3CA 2ZUSA 2FGZA 3KZSA 2XVGA 5CXPA 5E6YA 1FFRA 1V3IA 2JEPA 2ZXAA 2ZXBA 2YKKA 5A6AA 3G6LA 3RM4A 3QR3A 4XV0A 2RGMA 3T08A 3AHZA 1J0HA 3FNDA 5FCZA 4U31A 3A4AA 1B0IA 4CU6A 2CERA 2F61A 4GZJA 4UQEA 3AXIA 3QOKA 2XPKA 1G01A 3W6MA 5JIPA 1JD7A 3AIVA 1NP2A 3N11A 5M03A 3MSDA 1E56A 1NWTA 4CU7A 3AROA 4KGJA 1M53A 2X1IA 3O6AA 3CO4A 1EQPA 2G3NA 4PMYA 1GZJA 3FW6A 2PBGA 1E1FA 1KB3A 1QW8A 3FN9A 4QAWA 3AYSA 3AIBA 1XC6A 1W9PA 1OM0A 3AHYA 3VGDA 4UOJA 2VVSA 5HOSA 3AI0A 1DHKA 4DWSB 2F8QA 1HT6A 3AQUA 1V6UA 1E4MM 1SMDA 5LA0A 3GXDA 3W82A 3UESA 1VAHA 2FHFA 4NF7A 2G3IA 2Y8VA 1F4AA 4D6CA 3WUFA 3WNKA 1Q6DA 3VIFA 2CBUA 1LL6A 2Q8XA 4W85A 4LYQA 4P7NA 1B3ZA 2E3ZA 2JFEX 3K8MA 5HPOA 3L2MA 1TVPA 3FHQA 1DWFM 4PMZA 3MANA 1ITXA 5BRPA 3VGHA 2OWXA 5A8PA 2J75A 3SCQA 3WDQA 2VUYA 4MNMA 1E6SM 5DMYA 4J3UA 2VOTA 4UFIA 4D6EA 5FOOA 4CD7A 1BYBA 2GJRA 2CCRA 4MDOA 3WF1A 1PZ2A 4OUEA 4HPHA 2ZUNA 3U5UA 4CCCA 3UR7A 1W9VA 4WSJA 4GKLA 2GJXB 3OLGA 4IPLA 3VMNA 2Y8KA 4MNKA 5AC4A 4UNIA 4H2CA 2YA0A 1K6AA 4YHEA 2WHLA 3GBDA 3MUY1 1BSIA 1TMQA 1JDAA 3VUPA 3WNMA 3WDJA 3L4TA 2WHKA 3A4XA 5FL1A 2WSPA 2WWCA 4J27A 2A3EA 3ZR5A 1W9XA 3ARXA 3VIPA 4JCMA 1KR1A 1UD2A 4HP5A 5A8MA 3LPGA 2ZWYA 4UCFA 1K9TA 3AS2A 2BHZA 2NT1A 3SUTA 3OGVA 1Q6CA 2DSUA 1YQ2A 2YDQA 3IAQA 4MB3A 3VDCA 4DWSC 4MB4A 3SCWA 2J25A 2ZUWA 1JZ5A 1V3HA 5A1AA 4LYRA 4DWSA 2CHNA 2EPLX 3AXHA 3K4DA 1EQCA 4CUCA 1HL9A 3WH7A 4YHGA 3CHFA 1E72M 7A3HA 1LF1A 2V3GA 2QF8A 1SMAA 6TAAA 3QOMA 1P6WA 1ZU8A 2J7FA 4ZFMA 4NRRA 2E8ZA 1NARA 2BNJA 2E8YA 3GXFA 1BGGA 3BSGA 2XTKA 2CXGA 5BXPA 5BROA 4HZ7A 4BA0A 2PWFA 4TX8A 4WIWA 1V0NA 1C7SA 3POHA 4TUFA 2VI0A 4RE4A 1ZS2A 2DH2A 1CBGA 4D6JA 2VMFA 2ZX5A 1AQ0A 1V0LA 1V6VA 2C7FA 2E9LA 1J11A 4Z2HA 1E0WA 2W62A 3VD5A 1H3GA 4AXNA 3IAPA 1I75A 1XH1A 2DIEA 1UWUA 3VKKA 4C7GA 1UQZA 3UETA 1E71M 1R8LA 3CMGA 5E70A 1QOXA 2J8GA 1W2PA 1C3FA 3TTYA 1HKIA 2J7BA 4B9YA 4BQ2A 5M5DA 2ZX6A 5E0FA 2D1ZA 3LMYA 2VJXA 1LL4A 3MMWA 1K9EA 1ZB5A 3SCVA 3W6LA 1TA3B 4U3AA 4TX6A 5CSYA 1BFNA 1UKOA 1Q6EA 3WD0A 1HL8A 1LL7A 3WENA 2WVVB 4J7RA 1S46A 4MAVA 3B9AA 2DH3A 5D9OA 1MYRA 1FFQA 1JZ4A 1FA2A 3WMCA 1MW2A 3ARPA 2EPNA 2UY2A 4V27A 4D6IA 3CZ8A 3KL0A 4IISA 4PSPA 4UQAA 2BY1A 1C90A 3DHUA 4TTGA 2ZICA 2W5FA 4AZBA 3ARWA 1UR8A 1OGGA 1AQHA 1R7AA 3N9KA 4UFMA 3TTSA 3W4RA 3CUJA 2FH6A 1WAWA 1FHDA 3IJ9A 1J0KA 4Z2LA 4W7UA 3BCDA 4JL1A 3WH6A 5E6ZA 5D8WA 2O9OA 1R7OA 1B3WA 4GI6A 2VX5A 1HIZA 4MB1A 2ZX9A 1KXTA 1LLOA 5AC5A 1KXVA 1EHAA 1CDGA 5DT5A 4AISA 3T0DA 1BLIA 1FH7A 2XVLA 2J7GA 3WBAA 4HMEA 1KXHA 3VDAA 4C7FA 3RJYA 2BY0A 2XGIA 3SCPA 3HU7A 3GH5A 1HKKA 2Y5EA 3PZQA 2ESCA 1D3CA 3NIYA 3HN3A 5EMYA 3ZT7A 3WF2A 1UH4A 3F5JA 1JXJA 2WC4A 4AC1X 2BY2A 5LYRA 2A3AA 4W86A 1ITCA 3VM5A 1FP9A 5I5RA 2BV9A 2VTFA 1GOOA 1KGXA 4ACYA 1C8XA 2CETA 8CGTA 2X0HA 3SUUA 1J01A 3WMSA 2O9TA 3K8KA 3RIKA 5TD4A 1ISYA 2XFRA 2X05A 5CGTA 2MANA 3BLPX 3ZJ8A 3AMGA 2YL9A 4WJXA 4B3KA 1E5JA 4D6GA 1C92A 2J47A 1UD5A 2Z1KA 1PZ3A 4CVWA 1YHTA 1US3A 4N0RA 4Y7EA 4J3SA 3WL0A 1LWHA 4RL3A 3WN6A 5I24A 3ZOAA 5DFAA 2DSVA 1JF6A 4ZE4A 1IZKA 5A69A 3AMDA 1E55A 3N1AA 4DM2A 5I78A 1WDSA 4CD5A 4U2ZA 3CZKA 2DSWA 4JKKA 1Q6GA 1E15A 3S6TA 5FL0A 1CXLA 2CBIA 5DT7A 4MPKA 3I3BA 2YA1A 2WHJA 1XV8A 1GQJA 1DWIM 4HOXA 4ACZA 4UQBA 1UKQA 4GO8A 4BS0A 1W9UA 3FAXA 3NUKA 4UFJA 3VO0A 3I3EA 3BMVA 3B9EA 1UZ4A 4XUYA 1H0GA 1WNOA 2J77A 2WNWA 2ZX7A 1HVXA 4CGTA 1JG9A 4D72A 1CWYA 1DP0A 5M17A 4MADA 3VM7A 5ABFB 6CGTA 4AEFA 3WEOA 4J3TA 1OGSA 4DWSD 4HMCA 4PBGA 3KE0A 2YDRA 2VRKA 1UWSA 4KRTA 2J7DA 2ZIDA 1CGTA 1GORA 4ZENA 3GNRA 3A6OA 3VIHA 4AIUA 4AZHA 3A4WA 4J28A 3VD7A 2CITA 4AMCA 1UH3A 3SCOA 1KR0A 1KWKA 4P8XA 1GUVA 1W32A 2V3DA 2OWCA 3VD9A 4ZE5A 1PIGA 4JKMA 4PMDA 1PEZA 3T2OA 1KCKA 2QHAA 2D24A 2W66A 2YLAA 3BC9A 3ZJKA 3WH5A 3VDHA 3DYOA 5D9MA 3VGBA 2XUCA 3N18A 2VRQA 2V5DA 1V6YA 2YIHA 3WH9A 3CUGA 4EAMA 3OZPA 4P7OA 2DT2A 5BXTA 3ZMRA 3UCQA 3AHTA 1QNRA 1E6NA 3BGAA 1NOWA 1K9FA 2IUZA 2BXYA 3UG5A 5JBFA 4W8BA 2EXOA 3VIMA 4B3LA 2WC7A 4LX4A 2WLZA 4E2OA 1C8YA 3NCOA 1WKYA 1JI1A 4EK7A 1D2KA 2XM2A 5CLWA 1M03A 3TONA 2J4GA 2EPOA 1CENA 1EH9A 1JGIA 2EQDA 3WNOA 2W4XA 4W5UA 4LPCA 3W0KA 3BAWA 4UQ9A 2J74A 4HTYA 5EB8A 2GK1A 2CBVA 4FF5A 3EDDA 1BG9A 1RP8A 1ODUA 4AD1A 3M7SA 1QI0A 1UG6A 1J9YA 1QPKA 3W24A 3CPUA 1E4IA 3N15A 1OD0A 2O9PA 1UHVA 3OLDA 2FH8A 3PTQA 2O9RA 4JHOA 1WDRA 4CN4A 3PZTA 2YL8A 3RO8A 1AMYA 2NW0A 1XCXA 3MKKA 1V03A 1MFVA 1V6WA 2DDXA 1M04A 5CG0A 3VVGA 1E43A 5AY7A 1HNYA 1PBGA 4V2XA 4JFUA 2OYMA 3T2PA 1H41A 2DT1A 4W7VA 4E4PA 3CUIA 4OIFA 4CVUA 3U7VA 4GI8A 1BVZA 2WM0A 5CZKA 3OG2A 4LQ1A 3WF3A 5A2BA 5A6SA 1G1YA 2J79A 4AWEA 1FHLA 2ZX8A 4UFLA 1MQQA 3AXXA 1UD6A 2FHCA 1CGXA 4KMQA 1GPFA 4MNLA 1C8QA 3AS3A 1XHGA 2GDUA 3WH8A 1CXKA 2JALA 4HOWA 4HOZA 4HZ8A 2J7HA 4UFKA 3WD3A 2G41A 1EHNA 3G6MA 3AIEA 1V3JA 1QI2A 3VINA 2W67A 1CGUA 3VD3A 2VCBA 3W81A 2FDMA 1QNPA 2EEXA 2ZUMA 4PMOA 1JAEA 3SCNA 1WZAA 3I3DA 2DQXA 1V0KA 1IV8A 3B9DA 1US2A 1JZ3A 1ISVA 1UR4A 4AD2A 4AW7A 1OCQA 4ATWA 1E40A 4TTUA 2A3BA 5M3WA 3W29A 4HA1A 3CZGA 1LQ0A 1CXFA 3NJ3A 1RH9A 1VENA 3MO4A 3PZVA 4H8HA 1PJ9A 1BYCA 3EMCA 3W53A 3W28A 3CZLA 3LPFA 3N04A 4N42A 1U33A 3N13A 4JFSA 2ZE0A 3RCNA 1VRXA 1QVBA 1XRVA 4C7DA 1UZ1A 1GJUA 3L4ZA 3W25A 2CYGA 4HA4A 7TAAA 2DGAA 3GDBA 1JZ2A 2WKLA 2IXVA 2UY4A 3OA5A 4UTFA 1W3KA 3UR8A 3ARZA 2EPMX 1VEOA 3RM9A 1CXHA 1WZMA 2RGLA 4M24A 1JFHA 5DF0A 2X09A 3O9NA 4AD0A 1E73M 3BXWA 3ARUA 4GO9A 1M01A 1MXDA 2GVYA 3WUGA 3MV01 5HNNA 5A6BA 1LG2A 2D3NA 3F5KA 4D71A 3IJ8A 3VPLA 3WSUA 4PUDA 2OSWA 4WLCA 2WYSA
chains in the Genus database with same CATH superfamily
3W38A 3PR2A 1ZBCA 1CEOA 2DZXA 5LIKX 4FNQA 5AHMA 2WV8A 1UCWA 5FEPA 1NSJA 4K3ZA 5HK4A 2VURA 2QUUA 3GBEA 9XIAA 4FMVA 1EFZA 2FGLA 3LRKA 2VC9A 2BGSA 3B8UA 5CC6A 1S2CA 5FF2A 4LS1A 3W1MA 4MJZA 1A5CA 2BFGA 2VEGA 1W3JA 4LRTA 5LA1A 1IEWA 1XIEA 3SY5A 3UPBA 3G8RA 3LEPA 1UC5A 4JFWA 1Q2SA 3OPSA 2GDQA 3P74A 1OEPA 1WDPA 4UTKA 1JDDA 4LNYA 4BFAA 3MC5A 1UKSA 1RR2A 4KFOA 1KTBA 2DZWA 3MMDA 2ISVA 3W1LA 1ECEA 4AHOA 4W5ZA 4O11A 4GUGA 2WZIA 1W3HA 4UQDA 5CQ1A 1UWIA 4GWEA 4PMRA 2QCDB 4R27A 4DXKA 1QK0A 4US5D 4ZODA 3QGAC 5K9DA 3CT2A 1KFCA 3ALFA 4JQ1A 2BTMA 1HKJA 4AAJA 3FLUA 3LSBA 5E93A 1EP1A 1PIFA 1W2VA 4U10A 3RJXA 5C70A 5CBJA 3VGGA 2R1MA 3NDOA 2JK2A 2ZUVA 4MJ2A 4EACA 3VUSA 4NL1A 2P76A 4C6EA 5EU9A 1VR6A 4M6UA 1XGEA 1ITUA 2VO5A 1Q66A 4IOTA 4HNUA 2ZOXA 3KDOA 1AH4A 3T09A 4CKQA 1NELA 4Q8TA 4MWAA 3G8EA 2PRHA 5BCAA 4GIEA 4F40A 3VIGA 4M3PA 4LF1A 3POCA 5D9NA 3GTHA 4LF2A 2IPFA 3VIJA 1ZUAX 1M6JA 2QCCA 3NAVA 3NXFA 1XLHA 3LTPA 2WJEA 4ZEPA 1KBLA 1KKOA 3EA2A 4O0ZA 4F0SA 3NQGA 2INZA 3SCRA 1J0IA 3GR8A 1S2UA 1SW0A 2WCGA 4GI9A 3L4YA 4OV4A 2Z1SA 3UWYA 3BJTA 2Z1BA 1TV2A 4L4OA 4E8DA 3GTIA 4MY8A 2V30A 1TIWA 2WWDA 3QHMA 4IFOA 5AYIA 3RLUA 2REQB 1V08A 3GXIA 2OSXA 3R7MA 2I9UA 4JTSA 4AY8A 4AIEA 4MTVA 2E0PA 4MDPA 1E4NA 1CTNA 4RE2A 1SO5A 1IEVA 3UZWA 1TJPA 2ZZ1A 3AMLA 1REQB 9XIMA 3BV4A 3O6YX 5F4XA 1EDTA 1ONRA 1SFSA 3QV7A 4D8LA 4KRZA 1CYGA 4RZ6A 4A21A 1ADSA 4I5UA 3ENLA 2EG8A 4MY9A 3QC0A 3LG3A 5FESA 4FOUA 1GNXA 2G37A 4WUIA 1H2JA 3WDHA 4Z42C 5A95A 1KM0A 2Z0IA 3ZO9A 4FOKA 1WCGA 2VR4A 3G77A 2AMGA 5FAGA 5A6JA 3S2CA 4LEFA 2PGRA 2D22A 2BVTA 3P8IA 1DWJM 1TV4A 4ZQRA 4E2VA 4WKHA 4Q22A 2E6DA 1G67A 3RNDA 2FPYA 4PUUA 2PWDA 1DE5A 1YTEA 5HULA 1R9YA 1MQRA 2YCKX 1MW3A 4AVFA 3W02A 4F9JA 4NX0A 2PE4A 3B4UA 1CCWB 2WSKA 2R1PA 4F4RA 1IWPA 4MJ4A 1BYDA 3AISA 3JZEA 3N4EA 1QATA 1FTXA 2WMKA 3RFAA 3R6IA 2XH2A 4CQDA 3N2XA 5I2UA 1OWQA 1EEPA 2Q8ZA 1TWIA 1VEPA 7CGTA 2INFA 3UJ2A 1UOZA 1G0CA 4BJHA 1R2TA 2AQOA 3T9PA 4MAZA 1R3RA 2VD8A 4PFHA 4H9YA 2JKPA 1LROA 1GKQA 5EFFA 4CNNA 5FIPA 3NSXA 3PN8A 1QI3A 4ASTA 3E0LA 1JNDA 3OOQA 1X6NA 2QR6A 1RV8A 3BQ6A 4IMEA 3WQCA 2E7FA 3G1RA 3GVVA 2IXUA 2PF8A 3O6CA 1AG1O 4AZCA 5AFDA 2YDSA 2PTWA 3VOJA 3S5SA 3BH4A 3M5ZA 1R9XA 4WD0A 1TR1A 2VGGA 1R3QA 2WJDA 2XFFA 2J62A 1OCJA 4JZ5A 3TOYA 1LG1A 1IWAA 2WC3A 4UBPC 1VBRA 1FWIC 2FIQA 2GSJA 2VP8A 1M7XA 2WMJA 3W7GA 3T8QA 2ZUUA 2FHBA 3GC2A 4EXBA 3KLLA 1FWBC 1PKLA 1XS2A 2PI6A 3TDFA 4CEXC 1ISXA 1FH8A 4YVXA 3CMFA 1X96A 2AMXA 1TREA 1VHCA 4YN5A 1IT0A 1IR2A 3HZ3A 1ZBKA 4Q8PA 4I7VA 4AU0A 3MSGA 4KRUA 3Q2DA 5IBXA 1JD9A 4HHLA 1AVAA 4O57A 4ATLA 1UD3A 1V0MA 5HUPA 4GRSA 3TR2A 1XF0A 3V1HA 3QYSA 2FZ8A 4BQ4A 3HGSA 1RZMA 3ZXWA 4C6JA 1UJQA 3EB3A 3TH6A 4NY2A 2WVSA 2D0HA 2YZRA 3P5YA 2WMFA 2HCVA 4XTIA 1JYXA 1VFMA 3NO1A 4QE4A 1Q65A 4HNNA 4RZ4A 4GI4A 3TKFA 2I5QA 2PDKA 1W1VA 3EXSA 4LYKA 3T0BA 3QV9A 3T55A 1IR1A 1WDWA 4QFUA 2Y5JA 1ICSA 3HURA 5AYBA 3BMXA 1DIOA 4C6BA 1WB0A 1CX9A 3QKEA 1IXOA 4FLSA 1BWLA 4IUGA 1NH6A 8RUCA 2CPUA 1UR0A 3RILA 3W1AA 5EYWA 5H8MA 1UD8A 1N82A 3RCMA 5T91A 3GG0A 1OK6A 2IKGA 4DBSA 4Y9OA 2GQ3A 2ZRYA 2VZTA 2YL5A 2GVGA 3H23A 2XSBA 1GQLA 3GE7A 5KINA 1BQGA 1H11A 4XD6A 2CWXA 1XLFA 3WQ4A 2QGHA 1BWKA 3WEMA 1ADOA 5HWMA 1SPQA 4FXRA 3HG4A 3T40A 3WD4A 3NQEA 4BF9A 3RF9A 1BF2A 2E6YA 2QVHA 4A3RA 3L4UA 1J0JA 1DQUA 4XG1A 3SZ8A 4QJ1A 3GRIA 3QR0A 1FY6A 2JE8A 2GJPA 4HK7A 4OFCA 1PKNA 3VX0A 1F74A 1TUXA 1AQFA 3WEZA 5IHRA 3VMOA 3URBA 5BRBA 1FWCC 3DKJA 5A6MA 2E40A 4H04A 1R3TA 3WBEA 2YR1A 2BY3A 1OF8A 3LV6A 2IKHA 1GOWA 1OK4A 2VDGA 1QI5A 4XZBA 1OY0A 2WMHA 3VFCA 1F8MA 2WW5A 4I7WA 3PM6A 3DYPA 4PSRA 3TSDA 1XYZA 2JBMA 4NUWA 2YYTA 3L4XA 5XIMA 3TJLA 3KCLA 2AKMA 1EEXA 4MB5A 3B9NA 4RDWA 1RBOB 4Q6XA 4I8YA 4QLLA 5DY2A 3SJNA 3TUUA 1EJ7L 4NJIA 2YB4A 3IGSA 1W1TA 2V82A 4R7JA 4LAZA 4ZQCA 4YPJA 4BZYA 1UYQA 2W79A 1A0DA 3COTA 3KOYA 4W7WA 3U7BA 1B2YA 3CGTA 2DVUA 3GTXA 4JPGA 2BGNE 4AZCB 4PUNA 5DLCA 1EJTC 1K9DA 1P7TA 1IHIA 2G8ZA 2NQ9A 1PPIA 3MCNA 3LM7A 3G1VA 1T6MA 4NRSA 4YMZA 3TYAA 4WKFA 1OT2A 1AQMA 1UR9A 1E6XM 1SW3A 3H6OA 3W72A 4WSKA 2ZA3A 1JPHA 1OQFA 2E67A 1CGYA 2E1DA 4XAFA 2Y61A 4HSNA 4TVUA 3LBCA 4EF9A 4P8UA 3UJFA 4RNHA 1D7KA 2DZPA 2G3MA 1YE4A 3WD1A 1UZHA 2XIQA 2E4TA 4ZOAA 2CBJA 2YBTA 3W3OA 4R53A 2PDGA 3T2QA 4O8RA 1OHLA 3ARVA 1AH3A 3UPWA 3W2NA 2UBPC 1GW1A 3BMWA 4W89A 1YNYA 3AOFA 1MUMA 3THUA 4EKJA 5HPCA 2P88A 2ZDSA 3M6YA 1HUVA 1RQHA 3PPGA 2V8ZA 3T44A 1GOXA 3G0SA 4HNLA 3JVAA 4QDWA 4F79A 3D3AA 1A3WA 4FLOA 1WZKA 1HO1A 2FVMA 2XN1A 3ARTA 1DXFA 1I8JA 4ML4A 3UZXA 3GXPA 2WVUA 3SURA 2OKTA 1THFD 1HJXA 4PMNA 5EMLA 5EBAA 1JYVA 1IGSA 3KDNA 4Y8FA 3G18A 2JGYA 5F2LA 3PTMA 4O4WA 3PSWA 4QHRA 3XISA 4QNWA 3N17A 3L65A 4HCDA 1J96A 4NAEB 2JIWA 4Y90A 4X0VA 4XZWA 4ZB5A 7TIMA 1WZLA 1R85A 3R0KA 2Y70A 3PZ9A 1MZRA 4Z1BA 1MWOA 2OQLA 1H7PA 3R79A 1OFRA 4ZCWA 3CIVA 3WD2A 3U57A 1UUMA 5IDIA 1RQEA 2NQ5A 3CUHA 4N7QA 1ZBVA 3PJTA 4C1NA 4AEOA 3DYMA 2QF7A 1MDLA 4HD5A 2OEJA 4JNZA 1F5ZA 4FX8A 5D9PA 3C0QA 3IVSA 5TNVA 5CJNA 3RRXA 3IVTA 5HMDA 1UA3A 4GFSA 3O2LA 3QQ1A 2G3JA 2WQDA 2Y24A 4FNSA 1WP6A 3UY7A 3WDRA 3LPOA 2WCSA 3EA3A 4ZSTA 3AXKA 4INFA 5A8OA 4Z2IA 4PEKA 3EOUA 2PC8A 3QYQA 3WIJA 3TOPA 2G97A 1NF0A 2D0GA 5ABTA 4LUTB 2VVNA 2C1HA 3DESA 2D0FA 1SQ7A 3UPMA 4D9PA 2QJNA 3UWZA 5FD0A 2WZHA 3WO8A 1RP9A 3FAWA 8XIAA 3OEXA 5FJIA 4NI3A 2V3FA 2PP0A 3CHCA 1W3NA 2GDVA 5D30A 3W23A 1WAUA 2PUZA 4IM4A 3U6WA 2WK2A 4A8NA 3O1NA 1KM4A 3SIZA 1ONWA 1SZGA 4HJFA 2NWRA 3DBPA 3UR2A 1GHSA 2VM8A 4GFIA 1RSCA 2CC0A 3FV9A 1GVSA 2OQHA 4E6MA 1TVLA 3FXGA 3GAYA 4QIUA 2CLKA 3F4VA 3CHDA 1F9CA 1XXXA 4QCEA 1HN1A 1NP0A 3BPWA 3VNIA 3IPWA 4X2RA 1W91A 4JIPA 1L0PA 2I1OA 1A0EA 2PWGA 2Z2AA 1EOMA 3H4WA 3MUAA 3FDKA 1UB3A 1D3GA 2Z1XA 4Z17A 2VEMA 1KXQA 4YWSA 5JUVA 4S3CA 1TZ7A 3OZOA 4ECLA 3UXAA 1DTUA 4JTHA 1BD0A 1L6WA 4FEZA 1I6NA 1EWEA 3IJ6A 3GVWA 2W61A 3SUVA 1TTJA 4EPDC 1SJAA 1BKSA 2NVCA 1GOMA 1PX8A 2YXGA 1GQIA 4BCEA 3RR1A 4L6OA 5K7JA 4KESA 2OLHA 1F05A 2E5DA 4GCAA 3DN5A 4Q7NA 3S6DA 5A94A 5G2WA 1OFOA 3SY1A 3SJ3A 4YIWA 3RPMA 3EPOA 1FKXA 1CLVA 4X0NA 4A05A 1E51A 3WQWA 3WQVA 3WNPA 3DECA 3OGSA 3D47A 4Z1AA 3LS9A 2FGZA 3NPXA 3NZGA 2X1TA 2H3BA 2YPIA 2XVGA 1ZTVA 5E6YA 5F2MA 2ZXAA 2YKKA 3VAVA 2QEZA 4WCJA 3DFTA 3G6LA 3RM4A 3QR3A 4IHCA 4L1GA 1J0HA 1EF3A 4H7ZA 3A4AA 1B0IA 2CERA 1Z44A 5CZTA 1I45A 4CCZA 3QOKA 2XPKA 4Q8UA 1TKKA 5BOFA 1NP2A 3FX4A 2G96A 5M03A 1D3HA 3NTYA 1EQPA 5G1TA 2G3NA 4NZ5A 4DJEC 2DIKA 4WEVX 1TWSA 3B0XA 3UWWA 4EAYA 3AYSA 1OM0A 2H3DA 3REQB 4UOJA 2VVSA 2J6XA 3HFTA 1VPQA 5LA0A 4GY7A 4ZA0A 4NXKA 1TPC1 4D2JA 1B57A 1AH0A 1F4AA 3CT7A 3WUFA 3OBKA 4JTEA 3E12A 1B3ZA 2E3ZA 2JFEX 3BW4A 1DWFM 3EEZA 1KFEA 1TCDA 1ITXA 2ZZ3A 5BRPA 2OWXA 3BLIA 2J75A 2O56A 4MNMA 1E6SM 4S2CA 3E0VA 4UFIA 5FOOA 4MG4A 3T0TA 2GJRA 2CZFA 3FA4A 1S3TC 2C13A 2BVWA 4PBFA 4MDOA 4DYKA 2QT3A 1LTDA 4LSBA 1PZ2A 4H19A 3P7YA 1P5BA 4RUBA 2POZA 2FTPA 1XG4A 1W9VA 3DUGA 1M5WA 4GKLA 3LERA 2V9DA 1L9WA 3OLGA 4IPLA 1B4EA 1YPXA 4LW7A 5LHEA 3BZGA 2DZTA 4EPBC 1K6AA 3CQHA 4H83A 3CQJA 5AYXA 2IPWA 1BSIA 2TPSA 2CLOA 1JDAA 2XGZA 3VUPA 2RDWA 1A50A 2WHKA 3WQGA 4AMAA 1ELSA 1O5QA 2PCQA 5J8LA 5DN1A 5FL1A 1W6TA 4KCTA 2WWCA 3R0UA 3BVJA 1J79A 4DO6A 2AQVA 3EWZA 1AJ2A 2V5JA 4XAYA 4IG2B 4HTBA 4A6GA 3H4GA 3LPGA 3PPHA 2ZWYA 4IXXA 2Z25A 1T99A 3I6EA 2BHZA 1I2RA 2O4QA 2NT1A 3B4YA 3TSBA 3SUTA 1RAKA 3OGVA 2DSUA 4MB3A 3IAQA 5C9ZA 3M0XA 1V3HA 3GU9A 2CHNA 4QJ4B 2ZTJA 2PZNA 3AXHA 1T7LA 3WH7A 4YHGA 3CHFA 3UW6A 3STEA 1H63A 6TAAA 1ZU8A 3LB0A 3TAKA 2V69A 4NRRA 2PDIA 2E8ZA 1NARA 2NX9A 2OT1A 3K1GA 3NZQA 2PU1A 2YXXA 4IIDA 3HF3A 4LNCA 3NQFA 4BA0A 4KEZA 2PWFA 4TX8A 1EWDA 1V0NA 1IZCA 1J93A 3POHA 3URAA 1W8GA 4RE4A 1WYIA 3O3RA 4D6JA 3M0LA 3SFKA 5GJNA 1J11A 3LMZA 1E0WA 1ZZMA 3VD5A 1HO4A 1UMLA 5IM51 2D2GA 3STCA 1XH1A 3VNJA 1UWUA 3O0KA 1PTGA 1E71M 4JQ2A 2Y88A 4S2BA 3S9YA 3USBA 2J8GA 1DBTA 2D1ZA 4FXSA 2QKFA 3W6LA 2OTDA 1Q6EA 4GE8A 1QMLA 3C5QA 3HBLA 3WENA 4FPSA 5LIWX 4J7RA 1RCOB 1SZRA 3TQPA 1XQLA 1EGVA 2DH3A 1MW2A 3C0SA 2YFNA 3O8AA 4IISA 3QC3A 5BMXA 1UP3A 3DERA 4QM1A 3FFSA 3IRDA 1Q6LA 4K7YA 5C9UA 3PP7A 1IEIA 4CLMA 4AZBA 4DJDC 4UFMA 1WUFA 3W4RA 3CUJA 1MNSA 2FH6A 2Z2BA 1FHDA 3IJ9A 1HTIA 1H7NA 5D8WA 1ME8A 4GI6A 1UPMB 5AYZA 2VX5A 4MB1A 2ZX9A 1KXTA 1KV8A 4C1KA 1LLOA 4FR6A 1ZPTA 4JX4A 3N2OA 3W9ZA 2C16A 2QJHA 3UGVA 1G69A 4AISA 3T0DA 5HMFA 1SZEA 1BLIA 1FH7A 2BMBA 1LM1A 1JPDX 3P60A 1PTDA 4I6VA 4JN6A 4C7FA 4DN1A 2BY0A 2RDUA 4NILA 3G24A 6XIMA 5I02A 2XN0A 2Z29A 2ESCA 1D3CA 1RJQA 1OZQA 2TRSA 4A29A 1XJBA 1XYMA 3HN3A 3EX1A 4K8GA 3ZT7A 1Q6QA 3KFTA 1RJRA 2QDEA 4ZB2A 4DI8A 3GYEA 3IWPA 1BXNA 2A3AA 2D2JA 1J5TA 4W86A 3OYZA 4GH1A 3O7UA 1G4EA 3LV5A 1VBHA 1P0BA 1QAPA 1C8XA 8CGTA 2X0HA 2OOGA 3SUUA 1J01A 3FOKA 4NVTA 3G1FA 3PTDA 2XFRA 3GR4A 4REQB 5H6HA 2HRWA 3EKLA 4NJJA 2P8CA 4V1XA 4B3KA 5K9CA 4LV9A 4HVXA 1UD5A 4CQBA 4XVEA 4ZFCA 1QO5A 4O19A 1LWHA 3K2GA 3WN6A 1YLVA 2DSVA 1JF6A 5DFAA 4ZE4A 2QPXA 3BJFA 1LT8A 3L7RA 3EWXA 4CD5A 4U2ZA 2VD9A 4QDPA 4R7WA 2CFFA 1SJCA 2DSWA 3S6TA 1VFTA 4N02A 3WJYA 5DT7A 3U2OA 3I3BA 4J4KA 2YA1A 1DWIM 1VP5A 1IXQA 1OADA 2I16A 3FAXA 4UFJA 3VO0A 2FJUB 3B9EA 1JCXA 1H0GA 3U9IA 1WNOA 2WNWA 4KQNA 1JG9A 4HGXA 4MADA 3UR5A 6CGTA 3UD6A 2NQLA 2EKCA 3G1XA 1OGSA 4DWSD 2YDRA 2VRKA 3GNRA 3UWUA 3VIHA 1IWBA 4M51A 1O12A 3VD7A 3N34A 4AMCA 3SCOA 4P8XA 2XZ9A 2PDXA 4LOCA 4AQLA 4JNMA 3EA1A 3VD9A 3MP5A 2Q09A 1SW7A 4G56A 5C5YA 4PMDA 1PEZA 3AUJA 1XLLA 1OJXA 1PDYA 3DGBA 4P2VA 3LGGA 2W66A 1TJ2A 3PWAA 1ICPA 3N18A 4GX8A 3TA6A 3OZPA 4JR5A 4HHMA 2DT2A 4GYFA 2R9RA 4UXDA 2DUZA 4AC7C 3MB9A 1TRDA 1N8FA 1E6NA 3E74A 4WJEA 4LAMA 1Q7MA 5D32A 2WC7A 4LX4A 2WLZA 4E2OA 1C8YA 3SW6A 3I10A 4RZ5A 2DVXA 2V68A 3KAOA 4DJDA 2JGQA 2OGYA 4AF0A 1EC7A 4JHMA 2J4GA 1W8SA 1CENA 1EH9A 4AB4A 2EQDA 3QSRA 4C6QA 4W5UA 2J74A 4HTYA 5G1YA 4FF5A 2CBVA 4HA0A 4MFDA 3EDDA 4GUFA 2W0UA 2Y0FA 3UZYA 4M6VA 2CLLA 3N29A 2IPGA 3EX3A 4BWLC 4OE7A 2H90A 5D03A 1QPKA 1DL3A 2Y1HA 1E4IA 2V63A 4S3BA 2ZRWA 1UHVA 1EBHA 3JW7A 4XKYB 2AGTA 2O9RA 1WDRA 1T41A 3U2EA 3TV8A 1C9DA 1IYXA 3RPDA 3PUDA 3RO8A 3BV7A 3MKKA 1V03A 1I2NA 5EL1A 4QS6A 3MMTA 3MQTA 4XSLA 4GXMA 2NVDA 1E43A 3RO6A 4EPEC 3BUVA 2I17A 1VKFA 1JCNA 3E2RA 3WMLA 3T2PA 2DT1A 1UWAA 3GK0A 5LIUX 1FDZA 3WJWA 4GI8A 3ES7A 1B4KA 1BVZA 4C6MA 3DFNA 4LQ1A 5DQPA 1BWVA 5A2BA 3S1WA 1G1YA 3IJQA 1FHLA 3AXXA 3CL8A 4RLIA 1QT1A 2OFJA 4KMQA 1GPFA 5I3KA 3M5XA 5D2TA 1EUAA 1PS9A 3BQ5A 4AHQA 2BOFX 1V3JA 1QI2A 3VINA 2W67A 1JCTA 1L2UA 1EZ2A 3PF3A 1CGUA 3VD3A 2VCBA 3NQAA 3LUTA 1QNPA 5CZJA 3UWQA 4PUWA 1R3VA 2PGWA 1Q8JA 1US2A 4IIEA 1JZ3A 1F3EA 2PTXA 3CO8A 4OTKA 2WM1A 1PZ0A 4TV6A 4LV4A 5AHLA 4LAOA 6REQA 1K77A 2A3BA 5FEZA 4FNTA 3GIQA 3NQDA 3WK2A 1XLGA 1Q7QA 1CXFA 1VENA 3MO4A 4QSHA 3ABOA 4HB7A 2ZQ0A 3W53A 1TQJA 3N04A 4JFSA 4Q32A 3MSRA 1E0UA 1XGDA 1UZ1A 2IQ0A 7TAAA 1JZ2A 5LNSA 3HB9A 3OA5A 4JQ4A 4ENLA 4K2SA 2C91A 2GGEA 1CXHA 2RGLA 1FXPA 2L5HA 2PDLA 3SAZA 3BANA 3GDRA 4AD0A 4MOZA 1M01A 1QJWA 3T8LA 5FJRA 3U0HA 2BG5A 1LOSA 4GH3A 4JTUA 5SWUA 1AK5A 4D71A 2E68A 3EZ4A 3CV6A 3VPLA 2OSWA 4PCNA 3EXRA 1SSGA 2WYSA 3OA3A 1W9BM 1NDWA 3H22A 4HU0A 4PL1A 4Q4KA 5GJPA 4B5TA 3ZJ7A 1P6CA 1OSEA 1H09A 2HNHA 1FP8A 2VEKA 3EWYA 1DJGA 1K7FA 1O5XA 2X8RA 3C8NA 1ZAJA 1SJBA 1JGMA 3M44A 4YCOA 1OGBA 4P61A 4D6FA 1WA3A 4Y9MA 4FO4A 3ZR6A 1J0YA 4S3EA 4LFYA 1FUYA 3UG8A 2NV2A 2QQ6A 4PRWA 2FB3A 4IX0A 2XWDA 1XYCA 1W3LA 4TX9A 3NSMA 3I7RA 3DEQA 1O68A 3BE7A 3PHAA 4M29A 4GJJA 3BGGA 3IJ7A 3NL5A 3GY1A 4JTDA 3TA9A 1HP4A 4AZIA 4WF7A 5A3HA 4MUZA 3CV1A 1B3YA 4Z0JA 3TWBA 2J9XA 3B8VA 3LQGA 3KP0A 2R1KA 4M8UA 2YXOA 3B8DA 3WMBA 1LRTA 3C6CA 4E38A 3TYBA 1LBMA 3M46A 5FJOA 1RA5A 3DX5A 4XD5A 4V1YA 5L9FA 5A2AA 5CAHA 1A49A 1FH9A 4ATDA 2F2HA 3VC6A 3IGXA 1XPYA 3C86A 2Y7DA 1X7IA 4BQ3A 3LGDA 3LU2A 1MQPA 2XWEA 1DOSA 1PYFA 5DY3A 3MS8A 1OIMA 5GNYA 1H1NA 1G7VA 3QFWA 4XWUA 3WLJA 3WUEA 3S47A 4IICA 2DUAA 3C56A 1E9YB 2W63A 1A5UA 4RE0A 1KWGA 2HISA 2QPSA 1ALDA 3TE9A 5HDRA 3SUSA 1TE1A 4L1WA 4UTHA 4W8LA 3EX4A 3QV8A 3G3MA 1KFBA 2GQ8A 3QMRA 2EAWA 1M7PA 4C6CA 4MGGA 3TNOA 3U2CA 1KBKA 1QBBA 2ACQA 3JUGA 3LRLA 3KL3A 1PCWA 1XBYA 1QPRA 3BAKA 1MNZA 3AALA 2QPUA 1I1XA 1JUEA 3CWHA 2R14A 3UEQA 1EPVA 2VX6A 1HKWA 4U33A 4BWLA 4QBXA 2AOSA 2JIEA 1NQ6A 4EP8C 7XIMA 3QGKC 3URQA 1PE1A 4FK9A 4OBTA 4M5PA 3ECQA 3VKAA 2WVVA 1TPEA 3MCOA 1UD4A 3W75A 5EA9A 3GKFA 5KTLA 1QO2A 4XD3A 1EIXA 4MLRA 1XI3A 2X7VA 3LLDA 2ZADA 5BXSA 1JZ6A 4S3GA 4DJEA 3EMZA 4Q7BA 1PKMA 2XIOA 2OJPA 5IHSA 4K1GA 1UWQA 4PUJA 1S5NA 1XIDA 2BS9A 1XCWA 4HNVA 4DJDD 2R94A 5ABHA 1O95A 1WO2A 1A53A 1EL3A 1JL8A 1WKDA 1LCOA 1T0OA 4DXXA 3C2VA 1YBQB 1A3HA 4Z1CA 3MUXA 4H1ZA 3F2DA 1JPKA 4Z2KA 2GWGA 3UXIA 4UB9A 1V8EA 3K8LA 3WUBA 2X16A 5E0CA 2V3EA 3MSYA 2V2HA 3EYPA 4GHRA 1JI2A 1E3XA 3A47A 5CPSA 4DY1A 3SB0A 3AU6A 3PWIA 2WMIA 3WF0A 4ZO8A 5AHEA 2EHHA 1FWEC 1NFGA 3MWCA 1V3KA 3WK3A 3WF4A 4DB7A 1TPDA 3PPCA 2B7OA 2WJFA 3P6LA 3BOXA 4UMBA 1US0A 1EP3A 4FNPA 2E6AA 2DEPA 1XLBA 3R43A 2A79A 1KM5A 2BASA 1UC4A 5A6BD 1KRCC 4JFVA 4GJ1A 2WKGA 3FJLA 3OGRA 3GO2A 4M82A 3VNYA 4S39A 4B5WA 3ARQA 4M1RA 2BGQA 3MVTA 2OELA 3WK0A 3BLFA 4TMBA 3VNDA 4M19A 4K38A 5FEWA 3G1DA 3GDLA 4GA8A 4IPPA 2X0YA 4F9DA 3OJGA 1WBJA 3O06A 5D38A 3H2NA 4DWDA 4BQ5A 3A23A 4JEQA 3S3GA 1IF2A 1E6PA 1M41A 5E09A 3VIIA 3TN5A 4LYPA 1JCLA 3CLMA 1GQKA 3R2GA 1M7JA 3MZNA 4PMXA 5DBUA 1UUOA 4ADSA 4QJ3B 2Z6JA 1OFAA 2W27A 3DHPA 1UJPA 1ZFJA 4NAFB 3RCYA 2D73A 2ICSA 1H5VA 3M4HA 5J5RA 3MP4A 3W01A 1E1CA 3M0KA 5CJ5A 1E6RA 1ESWA 1TV3A 4RDYA 3SY8A 1V3LA 5IXEA 2Z28A 1UR3M 3N6JA 3GFXA 4IFKB 4DZAA 5A6LA 4GMEA 3AYVA 1JUKA 4XZ9A 1T5AA 3GNDA 4W8AA 2TAAA 1TV7A 5BXRA 3BTNA 8A3HA 2PAJA 1NWUA 4YU1A 1XGZA 4AD4A 4E8GA 3N6QA 2D3LA 3M0VA 4H3DA 1E9IA 2ZRZA 5FF0A 4MZ1A 3WL1A 2XHYA 3AFBA 4XK2A 1BHGA 5EY5A 2OMAA 4N9BA 4OKDA 3W22A 2DFAA 3ONBA 2QUTA 2WHMA 3DC0A 2A5HA 4LUJA 2BX7A 5H8PA 4L9YA 3I4KA 3IJLA 4U28A 3UXLA 1K4GA 3KVLA 4GISA 3PSVA 3EDJA 3FKKA 3LHVA 4GK8A 3GM8A 3M9YA 1V4YA 4CN1A 1DKWA 3VNMA 1BTCA 1VYRA 2WZMA 1PX3A 3WLHA 4S3KA 3ITYA 3INPA 4PFMA 4ZQOA 3O0FA 6TIMA 1EC9A 1DQWA 3F1QA 5EMJA 1SM9A 3PUOA 1W56A 1RLDA 1XSJA 3UYCA 1XIJA 3AMCA 1XQKA 1JXKA 1G9HA 1V79A 3GG7A 4Q4MA 1QOQA 1NY1A 2CLEA 1WXJA 2VFDA 2V5CA 4E4UA 3VOGA 1EDQA 4IIBA 2FFCA 3UG4A 2PEVA 3HFYA 4JKLA 6ENLA 3TFCA 4IGNA 1E1EA 2OLAA 5LA2A 4C6KA 1LJYA 4L9ZA 2PP3A 3FIGA 2B7PA 5CPNA 3LYEA 4UTJA 4IG2A 1VH7A 4KCUA 1EB3A 4CQAA 4C5ZA 1YKWA 2NSXA 4HA3A 2EO7A 5CBBA 3G1SA 4H9UA 1J0ZA 1KQZA 1TV5A 2YCLA 1V02E 1KBBA 4JYDA 4QR6A 4DX3A 3SQMA 2V5BA 3WJSA 3CBWA 3A3WA 1FCVA 1O5KA 1MDRA 1JZ7A 2YGYA 3H70A 3MT1A 2WPBA 1MO0A 1KM1A 2C0AA 2X1SA 4PH6A 2QMJA 3KW3A 2OXNA 3G1YA 1E0VA 3NZRA 3RMEA 5D4YA 3S42A 2G95A 4LRSA 4V28A 1KFKA 2BODX 3WX7A 3U4AA 3GVQA 4FLQA 3L0KA 3WLTA 1JCYA 4TXEA 3V5FA 1YDOA 5DCBA 2OZ8A 2QW5A 4PCFA 3TP4A 2ANUA 2NT0A 2VT0A 1A4MA 3G3DA 5CZSA 1BPLB 5G5IA 1SO6A 4IIHA 4G9PA 1DE6A 3U8GA 4PYSA 1GZGA 4I9JA 4UTIA 3VKCA 5I03A 1XDJA 4AYSA 5C55A 1EO7A 4J1OA 1KGWA 3B3DA 5FACA 3VDGA 2HROA 2HS6A 1PHQA 4OZOA 5I7GA 1L8NA 3MHFA 1OG0A 2PDUA 2YL6A 4X9YA 5U7SA 2P0OA 1PIIA 1UKPA 1ZL1A 3M7WA 4KCWA 4L4PA 1C93A 1E5NA 4XKYA 5ABGA 1CPUA 3IVUA 2ZUTA 3W7JA 2VYOA 4LXFA 5FSDC 1JDFA 3RDKA 5LNUA 1GOKA 3BLOA 4W87A 4UZSA 2HBXA 2O92A 4HSHA 1YW1A 4PTMA 1SVDA 3UY8A 1GOQA 4AWUA 3DOPA 2A3HA 4OU1A 1JJKA 3QZEA 3BLKA 2Y4SA 4R7OA 1I0BA 4E4FA 3LI1A 4RDZA 5HJLA 3PZOA 3APGA 2OZ3A 2XFYA 5K4ZA 1OZMA 4URIA 1GKPA 1PL9A 2PPGA 1TMHA 1VJSA 3D46A 4QSFA 2B31A 2J7CA 1WOBA 4CCDA 4O1DA 1XLKA 4FI4A 1P0DA 1IIHA 1HJWA 2FVKA 3FSTA 4B90A 4DYJA 2QCMA 1GG1A 3HJEA 3IIZA 4S3AA 1UMYA 3NWRA 3PJXA 4K37A 3T0AA 1HJUA 4E8CA 1A5SA 4WR3A 3VZZA 1RXOB 1R3WA 1BRLA 1JRBA 3C3UA 4S38A 1DPMA 5HNTA 3SN4A 4XX6A 4H8UA 2OEMA 4RE3A 1OB0A 2I5GA 1T8XA 3ES8A 3SUWA 1QK2A 3V1PA 2WQPA 4RV3A 4EPKA 4IFRA 4N9CA 3CHVA 4LGXA 1GYMA 2QAFA 3WY1A 2Z1VA 2WB5A 5B7ZA 3UU0A 3VK5A 4DO7A 2VWTA 1TJRA 4N9EA 3E0WA 3S5ZA 3PG9A 3H2FA 4DBDA 3AYRA 1C91A 2ZE3A 5CGMA 4AZ5A 4O0KA 3AZSA 4KIEA 1WDDA 1X8CA 4PMUA 2C1IA 2ATMA 3PG8A 2ZZ5A 3NR0A 1ZSXA 4GBDA 2QMKA 2J7EA 4Q7IA 3CWOX 4M80A 4DM1A 3W27A 3LDVA 1XLJA 1RBAA 4W93A 4JGDA 4RX0A 9RUBA 1AODA 4HIBA 1PVNA 4JTRA 1RUSA 3LGEA 1WXYA 1F8IA 4DLMA 3VOIA 2R24A 3E96A 3NFUA 3SECA 4DYEA 2Z7GA 1UR1A 3H26A 1DIKA 4FLRA 1OBAA 4JYEA 5G4HC 2AL2A 5D37A 2WAGA 2P50A 3B40A 3AMKA 5IBXC 4QE5A 4B5VA 4CQCA 1JNEA 1GVIA 2PU0A 4RR4A 3MDWA 3Q4DA 4DUXA 2OR2A 1XP3A 3MWAA 1A5MC 2VR2A 4GINA 2X41A 1C8VA 5GNXA 1CGWA 1XINA 3OYXA 3ATYA 1FBAA 4KH2A 1GCYA 5TAOA 4LBRA 2VDHA 3UNDA 4IF2A 3HQOA 1OABA 1QWKA 3BAIA 3KOZA 3AC0A 3H2MA 4LEQA 1KM3A 4IMFA 5GNZA 5REQB 3UCDA 5I23A 3M16A 5DXXA 4AZ7A 2DQWA 5GQBA 1XW8A 1B3VA 2GSHA 4C1NB 3CYVA 5FAJA 4JTIA 4JY8A 3IV3A 3E3HA 4H41A 3CPGA 5F1VA 3PTKA 1W54A 4GZIA 4BI7A 3WFLA 3UBPC 2QCFA 4UTTC 3CIXA 5BZAA 4G7FA 4AUBA 1CGVA 3B9OA 2CHRA 1U2YA 4FB7A 1BG4A 5C2XA 4OBSA 1ZP3A 3LNMA 1F07A 4L6HA 4IGHA 3W1TA 5TQLA 2HVNA 2I9EA 5FSEC 1O94A 4GGBA 1TV8A 3E2VA 4AD3A 4P7RA 1OX4B 2FPTA 1OINA 3FA3A 5HBFA 2WOQA 1V6TA 3CU2A 2QJJA 1KFLA 3MKCA 2Q8LA 3A3XA 4GQRA 1HP5A 1M65A 1H49A 4J5NA 3QHNA 1HZYA 1OYAA 3FXYA 3WBWA 1KD0A 3PY2A 5CC5A 4L61A 4CCEA 4QISA 3FK4A 1KCLA 1F6KA 2Z4GA 3PBYA 4NNAA 3W73A 1EXBA 3ZZ1A 3ZT6A 4LUSB 3ANVA 5HQLA 4QDMA 4R33A 4U3CA 2QVNA 3KZSA 1Z69A 4BHYA 5CXPA 4O1BA 3KRBA 4GVFA 1N7KA 3HGOA 3CB8A 4J40A 4YTUA 4FNUA 4E2DA 1TWDA 2PDYA 5FCZA 1VCFA 3CXOA 3NGFA 5CH9A 4UQEA 3NO3A 3P80A 4QXIA 3AXIA 3MPGA 4PCPA 4MJMA 1G01A 3W6MA 2HBVA 1W31A 1RCQA 4R9OA 1Q8AA 2X1UA 3MSDA 3TWAA 1E56A 4KGJA 1M53A 3V75A 3CO4A 5CSSA 3FW6A 1B3OA 3LM3A 1KB3A 4ML9A 5T9BG 4QAWA 1TPB1 1W9PA 4H6KA 3VGDA 3N6HA 1J2BA 3UQNA 4S1FA 3AI0A 1DHKA 1LT7A 2PS2A 1HT6A 1P43A 6REQB 1RLCL 4OT7A 5AN7A 2G3IA 2Y8VA 1SFLA 4IIGA 1XIFA 1Q6DA 1W37A 2CBUA 1LL6A 4MWAB 2Q8XA 4W85A 1GEQA 3MANA 3QTGA 2VENA 2YYUA 1AZ1A 3KS6A 3WLOA 5DMYA 2V67A 3A12A 5JU6A 5BU9A 3GU2A 1LLWA 5GVJA 3TAOA 4JTTA 1C9WA 1BYBA 1WQ5A 1ZGDA 1KM6A 4J2MA 4B3ZA 3WF1A 3ORWA 3QZAA 3H2EA 4HPHA 4O1EA 2R1LA 3MP3A 1AUSL 3U5UA 3UJEA 2AGKA 2FJKA 2HEJA 4JTCA 1L6YA 1JDEA 4MNKA 5AC4A 4UNIA 4H2CA 4KWVA 4O28A 2FTWA 3G0XA 3TC3A 3VKJA 4ZQNA 2WHLA 1RPXA 1BSLA 1S5WA 1TMQA 3DG7A 2QCGA 3L4TA 3K5XA 4XIAA 2WSPA 5D02A 4UTMA 4J27A 1AZ2A 1FKWA 2HV5A 4BKNA 1M68A 2A3EA 2VC7A 1DXIA 1W9XA 4DAFA 3VIPA 3RK8A 1JVNA 1KR1A 3TLQA 4G7EB 4ZQPA 1VFLA 4I7UA 4UCFA 2BLEA 5H2ZA 1UZDA 4PA8A 2J24A 4C6LA 2BSLA 1Q6CA 1YQ2A 2YDQA 3VDCA 4DWSC 2J25A 3LCWA 4GG9A 2Q6ZA 1Y8BA 2EPLX 1VBJA 3TYZA 1DJYA 1S38A 3SBFA 3S2LA 2GL5A 3KM8A 2V3GA 4PUKA 3LCXA 2HSAA 1KRBC 3QOMA 1P6WA 1WX0A 4IFKA 4KIRA 1HW6A 3L0NA 3TQ0A 3ABZA 2XTKA 3FSUA 2ZZ6A 3W2LA 3D0CA 4HZ7A 3P84A 1C7SA 1LQ2A 4IPJA 2P3ZA 2PRMA 4TUFA 1XBVA 4WX2A 5FF4A 1ZS2A 4H7CA 1O1ZA 4O1AA 4NQ1A 2VMFA 1LZOA 4WXYA 3T6CA 1V0LA 1XDMA 4HU3A 2E9LA 3QKZA 3UVIA 3B8TA 1DIEA 2A7RA 5D2WA 3EWWA 1H3GA 1I75A 2INEA 4V15A 4GVGA 2EPHA 2WSQA 1A3XA 1UQZA 2ZCGA 4FAMA 3UETA 3CMGA 2V6AA 1QOXA 1W2PA 4BQ2A 5M5DA 1KLYA 1QR7A 3BGJA 1ZJHA 1XLIA 5E0FA 1KKRA 3NURA 3LMYA 4L5ZA 3MMWA 1K9EA 2KX9A 2SFPA 4DBUA 4U3AA 4TX6A 3MI3A 1BFNA 1LL7A 3FCPA 2H6RA 3N25A 1MYRA 1FFQA 2P8BA 3ARPA 2EPNA 2FVLA 3NZPA 4P5UA 2OO0A 4M1BA 4MWAE 3KL0A 4UQAA 2QUNA 2BY1A 4ICMA 3S1VA 4U4MA 1E0TA 1C90A 5M1TA 1SFTA 1FCBA 4QQUA 5JH1A 3T4WA 1OGGA 1I4NA 1AQHA 3H4XA 3N9KA 4Y8EA 2NQZA 3DH7A 3RITA 1WAWA 1J0KA 1XC4A 5E5CA 4O12A 2RJHA 4W7UA 4B5XA 4JL1A 3WH6A 5E6ZA 3JRKA 5AB3A 1R7OA 4WDWA 4RJEA 1DHPA 3U3HA 3I68A 5EGRA 4JQ3A 4D8AA 4YTSA 3E5BA 1EJVC 4GXWA 1DJXA 2ON3A 3WBAA 4HMEA 3QEZA 3VDAA 5CPMA 2PLCA 2XGIA 3FEQA 4QROA 3W7EA 2ZDRA 3GH5A 4FZIA 4F0LA 3O6DA 4NZFA 1TRIA 3PZQA 4ZL1A 1DIDA 3R11A 1Z8AA 3WF2A 3GUWA 1VS1A 3N9SA 2A2IA 4C6PA 2WC4A 1S2TA 1J6PA 1ITCA 3VM5A 3CASA 2G5WA 4RZBA 2YSWA 2BV9A 4HPNA 4ACYA 1ZENA 1TSIA 4DJFA 2DZUA 3A5VA 1MUCA 5DMMA 3K8KA 5JQ9A 4WHBA 3BLPX 3LCHA 4N6EA 2BXVA 3PNUA 1C92A 2J47A 3PB0A 2Z1KA 4ZO6A 5REQA 4C6OA 2X7WA 1KNWA 1US3A 4Y7EA 3ZR4A 4RL3A 3NQ7A 3ZOAA 2NUXA 5A69A 3AMDA 3H8AA 4KBXA 4JKKA 1Q6GA 3MZ2A 1E15A 2FB2A 3DG3A 1IT8A 4MPKA 1XG3A 4FNRA 4NAFA 4HOXA 1HKVA 4DLFA 3OHIA 3TJXA 3USZA 4ACZA 4GO8A 2X30A 1ME9A 4HNTA 4UTWC 4F0MA 4AFYA 1UZ4A 3VOHA 2J77A 4FA3A 4CGTA 4I3GA 1CWYA 3M5YA 3LSCA 3VM7A 1W17A 3CWNA 4EWND 4GUHA 4J3TA 3ONCA 3MYPA 3W86A 3EWBX 5CJMA 3W1NA 5HR6A 3KE0A 1VD6A 5HWNA 3UXKA 1UWSA 2WJZA 4KRTA 2J7DA 2NUYA 4DNMA 1GORA 5C9RA 3N3MA 3A6OA 4GLEA 3TQVA 2PDCA 3TROA 2GOUA 3M47A 3KBVA 2GQ9A 1FWWA 3ZWTA 4JX5A 3T2OA 1KCKA 1T40A 6ALDA 3GHRA 4LUTA 1E1CB 2D24A 2QHAA 3O63A 3OP2A 5CZ0A 1BKHA 1UBPC 1S2VA 3BC9A 3ZJKA 2WSYA 3VGBA 5C7VA 1QTWA 1WKFA 2YIHA 3CUGA 3V35A 1SZFA 1XBXA 2ISFA 2OVLA 1NFPA 3ZMRA 4NZ3A 1KRMA 3LHUA 4Z1DA 5HMSA 1Z7AA 4WZHA 3OU8A 1QPNA 3H24A 1H1ZA 3A9BA 1A5KC 4JDBA 3UG5A 5JBFA 1IIGA 4XISA 2C19A 1FWTA 2DUXA 2GWNA 3NCOA 4L4LA 4OGZA 3UXDA 1D2KA 2P3EA 2XM2A 5AC8A 1M03A 4Q8NA 2PCEA 3WNOA 4B91A 4N6FA 3P82A 3W0KA 3OQEA 3HQ1A 3KTSA 1A4LA 4RNFA 2F6KA 2J13A 3LTSA 1RP8A 2XH7A 1TWZA 2VXNA 5AHFA 1XYBA 3APYA 5I3JA 1N8WA 4UR8A 1UG6A 3RLHA 1J9YA 3N15A 2VC6A 3S5OA 3AAMA 4XQ6A 1B54A 5XINA 1EF2A 1XISA 3DFHA 2FH8A 1JRCA 3PZTA 3UGRA 2NW0A 1LRNA 1H5YA 4RW3A 1MFVA 1V6WA 1YPFA 1GEHA 1VBGA 3VVGA 3I7SA 4V2XA 3C0LA 3DFPA 3NL2A 4JFUA 3N2TA 2OYMA 2HPIA 4E4PA 4OIFA 4CVUA 3L21A 4H6RA 3QTPA 3A9IA 2CZEA 4OV9A 5CZKA 3OG2A 1YADA 3OVRA 5A6SA 4BI6A 2J79A 2JKEA 2ZX8A 4J35A 4UFLA 1XL9A 2FHCA 4MMWA 1CGXA 4MWAC 4MNLA 4FXFA 1XHGA 1GWJA 2NXGA 2PODA 5AVHA 3WD3A 2G41A 1RA0A 3TXVA 4J9JA 1TJ0A 3S6OA 4FX7A 5C7HA 3LQLA 1X7FA 1U1JA 4PMOA 3BSMA 1JAEA 1WZAA 3N3TA 1V0KA 1FWAC 1ISVA 3AWNA 3GWQA 4LTSA 1UR4A 4ES4A 3GAKA 3IARA 3GG1A 3C8FA 3QRHA 3EPNA 4N2YA 5D2XA 4AD2A 3M0ZA 4ATWA 3OO2A 3PUEA 3V0SA 1R5YA 3E2QA 5CAKA 3W29A 1VLIA 4QRNA 1QUMA 1LQ0A 2WZTA 1BYCA 2OG9A 3W28A 3HG3A 3BCJA 1N55A 4CEUC 1VRXA 1XIBA 4MYXA 1QVBA 1XRVA 4C7DA 1TWWA 1L8PA 4EOUA 1GJUA 3L4ZA 4HA4A 1LQAA 3QPYA 2C1GA 2DGAA 4HU4A 4PUMA 2PZ0A 3CJPA 4Z0SA 2ISDA 2Y89A 1VEOA 3WQEA 1XUZA 4RPQA 4DZHA 1RQBA 3EGJA 1JFHA 5DF0A 1LDCA 2A1YA 2C3ZA 2A0NA 3KVMA 1OX4A 5EKYA 5C2GA 4MY1A 1FWNA 2F9RA 1LG2A 3F5KA 1Y5VA 2JQXA 4WLCA 3H21A 2FTYA 1GT8A 2WLYA 3RG6A 5BRQA 4QITA 1CT5A 4F0KA 5LNRA 4IMAA 4DZ5A 3P2VA 3DBNA 4QJ5B 4QAIA 2GUYA 2GSEA 3NSNA 1DEDA 4HJWA 1B31A 5BWAA 5CPQA 4LBUA 3S2NA 2A21A 3DG6A 1TELA 2J8TA 2BZNA 4NIRA 2IS7A 1ZAHA 3KBMA 1QU4A 3MU7A 3ERPA 3CL7A 1SYTA 3L4WA 3H54A 4HHHA 4LS2A 3QN3A 3W7OA 1T8QA 1E6ZA 3ZS4A 2PLMA 1XYFA 2CZVA 4UMAA 1UROA 3K1DA 3BDKA 4FXJA 3PS7A 3SI9A 5GPRA 4WY0A 2XM1A 1GYLA 4IPNB 1ML1A 4NNCA 5LKYA 4MYAA 1Q7ZA 3THCA 4PTVA 2EBNA 2BB0A 3JS3A 2ZA1A 3O15A 3ZSSA 3B8SA 3PBMA 1EKOA 1U1UA 4KPLA 3E5PA 3UZ5A 1G5AA 4JBRA 3PZNA 1WPCA 3GTFA 4H7VA 3K46A 3TTQA 3E0FA 3VMPA 8TIMA 2ZC8A 5KZ6A 4OWGA 2BOGX 1GJPA 3S4TA 5I3FA 2C15A 5KETA 2WSRA 2D2OA 4JXCA 4HCHA 1LBLA 1G94A 3KL5A 5JBDA 1ADDA 1E4LA 3HMCA 2YLLA 4IMDA 5HINA 5I3DA 2CZDA 3CB3A 1K1DA 3VKDA 2VCCA 3PANA 1Y7VA 3GXTA 4PMVA 5TIMA 1F61A 2ATSA 3P3BA 4O52A 5DRIA 1JDCA 1Q63A 4JICA 1H1YA 3P93A 4AY7A 1NU5A 2BXZA 2UY5A 5IRPA 1VYPX 3UZZA 3R0DA 3EB4A 1A47A 1GPWA 4Q4QA 1VZWA 5C71A 4PULA 3KZPA 2V81A 2HK0A 2PTYA 5F7UA 4O15A 2CIPA 3L4VA 1VB9A 3GS6A 2VKZG 2OEKA 3UYIA 3A3HA 2J88A 5LIYX 5LNWA 1U5HA 4Q4RA 3GTNA 3QJAA 4JIRA 1S3HA 2NWSA 4O18A 1QOPA 3F5LA 4G7EA 1DXEA 5JIWA 4Z2GA 5CKSA 4ZXOA 4PCTA 4GPNA 2VDIA 4S3DA 1KW1A 1LLZA 4CD6A 1CLXA 3GIPA 3TFXA 1UBSA 1K03A 2OPJA 3W85A 2V38A 4ZB0A 3NL6A 2XSXA 2JEQA 5D8ZA 4XKMA 3M0HA 4TVDA 3M5VA 4I5RA 4GNVA 1UQYA 3LPPA 2PDWA 4YTTA 4KW2A 2OKOA 3AZTA 1MEIA 3V5OA 5HQEA 1PCKA 2DZVA 1W0MA 4QCFA 1R87A 1TVNA 1AD4A 4RKAA 1DJZA 3HO8A 1GVFA 2F84A 3EWDA 1TX0A 4JL2A 4JNYA 4PODA 3CV7A 2P1FA 1W3IA 4WQ6A 1A5BA 3VFLA 3UJSA 1DWGM 5MHBA 2VFIA 1X98A 3OIHA 1E0XA 5I3HA 5MKGB 3N12A 1YIXA 4ADTA 3RU6A 1O6IA 3W26A 1S2WA 2QLYA 3ANYA 3RRAA 1EX5A 3R5EA 3LBOA 3V18A 4OECA 4IP5A 2H8XA 3VA8A 3F2BA 5C54A 1VFSA 4B15A 1F4HA 5KMYA 3SGUA 3N4AA 1YDNA 2IPJA 5G4EA 2OOFA 5C9WA 2XDFA 1AW5A 1Q2RA 4M0XA 2TYSA 3BL3A 1S5VA 3KX6A 1H0IA 2A6LA 4HBKA 4NYYA 4UTUA 3MBFA 1MXGA 3HG5A 3FGCA 4NJGA 1VFOA 5AZ0A 2GLKA 2BHUA 1N2VA 4QLJA 4F2UA 4GACA 4QS5A 4GUJA 3RAOA 1V02A 1ZBWA 5A5WA 3K13A 3RX2A 1QNVA 3ARRA 4L9XA 1YBQA 2FZBA 2I7GA 3T78A 1OYBA 1TFVA 5I0DA 3VCCA 3NDYA 5A8GA 1NF7A 1TMLA 4UMCA 3V0TA 4E5TA 2YW4A 4QE1A 3HPSA 1R9ZA 1EXPA 3GYCA 3PZGA 5D05A 1J6OA 3GQYA 3OIXA 1JYNA 3CZJA 2BWGA 4FX6M 3WLNA 4RV8A 2NQJA 2QGYA 2B81A 3EBVA 2OZ0A 5DXYA 5K3VA 1D8CA 4PGLA 3PUGA 3AHXA 4PB3A 1GYNA 1JQVA 3UT0A 1PKYA 1W5PA 3QV6A 1NIUA 4H9TA 1J2WA 1XLMA 1UW9A 4KWUA 3MYOA 3SN1A 4IL2A 4XZMX 3NM1A 4ALDA 4JX6A 1XYLA 1G7UA 7ODCA 1L6GA 1BVNP 1JZ8A 1HVQA 1Z48A 4DBEA 3LXBA 1VF8A 4YVPA 1MW1A 2P53A 1K8ZA 4Y6GA 1D8WA 2WNZA 5AOUA 2RFGA 2HWGA 1WUEA 3TU9A 3M41A 4I9AA 1E70M 3SRFA 1PHWA 3EMQA 2NVAA 2CLHA 4PCSA 4P7LA 3R58A 3MHGA 1NWSA 1OIFA 1EPXA 4L7ZA 5FJJA 2B4GA 4P8VA 4CNUA 1GOIA 3NQVA 3P5ZA 2PMQA 1KBJA 5BWFA 3PVFA 1EJXC 4ACZB 5XIAA 2CESA 3L68A 1BTMA 1OF6A 1ZQ5A 3WKZA 2BVYA 2GK1B 2QCLA 4OHQA 4O1CA 4PE8A 3OLEA 4JIIX 5KZDA 2YCEA 3PZUA 3W2UA 4GC3A 2A3CA 2GVEA 1R86A 3PZMA 1F3WA 3R89A 2CXEA 4OOZA 4AZGA 4C6NA 5JVLA 3MI2A 1RHCA 3W07A 4JAWA 1MEHA 2GUBA 4H6QA 2A6NA 3H7UA 3KVJA 2IKJA 1KA9F 4I9MA 2C0HA 2C8NA 1QNOA 3GDTA 2CEQA 4HSOA 2ZXDA 3W7DA 4UQCA 1J10A 3TYEA 3CEPA 1HJQA 3ZJ6A 1OC5A 5CG7A 3IIXA 3CV2A 2GJXA 3HMJG 3AJ7A 2Y85A 5JXQA 1H50A 4US6A 1KQYA 5I07A 2Z00A 2VZVA 2YX0A 5J04A 1SFJA 2GGGA 4A2SA 4TOQA 3WQFA 2BHYA 1R47A 3TTOA 1DWHM 1RPKA 4C65A 3HPAA 4QLKA 1POJA 4XO7A 4NKCA 1QHOA 1LORA 4FS9A 1KGUA 4IT1A 4AVOA 3FYYA 2XIJA 3E1F1 5DMNA 5BNKA 3KCOA 3BG5A 4Q4SA 1FX6A 2DPEA 3QLLA 1ONEA 1DQXA 1ZALA 2XVNA 4EXAA 3TMQA 1RALA 2XYLA 2YA2A 3DENA 4FR1A 4UOZA 3ARSA 3G1AA 1ZJBA 4PTNA 1PYMA 2DORA 1X1NA 4HNCA 2J9YA 4X60A 4B5SA 4H00A 1L6FA 4K36A 3OW1A 4WGHA 3ZLGA 4KS0A 4W9TA 1QNQA 3V36A 4R34A 3GC5A 4H6EA 2OSYA 2PWEA 3CM4A 3J7HA 2OLSA 3WLQA 4YXGA 2PDJA 2IQDA 1XLEA 3VD4A 3SQSA 4JTQA 3T07A 2YBUA 4ZOCA 4GJIA 3LY0A 3TYUA 4NZ1A 4L65A 1HL2A 5FKYA 3R8RA 3WLMA 4LVGA 2GVJA 4W4QA 2QJMA 1TX2A 4KF1A 3L5AA 4PC8A 4JIHA 1HJVA 3AYTA 4AG0A 1LP6A 4ZQMA 1NDZA 2Y2WA 4A8RA 4HYRA 3BAYA 4O16A 5LNVA 3SO7A 3R12A 1EP2A 2AAAA 1DVJA 1I2PA 3ALGA 2FDSA 4Y9NA 1BAGA 1QNSA 1NOUA 2NQHA 3EOLA 4GXPA 3NOYA 1TPFA 3FYOA 3GLCA 4C60A 1XSKA 1GVQA 1JYWA 3KRUA 4V33A 2I57A 1QASA 1UH2A 5T9CE 1IZJA 1FVPA 1A0CA 3AIUA 3L2IA 4YVVA 4KCVA 1EO5A 4DHGA 3PNZA 3N19B 4LH8A 2VX4A 4N9DA 3LLXA 3WNLA 1FHVA 3DHFA 3TN6A 4IL0A 4A3YA 3VX1A 2AL1A 3IV8A 1B30A 4NT0A 3OBEA 4D1IA 3MMUA 2ZVRA 3IS4A 3R8GA 2EPKX 2OYLA 3KEHA 2W92A 3FHAA 4BF7A 3R4IA 5CLTA 3WDPP 3VGEA 2WCAA 2FYMA 1H61A 5HXMA 1VJZA 1F3TA 3LCGA 2PDFA 4DF2A 1BQCA 3GC4A 4GGHA 1VGAA 1JPMA 4D6HA 3GXNA 1B5TA 1HX0A 1B9ZA 2AKZA 4IMGA 5A6KA 4P7QA 3S0CA 2BDQA 4LS0A 2XFWA 3VNZA 3WQ8A 4ZTYA 3E9AA 3MY9A 3RHGA 2QXWA 4BEUA 1XIIA 2EJ1A 4NHVA 4PB5A 4MF4A 3T1GA 4NSBA 3UA4A 4A8LA 3DFOA 3K30A 4ZVJA 5A8NA 2Z26A 4JCLA 1FQ0A 4LB4A 4LU0A 1VJIA 4I6KA 1UASA 3AS0A 1HQTA 1E9ZB 3F2CA 3IK2A 3QGVA 7REQA 4PUEA 3VOCA 1F2JA 2ZC1A 3RN6A 1EGZA 1QWGA 3OQ8A 3VZYA 2PP1A 5FEXA 3G2GA 1J4EA 1LWJA 4GC4A 4GQBA 4OBRA 3TCSA 3NEHA 2QZRA 1R6WA 1U30A 4PBEA 2QS8A 1A5OC 4GD0A 2FPVA 1Q4NX 3B8IA 2XVPA 2DP3A 4MVAA 1FWFC 4UC5A 3LENA 3MO7A 4M81A 1EIBA 4XD4A 3TK7A 3LI0A 3RX3A 4KKXA 4O0QA 5I3IA 1CXIA 4EE9A 4NXSA 2ACUA 5HWJA 2ZFAA 2VCAA 3ITOA 2YJQA 1H7RA 3QHOA 4NZCA 3IJIA 3OTRA 4FF7A 3W2MA 1XSIA 4Y2WA 2E9BA 1M1BA 3EOOA 1G6CA 1QW7A 3W7QA 2ZTKA 4MSSA 1GW9A 3ATZA 1IEXA 4JIEA 3KUMA 1VFUA 3BLEA 1GG0A 3K4AA 2GFTA 1OFEA 5ECVA 1KC7A 4IWWA 3GNXA 3C2EA 3SN0A 3HTWA 3A64A 4KWWA 4U2YA 1ZJAA 5F2GA 4F66A 1QBAA 4P8WA 4ERGA 1X97A 4CNPA 4JOMA 4GCXA 1WE5A 1EA9C 1CNVA 1Z32X 2WMIB 3LHTA 4PN2A 3VTRA 3U2ZA 2O7QA 1OC7A 2VQTA 5AKQA 3VDBA 5ABFA 3Q45A 4MKNA 3LXAA 3WYZA 4QG8A 3VOFA 1TZZA 4EIVA 3GH4A 4DUWA 1AMKA 3LZ3A 1XIMA 2FFIA 4AIOA 3MUIA 3D5HA 1QHPA 4B4HA 1FWHC 3B8WA 1QI4A 1TYGA 2VZSA 3JR2A 1GHRA 4KFNA 1NVMA 4I5XA 3WJZA