1YHVA

Crystal structure of pak1 kinase domain with two point mutations (k299r, t423e)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
293
structure length
293
Chain Sequence
SDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSEMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLDMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, transferase
molecule keywords Serine/threonine-protein kinase PAK 1
publication title The Active Conformation of the PAK1 Kinase Domain
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 293
sequence length 293
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1yhvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1yhvA01
4G3DA 3TUDA 4KKEA 3ZS5A 3PIYA 4E4MA 3GC9A 3NW6A 3ZRMA 2QG5A 1Y57A 3EQDA 4V04A 4DF3A 1MRVA 3MSSA 4YSMA 3VNTA 2R3QA 2OZAB 3QYWA 3ZFYA 2I6LA 5JZNA 3ORZA 2CKPA 3H9FA 3UC3A 5IQAA 2WMRA 3LIJA 5EYCA 5DR9A 4I4EA 4FKJA 1BMKA 4XV2A 5TF9A 4GT5A 4RWKA 3N4VA 3MPMA 4EJ7A 1YHVA 3RNYA 2J2IB 3NW7A 3PXRA 4G6NA 4QMVA 4U8ZA 3DDQA 3U6HA 2JITA 4FTCA 2J50A 3FDNA 1OM1A 3FL4A 3D14A 4FV7A 3G5DA 3HDNA 3R8MA 3NSZA 2RIOA 4TT7A 1BL6A 1DAWA 4J1RA 4MVFA 3K54A 4RJ4A 2YACA 1H08A 3WBLA 4FTNA 1ZY5A 2XK8A 4XOYA 3TZ7A 4DHFA 3KXZA 4USEA 4BIDA 4TWPA 3MIYA 4FKRA 2UZNA 3U51A 2X9FA 5AMNA 4OTPA 4Q5HA 5AV4A 1YHWA 1GIIA 4FZDB 4HZSA 4E5WA 1H1WA 3QKMA 5AUVA 3W2CA 4IW0A 5BMMA 2XRWA 4ZAUA 4FSNA 4EK6A 4IXPA 3LKMA 4R77A 3OEFX 4JRVA 2VO7A 5CU3A 1J3HA 3F6XA 3F3UA 4EUTA 4WBBB 2B53A 5KKRC 2WNTA 4O7ZA 4ZY5A 3ORIA 1M17A 1CM8A 4YUQA 2WQBA 2F2UA 3SW7A 4WG5A 2VTHA 4GH2A 4ZTMA 4FTTA 3LCSA 3Q32A 3RPVA 4OTHA 5BUEA 3ETAA 3SV0A 3U4UA 3ZXTA 4O7TA 4YC6A 3PG3A 4I24A 3UIXA 3UOJA 4LL0A 4UY9A 1KE8A 3HMIA 3ZC6A 1KV2A 2ERKA 2G2FA 2QOOA 4KRCA 3P0MA 3PIXA 2W06A 3KRRA 4NKSA 4HCVA 5M4CA 4W9WA 5BQ0A 3TUCA 4QTDA 4GW8A 3O7LB 3NUPA 3QC4A 2H34A 4ERWA 2C6MA 4QMOA 4FIIA 5EKOA 4LRMA 2HIWA 3MW1A 4EC9A 3P23A 5LVLA 4OBOA 3IKAA 4TKSA 5FEDA 4AW2A 4ZY4A 1ND4A 4FT3A 2OJ9A 4C4EA 1FVTA 3F5GA 3QGWA 3W55A 5FDPA 4LG4A 4AZWA 2ZDTA 3DQWA 1G3NA 1QPDA 4OTGA 5E1SA 1WBNA 4KWPA 2FSMX 4RA4A 4E4NA 4NH1A 3C51A 3VN9A 5A9UA 3UIMA 4NFMA 3LCTA 3MTLA 5F94A 2O3PA 3OOGA 4IVDA 2O8YA 5CS6A 4ANMA 4DC2A 2AUHA 4FGRA 5BYYA 3IW5A 4CFNA 2UZDA 2PL0A 3P1AA 2UW0A 3NWWA 2OF4A 4XH6A 5AAFA 3M2WA 2V7OA 1ZOEA 3OUNB 4C59A 4HVHA 3G15A 4E3CA 4UYNA 3LJ0A 3MV5A 5J5TA 4O86A 2QR7A 3GOKA 3O8UA 2PYWA 3I4BA 3MA6A 5DR6A 4IAFA 2R0IA 5E91A 2J0KA 3BV3A 3P79A 3PG1A 3TKIA 3PZHA 2XNEA 3OC1A 4GS6A 4YZMA 4EOPA 5A4EA 4CFXA 3T9TA 3PJ3A 2UZLA 2Y8OA 3CY3A 3QD2B 1Z5MA 2V55A 3D15A 4FIHA 2JKQA 3NDMA 5DEYA 3BYUA 4O91A 3I81A 4Z3VA 1M52A 4BTFA 2OJJA 3IPHA 1Y91A 3REPA 5EDQA 4F70A 3KL8A 4PWNA 3C4FA 3FE3A 4GCJA 4RQVA 5HO7A 3PVUA 4AZSA 4WRSA 5JN2A 4JAJA 2XNOA 4JX3A 4K33A 2W1CA 3LJ1A 3ROCA 4GIIA 4PDOA 4ZTQA 3RK7A 4BDDA 4P90A 3TCPA 4FKIA 4O0UA 1P14A 1PKGA 2EXEA 4FV2A 4OW8A 5CVGA 3W33A 4ZLZA 5CF8A 5HE2A 3KA0A 3BU6A 3R83A 4XCUA 4DN5A 4OTIA 4USFA 3JS2A 3R00A 4F9BA 4H3BA 2XKFA 4E5BA 3HAMA 3G6GA 2C1BA 5IA1A 3R0TA 4GK2A 2XB7A 3KU2A 2R64A 3V5JA 3KY2A 5CF5A 1S9IA 5HICA 3DA6A 5EDRA 4PMTA 1H1PA 3F7WA 4O21A 4B8MA 2UVXA 5DG5A 1NT2A 1K9AA 2J5FA 3Q3BA 4GUBA 4ITHA 3MH3A 2A27A 4A9TA 4A4OA 4X7QA 5CNNA 4A07A 3DDPA 3V5QA 2GHMA 1OZ1A 3R7OA 4FSWA 4FZFB 4L3JA 4C3RA 1JKTA 2NNWB 1OUYA 4I41A 1YOLA 2G9XA 3IDPA 2XYUA 4Z16A 2QO9A 5JFSA 4NTSA 2X7OA 1XH8A 5AUUA 5M44A 2WEVA 3RI1A 3VUDA 3DQXA 3IW6A 3ZZEA 2O0UA 5TKDA 1Y6BA 3SC1A 2FSOX 4I0TA 4UB7A 1PXLA 4RVMA 5JQ8A 2GNIA 2PMIA 3L9MA 2PHKA 4BDEA 2PE2A 4OT6A 1UU3A 4W4YA 2XF0A 4FV5A 3AD4A 4HNIA 3AD5A 2OJFE 3QFVA 4P2KA 1H4LA 2J4ZA 3C13A 3OCSA 4IWQA 5HLWA 5JGDA 4FL3A 3LLTA 1B39A 1FINA 3C4EA 3F5XA 3ZDUA 4LYNA 4UYAA 5HVJA 1BYGA 5CVHA 2QOLA 3FLNC 4BICA 3M1SA 3BU5A 4UWYA 2GS7A 2C6KA 4KA3A 3PRFA 2IVTA 3EN5A 5GZAA 3R7VA 5CI6A 3FKNA 4D2PA 4GUEA 4XLIA 4X6QC 4MWIA 2B9IA 2WTWA 2OI4X 3W8LA 4HVDA 1GOLA 3H30A 3ORTA 2WMSA 5BYLA 4UBAA 4UX9A 5K0KA 1PJKA 5EK7A 5EFQA 2X9EA 5EM7A 3GFWA 2FYSA 3OXTA 4MHAA 1UV5A 3PFQA 3E3BX 3OXZA 3KMMA 4K2RA 5I3RA 2R3KA 3BCEA 5F9EA 2J9MA 2JDSA 5IH6A 3KK9A 4XBUA 4CFMA 3P7BA 3VUIA 4AU8A 2OSCA 3COMA 4F7LA 2BVAA 3D7ZA 3LOKA 4RBLA 3RINA 5KX8A 1Q41A 2WD1A 4JS8A 3RM7A 2XNBA 3COKA 3NUNA 4QPMA 5FTOA 4FKLA 4GIHA 1KE5A 3OCGA 3OWLA 4S34A 2VN9A 3DY7A 4QQJA 5E1EA 5M55A 3F88A 3BKBA 1UKIA 2CCIA 3ZONA 4ZJVA 2YWPA 4XG3A 2BZJA 3LW0A 4YBJA 3CC6A 4AWIA 2BZIB 4L43A 5K3YA 4P7EA 1W82A 2GTNA 5EQEA 3L8VA 2PUUA 4U80A 4WG4A 4C7TA 5IF1A 1OBDA 3U9CA 4DGOA 2UZUE 2WKMA 3WZKA 4WUNA 2XKCA 2YAKA 1LPUA 3AGLA 3OFMA 2DUVA 3TIYA 4B7TA 5ETIA 4ANNA 2QVSE 1YWNA 4ZIMA 5K4IA 3CE3A 3NYOA 4H3QA 4EHGA 2PU8A 1J91A 4NTTA 4CYJA 5E8VA 2Z02A 2FB8A 2Q0NA 1IA8A 4G3EA 4U81A 2XP2A 3VHEA 3FXZA 4EOIA 2W4JA 4O7YA 3O7LD 5KBRA 5FUTA 5EH0A 4WRGA 4XEYA 4I20A 3QKLA 4DTKA 4O7VA 3CBLA 3VC4A 5LMKA 2VO3A 1DM2A 3TTIA 2XBAA 3SGCA 5CEMA 3T9IA 1NA7A 3RAWA 2CLXA 2WQMA 3OY1A 3VUHA 3G6HA 4ASXA 3DTCA 1LR4A 1U54A 2AC3A 2AC5A 3NAXA 1KE7A 5HTCA 4Y95A 5IISA 4GT3A 5KNJA 5FLFA 5L3AA 2ITZA 4APCA 3FKLA 4RC2A 2Z8CA 2C5XA 3R9RA 4F08A 3EN7A 4GU6A 4JXFA 2WEIA 5AUYA 3WF6A 5IUIA 1U54B 3C4WA 5FWKK 3NS9A 2C3JA 4W4VA 5AUTA 2J0MB 4EH2A 1PYXA 2ZDUA 2G01A 4KBAA 3ORKA 3KXMA 1OIQA 4IACA 3CQWA 2HOGA 1ZMUA 2QOFA 3EQGA 5HLNA 1YXVA 3ZM4A 4I5MA 3BX5A 5H8BA 4G16A 2WTVA 3KN5A 3C50A 1GNGA 5D12A 4AGWA 3BHYA 5EDPA 2UVZA 1AGWA 2JDOA 3ORLA 4FKGA 3KK8A 4R6VA 3TZMA 4DGGA 4TWOA 1DAYA 3AC8A 3W2QA 3S2PA 4DAWA 1GZNA 2W9ZB 5L6WL 3AC5A 2VGOA 5GHVA 1YI3A 5EQPA 2WOUA 2Y9QA 3FZSA 4L45A 3L8SA 1OECA 3F9NA 5HE1A 2P33A 4TYHB 3DCVA 4FV1A 3BBWA 4GG5A 4II5A 4BWXA 5LARA 4MBIA 4FNWA 2BHEA 2YZAA 2QOKA 2FA2A 4O7NA 4MXYA 2C68A 3FL5A 3V8SA 4HGEA 4TPTA 3H9OA 2IPXA 5HVYA 3QKKA 3RHKA 3THBA 5IQDA 1JVPP 3PY1A 4BDHA 3IW7A 2R5TA 2BILB 4X3FA 4BKZA 4JBQA 3LFCA 1IG1A 4E6CA 4YSJA 5C4LA 2ITTA 4TWNA 3DKOA 3DNEA 4U42A 3DLZA 4C35A 4FNXA 4L3LA 4E7WA 1J7IA 5DA3A 2OFVA 4CYIA 4EBVA 4EK3A 5CLPA 4IB1A 4JX7A 3ALOA 4L3PA 4ZSEA 5T3QA 2QOIA 3K5UA 5DYJA 2PVJA 5FP6A 4RWLA 1YRPA 4X3FB 4XHKB 2IZTA 2W17A 3E88A 3RP9A 4IJPA 1XWSA 2JAVA 3UE4A 2UW6A 4Y46A 5CZIA 5HG7A 5IH5A 2VAGA 2I0YA 4ACMA 2KTYA 1MP8A 1STCE 3C4CA 2F2CB 2R3HA 3OHTA 3QQHA 4GYIA 4M7IA 3VWAA 2XBJA 4WA9A 3EQBA 2UW8A 5LVNA 5FBNC 3R22A 4BBMA 4O7RA 2F4JA 2VNYA 5IG1A 3BYOA 2FH9A 4AS0A 4FK6A 4I93A 2QURA 3EB0A 2C5VA 3FMMA 4FSMA 4LOQA 3R02A 3L9PA 3VS1A 3ZLSA 4CLIA 3R7EA 3F3ZA 3VBVA 4FSRA 2XM9A 4GYGA 3BHTA 4RX7A 1TKIA 5AR8A 2QU5A 4G9CA 4KAOA 1YWVA 4MXZA 4OTDA 4YZNA 4MQ1A 3MH1A 5AIKA 3W18A 2PVNA 3A61A 3I0QA 5F95A 3WF9A 4BBEA 3UQFA 2YFXA 3R7IA 4KBCA 3U4WA 3VBQA 4QMNA 1JWHA 1HCLA 3EZVA 3HA8A 3QCQA 3R01A 3UGCA 4D9TA 2YLFA 3FHRA 1VJYA 2VTMA 4WG3A 4C3FA 3DJ5A 2R3PA 3UOHA 4F7JA 1WBPA 2HYYA 4IDTA 3G0FA 3S0OA 3QX2A 3D94A 5AR5A 2HZ0A 2FSLX 2Z2WA 1GJOA 4CQGA 2GQRA 3A2CA 2I0VA 4EZ3A 5AM7A 3QCXA 5E4HA 4A4LA 5L2IA 5EM6A 4PY1A 4AA5A 4HNFA 4EH7A 3ENMA 1WMKA 3KRXA 2XVDA 3UPZA 3QL8A 3DJ6A 4I6BA 4YC8A 2X1NA 1BI8A 1O6YA 4XG7A 4FVPA 2O63A 3IW8A 3MH0A 3Q9WA 4ZJJA 4ZSLA 3RK5A 3DPKA 3VUKA 4FK3A 2UW5A 4YO4A 1CMKE 3QTWA 4IDVA 2R7BA 3JR1A 5BVWA 4YURA 1LP4A 4RIXA 2HXQA 4YZDA 4QQCA 4CT1A 3R21A 5AP1A 2OXDA 2XUUA 4JI9A 4RVLA 3PYYA 4UALA 4AUAA 4K18A 4A7CA 5LVMA 4IANA 4IVBA 2B55A 4TXCA 2YJSA 1B38A 2PVKA 3LAUA 4G6OA 2I1MA 4J96A 4RIXB 4YGAA 5CAPA 5FM3A 3L9NA 1QL6A 4UXLA 3I1AA 1ZZ2A 4S33A 4H39A 2ITPA 2BZHB 3CPCA 5C1QB 4UEUA 4PP9A 1UU9A 4H58A 1TQPA 2YCQA 4IZ5A 3VHKA 4MXAA 3LCKA 5D10A 3V6RA 4C0TA 4CKJA 5JMSA 2C0OA 1REKA 2PVLA 1OIUA 2CDZA 1ZMVA 2B9HA 3OF0A 3Q52A 3RTPA 1OL5A 2YISA 4GVAA 4PMMA 4EBWA 2C6DA 2ZOQA 4FT7A 4I94A 5KZIA 3WYYA 3CTQA 5EYDA 3LLAA 4D4VA 3MY5A 3EQIA 3W8QA 3MWUA 4CVAA 2VX3A 3CSVA 2Q0BA 4O2PA 4TRLA 4MNEA 4AN3A 4BYIA 4QMPA 2E9PA 4NM7A 4L46A 5C26A 2I0EA 4QMZA 3C4ZA 2C0IA 4F6WA 1LUFA 3BWJA 2BTRA 4EH3A 1JKSA 3H0YA 4LL5A 3ODYX 1ZY4A 3SHEA 5AWMA 1TQIA 1GZ8A 1CSNA 4LOPA 3AMAA 2IW6A 3HUCA 4MNEB 3VAPA 5IDPA 2YWVA 4DCEA 2Y4IC 3EH9A 4CRLA 2B9FA 4I92A 4JBVA 2O65A 4FKOA 3E63A 4YR8A 5FGKA 3V8WA 3DBEA 5EW8A 3R7UA 3V51A 4YBKA 3RBWA 2QHNA 3VRZA 4DGLC 4I0SA 3OY3A 5HVKA 3PJ2A 3WIGA 4LUDA 3DJ7A 3BYSA 2G15A 2QI8A 4HW7A 4RVTA 1H24A 2CN5A 4UV0A 2W1ZA 4N6ZA 3F3TA 3QTSA 4G5PA 3BGQA 5ACBC 3BHVA 1OB3A 4ZTRA 1K2PA 1H01A 3DTWA 3BEGA 4X21A 4C62A 3NCGA 5J1VA 4N6YA 4G31A 3QU0A 4M0ZA 4XG9A 3DKFA 4BIEA 4B4LA 1MQBA 4JG6A 3TL8A 3O96A 1WBTA 2PPQA 5IKWA 3MN3A 4RC4A 2QR8A 5CF4A 4PTCA 3LMIA 2WTCA 1ZOGA 3CQUA 2GDOA 2X2KA 5HG9A 3UTOA 4S32A 3ZO3A 5KUPA 1ZYSA 5CAQA 2PMLX 4FNYA 5AR3A 5HESA 4FTKA 3RK9A 2XK6A 4CNHA 4QPAA 3DKCA 3ERKA 3TV6A 4QP7A 1SNUA 3E87A 1GIJA 5LWNA 4GT4A 2XCHA 5LQFA 1PF8A 3GUBA 5DRBA 3LQ3A 3RVGA 5HE0A 2VWUA 4U41A 3GCPA 5A4TA 5CAUA 4O27B 3JPVA 5BVEA 2WU7A 3PXZA 2BKKA 2ITOA 1BLXA 3A8WA 3UO6A 3CS9A 3NGAA 4U7ZA 2GHLA 4I5HA 3CP9A 4FNZA 4I5CA 5DI1A 3ZOSA 3CD8A 3RPRA 3MIAA 4LMNA 1FQ1B 5IA2A 2HY0A 3OEZA 3PJ1A 4ZZNA 3MB6A 5FG8A 5M51A 4IE9A 5JH6A 3LFEA 3POOA 1M2PA 3WZDA 3EYGA 3A99A 2ITXA 3AMBA 2CNVA 4Y72A 5IA3A 3TKHA 3LQ8A 5LVPA 4FTOA 3D5VA 3KF4A 4FTUA 1ZYCA 3R8LA 2ITWA 4NJ3A 4RLKA 3LFNA 2FO0A 5EOBA 4AE6A 3S00A 1XJDA 4WHZA 3FJQE 4Q9ZA 1OGUA 5DGZA 4FV8A 4I1ZA 3FMNA 5KBQA 2CCHA 4DH1A 3CCNA 2BAKA 1YWRA 2XNPA 2YCFA 5AUXA 1Q3WA 4ID7A 3T3VA 4DA5A 2WTKC 4M15A 2XIRA 2X4ZA 3NZ0A 3PTGA 3OCBA 4BGGA 4XYFA 4MBLA 4M67A 4NUSA 2PE0A 4O1OA 5JGAA 3FLZA 3POZA 2B9JA 2IZUA 4F99A 4RMZA 4ONAA 3S3IA 4ZMFA 1XQZA 3I0OA 1ZMWA 3SOCA 4RJ7A 5K5NA 4K0YA 3H9RA 2BAJA 4FL2A 3UG2A 3LHJA 4U44A 2BIYA 4Y5QA 4JDKA 4O0XA 1TQMA 5BYZA 2CN8A 2PMNX 3GGFA 2G2HA 4AA0A 4XS2A 4NFNA 3B8QA 1M7QA 3BYMA 2BTSA 2Z7SA 4KSPA 2ITVA 5CASA 4IB0A 2C5NA 3ZEWA 2H6DA 3ATTA 5IDNA 4ZTSA 4CFWA 4CFUA 2C3KA 4KKHA 4YHFA 4UMUA 4R5YA 5AV1A 5HTBA 3W10A 4E6QA 2OJIA 5CSHA 4F63A 3EQCA 3HV6A 1XH9A 4AW0A 5K5XA 4XV3A 3BE2A 3DBQA 4CRSA 1UU8A 3WZEA 3C9WA 3G90X 3F5PA 1KOAA 4HJOA 3MDYA 5AA8A 3CD3A 2XH5A 3NR9A 2XIYA 4NM5A 2ETRA 2GNFA 3K3IA 4YNEA 4EYMA 3LJ2A 3FYJX 4FKTA 3TNIA 1KE9A 3IDBA 1W98A 2HW6A 2WTJA 3V3VA 3HECA 2GNJA 3GENA 3QF9A 4IWDA 3ZUUA 3ZRLA 4QOXA 2WMVA 3F69A 3W32A 4L67A 3PLSA 4L6QA 2YHVA 5BVNA 2W1EA 4MH7A 5T68A 2QC6A 2WQNA 4NM3A 3ZO1A 5LMBA 3EKNA 4BI0A 5D1JA 1CTPE 3HLLA 5DMZA 3L9LA 3Q9ZA 5IQBA 4M14A 4ENXA 5JRQA 3S1HA 1WCCA 1WVWA 4QRCA 3IDCA 3CIKA 4KKGA 4FYOA 5AP6A 3BQRA 2A19B 5BX0A 3R7YA 3RAHA 3LM0A 5B2LA 3FY0A 5J1WA 1RW8A 4BR3A 2HENA 2HK5A 4E4XA 1P2AA 2PY3A 4ACHA 2BFYA 5AAGA 3TEIA 1R1WA 2PVMA 3IGGA 5CZHA 4IIRA 2F9GA 3G51A 3UOLA 5ETFA 1T46A 3QQLA 5L4QA 4M13A 4BCQA 4L9IA 5T6KA 5HORA 1OIYA 3QRKA 4DH3A 4RIYA 4USDA 4WSQA 5J9LA 4YO6A 5BVOA 2C6OA 1UNGA 3GC0A 4HYIA 5LCKA 5KHXA 3CTHA 2B0QA 3QHRA 4OGRA 1O9UA 4O6EA 4QO9A 3ORNA 3UDBA 3CEKA 3D4QA 4BWKA 1UNLA 3BHHA 3FLSA 4DYMA 4YP8A 2JEDA 2P0CA 4F0IA 2UZOA 3P5KA 3C5IA 3PIZA 3NX8A 4RIYB 4RC3A 2UW3A 3H3CA 5AV3A 2UW9A 1JOWB 3Q04A 4AX8A 3R2YA 4DH5A 2ITNA 4WNMA 1IAHA 3FMKA 2CKOA 2VTOA 3E92A 5A3XA 4DFUA 4BKJA 4F0FA 4FV6A 4ZZOA 4BZOA 2IZSA 5H3QA 1DI9A 4IADA 4NZWB 3U8WA 4M69A 3IOPA 2YA9A 2PZPA 4LUEA 2C69A 4YC3A 2BMCA 4W9XA 4ZSAA 3ZU7A 1J1BA 4FUYA 4J95A 3FMDA 2VWYA 2G2IA 4IB5A 3PZEA 3PA3A 3RKBA 4BI1A 1WZYA 3OOMA 4FTIA 4M69B 4QTCA 3AG9A 3V5LA 3ZYAA 4A06A 2YLEA 3SDJA 1GIHA 2UZEA 4FZ7A 4AT3A 2AYPA 3O17A 3QXOA 5CU4A 5DVRA 3FYKX 3VW6A 3UQCA 3GU4A 4M97A 2B1PA 3QTQA 4AGUA 4YZ9A 3SG9A 4MAOA 4K8AA 1YXSA 1ZOHA 4O0SA 2QKRA 3V04A 3NEWA 3OMVA 4L52A 5M57A 4CCBA 5HOAA 4G1WA 3U87A 1XH5A 2BRGA 2X2MA 2F7EE 2W9FB 3ZHPC 4QNAA 3FMEA 1JAMA 5HD4A 4C37A 2WOTA 4EQMA 4C2WA 2J51A 4LMUA 3FEGA 3NMUF 5GINE 5CAOA 2WMWA 3D0EA 4DFNA 2BZKB 2KULA 2OG8A 3DZQA 2J90A 2YM3A 4K9YA 3FXWA 4WIHA 4F9WA 3ZLWA 4O96A 5AX9A 3TM0A 1MUOA 2CKQA 2RFNA 4E5AX 2IVUA 4JQ8A 4UWBA 2XK4A 4BDAA 2R3RA 3FBVA 5HQ0A 4RVKA 5KE0A 5EW9A 5FM2A 3EFLA 5CQWA 3ZFMA 4C34A 1H00A 3WILA 4R1VA 4BTMA 4D4YA 4J7BA 4O81A 4JG8A 4QP8A 1GY3A 2IVVA 3WI6A 4ANOA 2GFSA 4PL4A 4BGQA 2YN8A 4BKYA 1PW2A 1XBCA 1PMUA 2GTMA 4MX9A 2XK3A 5B2MA 4L42A 5L6OA 3PJCA 3F2RA 1Q24A 3QA8A 3UIBA 4EKKA 2PZ5A 3Q2MA 3Q4ZA 3EIDA 3P7AA 4JT3A 5HHWA 4A4XA 1WBSA 4JNWA 4UWCA 4ASDA 2JBOA 4IX6A 1Y8YA 4JDIA 4U6RA 3BEAA 3BLQA 3KKVA 5IEVA 5HLPA 2X39A 5HE3A 4DEGA 1JPAA 2HELA 3R6XA 4O1PA 4E26A 4E8AA 5JFXA 4C57A 2R3LA 1P5EA 5D9HA 3Q5IA 3DLSA 3HV3A 5CEOA 2X7FA 3ZSHA 4GU9A 4IX4A 2PVYA 2LGCA 4O0YA 4B9DA 2OK1A 3ORPA 4EJNA 4JDJA 1T45A 4RX8A 1FOTA 2VWWA 2YITA 4U3YA 4EH9A 3TJCA 5KKRB 3JY0A 3SRVA 4GJ3A 3LVPA 1L8TA 2HW7A 5E8YA 2WO6A 1G5SA 4NT4A 4FYNA 2W99B 4BBFA 2RG6A 3VS0A 4D9UA 3QZGA 5CU0A 2XMYA 5KMJA 4WO5A 3GBZA 3MS9A 3KXNA 3SRVB 3QGYA 3RNIA 5FQDC 4FKQA 3R8ZA 4BI2A 3SW4A 1FMKA 3EN6A 2P3GX 5C8NA 2GFCA 3QZIA 3PE2A 3AMYA 3PY3A 2GSFA 3R9OA 1UNHA 4KS8A 3WIKA 2YZLA 2ZAZA 4IWPA 3R63A 2QOBA 2BRNA 1BI7A 3O50A 1OL6A 3DS6A 4CXAA 4WKQA 2JDRA 3AXWA 3KULA 3ACKA 3DKGA 3AC1A 1E1XA 5I0BA 5ETCA 4BCHA 1GZKA 3MPAA 2BRMA 1NY3A 4PRJA 3V6SA 2W1IA 5EHOA 3VS3A 1PXNA 3F2NA 4TTHB 4BZDA 1XKKA 2XJ1A 4XLVA 3C1XA 2C4GA 3RMFA 3VBXA 5A14A 3KULB 5JKGA 1YDTE 1ZWSA 2VO0A 3O23A 3UQGA 5DH3A 4I22A 5CSVA 4XX9A 4EL9A 3UJGA 4DFBA 4AZFA 2OH0E 2OW3A 3BBTB 3CLYA 2GHGA 3KQ7A 3HRBA 5CEPA 1A48A 5IU2A 2A4LA 4EI4A 3QUDA 3V5TA 5LXMA 4FT9A 3OP5A 2RL5A 3ANQA 5BVDA 2Z7LA 2FSTX 3GXLA 2JKMA 3AT2A 3QQUA 1VR2A 3R30A 3MB7A 4X3FC 4U79A 3U6JA 3DAJA 4XMOA 4Y73A 3OTVA 4RWIA 3TI1A 3KREA 5K9IA 1CKPA 1SVEA 2GS2A 3NVKI 4D4SA 2X4FA 3HV4A 4RLLA 3GCVA 4RJ6A 5CT0A 4QP9A 5CAVA 5HU3A 1VEBA 3F3WA 2WMBA 1OL2A 3BGPA 2P2HA 3PXQA 5K4JA 1IR3A 2W7XA 4ALUA 3CXWA 2OWBA 5E8ZA 4A9UA 3QRIA 4BYJA 3QWJA 3ZO2A 1XH7A 3PVGA 4NW6A 5GJGA 1Q8YA 3H0ZA 4D2SA 2YM6A 3CQEA 2JAMA 2GCDA 4IC7A 3SX9A 3C0IA 2R3NA 3QRTA 1KE6A 4H05A 1PMVA 2IO6A 4F65A 2BROA 4FX3A 4CMUA 1XH6A 4BDKA 2VTQA 3MTFA 4W8DA 2HXLA 4U0IA 2V5QA 3F82A 3VF9A 4PP7A 2VD5A 3I6UA 5A54A 5ANKA 3QQFA 3G9LX 1OKWA 3FPMA 2LAVA 2PE1A 3A60A 3FMJA 2VZ6A 3E5AA 2C30A 4HPUE 3D2IA 4JOAA 2Z60A 4KSQA 4PQNA 4YJTA 5ANGA 4EONA 2QG7A 2ONLC 5C8KA 3I5ZA 3QWKA 4UMRA 5L8JA 4TYEA 3QD0A 3UMWA 4H36A 3ZFXA 3GFEA 3HRCA 4BCKA 4KIOA 3DOGA 1W0XC 1YHSA 2JFLA 3KVWA 4OTQA 2VTTA 3ZUTA 5JK3A 4ZS4A 4JBPA 1CKJA 5CU6A 3ZLXA 4QQ5A 3PPKA 5K0XA 5C8MA 4DBNA 3EMGA 1SVGA 5DR2A 4TYJA 2X8EA 2YCRA 5HIDA 4R3PA 1R3CA 5M4UA 4AQCA 3D83A 4G3FA 4TNBA 1G8SA 4BY9E 2GMXA 4O7SA 4CZYB 4FE2A 5TT7A 3TNHA 3UOKA 3NNUA 4BHZA 4HPTE 3HVCA 3C0HA 2BCJA 5KMIA 4ZK5A 4AF3A 4RJ8A 3QALE 2UW7A 4LGHA 4F6SA 1R39A 4MBJA 4KINA 4JAIA 5HGIA 4XOZA 4B99A 3HA6A 3ORMA 1OKYA 5GJDA 2WMUA 3DT1A 1S9JA 4NK9A 4DINA 3MYGA 4IJ9A 4YPDA 5E92A 1Y8GA 5BMSA 3E62A 3LMGA 4C58A 2J5EA 2RFEA 4DFZE 5IQHA 5EHYA 4PTGA 3LXLA 3Q4UA 5AX3A 3ZBFA 1PRYA 3F66A 4Y8DA 3ACJA 4F9CA 3CKXA 3P86A 4H1JA 5H8GA 3CGOA 1JSVA 5IMEA 3ITZA 4RJ5A 3ZTXA 3DV3A 5JQ5A 3KN6A 4L44A 4QMLA 4TW9A 1J7UA 5IEXA 3P7CA 3PSBA 3R8VA 2V22A 5CU2A 4FSTA 4O0RA 3OW3A 1PXIA 1SVHA 3RCJA 3EFKA 5J9ZA 3PRIA 3BELA 4IX3A 3SXRA 5CEQA 4M0YA 5KHWA 3TDVA 5HNIX 1I44A 2NP8A 1P4FA 3LM5A 4ACGA 4C4FA 2WHBA 3UC4A 4QPSA 1MRYA 2FUMA 5CVFA 1BL7A 4RJ3A 2ZB1A 2XJ0A 4L8MA 3QXPA 2WMAA 3KMUA 3NUUA 3G0EA 3QTZA 2DYLA 5A4CA 3KF7A 3I7CA 2E9OA 2UZWE 3R73A 3OW4A 1OI9A 4CEGA 4FVRA 2WMTA 2CLQA 4EZ5A 3F61A 1JKKA 2X7GA 4FVQA 4FIFA 3NCZA 1YXUA 4WNKA 2UZTA 3TT0A 4YLJA 4FEWA 3AT3A 4IFCA 2W96B 4GL9A 4J98A 2CPKE 2HAKA 3P9JA 5EM5A 3DGKA 3R7GA 1H27A 4OTWA 3TV7A 4BIBA 1U59A 4DGMA 2V62A 3MVJA 3AC2A 3FHIA 4D28A 2ESMA 3MJ1A 2NPQA 3WOWA 1VYWA 1ERKA 4QP4A 4K6ZA 4WNOA 2JKOA 2YERA 3VF8A 5LJJA 3F5UA 4CFVA 3DBCA 4C4GA 5IQFA 3CTJA 4V0GA 2PUIA 3RCDA 3D5XA 1AQ1A 4LOOA 5CTPA 3KRWA 5L8LA 3IW4A 4FV0A 4BCIA 2W4KA 4EOSA 1H28A 4BL1A 5F4NA 2E2BA 3E8EA 4IZYA 3TACA 4V0GB 3PVBA 3II5A 1OPJA 4MD8E 2DQ7X 3U54A 3NYNA 4KS7A 2RGPA 1YDRE 4WT6A 3LFBA 4GFOA 2WB8A 5HEZA 1HCKA 1FMOE 2XIZA 3E3PA 4QMSA 5ACKA 2X2LA 1GZOA 1Q97A 2W4OA 3W2SA 4ACDA 1V0PA 4NEUA 5TO8A 3FLWA 3JVSA 5A6NA 5LWMA 1BUHA 3A7GA 4IM2A 3TNWA 3Q9XA 3QUEA 4RRVA 1ZAOA 2XIXA 5EQYA 3M11A 2VO6A 4I6HA 4MXOA 4IQ6A 5EG3A 3HKOA 3VS5A 4R7IA 3RM6A 3RALA 3UPXA 4FSQA 4ALWA 4NYEA 4D1XA 4BCGA 2BR1A 1Q8ZA 3OT8A 2GPHA 4W4WA 2OBJA 3M42A 4YTHA 5ANOA 3HP5A 2A2AA 3QTRA 1M2QA 4Q9SA 4QTAA 5M08A 3BPRA 5DT0A 5B0XA 2W0JA 1JSUA 4R78A 3ZXZA 4YNOA 3QRJA 3KCKA 5FTGA 3RAKA 3I5NA 3O51A 1J7LA 3DNDA 5BVKA 3UODA 1H0VA 2A1AB 4ZS0A 3QAME 3SOAA 4U3ZA 3JUHA 2W1GA 2YIXA 4NL0A 4FGBA 4D2RA 4FV9A 5CY3A 3F3VA 5AUZA 2IZRA 2YIWA 5KMNA 3ZM9A 4LRJA 2WU6A 1PYEA 4W4XA 5FBOA 3KEXA 5HBEA 2ZM1A 1Z57A 3W1FA 3PP0A 2XNNA 5HO8A 4J99A 4QYYA 4RT7A 4PDPA 3PA5A 2J0LA 2XS0A 4IM0A 4DCAA 2QLQA 4CMOA 2PVRA 1ATPE 4FSZA 4BDFA 3ORXA 4ZSGA 3WARA 4BCOA 5CEKA 3T8OA 2EUFB 1KV1A 1ZZLA 3ET7A 4XG2A 5AUWA 4NM0A 4ZJIA 2JBPA 3N4UA 3DB6A 5JRSA 3R1YA 2OLCA 3IG7A 3SLSA 3QD3A 3KRLA 2ZV2A 3HMNA 4QMQA 5GJFA 3OVVA 2GU8A 4L7FA 5I3OA 3UNZA 5E8TA 5E90A 2ERZE 1Q8WA 3CPBA 4QYFA 5HG5A 4JBOA 4NW5A 4PL5A 1RE8A 4KBKA 1PKDA 4TYIA 5DHJA 2B52A 3FWQA 5KMOA 2H96A 4CMTA 3RPYA 5DFPA 4D2VA 4EUUA 4AOIA 2F7XE 2VUWA 1REJA 3NNWA 3LXNA 3DU8A 4PNIA 4EH6A 1PXPA 3OG7A 2XCKA 4CV9A 4FEQA 4FT0A 2OXXA 5L2QA 3PWYA 1NXKA 5GIPE 3I60A 4RX5A 2C5YA 2X6EA 5G6VA 2Y4PA 4MNFA 3VS4A 1Y6AA 3UMXA 1Q99A 1YDSE 4JR3A 4C4IA 2R9SA 4DEIA 2P55A 4FZ6A 3RPSA 5AEPA 2WAJA 4EC8A 2ITYA 4XUFA 1H0WA 3LCOA 3QQKA 3NNXA 5AP2A 1NVRA 4GG7A 4I21A 2RKUA 4FOBA 3PPJA 3HP2A 5C01A 5HBHA 2C6IA 2W1HA 3Q53A 4BCMA 1H8FA 2QOCA 4F09A 4D4RA 4DFLA 4B8LA 5FXQA 1Q4LA 4R7BA 4AN2A 4IFGA 2R0UA 2EXCX 4O0TA 2OJGA 4I4FA 4BDBA 4CCUA 3FMLA 3UVQA 3UYTA 4JIAA 4YJVA 4YLKA 2P2IA 2XK9A 3HDMA 4L01A 4AAAA 4ZY6A 1W8CA 3HUBA 3QTUA 4WBOA 5HTIA 1ZARA 3WE4A 4FTJA 5FXSA 5EW3A 4C4HA 2JC6A 4R1YA 3VUMA 4KNBA 5GIOE 5FXRA 3FAAA 4QMMA 3PXYA 3VULA 3HYHA 4NIFA 2EWAA 3MFRA 3OCTA 4XNEA 4AGCA 3NYVA 2C0TA 4FG8A 2YIRA 5M09A 3DFCB 4ZMEA 2VWIA 2R2PA 1QPCA 3BE9A 4C2VA 5IQCA 2CJMA 4TY1A 5HIBA 4RZWA 3LFQA 3LXPA 2BRBA 4FL1A 4NIFB 2ZM4A 4FF8A 4RSSA 2ZV9A 5DLSA 2QO7A 1XO2B 4X0MA 4XG8A 4XG6A 2C6EA 5CEIA 1UWHA 5KMKA 4YJQA 3NUSA 5H9BA 4BHNA 3I6WA 4LFIA 4BDCA 1QPEA 4ANQA 3A4OX 4BC6A 2W05A 4OT5A 5AP3A 4D58A 2QO2A 5BNJA 2CGUA 3ULIA 4ASEA 1B6CB 4H3PA 4K11A 5EI6A 5G1XA 5JZJA 3FKOA 3D5WA 4HYSA 4KUJA 5EYKA 3AC4A 3S95A 4WOVA 2XZSA 2Q83A 5KZ0A 4U43A 3R9HA 3FXXA 3DK6A 4EOQA 4F1TA 1W84A 3EN4A 3MFTA 4EQUA 1TVOA 1URCA 5D41A 5CSXA 1DS5A 3GEQA 2ZV8A 1OITA 2VTRA 3RPOA 4V05A 1O6KA 4HGSA 3NPCA 2BALA 4YHTA 2JIVA 4XRLA 4AE9A 3E8CA 2X0GA 3TJDA 2PZIA 1PY5A 2C1AA 3DXNA 4K77A 5L2SA 3IQ7A 2OH4A 1PXMA 3WF8A 2XKEA 4BZNA 5M4IA 3FI2A 1W7HA 4I5PA 4IC8A 4IH8A 5IEYA 4GVJA 3QLFA 1FBNA 2GNHA 4FOCA 4EORA 4CV8A 2PSQA 3AD6A 4FEVA 4O82A 2IWIA 2JGZA 5ANIA 4YTFA 3L8PA 1YXXA 5B2KA 4JQEA 2WFYA 4MF0A 4NCTA 5HKMA 4WD5A 4O6LA 2X8DA 3N9XA 3KGAA 4F6UA 3R9DA 2WMQA 2F7ZE 5J7BA 1Q8UA 4ITIA 3NIEA 2PZYA 3W2RA 4OAVB 4M66A 4D1SA 5HBJA 4CZUA 3KB7A 2HCKA 4EEVA 4HVIA 4J97A 4J52A 4V01A 1HOWA 4S2ZA 3FI3A 2VTIA 5GZ9A 2Y0AA 4QP3A 5AR7A 3RAIA 5FTQA 1V0OA 5TR6A 5CALA 1VYZA 3CJGA 4AZVA 5IQIA 4QP1A 3HAVA 3A7IA 3UVRA 2B54A 3UYSA 1U4DA 3R71A 2HZIA 1QPJA 2Y7JA 3ODZX 4TZRA 4JLCA 2UUEA 3F2AA 5J8IA 4KB8A 4C4JA 4XP0A 5L2WA 3L1SA 5AIRA 3Q60A 2PTKA 2QHMA 4F9AA 4F1MA 3FSFA 3BV2A 1PXKA 4IZAA 4L68A 4S31A 1OUKA 3MJ2A 3O0GA 2DWBA 2VX0A 4GFMA 3QYZA 4FKUA 2BRHA 4FTRA 2ZB0A 4FT5A 5DWRA 4ZEGA 2CNQA 4BTKA 3FMHA 3FZ1A 5J5SA 3E93A 2C3LA 2CNUA 5I9YA 3TN8A 4DLJA 4PF4A 3EQPA 5DOSA 3T3UA 4B6LA 2YJRA 3OWPA 3PVWA 5FEEA 3DK3A 2BKZA 1XH4A 5FP5A 3QLGA 3VW8A 2JKKA 1SM2A 4HOKA 3ZMMA 4QTEA 4J53A 1OPLA 2GS6A 4WSYA 2QCSA 3LFSA 4NU1A 5JGBA 2VX1A 4FZAB 3LFFA 1MQ4A 5M06A 1ZLTA 3CY2A 3MGYA 3BWFA 3ELJA 5I9ZA 4Q2AA 1I09A 4UN0C 3GQLA 3NUAA 4KIPA 4OUCA 1LEZA 5AADA 4CLJA 4EZ7A 1BX6A 1ZYJA 2UVYA 5CX9A 5DT4A 2EVAA 3EQHA 3QTXA 5E8UA 4MWHA 3LZBA 2V0DA 1PXJA 4GEOA 3EOCA 4S30A 4O7LA 5AV0A 1OPKA 3JVRA 3Q5ZA 3AC3A 2XK7A 4OBPA 4YLLA 4HCUA 5I9VA 3QD4A 5HZNA 4BVUA 4LM5A 3W2PA 4YJNA 1UVRA 1YVJA 4AW1A 4CQEA 4JVGA 4RIWA 4YJRA 4DGNA 5IA0A 3EYHA 4I6FA 3U9NA 4YTIA 3A4PA 5DE2A 3OS3A 3BIZA 4PUZA 4MYGA 5AJQA 3A7HA 4AW5A 4QD6A 5LVOA 5AP5A 4JIKA 5EOLA 5HCYA 4IX5A 4FBXA 4QMXA 4ZTLA 4ZZMA 2CHLA 3UZRA 3D5UA 3LXKA 4RIWB 4X2NA 4JQ7A 4ZSJA 5BUJA 2E9NA 2FVDA 5HG8A 4ANLA 1QCFA 3KXXA 4YJUA 1KSWA 2R3IA 4PDYA 2WTKB 3K5VA 5D7AA 5CXZA 4DG2E 1O6LA 4FEXA 3E64A 3KRJA 4G3GA 4IZ7A 2ZM3A 3P78A 5C27A 4G9RA 3KVXA 4HGLA 2E9UA 2PWLA 4YTCA 1JBPE 3HZTA 4D1ZA 2J7TA 3UO4A 1SMHA 4HYHA 4U5JA 3MFUA 4R3CA 1R78A 4QTBA 4ANSA 5CANA 1U46A 4X6RA 2XEYA 2QOQA 4PMSA 2WZJA 5IPJA 3VRYA 2UV2A 4HZRA 3UP7A 5J87A 4FTLA 5IUHA 3GP0A 3IO7A 2JDTA 4GK4A 4F0GA 1VZOA 4IVCA 2WGJA 2E9VA 2J6MA 3O71A 4QYEA 3P4KA 2VWZA 2WQOA 4RQKA 3IS5A 4UZDA 3U55A 3MA3A 1KUTA 2HWPA 1U5RA 2FGIA 4D0XA 4G34A 2C6TA 4NSTA 4JDHA 2PZRA 3ZEPA 2ACXA 3KCFA 1OBGA 1R0PA 2ETKA 4ERKA 3OD6X 3EWHA 2R3FA 4M68A 3BLHA 1OKZA 4UZHA 4F1OA 3PXFA 2R3OA 4MF1A 3ZO4A 4CD0A 4DE4A 3PSDA 4XV1A 5HNBA 3DAEA 4P5QA 3H10A 2NO3A 3ZRKA 4UMQA 3BRBA 2WPAA 4EHZA 3PY0A 2QLUA 3HMMA 3UBDA 5LMKC 3ATSA 4NJDA 3VQHA 1E1VA 1OMWA 4PPBA 4C33A 3QHWA 1NVQA 3OTUA 4FKPA 4QYGA 4ZP5A 5I9XA 5IUGA 2CGWA 2W5HA 4DEHA 4E6AA 4C8BA 2EB2A 1H25A 2W1DA 4N0SA 2J0JA 5ETAA 5F1ZA 3ZSIA 4X2JA 5HU9A 4OTFA 4QMWA 4E20A 3TZ9A 4Z55A 3OROA 4XG4A 4KIKA 5TE0A 1G8AA 4FICA 4YZCA 2CMWA 3GT8A 4MK0A 2OO8X 3MI9A 3MBLA 3UNKA 3HV5A 4BB4A 2ZVAA 3FLYA 4RZVA 2UZBA 3TG1A 4F4PA 4ZTNA 2W1FA 4BRXA 5M53A 3PDTA 1Q61A 1DI8A 4KIKB 4LGDA 4YZBA 1AD5A 3V5PA 1IASA 1M2RA 4U9AA 4YJPA 3KXHA 3C4XA 4MXXA 4E93A 4EYJA 2RFDA 4CZTA 5IH4A 4U97A 3VVHA 4D0WA 4DT9A 3UNJA 1KWPA 3AQVA 3GU7A 4FI1A 1V1KA 2F57A 4MD9E 4L00A 3OBJA 4QMUA 4IEBA 4ARKA 3G2FA 3SVVA 2ZJWA 3EFJA 5AM6A 2EXMA 4HVSA 1JQHA 4RGJA 5KCVA 4AT4A 1CKIA 1XHAA 3FZRA 3FSKA 4O83A 4DTBA 3ANRA 4JL9A 3BU3A 2BDJA 3PUPA 4BGHA 5I5ZA 4I6QA 1V0BA 3U6IA 3R2BA 4KIQA 2XYNA 4IBMA 2GNLA 3ZLYA 2BUJA 2BFXA 3AGMA 4Y5HA 4QYHA 4AXAA 4O38A 2B4SB 5LMAA 3B8RA 1XBBA 4PL3A 2ITUA 2RFSA 4GJ2A 3GB2A 5F20A 3BGZA 4FMQA 4ENYA 4G5JA 4QMYA 4XJ0A 1WBWA 2PUPA 2IW9A 2VTPA 3VIDA 4FTAA 2I0HA 4AT5A 4C38A 3QZFA 2QODA 3DK7A 5AA9A 5LCJA 1YOJA 4UXQA 3V01A 3TV4A 4BDGA 4OR5A 5ANJA 4D5HA 3E7VA 3FQSA 1PHKA 2PULA 4QP6A 2ZV7A 3Q6UA 4KABA 5ANDA 4D55A 2YM8A 4XV9A 2H8HA 4RFYA 4FIJA 4X2KA 2F49A 3FQHA 5IQEA 3QC9A 2OXYA 3JY9A 3VJOA 2B7AA 4AACA 2SRCA 2JFMA 4ITJA 4FG7A 2OF2A 3KFAA 4G6LA 3PP1A 1M7NA 3WF7A 5D7VA 5DRDA 3PSCA 3UO5A 2PVFA 4IM3A 3MVMA 3WZJA 5EKNA 4L7SA 1Z9XA 4NKAA 4Z7HA 2G1TA 3B2WA 3GC7A 5I9WA 3DAKA 5ICPA 1BKXA 3BZ3A 3E8DA 2OGVA 4N4SA 2YM4A 2WQEA 2IJMA 3NLBA 3VBWA 2UW4A 4PNKA 5AAEA 2X6DA 4DT8A 2CGXA 2ZMCA 3C0GA 1K3AA 3GQIA 1YXTA 3CR0A 4HCTA 4AGDA 1E9HA 4BCFA 2CGVA 4C3PA 4A9YA 2NRYA 1SZMA 3GOPA 4F7NA 2YDKA 2A0CX 2HZNA 4AFEA 4OAUC 3EL8A 5AFVA 1FVVA 1F3MC 3PA4A 3PPZA 3OWJA 3HGKA 3R1SA 3Q6WA 5HO6A 4DLIA 1WFCA 3DZOA 1YQJA 3VS2A 2YEXA 3TNQB 5CENA 4FV4A 4JG7A 5EM8A 1FVRA 2VV9A 4O0VA 4FKWA 3CGFA 3HEGA 2BHHA 3R8UA 5JEBA 5HI2A 3OT3A 2YDJA 3PWDA 1YW2A 2R3GA 2REIA 4AG8A 5L2TA 4BDIA 3LMHA 1WBOA 3MVHA 3A7FA 5BVFA 1ZYLA 3SA0A 5IQGA 4FV3A 3UP2A 2PMOX 4N57A 3B2TA 5AP4A 3RGFA 4IB3A 3Q4CA 1RDQE 5HCZA 2R7IA 3RWQA 3VBTA 4P5ZA 2IG7A 4DH8A 4BFMA 4N70A 2VTJA 1H1SA 2OIDA 3L8XA 1Q8TA 2XKDA 3DB8A 2QONA 4HVGA 1RJBA 2WTDA 3WYXA 2IN6A 2C3IB 4APPA 5D11A 2WXVA 4FSYA 4E6DA 3Q96A 3QX4A 4ORKA 2XEZA 4R7HA 1YI6A 2QKWB 2ZYBA 2XJ2A 2YDIA 3OZ6A 3ZCLA 3IECA 4U45A 3RZFA 2C6LA 2C47A 3JYAA 3PLAE 1UWJA 3DFAA 4LQMA 4TYHA 4ZTHA 5CNOA 3UVPA 3BI6A 4MKCA 3MH2A 2GNGA 3BQCA 1WVYA 3PXKA 3FPQA 3DXPA 3JXWA 1Q62A 5E8XA 2XM8A 5KMLA 2VWVA 1JNKA 5EI8A 2ITQA 3GU6A 4PMPA 3MVLA 4FUXA 5DPVA 3IOKA 5A6OA 2YIQA 4FTMA 3QUPA 5E7RA 3S4QA 5EHLA 5M56A 4IAKA 2O64A 4EWQA 5L6PA 3PE1A 3A8XA 1SNXA 4RIOA 4IWOA 4FR4A 5AP0A 4W8EA 4ACCA 1WAKA 4ASZA 4AZEA 4CTBA 1WBVA 3ZUVA 4BWPA 5TOZA 4M12A 3N51A 5KMMA 1IAJA 3ZH8A 3UZTA 1P4OA 3FLQA 5JSMA 2CKEA 3LFDA 3C5UA 1F0QA 1LEWA 2YCSA 2OFUA 2QD9A 1XBAA 3Q9YA 3HX4A 4G3CA 5CI7A 3ZBXA 4ALVA 4XBRA 5CWZA 3ID6C 5CQUA 1CDKA 4BTJA 2ETMA 2R4BA 3TTJA 4CKIA 2P4IA 4BCJA 4PV0A 4EH5A 5IMXA 1H1RA 3NW5A 2RSVA 2DS1A 1J1CA 4EK5A 3LPBA 4ZLOA 3PJ8A 3TZ8A 3BLRA 1NVSA 1H26A 1OVEA 2VGPA 4XP2A 1OL7A 2WIHA 3EZRA 5FEQA 3RWPA 5ITAA 5L8KA 3HV7A 3K3JA 4GFGA 3QRUA 3FI4A 4CTCA 3R28A 1APME 3RJCA 4MCVA 1FGKA 1FPUA 4HGTA 1URWA 4YU2A 4EOMA 5E9EA 3DBDA 3FZTA 3QCSA 4DFXE 4O2ZA 1IA9A 2BDWA 4I0RA 4J71A 2X81A 4YJSA 2OIQA 1H1QA 2IW8A 3HRFA 4EOLA 3HMOA 4DG3E 2WTIA 4QT1A 1JSTA 2ONLA 3EL7A 5A4QA 2VTLA 4QNYA 4DEEA 4M84A 4MTAA 4P4CA 2Y6OA 4AZTA 4CFFA 4C61A 4D2TA 4IAAA 4X2GA 4BCPA 3WE8A 4EOJA 5M07A 4RFMA 4WUAA 3LE6A 3IGOA 5HIEA 4LV8A 2J0IA 4OBQA 4O7WA 4DBXA 3NNVA 2WIPA 3UZPA 5HCXA 3K2LA 3VBYA 4BN1A 3FQEA 4DEDA 4R8QA 1W83A 2OIBA 5HX6A 5AP7A 4HYUA 2BAQA 4B0GA 3COIA 4MEDA 5FRIA 4AFJA 5JFVA 1U5QA 4CG9A 3F7ZA 4PPAA 2OICA 3UG1A 2I7QA 1JLUE 1XR1A 4E73A 2VU3A 3SAYA 3NUXA 4XP3A 4D5KA 4EHVA 3GI3A 1OKVA 4R5SA 5GNKA 2JIIA 3O8TA 1X8BA 3TUBA 4F64A 4EK8A 4GMYA 3O2MA 1F5QA 4DG0E 3RHXA 5HNGA 4AOTA 4GKHA 2Z7QA 4FC0A 4FSUA 1ZYDA 3SXSA 2PUNA 3ZZWA 3SG8A 4AP7A 4CT2A 3MPTA 3ZC5A 4YMJA 2VNWA 4X2FA 4X3JA 3KC3A 2XNMA 3FI8A 5DIAA 4NWMA 4UMTA 4DITA 3FY2A 4GKIA 4XRJA 4FG9A 2YM5A 5IA5A 4JR7A 3BYVA 3VS7A 1PMEA 3ROYA 3NIZA 4M3QA 3AT4A 3VUTA 1YOMA 3GC8A 4AA4A 4CG8A 3AOXA 2H9VA 5CSWA 3W2OA 2VTNA 1PMNA 4G17A 4DEAA 4ZLYA 3FC2A 5J9YA 4EH4A 2HZ4A 1H07A 5FD2A 1UU7A 3NRMA 2OZOA 1FGIA 4RPVA 3VJNA 1WVXA 1A06A 2GQGA 4O84A 4GV1A 4FKVA 3SXFA 4AN9A 2OU7A 3C7QA 4TWCA 3P08A 3FC1X 4PTEA 4E1ZA 4JRNA 5J7HA 3QZHA 2JD5A 5CT7A 3R04A 3H4JA 4OLIA 5JFWA 4CSVA 5E8SA 2BDFA 3G9NA 3QQGA 3V8TA 4EOOA 4IVAA 5C03A 4PX6A 2BPMA 4EWHA 1QMZA 3R9NA 3DXQA 5H8EA 3NVMB 4L53A 2VTAA 5I4NA 3SQQA 4LRKA 3GCQA 3MFSA 1YI4A 3RZBA 4BCNA 4EH8A 3WF5A 3D7TA 2VWXA 4TL0A 4CKRA 4FIGA 4RA5A 1ZXEA 2W5BA 3Q2JA 2BIKB 3SD0A 3W16A 3N4TA 1ZRZA 2PK9A 2PVHA 3NYXA 4MQ2A 5BUIA 3EQRA 5DN3A 4NCTC 3VUGA 4MD7E 1R0EA 4MXCA 3GVUA 2Y6MA 2XRUA 3HMPA 4LI5A 4OTRA 1PXOA 3D7TB 3A7JA 3TDWA 3ALNA 5E8WA 2RF9A 3CKWA 1SYKA 2XA4A 5KO1A 4FEUA 4LGGA 2R3MA 4G2FA 3R1QA 4QP2A 3MY0A 3R1NA 5AR4A 4EKLA 3SKCA 3TIZA 4EQCA 4YPSA 3GU8A 1IRKA 3OWKA 4D2WA 4FKSA 5IZFA 1JKLA 1Q3DA 2JDVA 4LV5A 2O5KA 4EHEA 3QQJA 5CSPA 3DBFA 1OIRA 3V5WA 5A46A 3LFAA 5HX8A 3OUKA 2I40A 3FZOA 4Z7GA 3QA0A 4AOJA 2YIYA 2C5OA 3NAYA 3GNIB 3VO3A 3GCUA 3QBNA 3G33A 4TNDA 3ENHA 2VWBA 4GRBA 4YHJA 3TXOA 5CYIA 4YJOA 4DH7A 3D9VA 1UA2A 5LOHA 2RG5A 4J8MA 4M8TA 5DEWA 3FV8A 4PPCA 3FUPA 4BDJA 2VRXA 3EFWA 2W5AA 5FDXA 5CXHA 4U40A 1GAGA 3I7BA 4IHPA 1L3RE 1RQQA 2X8IA 3E8NA 4TYGA 5DNRA 4RG0A 5AV2A 3VQUA 4Q5EA 3EQFA 3EN9A 4C36A 3CJFA 4RFZA 4ANBA 2NRUA 4DTAA 2XIKA 4GK3A 4C02A 3NUYA 1MRUA 3QTIA 5EYMA 3ULZA 2ZMDA 4A9SA 1NW1A 2QU6A 3O8PA 4RWJA 2VTSA 3HL7A 3D2KA 3LCDA 2EB3A 5IA4A 1EH4A 3IK3A 3WZUA 3EKKA 4H1MA 4CGAA 1Q5KA 3HNGA 3EJ1A 2V7AA 3R8PA 2XNGA 3TWJA 3OBGA 4IAIA 3MY1A 3VS6A 2QQ7A 2R3JA 2IVSA 4FTQA 5DT3A 3TKUA 3UIUA 4FIEA 4QQTA 4Y85A 4Z9LA 5M4FA 4I23A 3I79A 3KMWA 5J79A 2GQSA 2YAAA 4RX9A 4BF2A 4GSBA 1KOBA 4DEBA 3GCSA 5BPYA 3QCYA 4F9YA 4DFYA 4KRDA 3A62A 2Z7RA 5AR2A 1A9UA 1YKRA 4QMTA 5HD7A 5J95A 3ZSGA 2QOHA 4ZOGA 2QNJA 5EI2A 4A9RA 4UMPA 2HY81 4O22A 4K1BA 4E4LA 3MESA 3Q4TA 5ANEA 5C9CA 4JJRA 4IAYA 5DBXA 1OL1A 2YM7A 4I3ZA 1IEPA 2WELA 4KD1A 3KXGA 3E7OA 4EOKA 2JIUA 4O0WA 3GU5A 5A4LA 2OKRA 3OXIA 1UKHA 5I9UA 5B7VA 2CSNA 3TNPC 4Y83A 3LQ5A 4TN6A 4EK4A 2YABA 5CF6A 4F7SA 4FA2A 3ZDIA 5C4KA 1M14A 4PDSA 5H2UA 3COHA 3EHAA 2JLDA 4FODA 2EU9A 4IAZA 2Y4IB 4IMYA 5JT2A 2HWOA 2UZVA 3BHUA 4ZXTA 3IONA 2OZAA 4J8NA 4R3RA 4WNPA 2O2UA 3FZPA 2WMXA 5GZ8A
chains in the Genus database with same CATH superfamily
4G3DA 3TUDA 4KKEA 3ZS5A 3PIYA 4E4MA 3GC9A 3NW6A 3ZRMA 2QG5A 1Y57A 3EQDA 4V04A 4DF3A 4DHZA 1MRVA 3MSSA 4YSMA 3VNTA 2R3QA 2OZAB 3QYWA 3ZFYA 2I6LA 5JZNA 3ORZA 2CKPA 3H9FA 3UC3A 5IQAA 2WMRA 3LIJA 5EYCA 5DR9A 4I4EA 4FKJA 1BMKA 4XV2A 5TF9A 4GT5A 4RWKA 3N4VA 3MPMA 4EJ7A 1YHVA 3RNYA 2J2IB 3NW7A 3PXRA 4G6NA 4QMVA 4U8ZA 3DDQA 3U6HA 2JITA 4FTCA 2J50A 3FDNA 1OM1A 3FL4A 3D14A 4FV7A 3G5DA 3HDNA 3R8MA 3NSZA 2RIOA 4TT7A 1BL6A 4QDVA 1DAWA 4J1RA 4MVFA 3K54A 4RJ4A 2YACA 1H08A 3WBLA 4FTNA 1ZY5A 2XK8A 4XOYA 3TZ7A 4DHFA 3KXZA 4USEA 4BIDA 4TWPA 3MIYA 4FKRA 2UZNA 3U51A 2X9FA 5AMNA 4OTPA 4Q5HA 5AV4A 1YHWA 1GIIA 4FZDB 4HZSA 4E5WA 1H1WA 3QKMA 5AUVA 3W2CA 4IW0A 5BMMA 2XRWA 4ZAUA 3O5AA 3PFYA 4FSNA 4EK6A 4IXPA 3LKMA 4R77A 3OEFX 4JRVA 2VO7A 5CU3A 1J3HA 3F6XA 3F3UA 4EUTA 4WBBB 2B53A 5KKRC 2WNTA 4O7ZA 4ZY5A 3ORIA 1M17A 1CM8A 4YUQA 2WQBA 2F2UA 3SW7A 4WG5A 2VTHA 4GH2A 4ZTMA 4FTTA 3LCSA 3Q32A 3RPVA 4OTHA 5BUEA 3ETAA 3SV0A 3U4UA 3ZXTA 4O7TA 4YC6A 3PG3A 4I24A 3UIXA 3UOJA 4LL0A 4UY9A 1KE8A 3HMIA 3ZC6A 1KV2A 2ERKA 2G2FA 2QOOA 4KRCA 3P0MA 3PIXA 2W06A 3KRRA 4NKSA 4HCVA 5M4CA 3W0RA 4W9WA 5BQ0A 3TUCA 4QTDA 4GW8A 3O7LB 3NUPA 3QC4A 2H34A 4ERWA 2C6MA 4QMOA 4FIIA 5EKOA 4LRMA 2HIWA 3MW1A 4EC9A 3P23A 5LVLA 4OBOA 3IKAA 4TKSA 5FEDA 4AW2A 4ZY4A 1ND4A 4FT3A 2OJ9A 4C4EA 1FVTA 3F5GA 3QGWA 3W55A 5FDPA 4LG4A 4AZWA 2ZDTA 3DQWA 1G3NA 1QPDA 4OTGA 5E1SA 1WBNA 4KWPA 2FSMX 4RA4A 4E4NA 4NH1A 3C51A 3VN9A 5A9UA 3UIMA 4NFMA 3LCTA 3MTLA 5F94A 2O3PA 3OOGA 4IVDA 2O8YA 5CS6A 4ANMA 4DC2A 2AUHA 4FGRA 5BYYA 3IW5A 4CFNA 2UZDA 2PL0A 3P1AA 2UW0A 3NWWA 2OF4A 4XH6A 5AAFA 3M2WA 2V7OA 1ZOEA 3OUNB 4C59A 4HVHA 3G15A 4E3CA 4UYNA 3LJ0A 3MV5A 5J5TA 2IEWA 4O86A 2QR7A 3GOKA 3O8UA 2PYWA 3I4BA 3MA6A 5DR6A 4IAFA 2R0IA 5E91A 2J0KA 3BV3A 3P79A 3PG1A 3TKIA 3PZHA 2XNEA 3OC1A 4GS6A 4YZMA 4EOPA 5A4EA 4CFXA 3T9TA 3PJ3A 2UZLA 2Y8OA 3CY3A 3QD2B 1Z5MA 2V55A 3D15A 4FIHA 2JKQA 3NDMA 5DEYA 3BYUA 4O91A 3I81A 4Z3VA 1M52A 4BTFA 2OJJA 3IPHA 1Y91A 3REPA 5EDQA 4F70A 3KL8A 4PWNA 3C4FA 3FE3A 4GCJA 4RQVA 5HO7A 3PVUA 4AZSA 4WRSA 5JN2A 4JAJA 2XNOA 4JX3A 4K33A 2W1CA 3LJ1A 3ROCA 4GIIA 4PDOA 4ZTQA 3RK7A 4BDDA 4P90A 3TCPA 4FKIA 4O0UA 1P14A 1PKGA 2EXEA 4FV2A 4OW8A 5CVGA 3W33A 4ZLZA 5CF8A 5HE2A 3KA0A 3BU6A 3R83A 4XCUA 4DN5A 4OTIA 4USFA 3JS2A 3R00A 4F9BA 4H3BA 2XKFA 4E5BA 3HAMA 3G6GA 2C1BA 5IA1A 3R0TA 4GK2A 2XB7A 3KU2A 2R64A 3V5JA 3KY2A 5CF5A 1S9IA 5HICA 3DA6A 5EDRA 4PMTA 1H1PA 3F7WA 4O21A 4B8MA 2UVXA 5DG5A 1NT2A 1K9AA 2J5FA 3Q3BA 4GUBA 4ITHA 3MH3A 2A27A 4A9TA 4A4OA 4X7QA 5CNNA 4A07A 3DDPA 3V5QA 2GHMA 1OZ1A 3R7OA 4FSWA 4FZFB 4L3JA 4C3RA 1JKTA 2NNWB 1OUYA 4I41A 1YOLA 2G9XA 3IDPA 2XYUA 4Z16A 2QO9A 5JFSA 4NTSA 2X7OA 1XH8A 5AUUA 5M44A 2WEVA 3RI1A 2X0OA 3VUDA 3DQXA 3IW6A 3ZZEA 4O4EA 2O0UA 5TKDA 1Y6BA 3SC1A 2FSOX 4I0TA 4UB7A 1PXLA 4RVMA 5JQ8A 2GNIA 2PMIA 3L9MA 2PHKA 4BDEA 2PE2A 4OT6A 1UU3A 4W4YA 2XF0A 4FV5A 3AD4A 4HNIA 3AD5A 2OJFE 3QFVA 4P2KA 1H4LA 2J4ZA 3C13A 3OCSA 4IWQA 4QEBA 5HLWA 5JGDA 4FL3A 3LLTA 1B39A 1FINA 3C4EA 3F5XA 3ZDUA 4LYNA 4UYAA 5HVJA 1BYGA 5CVHA 3W0SA 2QOLA 3FLNC 4BICA 3M1SA 3BU5A 4UWYA 2GS7A 2C6KA 4KA3A 3PRFA 2IVTA 3EN5A 5GZAA 3R7VA 5CI6A 3FKNA 4D2PA 4GUEA 4XLIA 4X6QC 4MWIA 2B9IA 2WTWA 2OI4X 3W8LA 3AKJA 4HVDA 1GOLA 3H30A 3ORTA 2WMSA 1XMMA 5BYLA 4UBAA 4UX9A 5K0KA 1PJKA 5EK7A 5EFQA 2X9EA 5EM7A 3GFWA 2FYSA 3OXTA 4MHAA 1UV5A 3PFQA 3E3BX 3OXZA 3KMMA 4K2RA 5I3RA 2R3KA 3BCEA 5F9EA 2J9MA 2JDSA 5IH6A 3KK9A 4XBUA 4CFMA 3P7BA 3VUIA 4AU8A 2OSCA 3COMA 4F7LA 2BVAA 3D7ZA 3LOKA 4RBLA 3RINA 5KX8A 1Q41A 2WD1A 4JS8A 3RM7A 2XNBA 3COKA 3NUNA 4QPMA 5FTOA 4FKLA 4GIHA 1KE5A 3OCGA 3OWLA 4S34A 2VN9A 3DY7A 4QQJA 5E1EA 5M55A 3F88A 3BKBA 1UKIA 2CCIA 3ZONA 4ZJVA 2YWPA 4XG3A 2BZJA 3LW0A 4YBJA 3CC6A 4AWIA 2BZIB 4L43A 5K3YA 4P7EA 1W82A 2GTNA 5EQEA 3L8VA 2PUUA 4U80A 4WG4A 4C7TA 5IF1A 1OBDA 3U9CA 4DGOA 4AXFA 2UZUE 2WKMA 3WZKA 4WUNA 2XKCA 2YAKA 1LPUA 3AGLA 3OFMA 2DUVA 3TIYA 4B7TA 5ETIA 4DHIB 4ANNA 2QVSE 1YWNA 4ZIMA 5K4IA 3CE3A 3NYOA 4H3QA 4EHGA 2PU8A 1J91A 4NTTA 4CYJA 5E8VA 2Z02A 2FB8A 2Q0NA 1IA8A 4G3EA 4U81A 2XP2A 3VHEA 3FXZA 4EOIA 2W4JA 2XAMA 4O7YA 3O7LD 5KBRA 5FUTA 5EH0A 4WRGA 4XEYA 4I20A 3QKLA 4DTKA 4O7VA 3CBLA 3VC4A 5LMKA 2VO3A 1DM2A 3TTIA 2XBAA 3SGCA 5CEMA 3T9IA 1NA7A 3RAWA 2CLXA 2WQMA 3OY1A 3VUHA 3AKLA 3G6HA 4ASXA 3DTCA 1LR4A 1U54A 2AC3A 2AC5A 3NAXA 1KE7A 5HTCA 4Y95A 5IISA 4GT3A 5KNJA 5FLFA 5L3AA 3VONA 2ITZA 4APCA 3FKLA 4RC2A 2Z8CA 2C5XA 3R9RA 4F08A 3EN7A 4GU6A 4JXFA 2WEIA 5AUYA 3WF6A 5IUIA 1ST0A 1U54B 3C4WA 5FWKK 3NS9A 2C3JA 4W4VA 5AUTA 2J0MB 4EH2A 1PYXA 2ZDUA 2G01A 4KBAA 3ORKA 3KXMA 1OIQA 4IACA 3CQWA 2HOGA 1ZMUA 2QOFA 3EQGA 5HLNA 1YXVA 3ZM4A 4I5MA 3BX5A 5H8BA 4G16A 2WTVA 3KN5A 3C50A 1GNGA 5D12A 4AGWA 3BHYA 5EDPA 2UVZA 1AGWA 2JDOA 3ORLA 4FKGA 3KK8A 4R6VA 3TZMA 4DGGA 4TWOA 1DAYA 3AC8A 3W2QA 3S2PA 4DAWA 1GZNA 2W9ZB 5L6WL 3AC5A 2VGOA 5GHVA 1YI3A 5EQPA 2WOUA 2Y9QA 3FZSA 4L45A 3L8SA 1OECA 3F9NA 5HE1A 2P33A 4TYHB 3DCVA 4FV1A 3BBWA 4GG5A 4II5A 4BWXA 5LARA 4MBIA 4FNWA 2BHEA 2YZAA 2QOKA 2FA2A 4O7NA 4MXYA 2C68A 3FL5A 3V8SA 4HGEA 4TPTA 3H9OA 2IPXA 5HVYA 3QKKA 3RHKA 3THBA 5IQDA 1JVPP 3PY1A 4BDHA 3IW7A 2R5TA 2BILB 2AQXA 4X3FA 4BKZA 4JBQA 3LFCA 1IG1A 4E6CA 1OGYA 4YSJA 5C4LA 2ITTA 4TWNA 3DKOA 3DNEA 4U42A 3DLZA 4C35A 4FNXA 4L3LA 4E7WA 1J7IA 5DA3A 2OFVA 4CYIA 4EBVA 4EK3A 5CLPA 4IB1A 4JX7A 3ALOA 4L3PA 4ZSEA 5T3QA 2QOIA 3K5UA 5DYJA 2PVJA 5FP6A 4RWLA 1YRPA 4X3FB 4XHKB 2IZTA 2W17A 3E88A 3RP9A 4IJPA 1XWSA 2JAVA 3UE4A 2UW6A 4Y46A 5CZIA 5HG7A 5IH5A 2VAGA 2I0YA 4ACMA 2KTYA 1MP8A 1STCE 3C4CA 2F2CB 2R3HA 3OHTA 3QQHA 4GYIA 4M7IA 3VWAA 2XBJA 4WA9A 3EQBA 2UW8A 5LVNA 5FBNC 3R22A 4BBMA 4O7RA 2F4JA 2VNYA 5IG1A 3BYOA 2FH9A 4AS0A 4FK6A 4I93A 2QURA 3EB0A 2C5VA 3FMMA 4FSMA 4LOQA 3R02A 3L9PA 3VS1A 3ZLSA 4CLIA 3R7EA 3F3ZA 3VBVA 4FSRA 2XM9A 4GYGA 3BHTA 4RX7A 1TKIA 5AR8A 2QU5A 4G9CA 4KAOA 1YWVA 4MXZA 4OTDA 4YZNA 4MQ1A 3MH1A 5AIKA 3W18A 2PVNA 3A61A 3I0QA 5F95A 3WF9A 4BBEA 3UQFA 2YFXA 3R7IA 4KBCA 3U4WA 3VBQA 4QMNA 1JWHA 1HCLA 3EZVA 3HA8A 3QCQA 3R01A 3UGCA 4D9TA 2YLFA 3BLAA 3FHRA 1VJYA 2VTMA 4WG3A 4C3FA 3DJ5A 2R3PA 3UOHA 4F7JA 1WBPA 2HYYA 4IDTA 3G0FA 3S0OA 3QX2A 3D94A 5AR5A 2HZ0A 2ZFYA 2FSLX 2Z2WA 1GJOA 4CQGA 2GQRA 3A2CA 2I0VA 4EZ3A 5AM7A 3QCXA 5E4HA 4A4LA 5L2IA 5EM6A 4PY1A 4AA5A 4HNFA 4EH7A 3ENMA 1WMKA 3KRXA 2XVDA 3UPZA 3QL8A 3DJ6A 4I6BA 4YC8A 2X1NA 1BI8A 1O6YA 4XG7A 4FVPA 2O63A 3IW8A 3MH0A 3Q9WA 4ZJJA 4ZSLA 3RK5A 3DPKA 3VUKA 4FK3A 2UW5A 4YO4A 1CMKE 3QTWA 4IDVA 2R7BA 3JR1A 5BVWA 4YURA 1XMLA 1LP4A 4RIXA 2HXQA 4YZDA 4QQCA 1W2DA 4CT1A 3R21A 5AP1A 2OXDA 2XUUA 4JI9A 4RVLA 3PYYA 4UALA 4AUAA 4K18A 4A7CA 5LVMA 4IANA 4IVBA 2B55A 4TXCA 2YJSA 1B38A 2PVKA 3LAUA 4G6OA 2I1MA 4J96A 4RIXB 4YGAA 5CAPA 5FM3A 3L9NA 1QL6A 4UXLA 3I1AA 1ZZ2A 4S33A 4H39A 2ITPA 2BZHB 3CPCA 5C1QB 4UEUA 4PP9A 1UU9A 4H58A 1TQPA 2YCQA 4IZ5A 3VHKA 4MXAA 3LCKA 5D10A 3V6RA 4C0TA 4CKJA 5JMSA 5BV3A 2C0OA 1REKA 2PVLA 1OIUA 2CDZA 1ZMVA 2B9HA 3OF0A 3Q52A 3RTPA 1OL5A 2YISA 4GVAA 4PMMA 4EBWA 2C6DA 2ZOQA 4FT7A 4I94A 5KZIA 3WYYA 3CTQA 5EYDA 3LLAA 4D4VA 3MY5A 3EQIA 3W8QA 3MWUA 4CVAA 2VX3A 3CSVA 2Q0BA 4O2PA 4TRLA 4MNEA 4AN3A 4BYIA 4QMPA 2E9PA 4NM7A 4L46A 5C26A 2I0EA 4QMZA 3C4ZA 2C0IA 4F6WA 1LUFA 3BWJA 2BTRA 4EH3A 1JKSA 3H0YA 4LL5A 3NFFB 3ODYX 4LDTA 1ZY4A 3SHEA 5AWMA 1TQIA 1GZ8A 1CSNA 4LOPA 3AMAA 2IW6A 3HUCA 4MNEB 3VAPA 5IDPA 2YWVA 4DCEA 2Y4IC 3EH9A 4CRLA 2B9FA 4I92A 4JBVA 2O65A 4FKOA 3E63A 4YR8A 5FGKA 3V8WA 3DBEA 5EW8A 3R7UA 3V51A 4YBKA 3RBWA 2QHNA 3VRZA 4DGLC 4I0SA 3PUFC 3OY3A 5HVKA 3PJ2A 3WIGA 4LUDA 4MUQA 3DJ7A 3BYSA 2G15A 2QI8A 4HW7A 4RVTA 1H24A 2CN5A 4UV0A 2W1ZA 4N6ZA 3F3TA 3QTSA 4G5PA 3BGQA 5ACBC 3BHVA 1OB3A 4ZTRA 1K2PA 1H01A 3DTWA 3BEGA 4X21A 4C62A 3NCGA 5J1VA 4N6YA 4G31A 3QU0A 4M0ZA 4XG9A 3DKFA 4BIEA 1TFFA 4B4LA 1MQBA 4JG6A 3TL8A 3O96A 1WBTA 2PPQA 5IKWA 3MN3A 4RC4A 2QR8A 5CF4A 4PTCA 3LMIA 2WTCA 1ZOGA 3CQUA 2GDOA 2X2KA 5HG9A 3UTOA 4S32A 3ZO3A 5KUPA 1VLRA 1ZYSA 5CAQA 2PMLX 4FNYA 5AR3A 5HESA 4FTKA 3RK9A 2XK6A 4CNHA 4QPAA 3DKCA 3ERKA 3TV6A 4QP7A 1SNUA 3E87A 1GIJA 5LWNA 4GT4A 2XCHA 5LQFA 1PF8A 3GUBA 5DRBA 3LQ3A 3RVGA 5HE0A 2VWUA 4U41A 3GCPA 5A4TA 5CAUA 4O27B 3JPVA 5BVEA 2WU7A 3PXZA 2BKKA 2ITOA 1BLXA 3A8WA 3UO6A 3CS9A 3NGAA 4U7ZA 2GHLA 4I5HA 3CP9A 4FNZA 4I5CA 5DI1A 3ZOSA 3CD8A 3RPRA 3MIAA 4LMNA 1FQ1B 5IA2A 2HY0A 3OEZA 3PJ1A 4ZZNA 3MB6A 5FG8A 5M51A 4IE9A 5JH6A 3LFEA 3POOA 1M2PA 3WZDA 3EYGA 3A99A 2ITXA 3AMBA 2CNVA 4Y72A 5IA3A 3TKHA 3LQ8A 5LVPA 4FTOA 3D5VA 3KF4A 4FTUA 1ZYCA 3R8LA 2ITWA 4NJ3A 3UDZA 4RLKA 3LFNA 2FO0A 5EOBA 4AE6A 3S00A 1XJDA 4WHZA 3FJQE 4Q9ZA 1OGUA 5DGZA 4FV8A 4I1ZA 3FMNA 5KBQA 2CCHA 4DH1A 3CCNA 2BAKA 1YWRA 2XNPA 2YCFA 5AUXA 1Q3WA 4ID7A 3T3VA 4DA5A 2WTKC 4M15A 2XIRA 2X4ZA 3NZ0A 3PTGA 3OCBA 4BGGA 4XYFA 4MBLA 4M67A 4NUSA 2PE0A 4O1OA 5JGAA 3FLZA 3POZA 2B9JA 2IZUA 4F99A 4RMZA 4ONAA 3S3IA 1G8KA 3UDTA 1XQZA 3I0OA 4ZMFA 1ZMWA 3SOCA 4RJ7A 5K5NA 4K0YA 3H9RA 2BAJA 4FL2A 3UG2A 3LHJA 4U44A 2BIYA 4Y5QA 4JDKA 4O0XA 1TQMA 5BYZA 2CN8A 2PMNX 3GGFA 2G2HA 4AA0A 4XS2A 4NFNA 3B8QA 1M7QA 3BYMA 2BTSA 2Z7SA 4KSPA 2ITVA 5CASA 4IB0A 2C5NA 3ZEWA 2H6DA 3ATTA 5IDNA 4ZTSA 4CFWA 4CFUA 2C3KA 4KKHA 4YHFA 4UMUA 4R5YA 5AV1A 5HTBA 3W10A 4E6QA 2OJIA 5CSHA 4F63A 3EQCA 3HV6A 1XH9A 4AW0A 5K5XA 4XV3A 3BE2A 3DBQA 4CRSA 1UU8A 3WZEA 3C9WA 3G90X 3F5PA 3TMOA 1KOAA 4HJOA 3MDYA 5AA8A 3CD3A 2XH5A 3NR9A 2XIYA 4NM5A 2ETRA 2GNFA 3K3IA 4YNEA 4EYMA 3LJ2A 3FYJX 4FKTA 3TNIA 1KE9A 3IDBA 1W98A 2HW6A 2WTJA 3V3VA 3HECA 2GNJA 3GENA 3QF9A 4IWDA 3ZUUA 3ZRLA 4QOXA 2WMVA 3F69A 3W32A 4L67A 3PLSA 4L6QA 2YHVA 5BVNA 2W1EA 4MH7A 5T68A 2QC6A 2WQNA 4NM3A 3ZO1A 5LMBA 3EKNA 4BI0A 5D1JA 1CTPE 3HLLA 5DMZA 3L9LA 3Q9ZA 5IQBA 4M14A 4ENXA 5JRQA 3S1HA 1WCCA 1WVWA 4QRCA 3IDCA 3CIKA 4KKGA 4FYOA 5AP6A 3BQRA 2A19B 5BX0A 3R7YA 3RAHA 3LM0A 5B2LA 3FY0A 5J1WA 1RW8A 4BR3A 2HENA 2HK5A 4E4XA 1P2AA 2PY3A 4ACHA 2BFYA 5AAGA 3TEIA 1R1WA 2PVMA 3IGGA 5CZHA 4IIRA 2F9GA 3G51A 3UOLA 5ETFA 1T46A 3QQLA 5L4QA 4M13A 4BCQA 4L9IA 5T6KA 5HORA 1OIYA 3QRKA 4DH3A 4RIYA 4USDA 4WSQA 5J9LA 4YO6A 5BVOA 2C6OA 1UNGA 3GC0A 4HYIA 5LCKA 5KHXA 3CTHA 2B0QA 3QHRA 4OGRA 1O9UA 4O6EA 4QO9A 3ORNA 3UDBA 3CEKA 3KIOC 3D4QA 4BWKA 1UNLA 3BHHA 3FLSA 4DYMA 4YP8A 2JEDA 2P0CA 4F0IA 2UZOA 3P5KA 3C5IA 3PIZA 3NX8A 4RIYB 4RC3A 2UW3A 3H3CA 5AV3A 2UW9A 1JOWB 3Q04A 4AX8A 3R2YA 4DH5A 2ITNA 4WNMA 1IAHA 3FMKA 2CKOA 2VTOA 3E92A 5A3XA 4DFUA 4BKJA 4F0FA 4FV6A 4ZZOA 4BZOA 2IZSA 5H3QA 1DI9A 4IADA 4NZWB 3U8WA 4M69A 3IOPA 2YA9A 2PZPA 4LUEA 2C69A 4YC3A 2BMCA 4W9XA 4ZSAA 3ZU7A 1J1BA 4FUYA 4J95A 3FMDA 2VWYA 2G2IA 4IB5A 3PZEA 3PA3A 3RKBA 4BI1A 1WZYA 3OOMA 4FTIA 4M69B 4QTCA 3AG9A 3V5LA 3ZYAA 4A06A 2YLEA 3SDJA 1GIHA 2UZEA 4FZ7A 4AT3A 2AYPA 3O17A 3QXOA 5CU4A 5DVRA 3FYKX 3VW6A 3UQCA 3GU4A 4M97A 2B1PA 3QTQA 4AGUA 4YZ9A 3SG9A 4MAOA 4K8AA 1YXSA 1ZOHA 4O0SA 2QKRA 3V04A 3NEWA 3OMVA 4L52A 5M57A 4CCBA 5HOAA 4G1WA 3U87A 1XH5A 2AEGA 2BRGA 2X2MA 2F7EE 2W9FB 3ZHPC 4QNAA 3W0MA 3FMEA 1JAMA 5HD4A 4C37A 2WOTA 4EQMA 4C2WA 2J51A 4LMUA 3FEGA 3NMUF 5GINE 5CAOA 2WMWA 3D0EA 4DFNA 2BZKB 2KULA 2OG8A 3DZQA 2J90A 2YM3A 4K9YA 3FXWA 4WIHA 4F9WA 3ZLWA 4O96A 5AX9A 3TM0A 1MUOA 2CKQA 2RFNA 4E5AX 2IVUA 4JQ8A 4UWBA 2XK4A 4BDAA 2R3RA 3FBVA 5HQ0A 4RVKA 5KE0A 4DHJA 5EW9A 5FM2A 3EFLA 5CQWA 3ZFMA 4C34A 1H00A 3WILA 4R1VA 4BTMA 4D4YA 4J7BA 4O81A 4JG8A 4QP8A 1GY3A 2IVVA 3WI6A 4ANOA 2GFSA 4PL4A 4BGQA 2YN8A 4BKYA 1PW2A 1XBCA 1PMUA 2GTMA 4MX9A 2XK3A 5B2MA 4L42A 5L6OA 3PJCA 3F2RA 1Q24A 3QA8A 3UIBA 4EKKA 2PZ5A 3Q2MA 3Q4ZA 3EIDA 3P7AA 4JT3A 5HHWA 4A4XA 1WBSA 4JNWA 4UWCA 4ASDA 2JBOA 4IX6A 1Y8YA 4JDIA 4U6RA 3BEAA 3BLQA 3KKVA 5IEVA 5HLPA 2X39A 5HE3A 4DEGA 1JPAA 2HELA 3R6XA 4O1PA 4E26A 4E8AA 5JFXA 4C57A 2R3LA 1P5EA 1W2FA 5D9HA 3Q5IA 3DLSA 3HV3A 5CEOA 4LV7A 2X7FA 3ZSHA 4GU9A 4IX4A 2PVYA 2LGCA 3NFGB 4O0YA 4B9DA 2OK1A 3ORPA 4EJNA 4JDJA 1T45A 4RX8A 1FOTA 2VWWA 2YITA 4U3YA 4EH9A 3TJCA 5KKRB 3JY0A 3SRVA 4GJ3A 3LVPA 1L8TA 2HW7A 5E8YA 2WO6A 1G5SA 4NT4A 4FYNA 2W99B 4BBFA 2RG6A 3VS0A 4D9UA 3QZGA 5CU0A 2XMYA 5KMJA 4WO5A 3GBZA 3MS9A 3KXNA 3SRVB 3QGYA 3RNIA 5FQDC 4FKQA 3R8ZA 4BI2A 3SW4A 1FMKA 3EN6A 2P3GX 5C8NA 2GFCA 3QZIA 3PE2A 3AMYA 3PY3A 2GSFA 3R9OA 1UNHA 4KS8A 3WIKA 2YZLA 2ZAZA 4IWPA 3R63A 3W0PA 2QOBA 2BRNA 1BI7A 3O50A 1OL6A 3DS6A 4CXAA 4WKQA 2JDRA 3AXWA 3KULA 3ACKA 3DKGA 3AC1A 1E1XA 5I0BA 5ETCA 4BCHA 1GZKA 3MPAA 2BRMA 1NY3A 4PRJA 3V6SA 2W1IA 3W0OA 5EHOA 3VS3A 1PXNA 3F2NA 4TTHB 4BZDA 1XKKA 2XJ1A 4XLVA 3C1XA 2C4GA 3RMFA 3VBXA 5A14A 3KULB 5JKGA 1YDTE 1ZWSA 2VO0A 3O23A 3UQGA 5DH3A 4I22A 5CSVA 4XX9A 4EL9A 3UJGA 4DFBA 4AZFA 2OH0E 2OW3A 3BBTB 3CLYA 2GHGA 3KQ7A 3HRBA 5CEPA 1A48A 3ML1A 5IU2A 2A4LA 4EI4A 3QUDA 3V5TA 5LXMA 4FT9A 3OP5A 2RL5A 3ANQA 5BVDA 2Z7LA 2FSTX 3GXLA 2JKMA 3AT2A 3QQUA 1VR2A 3R30A 3MB7A 4X3FC 4U79A 3U6JA 3DAJA 4XMOA 4Y73A 3OTVA 4RWIA 3TI1A 3KREA 5K9IA 1CKPA 1SVEA 2GS2A 3NVKI 4D4SA 2X4FA 3HV4A 4RLLA 3GCVA 4RJ6A 5CT0A 4QP9A 5CAVA 5HU3A 1VEBA 3F3WA 2WMBA 1OL2A 3BGPA 2P2HA 3PXQA 5K4JA 1IR3A 2W7XA 4ALUA 3CXWA 2OWBA 5E8ZA 4A9UA 3QRIA 4BYJA 3QWJA 3ZO2A 1XH7A 3PVGA 4NW6A 5GJGA 1Q8YA 3H0ZA 4D2SA 2YM6A 3CQEA 2JAMA 2GCDA 4IC7A 3SX9A 3C0IA 2R3NA 3QRTA 1KE6A 4H05A 1PMVA 2IO6A 4F65A 2BROA 4FX3A 4CMUA 1XH6A 4BDKA 2VTQA 3MTFA 4W8DA 2HXLA 4U0IA 2V5QA 3F82A 3VF9A 4PP7A 2VD5A 3I6UA 5A54A 3UDSA 5ANKA 3QQFA 3G9LX 1OKWA 3FPMA 2LAVA 2PE1A 3A60A 3FMJA 2VZ6A 3E5AA 2C30A 4HPUE 3D2IA 4JOAA 2Z60A 4KSQA 4PQNA 4YJTA 5ANGA 4EONA 2QG7A 2ONLC 5C8KA 3I5ZA 3QWKA 4UMRA 5L8JA 4TYEA 3QD0A 3UMWA 4H36A 3ZFXA 3GFEA 3HRCA 4BCKA 4KIOA 3DOGA 1W0XC 1YHSA 2JFLA 3KVWA 4OTQA 2VTTA 3ZUTA 5JK3A 4ZS4A 4JBPA 1CKJA 5CU6A 3ZLXA 4QQ5A 3PPKA 5K0XA 5C8MA 4DBNA 3EMGA 1SVGA 5DR2A 4TYJA 3W0QA 2X8EA 2YCRA 5HIDA 4R3PA 1R3CA 5M4UA 4AQCA 3D83A 4G3FA 4TNBA 1G8SA 4BY9E 2GMXA 4O7SA 4CZYB 4FE2A 5TT7A 3TNHA 3UOK