1YI23

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule keywords 23S Ribosomal RNA
molecule tags Ribosome
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1yi2300
1KD14 3CPW2 1YJN3 3CCJ3 3CCE3 1YI23 1KC84 3G713 2QEX3 3CCV3 1JJ22 1QVG2 3CCU3 1YHQ3 2OTL3 1VQO3 1YIJ3 1YJ93 1VQL3 1K9M4 1VQ93 1Q7Y4 1K8A4 1VQ73 1VQN3 3I553 3I563 1M1K4 3CD63 1VQP3 3CCM3 1Q824 3CC23 1QVF2 1Q864 3CCS3 1VQ53 1VQK3 3CME3 1M904 3CC43 3CMA3 1Q814 2QA43 1W2B2 1S723 1YIT3 3G4S3 1VQ63 3G6E3 3CXC2 1YJW3 1VQ43 1KQS2 1K734 2OTJ3 1VQ83 1NJI4 1VQM3 3CCQ3 1N8R4 3CCL3 3CC73 3OW22 3CCR3
chains in the Genus database with same CATH superfamily
2XFSA 3GZYB 1BGSA 1KD14 5HGRA 4NREA 1K41A 4LMIA 5G1KA 1FA3A 3S27A 1BNGA 3LTDA 2AAEA 1IYYA 2YFJB 2ZHXB 4J9AA 4KFDA 1JN5B 1GYBA 3LMLA 4R1KA 2KF6A 4HM2B 1VQP3 4RZMA 2CHCA 1BNSA 4R9LA 3GRDA 2GXFA 4STDA 3WHOA 1QVF2 1JRQA 3KN4A 3CCS3 1HKXA 1FGOA 1G0TA 1WMOA 3BNBA 3F8HA 3CC43 3NUVA 1YVSA 2IYJA 1MGWA 3NX0A 3FF0A 3WOEB 3N9HA 1IV9A 5I97A 1UI7A 2XGNA 3O8YA 2E2VA 3D3LA 1IDPA 2A15A 1JZOA 1AQZA 2Y73A 2WOFA 2ZDJA 3KIIA 1DETA 2FNQA 1UCIA 1JBTA 3ER7A 4CPKA 4N6NB 4CJNA 5IEPA 2KF3A 1WMNA 3EJVA 3B4OA 2CG1A 2D42A 1LRAA 1BSBA 1UUVB 1MWRA 1JKGA 1R4CA 1SIIA 1OGXA 3HX8A 3MG3A 4HM8B 1BRNL 2XRXB 4EW5A 5IG4A 1NB3I 4EXRA 3DY5A 2OCTA 3DH2A 4LGQA 1I8VA 1M1XB 1I70A 4EV2A 2OOVC 1ZGXA 2FXTA 1JZDA 2P09A 2UGIA 3B7CA 3NV0B 2L4VA 3DGMA 4MMXB 1US1A 1UGHI 1YIT3 3G16A 1S723 1PU4A 2H0IA 1BNEA 1OHPA 2J8XB 1V57A 3EN1B 1RCLA 1A67A 3BNDA 2Y74A 3CCR3 1W6YA 4FCJA 1O7WB 2KXGA 1K28A 3IPTA 2CC3A 3NHXA 4JF8A 3SXXA 2CFDA 4DKIA 1QVG2 1B27A 3PXMA 4XB5A 4J8TA 4CDLA 3G8ZA 7GSPA 1UCLA 3K9MC 5STDA 4HM0B 1K8A4 3DM8A 1Q42A 1ZO2A 5TGNA 1CQSA 1Q40A 3AMOA 2GEXA 2FGTA 1G02A 1WTHA 1WMPA 3UNLA 1CYUA 2RFRA 5JPPA 3S5CA 2F99A 1BSEA 3MG2A 4O3VA 3G4S3 1RNTA 1MWUA 3N54B 1KQS2 4I4KA 2OWPA 2GU3A 1DVDA 1S5AA 4AEQA 2XGLA 3NQYA 1FUSA 4NPBA 2IY2A 2HMLB 1MNLA 1WNHA 3V98A 1IVXA 1RNBA 1RGLA 3CCV3 5HOHA 2M7OA 1NNVA 1OF5A 1W6GA 3H51A 2W9PA 4HZBB 1RN7A 3MPHA 5ELJA 3EE1A 5CF2A 1VQ73 1A2VA 1IQ8A 2WOHA 2INXA 3BB9A 4HAAA 5AEWB 3HIGA 3LT8A 1OH0A 3CCM3 1B2XA 1UCKA 4K90B 2STDA 3GSPA 6GSPA 2H0HA 5EEOA 1ULIB 1RKYA 1M904 1DYUA 4FMAA 2W6JH 4CCVA 2BNGA 6RNTA 4MMZB 3SEDA 1OHSA 1BSAA 3CXC2 3SLUA 1GSPA 4KFFA 5AYRB 1OGZA 1A2PA 5FW5A 3PYJA 3WODG 2MF7A 4KVHA 1M9GA 1DE3A 1JNQA 3DMCA 4R80A 3BIRA 2GBWB 2IUKA 1UI8A 1UUWB 4OVMA 3SOAA 2XR8B 1J2BA 3T8NA 1VQO3 1K9M4 2KRTA 5A0OB 2KF4A 1BIRA 1RCKA 2CW9A 2W9QA 1ZX2A 3I553 2IMJA 5IEOA 4N6OB 2YX9A 2C10A 3UL5A 2CG0A 2H0GA 2Q07A 1LOVA 2XSHB 5BXQA 3D79A 4U13A 4L7KA 1RGFA 3NM2A 3UL6A 4AKYA 2JQ5A 1RRLA 1TTOA 2ZL8A 3FF2A 4K1VA 4WYKA 5IF6A 1RGEA 2HOHA 1EKMA 3IMAB 5BVBA 2HMKB 1X1UA 1LQMB 3F7SA 4O2HA 2C11A 1NWWA 1K734 2OTJ3 4EBGA 1OACA 1YVBI 2P0MA 3GZXB 3Q3FA 3ZFZA 1VQM3 1NJI4 2UUGC 2W03A 3BNEA 3OX9A 1RSNA 3EF8A 4MMYB 2WGQA 3DGOA 5RNTA 3WOFB 1HZ1A 5IW9A 3CCU3 1AVKA 2XF3A 2ML5A 1YIJ3 1VQL3 1B20A 1DMNA 3D5GA 1LOXA 5IERA 1RDSA 1JN5A 3TDGA 1W2ZA 4HOHA 5D82A 1NB5I 3D9RA 1GD3A 3FG1A 1BNJA 3WA2X 4HYZA 3X3ZA 2RGQA 2QIYA 1W4NA 1SIHA 1VQ93 3JUNA 3G6E3 3EBTA 3EN8A 3K63A 3A76A 3K0ZA 4EYCA 3MYTA 4GL6A 2CFGA 5IG5A 3BNCA 5LC7A 3J7Yd 1UW1A 2GSPA 3FSDA 3K7CA 1AR0A 4K1UA 3Q90A 2W56B 1KSIA 2R4IA 2BMRB 2W0QA 1YI23 1W6CA 5AIHA 1GOYA 3BU4A 1BU4A 4XDWA 5JPUA 2F5MA 1IVUA 1BRKA 1LXEA 1Q7HA 2V1LA 3I563 3MKIA 2F5WA 1PY3A 3KFQC 3LTBA 2K3DA 5KP1A 1TU5A 1ISKA 4HM5B 1GD4A 4NHFA 2HMMB 1YGWA 2BMOB 1RGHA 2SBLA 1IV7A 1O7MB 3AHSA 2CWVA 3NV0A 4L8OA 5GSPA 5CK6A 1VQ63 3BLZA 3LOYA 1QJGA 3OWSA 2HMOB 1MGRA 3WDGB 3WR2A 1MOLA 2BO9B 4IT7A 1DMQA 3LH4A 3ZG5A 1RHLA 1Q824 2CWTA 3CCE3 4GHOA 4J5GA 2WGOA 1RGAA 3DUKA 3PGBA 1ROVA 2K0MA 1RTUA 2HMJB 1B2SA 3B8LA 4HZ9B 3KCHA 2F98A 1W01A 2CWUA 1W7CA 3DXOA 4QWTA 1AVLA 5AIIA 5LC6A 4TX4A 2Z76A 3GWRA 4BTWA 1LOYA 2ML6A 2CKFB 1BRJA 4HJLB 1A2KA 4OUQA 4X2OA 1Y4KA 4KT3B 4FR9A 1U5OA 1W02A 3FH1A 1JBSA 3CMA3 3UB1A 1Q814 1BNRA 2CIUA 2BMQB 3PCRA 3LXUX 1VQ43 4IIAA 3G0KA 7STDA 1TIJA 2JDIH 5CLKA 2KAAA 1UCJA 4Q53A 1RMSA 2RCDA 1JB4A 3CC73 1T5YA 2IA7A 1JV2B 3G713 3PS8A 3OV4A 8CHOA 2QEX3 4ZM8A 2OTL3 2O9UX 1YJ93 1B2UA 5KP3A 3OWYA 1BSDA 3GZBA 1RGGA 2GU1A 3OWUA 3U1WA 1BOXA 1I2EA 1Q40B 1GMQA 2LQVA 3HZPA 3L0RA 4H61A 1N9JA 1EUIC 2YFLB 1IU7A 2F86B 1GMRA 4EC6A 1DVCA 1STDA 3RGRA 1HYFA 2L1SA 1IQYA 1X1WA 3NQZA 5DRVA 2Z6BA 3M8CA 1UDII 1HU9A 3VGNA 1OPYA 4XBXA 1V74A 3CCL3 4EV5A 1RN4A 2CFLA 4IPBA 3LZAA 1FUWA 3FGYA 1ASKA 1B2MA 4G1MB 3UJMA 1QALA 2KCDA 2P0XA 3F40A 5IENA 1VQN3 1PFPA 4HM1B 4JRFA 5G2GA 3F7XA 2W2CA 1YGEA 2RBIA 2BU4A 3LT9A 1LNIA 3CNMA 4GSPA 3AGOA 4WFOA 1VQQA 3PCSA 1AV4A 5CXOA 1VQK3 2GEYA 2O3OA 3FLJA 4BTYA 1RN1A 4MEIA 1FGMA 3ALAA 3Q2PA 1ZS7A 5G1LA 5FGOA 1FGQA 3ECFA 3T8UA 4N6MA 1D6ZA 3I0YA 3HI7A 3CNXA 4HBRA 4RBNA 1IT8A 3F9SA 3RGAA 3K5TA 1BUJA 4H3UA 3OW22 1V58A 4O02B 5KP4A 3CPW2 1O7HB 2Z7AA 4XM4A 1BANA 1NO3A 3VSYA 1I0VA 3LTCA 4GB5A 5AI1A 1L5GB 1FW7A 4FCMA 1O7PB 1T2IA 3KE7A 1JB5A 1IQXA 1TP6A 1IK3A 3DGLA 1IT7A 1R4YA 1Q864 1LOWA 1GS3A 1VQ53 4K61A 2PNCA 1BAOA 3N8BA 3V92A 3RDEA 4WHAA 5DREA 3EHCA 5EVHA 3GAXA 5M19A 3IJEB 4N6UA 2ZA4A 3LYGA 1LVNA 1NU3A 3FZWA 4PEJA 2RNTA 1BNFA 2W56A 4FMCA 2XEPA 2YFIB 4RNYA 3CCJ3 3WMDA 4OK0A 1AY7A 1W00A 3X42A 1JJ22 4LZIA 6STDA 3D5IA 4L8PA 4HVNA 1RGCA 3WA3A 1BRGA 3CD63 5M1AA 4BL3A 2XH9A 3JUMA 1U8CB 1BVIA 2B1XB 1N5PA 1BSCA 2OOVA 3SVAA 1EQKA 3EBYA 3SYUA 1OUNA 3DGYA 3JUOA 4X2HA 1W2B2 5D83A 3EB8A 1PYLA 1JBRA 2XFTA 2AADA 1Z1SA 3MSOA 4KZ1A 4R9KA 4ILFA 2E2UA 4J5KA 2IUJA 2CX1A 1LNHA 3MG1A 4FMBA 3ZG0A 2BIRA 3X3XA 1MWSA 3PZWA 3NM7A 1UUGB 3URPA 3S28A 2CX0A 1JKGB 1QMAA 2CH9A 4RNZA 3B4PA 1CEWI 1NDOB 1CH0A 1TFKA 5M18A 1E3VA 1B2ZA 4BU4A 1FGRA 1LQGC 2SARA 2CK3H 1QAFA 3MWZA 3E99A 3NBJA 5AIFA 1BUQA 3FKAA 1WQLB 4XBTA 8RNTA 3KSPA 2Z77A 5EQLA 1RJOA 4FMDA 1I3IA 2F4YA 1CYVA 3V99A 1N8R4 3T0UA 4RNTA 1O7NB 2K54A 1C54A 1B21A 1Q9EA 1SJWA 1UGIA 4O8SA 1I0XA 1YJN3 2KF5A 3DZLA 2W04A 2E2TA 3JUQA 3STDA 1YHQ3 3JVCA 1QAKA 1EA2A 1Q7Y4 1B3SA 3MHEA 3VF1A 1I3FA 5IG0A 1C7HA 3AMOB 3ROBA 1MWTA 3FG3A 4LSOA 1TUHA 1RGKA 2MC8A 2LYXA 2OQEA 3CME3 1N9EA 4HKVB 9RNTA 1A90A 5CF1A 2HMNB 1YNVX 3FCSB 2QA43 3A5EA 1X1XA 1FYSA 4N3VA 3LTAA 4HM4B 1T3BA 1W5ZA 3U97A 1BNIA 1FZUA 2F56A 1YJW3 3EC9A 1VZZA 1DMMA 1EEJA 3KSED 1IVWA 2I9WA 3S29A 1GY6A 1I2GA 7RNTA 2UX0A 4BL2A 3QRDA 1N5HA 3QK9A 1BRIA 3HIIA 1BRSA 1OF5B 2B24B 1OCVA 4N6TA 2P38A 4LEHA 4HM7B 3X41A 5AEUB 2WO0A 5D81A 3KZTA 1M1K4 2CFWA 3S67A 5BIRA 1JB2A 3CC23 4AKZA 1N8QA 2BHMA 1KWIA 1SARA 1STFI 3JUPA 1IVVA 1TRQA 2BT3A 1D6UA 2CFKA 2OQEC 2PZVA 2XSOB 3FG4A 4FCZA 4XBYA 3SX1A 4BTXA 1FGTA 3NBRA 1F8NA 3NBBA 1RLSA 4N6LA 1T2HA 3EQQB 3DGNA 4MJDA 4ORLA 4N6V0 4WP5A 3X3YA 1ULJB 4XDVA 3RNTA 4WWUC 1GY7A 1E97A 3CCQ3 1OHOA 1FUTA 1VQ83 3AGNA 3HOHA 1D6YA 3F14A 1KC84 3CPOA 5AYSC 1SPUA 4LYLB 1ROAA 3OXAA 3H3HA 5AIGA 1GOUA 5JBSA 1GOVA 1BRHA 1TJDA 2R41A 3AHWA 3CU3A 1G96A 5ELUA 3KKGA 5IG3A 3F8XA 1TRPA 1SQWA 1RRHA 4KFEA 3GZRA 4R4KA 2D1WA 1GY5A 4I5QA 1X1YA 4HM6B 4WYKB 3SOYA 3X40A 1EG9B 1TFOA 1GMPA 1E3RA 2P05A 3D4AA 3NXJA 2GBXB 2RSXA 3Q1CA 2QGUA 1O7GB 5BU4A 2C4BA 4HM3B 4BIRA 1I2FA 3HK4A 3EX9A
chains in the Genus database with same CATH topology
2XFSA 3GZYB 1KD14 5HGRA 4NREA 1K41A 4LMIA 1FA3A 3S27A 3LTDA 2YFJB 4J9AA 4KFDA 1JN5B 1GYBA 3LMLA 4R1KA 1VQP3 4HM2B 4RZMA 2CHCA 4R9LA 3GRDA 2GXFA 4STDA 1QVF2 1JRQA 3KN4A 3CCS3 1HKXA 1FGOA 1WMOA 3BNBA 3F8HA 3CC43 3NUVA 3NX0A 3FF0A 3WOEB 3N9HA 1IV9A 5I97A 1UI7A 2XGNA 3O8YA 2E2VA 3D3LA 1IDPA 2A15A 2Y73A 2WOFA 2ZDJA 3KIIA 2FNQA 3ER7A 4N6NB 5IEPA 1WMNA 3EJVA 3B4OA 2CG1A 2D42A 1UUVB 1JKGA 1R4CA 1SIIA 1OGXA 3HX8A 3MG3A 4HM8B 2XRXB 5IG4A 1NB3I 4EXRA 3DY5A 2OCTA 4LGQA 1M1XB 4EV2A 2OOVC 2FXTA 2P09A 3B7CA 3NV0B 2L4VA 3DGMA 4MMXB 1US1A 1YIT3 1S723 3G16A 1PU4A 1OHPA 3EN1B 1A67A 3BNDA 2Y74A 3CCR3 1W6YA 4FCJA 1O7WB 2KXGA 1K28A 3IPTA 2CC3A 3NHXA 4JF8A 3SXXA 2CFDA 1QVG2 3PXMA 4XB5A 4J8TA 4CDLA 3G8ZA 3K9MC 5STDA 4HM0B 1K8A4 3DM8A 1Q42A 1ZO2A 5TGNA 1CQSA 1Q40A 3AMOA 2GEXA 2FGTA 1WTHA 1WMPA 3UNLA 1CYUA 2RFRA 5JPPA 3S5CA 2F99A 3MG2A 4O3VA 3G4S3 3N54B 1KQS2 4I4KA 2OWPA 2GU3A 1DVDA 1S5AA 4AEQA 2XGLA 3NQYA 2HMLB 1MNLA 1WNHA 3V98A 1IVXA 3CCV3 2M7OA 1W6GA 1OF5A 3H51A 4HZBB 2W9PA 5CF2A 1RN7A 3MPHA 5ELJA 3EE1A 1VQ73 1A2VA 1IQ8A 2WOHA 2INXA 3BB9A 5AEWB 3HIGA 3LT8A 1OH0A 3CCM3 4K90B 2STDA 5EEOA 1ULIB 1RKYA 1M904 1DYUA 4FMAA 2W6JH 4CCVA 2BNGA 4MMZB 3SEDA 1OHSA 3CXC2 3SLUA 4KFFA 5AYRB 1OGZA 5FW5A 3PYJA 3WODG 2MF7A 4KVHA 1M9GA 1JNQA 3DMCA 4R80A 2GBWB 2IUKA 1UI8A 1UUWB 4OVMA 3SOAA 2XR8B 1J2BA 3T8NA 1VQO3 1K9M4 2KRTA 5A0OB 2CW9A 2W9QA 1ZX2A 3I553 2IMJA 5IEOA 4N6OB 2YX9A 2C10A 2CG0A 2Q07A 2XSHB 5BXQA 1FUWA 4U13A 4L7KA 3NM2A 3UL6A 4AKYA 2JQ5A 1RRLA 2ZL8A 3FF2A 4K1VA 4WYKA 5IF6A 1EKMA 3IMAB 5BVBA 2HMKB 3F7SA 4O2HA 2C11A 1NWWA 1K734 2OTJ3 4EBGA 1OACA 1YVBI 2P0MA 3GZXB 1NJI4 1VQM3 2W03A 3BNEA 3OX9A 3EF8A 4MMYB 2WGQA 3DGOA 3WOFB 5IW9A 3CCU3 1AVKA 2XF3A 2ML5A 1YIJ3 1VQL3 1DMNA 5IERA 1VQ93 1LOXA 1JN5A 3TDGA 1W2ZA 5D82A 1NB5I 3D9RA 1GD3A 3FG1A 3WA2X 4HYZA 3X3ZA 2RGQA 2QIYA 1W4NA 1SIHA 3JUNA 3G6E3 3EBTA 3EN8A 3K63A 3A76A 3K0ZA 4EYCA 3MYTA 4GL6A 2CFGA 5IG5A 3BNCA 5LC7A 3J7Yd 1UW1A 3FSDA 3K7CA 1AR0A 4K1UA 3Q90A 2W56B 1KSIA 2R4IA 2BMRB 2W0QA 1YI23 1W6CA 5AIHA 5JPUA 4XDWA 1IVUA 1LXEA 2V1LA 3I563 3MKIA 3KFQC 3LTBA 1TU5A 5KP1A 1ISKA 4HM5B 1GD4A 4NHFA 2HMMB 2BMOB 2SBLA 1IV7A 1O7MB 2CWVA 3NV0A 4L8OA 5CK6A 1VQ63 3BLZA 3LOYA 1QJGA 3OWSA 2HMOB 3WDGB 1MOLA 2BO9B 4IT7A 1DMQA 3LH4A 1Q824 2CWTA 3CCE3 2WGOA 3DUKA 3PGBA 1ROVA 2K0MA 3B8LA 2HMJB 4HZ9B 2F98A 1W01A 2CWUA 1W7CA 3DXOA 4QWTA 1AVLA 5AIIA 5LC6A 4TX4A 2Z76A 3GWRA 4BTWA 2ML6A 2CKFB 4HJLB 4OUQA 1A2KA 4X2OA 1Y4KA 4FR9A 1U5OA 1W02A 3FH1A 3CMA3 3UB1A 1Q814 2CIUA 2BMQB 3PCRA 3LXUX 1VQ43 4IIAA 3G0KA 7STDA 1TIJA 2JDIH 5CLKA 4Q53A 2RCDA 1JB4A 3CC73 1T5YA 2IA7A 1JV2B 3G713 3PS8A 3OV4A 8CHOA 2QEX3 4ZM8A 2OTL3 2O9UX 1YJ93 5KP3A 3OWYA 3GZBA 3U1WA 2GU1A 3OWUA 1Q40B 2LQVA 3HZPA 3L0RA 4H61A 1N9JA 2YFLB 1IU7A 2F86B 4EC6A 1DVCA 1STDA 3RGRA 1IQYA 3NQZA 5DRVA 2Z6BA 3M8CA 1HU9A 3VGNA 1OPYA 4XBXA 1V74A 3CCL3 4EV5A 2CFLA 4IPBA 3LZAA 3FGYA 1ASKA 4G1MB 3UJMA 1QALA 2KCDA 2P0XA 3F40A 5IENA 1VQN3 1PFPA 4HM1B 4JRFA 5G2GA 3F7XA 2W2CA 1YGEA 3LT9A 3CNMA 4WFOA 3PCSA 5CXOA 1AV4A 1VQK3 2GEYA 2O3OA 3FLJA 4BTYA 4MEIA 1FGMA 3ALAA 3Q2PA 5FGOA 1FGQA 3ECFA 3T8UA 4N6MA 1D6ZA 3I0YA 3HI7A 3CNXA 4HBRA 4RBNA 1IT8A 3F9SA 3RGAA 3K5TA 4H3UA 3OW22 4O02B 5KP4A 3CPW2 1O7HB 2Z7AA 4XM4A 3VSYA 1NO3A 1L5GB 3LTCA 4GB5A 5AI1A 4FCMA 1O7PB 3KE7A 1JB5A 1IQXA 1TP6A 1IK3A 3DGLA 1IT7A 1Q864 1GS3A 1VQ53 4K61A 2PNCA 3N8BA 3V92A 3RDEA 4WHAA 5DREA 3EHCA 5EVHA 3GAXA 3IJEB 4N6UA 3LYGA 1LVNA 1NU3A 3FZWA 4PEJA 2W56A 4FMCA 2XEPA 2YFIB 4RNYA 3CCJ3 3WMDA 4OK0A 1W00A 3X42A 1JJ22 4LZIA 6STDA 4L8PA 4HVNA 3WA3A 3CD63 2XH9A 3JUMA 1U8CB 2B1XB 1N5PA 2OOVA 3SVAA 1EQKA 3EBYA 1OUNA 3JUOA 4X2HA 1W2B2 5D83A 3EB8A 2XFTA 1Z1SA 3MSOA 4KZ1A 4R9KA 2E2UA 2IUJA 1LNHA 3MG1A 4FMBA 3X3XA 3PZWA 3NM7A 3S28A 1JKGB 1QMAA 2CH9A 4RNZA 3B4PA 1CEWI 1NDOB 1TFKA 1E3VA 1FGRA 2CK3H 1QAFA 3MWZA 3E99A 3NBJA 5AIFA 1BUQA 3FKAA 1WQLB 4XBTA 3KSPA 2Z77A 5EQLA 1RJOA 4FMDA 1CYVA 3V99A 1N8R4 3T0UA 1O7NB 2K54A 1SJWA 4O8SA 1YJN3 3DZLA 2W04A 2E2TA 3JUQA 3STDA 1YHQ3 3JVCA 1QAKA 1EA2A 1Q7Y4 3MHEA 3VF1A 5IG0A 1C7HA 3AMOB 3ROBA 3FG3A 4LSOA 1TUHA 2OQEA 2MC8A 2LYXA 3CME3 1N9EA 4HKVB 1A90A 5CF1A 2HMNB 3FCSB 2QA43 4N3VA 3LTAA 4HM4B 3U97A 1W5ZA 1YJW3 3EC9A 1VZZA 1DMMA 3KSED 1IVWA 2I9WA 3S29A 1GY6A 2UX0A 3QRDA 1N5HA 3QK9A 3HIIA 1OF5B 2B24B 1OCVA 4N6TA 2P38A 4LEHA 4HM7B 3X41A 5AEUB 2WO0A 5D81A 3KZTA 1M1K4 2CFWA 3S67A 1JB2A 3CC23 4AKZA 1N8QA 2BHMA 1KWIA 1STFI 3JUPA 1IVVA 2BT3A 4XBYA 1D6UA 2CFKA 2OQEC 2PZVA 2XSOB 3FG4A 4FCZA 3UL5A 3SX1A 4BTXA 1FGTA 3NBRA 1F8NA 3NBBA 4N6LA 3EQQB 3DGNA 4MJDA 4ORLA 4N6V0 4WP5A 3X3YA 1ULJB 4XDVA 4WWUC 1GY7A 1E97A 3CCQ3 1OHOA 1VQ83 1D6YA 3F14A 1KC84 3CPOA 5AYSC 1SPUA 1ROAA 3OXAA 3H3HA 5AIGA 5JBSA 3CU3A 5IG3A 1G96A 5ELUA 3KKGA 3F8XA 1SQWA 1RRHA 4KFEA 3GZRA 4R4KA 2D1WA 1GY5A 4HM6B 4WYKB 3SOYA 3X40A 1EG9B 1TFOA 1E3RA 2P05A 3NXJA 2GBXB 2RSXA 3Q1CA 2QGUA 1O7GB 4HM3B 3HK4A 3EX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 4;  3CPW 2;  1YJN 3;  3CCJ 3;  3CCE 3;  1YI2 3;  1KC8 4;  3G71 3;  2QEX 3;  3CCV 3;  1JJ2 2;  1QVG 2;  3CCU 3;  1YHQ 3;  2OTL 3;  1VQO 3;  1YIJ 3;  1YJ9 3;  1VQL 3;  1K9M 4;  1VQ9 3;  1Q7Y 4;  1K8A 4;  1VQ7 3;  1VQN 3;  3I55 3;  3I56 3;  1M1K 4;  3CD6 3;  1VQP 3;  3CCM 3;  1Q82 4;  3CC2 3;  1QVF 2;  1Q86 4;  3CCS 3;  1VQ5 3;  1VQK 3;  3CME 3;  1M90 4;  3CC4 3;  3CMA 3;  1Q81 4;  2QA4 3;  1W2B 2;  1S72 3;  1YIT 3;  3G4S 3;  1VQ6 3;  3G6E 3;  3CXC 2;  1YJW 3;  1VQ4 3;  1KQS 2;  1K73 4;  2OTJ 3;  1VQ8 3;  1NJI 4;  1VQM 3;  3CCQ 3;  1N8R 4;  3CCL 3;  3CC7 3;  3OW2 2;  3CCR 3; 
#chains in the Genus database with same CATH topology
 2XFS A;  3GZY B;  1BGS A;  1KD1 4;  5HGR A;  4NRE A;  1K41 A;  4LMI A;  5G1K A;  1FA3 A;  3S27 A;  1BNG A;  3LTD A;  2AAE A;  1IYY A;  2YFJ B;  2ZHX B;  4J9A A;  4KFD A;  1JN5 B;  1GYB A;  3LML A;  4R1K A;  2KF6 A;  4HM2 B;  1VQP 3;  4RZM A;  2CHC A;  1BNS A;  4R9L A;  3GRD A;  2GXF A;  4STD A;  3WHO A;  1QVF 2;  1JRQ A;  3KN4 A;  3CCS 3;  1HKX A;  1FGO A;  1G0T A;  1WMO A;  3BNB A;  3F8H A;  3CC4 3;  3NUV A;  1YVS A;  2IYJ A;  1MGW A;  3NX0 A;  3FF0 A;  3WOE B;  3N9H A;  1IV9 A;  5I97 A;  1UI7 A;  2XGN A;  3O8Y A;  2E2V A;  3D3L A;  1IDP A;  2A15 A;  1JZO A;  1AQZ A;  2Y73 A;  2WOF A;  2ZDJ A;  3KII A;  1DET A;  2FNQ A;  1UCI A;  1JBT A;  3ER7 A;  4CPK A;  4N6N B;  4CJN A;  5IEP A;  2KF3 A;  1WMN A;  3EJV A;  3B4O A;  2CG1 A;  2D42 A;  1LRA A;  1BSB A;  1UUV B;  1MWR A;  1JKG A;  1R4C A;  1SII A;  1OGX A;  3HX8 A;  3MG3 A;  4HM8 B;  1BRN L;  2XRX B;  4EW5 A;  5IG4 A;  1NB3 I;  4EXR A;  3DY5 A;  2OCT A;  3DH2 A;  4LGQ A;  1I8V A;  1M1X B;  1I70 A;  4EV2 A;  2OOV C;  1ZGX A;  2FXT A;  1JZD A;  2P09 A;  2UGI A;  3B7C A;  3NV0 B;  2L4V A;  3DGM A;  4MMX B;  1US1 A;  1UGH I;  1YIT 3;  3G16 A;  1S72 3;  1PU4 A;  2H0I A;  1BNE A;  1OHP A;  2J8X B;  1V57 A;  3EN1 B;  1RCL A;  1A67 A;  3BND A;  2Y74 A;  3CCR 3;  1W6Y A;  4FCJ A;  1O7W B;  2KXG A;  1K28 A;  3IPT A;  2CC3 A;  3NHX A;  4JF8 A;  3SXX A;  2CFD A;  4DKI A;  1QVG 2;  1B27 A;  3PXM A;  4XB5 A;  4J8T A;  4CDL A;  3G8Z A;  7GSP A;  1UCL A;  3K9M C;  5STD A;  4HM0 B;  1K8A 4;  3DM8 A;  1Q42 A;  1ZO2 A;  5TGN A;  1CQS A;  1Q40 A;  3AMO A;  2GEX A;  2FGT A;  1G02 A;  1WTH A;  1WMP A;  3UNL A;  1CYU A;  2RFR A;  5JPP A;  3S5C A;  2F99 A;  1BSE A;  3MG2 A;  4O3V A;  3G4S 3;  1RNT A;  1MWU A;  3N54 B;  1KQS 2;  4I4K A;  2OWP A;  2GU3 A;  1DVD A;  1S5A A;  4AEQ A;  2XGL A;  3NQY A;  1FUS A;  4NPB A;  2IY2 A;  2HML B;  1MNL A;  1WNH A;  3V98 A;  1IVX A;  1RNB A;  1RGL A;  3CCV 3;  5HOH A;  2M7O A;  1NNV A;  1OF5 A;  1W6G A;  3H51 A;  2W9P A;  4HZB B;  1RN7 A;  3MPH A;  5ELJ A;  3EE1 A;  5CF2 A;  1VQ7 3;  1A2V A;  1IQ8 A;  2WOH A;  2INX A;  3BB9 A;  4HAA A;  5AEW B;  3HIG A;  3LT8 A;  1OH0 A;  3CCM 3;  1B2X A;  1UCK A;  4K90 B;  2STD A;  3GSP A;  6GSP A;  2H0H A;  5EEO A;  1ULI B;  1RKY A;  1M90 4;  1DYU A;  4FMA A;  2W6J H;  4CCV A;  2BNG A;  6RNT A;  4MMZ B;  3SED A;  1OHS A;  1BSA A;  3CXC 2;  3SLU A;  1GSP A;  4KFF A;  5AYR B;  1OGZ A;  1A2P A;  5FW5 A;  3PYJ A;  3WOD G;  2MF7 A;  4KVH A;  1M9G A;  1DE3 A;  1JNQ A;  3DMC A;  4R80 A;  3BIR A;  2GBW B;  2IUK A;  1UI8 A;  1UUW B;  4OVM A;  3SOA A;  2XR8 B;  1J2B A;  3T8N A;  1VQO 3;  1K9M 4;  2KRT A;  5A0O B;  2KF4 A;  1BIR A;  1RCK A;  2CW9 A;  2W9Q A;  1ZX2 A;  3I55 3;  2IMJ A;  5IEO A;  4N6O B;  2YX9 A;  2C10 A;  3UL5 A;  2CG0 A;  2H0G A;  2Q07 A;  1LOV A;  2XSH B;  5BXQ A;  3D79 A;  4U13 A;  4L7K A;  1RGF A;  3NM2 A;  3UL6 A;  4AKY A;  2JQ5 A;  1RRL A;  1TTO A;  2ZL8 A;  3FF2 A;  4K1V A;  4WYK A;  5IF6 A;  1RGE A;  2HOH A;  1EKM A;  3IMA B;  5BVB A;  2HMK B;  1X1U A;  1LQM B;  3F7S A;  4O2H A;  2C11 A;  1NWW A;  1K73 4;  2OTJ 3;  4EBG A;  1OAC A;  1YVB I;  2P0M A;  3GZX B;  3Q3F A;  3ZFZ A;  1VQM 3;  1NJI 4;  2UUG C;  2W03 A;  3BNE A;  3OX9 A;  1RSN A;  3EF8 A;  4MMY B;  2WGQ A;  3DGO A;  5RNT A;  3WOF B;  1HZ1 A;  5IW9 A;  3CCU 3;  1AVK A;  2XF3 A;  2ML5 A;  1YIJ 3;  1VQL 3;  1B20 A;  1DMN A;  3D5G A;  1LOX A;  5IER A;  1RDS A;  1JN5 A;  3TDG A;  1W2Z A;  4HOH A;  5D82 A;  1NB5 I;  3D9R A;  1GD3 A;  3FG1 A;  1BNJ A;  3WA2 X;  4HYZ A;  3X3Z A;  2RGQ A;  2QIY A;  1W4N A;  1SIH A;  1VQ9 3;  3JUN A;  3G6E 3;  3EBT A;  3EN8 A;  3K63 A;  3A76 A;  3K0Z A;  4EYC A;  3MYT A;  4GL6 A;  2CFG A;  5IG5 A;  3BNC A;  5LC7 A;  3J7Y d;  1UW1 A;  2GSP A;  3FSD A;  3K7C A;  1AR0 A;  4K1U A;  3Q90 A;  2W56 B;  1KSI A;  2R4I A;  2BMR B;  2W0Q A;  1YI2 3;  1W6C A;  5AIH A;  1GOY A;  3BU4 A;  1BU4 A;  4XDW A;  5JPU A;  2F5M A;  1IVU A;  1BRK A;  1LXE A;  1Q7H A;  2V1L A;  3I56 3;  3MKI A;  2F5W A;  1PY3 A;  3KFQ C;  3LTB A;  2K3D A;  5KP1 A;  1TU5 A;  1ISK A;  4HM5 B;  1GD4 A;  4NHF A;  2HMM B;  1YGW A;  2BMO B;  1RGH A;  2SBL A;  1IV7 A;  1O7M B;  3AHS A;  2CWV A;  3NV0 A;  4L8O A;  5GSP A;  5CK6 A;  1VQ6 3;  3BLZ A;  3LOY A;  1QJG A;  3OWS A;  2HMO B;  1MGR A;  3WDG B;  3WR2 A;  1MOL A;  2BO9 B;  4IT7 A;  1DMQ A;  3LH4 A;  3ZG5 A;  1RHL A;  1Q82 4;  2CWT A;  3CCE 3;  4GHO A;  4J5G A;  2WGO A;  1RGA A;  3DUK A;  3PGB A;  1ROV A;  2K0M A;  1RTU A;  2HMJ B;  1B2S A;  3B8L A;  4HZ9 B;  3KCH A;  2F98 A;  1W01 A;  2CWU A;  1W7C A;  3DXO A;  4QWT A;  1AVL A;  5AII A;  5LC6 A;  4TX4 A;  2Z76 A;  3GWR A;  4BTW A;  1LOY A;  2ML6 A;  2CKF B;  1BRJ A;  4HJL B;  1A2K A;  4OUQ A;  4X2O A;  1Y4K A;  4KT3 B;  4FR9 A;  1U5O A;  1W02 A;  3FH1 A;  1JBS A;  3CMA 3;  3UB1 A;  1Q81 4;  1BNR A;  2CIU A;  2BMQ B;  3PCR A;  3LXU X;  1VQ4 3;  4IIA A;  3G0K A;  7STD A;  1TIJ A;  2JDI H;  5CLK A;  2KAA A;  1UCJ A;  4Q53 A;  1RMS A;  2RCD A;  1JB4 A;  3CC7 3;  1T5Y A;  2IA7 A;  1JV2 B;  3G71 3;  3PS8 A;  3OV4 A;  8CHO A;  2QEX 3;  4ZM8 A;  2OTL 3;  2O9U X;  1YJ9 3;  1B2U A;  5KP3 A;  3OWY A;  1BSD A;  3GZB A;  1RGG A;  2GU1 A;  3OWU A;  3U1W A;  1BOX A;  1I2E A;  1Q40 B;  1GMQ A;  2LQV A;  3HZP A;  3L0R A;  4H61 A;  1N9J A;  1EUI C;  2YFL B;  1IU7 A;  2F86 B;  1GMR A;  4EC6 A;  1DVC A;  1STD A;  3RGR A;  1HYF A;  2L1S A;  1IQY A;  1X1W A;  3NQZ A;  5DRV A;  2Z6B A;  3M8C A;  1UDI I;  1HU9 A;  3VGN A;  1OPY A;  4XBX A;  1V74 A;  3CCL 3;  4EV5 A;  1RN4 A;  2CFL A;  4IPB A;  3LZA A;  1FUW A;  3FGY A;  1ASK A;  1B2M A;  4G1M B;  3UJM A;  1QAL A;  2KCD A;  2P0X A;  3F40 A;  5IEN A;  1VQN 3;  1PFP A;  4HM1 B;  4JRF A;  5G2G A;  3F7X A;  2W2C A;  1YGE A;  2RBI A;  2BU4 A;  3LT9 A;  1LNI A;  3CNM A;  4GSP A;  3AGO A;  4WFO A;  1VQQ A;  3PCS A;  1AV4 A;  5CXO A;  1VQK 3;  2GEY A;  2O3O A;  3FLJ A;  4BTY A;  1RN1 A;  4MEI A;  1FGM A;  3ALA A;  3Q2P A;  1ZS7 A;  5G1L A;  5FGO A;  1FGQ A;  3ECF A;  3T8U A;  4N6M A;  1D6Z A;  3I0Y A;  3HI7 A;  3CNX A;  4HBR A;  4RBN A;  1IT8 A;  3F9S A;  3RGA A;  3K5T A;  1BUJ A;  4H3U A;  3OW2 2;  1V58 A;  4O02 B;  5KP4 A;  3CPW 2;  1O7H B;  2Z7A A;  4XM4 A;  1BAN A;  1NO3 A;  3VSY A;  1I0V A;  3LTC A;  4GB5 A;  5AI1 A;  1L5G B;  1FW7 A;  4FCM A;  1O7P B;  1T2I A;  3KE7 A;  1JB5 A;  1IQX A;  1TP6 A;  1IK3 A;  3DGL A;  1IT7 A;  1R4Y A;  1Q86 4;  1LOW A;  1GS3 A;  1VQ5 3;  4K61 A;  2PNC A;  1BAO A;  3N8B A;  3V92 A;  3RDE A;  4WHA A;  5DRE A;  3EHC A;  5EVH A;  3GAX A;  5M19 A;  3IJE B;  4N6U A;  2ZA4 A;  3LYG A;  1LVN A;  1NU3 A;  3FZW A;  4PEJ A;  2RNT A;  1BNF A;  2W56 A;  4FMC A;  2XEP A;  2YFI B;  4RNY A;  3CCJ 3;  3WMD A;  4OK0 A;  1AY7 A;  1W00 A;  3X42 A;  1JJ2 2;  4LZI A;  6STD A;  3D5I A;  4L8P A;  4HVN A;  1RGC A;  3WA3 A;  1BRG A;  3CD6 3;  5M1A A;  4BL3 A;  2XH9 A;  3JUM A;  1U8C B;  1BVI A;  2B1X B;  1N5P A;  1BSC A;  2OOV A;  3SVA A;  1EQK A;  3EBY A;  3SYU A;  1OUN A;  3DGY A;  3JUO A;  4X2H A;  1W2B 2;  5D83 A;  3EB8 A;  1PYL A;  1JBR A;  2XFT A;  2AAD A;  1Z1S A;  3MSO A;  4KZ1 A;  4R9K A;  4ILF A;  2E2U A;  4J5K A;  2IUJ A;  2CX1 A;  1LNH A;  3MG1 A;  4FMB A;  3ZG0 A;  2BIR A;  3X3X A;  1MWS A;  3PZW A;  3NM7 A;  1UUG B;  3URP A;  3S28 A;  2CX0 A;  1JKG B;  1QMA A;  2CH9 A;  4RNZ A;  3B4P A;  1CEW I;  1NDO B;  1CH0 A;  1TFK A;  5M18 A;  1E3V A;  1B2Z A;  4BU4 A;  1FGR A;  1LQG C;  2SAR A;  2CK3 H;  1QAF A;  3MWZ A;  3E99 A;  3NBJ A;  5AIF A;  1BUQ A;  3FKA A;  1WQL B;  4XBT A;  8RNT A;  3KSP A;  2Z77 A;  5EQL A;  1RJO A;  4FMD A;  1I3I A;  2F4Y A;  1CYV A;  3V99 A;  1N8R 4;  3T0U A;  4RNT A;  1O7N B;  2K54 A;  1C54 A;  1B21 A;  1Q9E A;  1SJW A;  1UGI A;  4O8S A;  1I0X A;  1YJN 3;  2KF5 A;  3DZL A;  2W04 A;  2E2T A;  3JUQ A;  3STD A;  1YHQ 3;  3JVC A;  1QAK A;  1EA2 A;  1Q7Y 4;  1B3S A;  3MHE A;  3VF1 A;  1I3F A;  5IG0 A;  1C7H A;  3AMO B;  3ROB A;  1MWT A;  3FG3 A;  4LSO A;  1TUH A;  1RGK A;  2MC8 A;  2LYX A;  2OQE A;  3CME 3;  1N9E A;  4HKV B;  9RNT A;  1A90 A;  5CF1 A;  2HMN B;  1YNV X;  3FCS B;  2QA4 3;  3A5E A;  1X1X A;  1FYS A;  4N3V A;  3LTA A;  4HM4 B;  1T3B A;  1W5Z A;  3U97 A;  1BNI A;  1FZU A;  2F56 A;  1YJW 3;  3EC9 A;  1VZZ A;  1DMM A;  1EEJ A;  3KSE D;  1IVW A;  2I9W A;  3S29 A;  1GY6 A;  1I2G A;  7RNT A;  2UX0 A;  4BL2 A;  3QRD A;  1N5H A;  3QK9 A;  1BRI A;  3HII A;  1BRS A;  1OF5 B;  2B24 B;  1OCV A;  4N6T A;  2P38 A;  4LEH A;  4HM7 B;  3X41 A;  5AEU B;  2WO0 A;  5D81 A;  3KZT A;  1M1K 4;  2CFW A;  3S67 A;  5BIR A;  1JB2 A;  3CC2 3;  4AKZ A;  1N8Q A;  2BHM A;  1KWI A;  1SAR A;  1STF I;  3JUP A;  1IVV A;  1TRQ A;  2BT3 A;  1D6U A;  2CFK A;  2OQE C;  2PZV A;  2XSO B;  3FG4 A;  4FCZ A;  4XBY A;  3SX1 A;  4BTX A;  1FGT A;  3NBR A;  1F8N A;  3NBB A;  1RLS A;  4N6L A;  1T2H A;  3EQQ B;  3DGN A;  4MJD A;  4ORL A;  4N6V 0;  4WP5 A;  3X3Y A;  1ULJ B;  4XDV A;  3RNT A;  4WWU C;  1GY7 A;  1E97 A;  3CCQ 3;  1OHO A;  1FUT A;  1VQ8 3;  3AGN A;  3HOH A;  1D6Y A;  3F14 A;  1KC8 4;  3CPO A;  5AYS C;  1SPU A;  4LYL B;  1ROA A;  3OXA A;  3H3H A;  5AIG A;  1GOU A;  5JBS A;  1GOV A;  1BRH A;  1TJD A;  2R41 A;  3AHW A;  3CU3 A;  1G96 A;  5ELU A;  3KKG A;  5IG3 A;  3F8X A;  1TRP A;  1SQW A;  1RRH A;  4KFE A;  3GZR A;  4R4K A;  2D1W A;  1GY5 A;  4I5Q A;  1X1Y A;  4HM6 B;  4WYK B;  3SOY A;  3X40 A;  1EG9 B;  1TFO A;  1GMP A;  1E3R A;  2P05 A;  3D4A A;  3NXJ A;  2GBX B;  2RSX A;  3Q1C A;  2QGU A;  1O7G B;  5BU4 A;  2C4B A;  4HM3 B;  4BIR A;  1I2F A;  3HK4 A;  3EX9 A; 
#chains in the Genus database with same CATH homology
 2XFS A;  3GZY B;  1KD1 4;  5HGR A;  4NRE A;  1K41 A;  4LMI A;  1FA3 A;  3S27 A;  3LTD A;  2YFJ B;  4J9A A;  4KFD A;  1JN5 B;  1GYB A;  3LML A;  4R1K A;  1VQP 3;  4HM2 B;  4RZM A;  2CHC A;  4R9L A;  3GRD A;  2GXF A;  4STD A;  1QVF 2;  1JRQ A;  3KN4 A;  3CCS 3;  1HKX A;  1FGO A;  1WMO A;  3BNB A;  3F8H A;  3CC4 3;  3NUV A;  3NX0 A;  3FF0 A;  3WOE B;  3N9H A;  1IV9 A;  5I97 A;  1UI7 A;  2XGN A;  3O8Y A;  2E2V A;  3D3L A;  1IDP A;  2A15 A;  2Y73 A;  2WOF A;  2ZDJ A;  3KII A;  2FNQ A;  3ER7 A;  4N6N B;  5IEP A;  1WMN A;  3EJV A;  3B4O A;  2CG1 A;  2D42 A;  1UUV B;  1JKG A;  1R4C A;  1SII A;  1OGX A;  3HX8 A;  3MG3 A;  4HM8 B;  2XRX B;  5IG4 A;  1NB3 I;  4EXR A;  3DY5 A;  2OCT A;  4LGQ A;  1M1X B;  4EV2 A;  2OOV C;  2FXT A;  2P09 A;  3B7C A;  3NV0 B;  2L4V A;  3DGM A;  4MMX B;  1US1 A;  1YIT 3;  1S72 3;  3G16 A;  1PU4 A;  1OHP A;  3EN1 B;  1A67 A;  3BND A;  2Y74 A;  3CCR 3;  1W6Y A;  4FCJ A;  1O7W B;  2KXG A;  1K28 A;  3IPT A;  2CC3 A;  3NHX A;  4JF8 A;  3SXX A;  2CFD A;  1QVG 2;  3PXM A;  4XB5 A;  4J8T A;  4CDL A;  3G8Z A;  3K9M C;  5STD A;  4HM0 B;  1K8A 4;  3DM8 A;  1Q42 A;  1ZO2 A;  5TGN A;  1CQS A;  1Q40 A;  3AMO A;  2GEX A;  2FGT A;  1WTH A;  1WMP A;  3UNL A;  1CYU A;  2RFR A;  5JPP A;  3S5C A;  2F99 A;  3MG2 A;  4O3V A;  3G4S 3;  3N54 B;  1KQS 2;  4I4K A;  2OWP A;  2GU3 A;  1DVD A;  1S5A A;  4AEQ A;  2XGL A;  3NQY A;  2HML B;  1MNL A;  1WNH A;  3V98 A;  1IVX A;  3CCV 3;  2M7O A;  1W6G A;  1OF5 A;  3H51 A;  4HZB B;  2W9P A;  5CF2 A;  1RN7 A;  3MPH A;  5ELJ A;  3EE1 A;  1VQ7 3;  1A2V A;  1IQ8 A;  2WOH A;  2INX A;  3BB9 A;  5AEW B;  3HIG A;  3LT8 A;  1OH0 A;  3CCM 3;  4K90 B;  2STD A;  5EEO A;  1ULI B;  1RKY A;  1M90 4;  1DYU A;  4FMA A;  2W6J H;  4CCV A;  2BNG A;  4MMZ B;  3SED A;  1OHS A;  3CXC 2;  3SLU A;  4KFF A;  5AYR B;  1OGZ A;  5FW5 A;  3PYJ A;  3WOD G;  2MF7 A;  4KVH A;  1M9G A;  1JNQ A;  3DMC A;  4R80 A;  2GBW B;  2IUK A;  1UI8 A;  1UUW B;  4OVM A;  3SOA A;  2XR8 B;  1J2B A;  3T8N A;  1VQO 3;  1K9M 4;  2KRT A;  5A0O B;  2CW9 A;  2W9Q A;  1ZX2 A;  3I55 3;  2IMJ A;  5IEO A;  4N6O B;  2YX9 A;  2C10 A;  2CG0 A;  2Q07 A;  2XSH B;  5BXQ A;  1FUW A;  4U13 A;  4L7K A;  3NM2 A;  3UL6 A;  4AKY A;  2JQ5 A;  1RRL A;  2ZL8 A;  3FF2 A;  4K1V A;  4WYK A;  5IF6 A;  1EKM A;  3IMA B;  5BVB A;  2HMK B;  3F7S A;  4O2H A;  2C11 A;  1NWW A;  1K73 4;  2OTJ 3;  4EBG A;  1OAC A;  1YVB I;  2P0M A;  3GZX B;  1NJI 4;  1VQM 3;  2W03 A;  3BNE A;  3OX9 A;  3EF8 A;  4MMY B;  2WGQ A;  3DGO A;  3WOF B;  5IW9 A;  3CCU 3;  1AVK A;  2XF3 A;  2ML5 A;  1YIJ 3;  1VQL 3;  1DMN A;  5IER A;  1VQ9 3;  1LOX A;  1JN5 A;  3TDG A;  1W2Z A;  5D82 A;  1NB5 I;  3D9R A;  1GD3 A;  3FG1 A;  3WA2 X;  4HYZ A;  3X3Z A;  2RGQ A;  2QIY A;  1W4N A;  1SIH A;  3JUN A;  3G6E 3;  3EBT A;  3EN8 A;  3K63 A;  3A76 A;  3K0Z A;  4EYC A;  3MYT A;  4GL6 A;  2CFG A;  5IG5 A;  3BNC A;  5LC7 A;  3J7Y d;  1UW1 A;  3FSD A;  3K7C A;  1AR0 A;  4K1U A;  3Q90 A;  2W56 B;  1KSI A;  2R4I A;  2BMR B;  2W0Q A;  1YI2 3;  1W6C A;  5AIH A;  5JPU A;  4XDW A;  1IVU A;  1LXE A;  2V1L A;  3I56 3;  3MKI A;  3KFQ C;  3LTB A;  1TU5 A;  5KP1 A;  1ISK A;  4HM5 B;  1GD4 A;  4NHF A;  2HMM B;  2BMO B;  2SBL A;  1IV7 A;  1O7M B;  2CWV A;  3NV0 A;  4L8O A;  5CK6 A;  1VQ6 3;  3BLZ A;  3LOY A;  1QJG A;  3OWS A;  2HMO B;  3WDG B;  1MOL A;  2BO9 B;  4IT7 A;  1DMQ A;  3LH4 A;  1Q82 4;  2CWT A;  3CCE 3;  2WGO A;  3DUK A;  3PGB A;  1ROV A;  2K0M A;  3B8L A;  2HMJ B;  4HZ9 B;  2F98 A;  1W01 A;  2CWU A;  1W7C A;  3DXO A;  4QWT A;  1AVL A;  5AII A;  5LC6 A;  4TX4 A;  2Z76 A;  3GWR A;  4BTW A;  2ML6 A;  2CKF B;  4HJL B;  4OUQ A;  1A2K A;  4X2O A;  1Y4K A;  4FR9 A;  1U5O A;  1W02 A;  3FH1 A;  3CMA 3;  3UB1 A;  1Q81 4;  2CIU A;  2BMQ B;  3PCR A;  3LXU X;  1VQ4 3;  4IIA A;  3G0K A;  7STD A;  1TIJ A;  2JDI H;  5CLK A;  4Q53 A;  2RCD A;  1JB4 A;  3CC7 3;  1T5Y A;  2IA7 A;  1JV2 B;  3G71 3;  3PS8 A;  3OV4 A;  8CHO A;  2QEX 3;  4ZM8 A;  2OTL 3;  2O9U X;  1YJ9 3;  5KP3 A;  3OWY A;  3GZB A;  3U1W A;  2GU1 A;  3OWU A;  1Q40 B;  2LQV A;  3HZP A;  3L0R A;  4H61 A;  1N9J A;  2YFL B;  1IU7 A;  2F86 B;  4EC6 A;  1DVC A;  1STD A;  3RGR A;  1IQY A;  3NQZ A;  5DRV A;  2Z6B A;  3M8C A;  1HU9 A;  3VGN A;  1OPY A;  4XBX A;  1V74 A;  3CCL 3;  4EV5 A;  2CFL A;  4IPB A;  3LZA A;  3FGY A;  1ASK A;  4G1M B;  3UJM A;  1QAL A;  2KCD A;  2P0X A;  3F40 A;  5IEN A;  1VQN 3;  1PFP A;  4HM1 B;  4JRF A;  5G2G A;  3F7X A;  2W2C A;  1YGE A;  3LT9 A;  3CNM A;  4WFO A;  3PCS A;  5CXO A;  1AV4 A;  1VQK 3;  2GEY A;  2O3O A;  3FLJ A;  4BTY A;  4MEI A;  1FGM A;  3ALA A;  3Q2P A;  5FGO A;  1FGQ A;  3ECF A;  3T8U A;  4N6M A;  1D6Z A;  3I0Y A;  3HI7 A;  3CNX A;  4HBR A;  4RBN A;  1IT8 A;  3F9S A;  3RGA A;  3K5T A;  4H3U A;  3OW2 2;  4O02 B;  5KP4 A;  3CPW 2;  1O7H B;  2Z7A A;  4XM4 A;  3VSY A;  1NO3 A;  1L5G B;  3LTC A;  4GB5 A;  5AI1 A;  4FCM A;  1O7P B;  3KE7 A;  1JB5 A;  1IQX A;  1TP6 A;  1IK3 A;  3DGL A;  1IT7 A;  1Q86 4;  1GS3 A;  1VQ5 3;  4K61 A;  2PNC A;  3N8B A;  3V92 A;  3RDE A;  4WHA A;  5DRE A;  3EHC A;  5EVH A;  3GAX A;  3IJE B;  4N6U A;  3LYG A;  1LVN A;  1NU3 A;  3FZW A;  4PEJ A;  2W56 A;  4FMC A;  2XEP A;  2YFI B;  4RNY A;  3CCJ 3;  3WMD A;  4OK0 A;  1W00 A;  3X42 A;  1JJ2 2;  4LZI A;  6STD A;  4L8P A;  4HVN A;  3WA3 A;  3CD6 3;  2XH9 A;  3JUM A;  1U8C B;  2B1X B;  1N5P A;  2OOV A;  3SVA A;  1EQK A;  3EBY A;  1OUN A;  3JUO A;  4X2H A;  1W2B 2;  5D83 A;  3EB8 A;  2XFT A;  1Z1S A;  3MSO A;  4KZ1 A;  4R9K A;  2E2U A;  2IUJ A;  1LNH A;  3MG1 A;  4FMB A;  3X3X A;  3PZW A;  3NM7 A;  3S28 A;  1JKG B;  1QMA A;  2CH9 A;  4RNZ A;  3B4P A;  1CEW I;  1NDO B;  1TFK A;  1E3V A;  1FGR A;  2CK3 H;  1QAF A;  3MWZ A;  3E99 A;  3NBJ A;  5AIF A;  1BUQ A;  3FKA A;  1WQL B;  4XBT A;  3KSP A;  2Z77 A;  5EQL A;  1RJO A;  4FMD A;  1CYV A;  3V99 A;  1N8R 4;  3T0U A;  1O7N B;  2K54 A;  1SJW A;  4O8S A;  1YJN 3;  3DZL A;  2W04 A;  2E2T A;  3JUQ A;  3STD A;  1YHQ 3;  3JVC A;  1QAK A;  1EA2 A;  1Q7Y 4;  3MHE A;  3VF1 A;  5IG0 A;  1C7H A;  3AMO B;  3ROB A;  3FG3 A;  4LSO A;  1TUH A;  2OQE A;  2MC8 A;  2LYX A;  3CME 3;  1N9E A;  4HKV B;  1A90 A;  5CF1 A;  2HMN B;  3FCS B;  2QA4 3;  4N3V A;  3LTA A;  4HM4 B;  3U97 A;  1W5Z A;  1YJW 3;  3EC9 A;  1VZZ A;  1DMM A;  3KSE D;  1IVW A;  2I9W A;  3S29 A;  1GY6 A;  2UX0 A;  3QRD A;  1N5H A;  3QK9 A;  3HII A;  1OF5 B;  2B24 B;  1OCV A;  4N6T A;  2P38 A;  4LEH A;  4HM7 B;  3X41 A;  5AEU B;  2WO0 A;  5D81 A;  3KZT A;  1M1K 4;  2CFW A;  3S67 A;  1JB2 A;  3CC2 3;  4AKZ A;  1N8Q A;  2BHM A;  1KWI A;  1STF I;  3JUP A;  1IVV A;  2BT3 A;  4XBY A;  1D6U A;  2CFK A;  2OQE C;  2PZV A;  2XSO B;  3FG4 A;  4FCZ A;  3UL5 A;  3SX1 A;  4BTX A;  1FGT A;  3NBR A;  1F8N A;  3NBB A;  4N6L A;  3EQQ B;  3DGN A;  4MJD A;  4ORL A;  4N6V 0;  4WP5 A;  3X3Y A;  1ULJ B;  4XDV A;  4WWU C;  1GY7 A;  1E97 A;  3CCQ 3;  1OHO A;  1VQ8 3;  1D6Y A;  3F14 A;  1KC8 4;  3CPO A;  5AYS C;  1SPU A;  1ROA A;  3OXA A;  3H3H A;  5AIG A;  5JBS A;  3CU3 A;  5IG3 A;  1G96 A;  5ELU A;  3KKG A;  3F8X A;  1SQW A;  1RRH A;  4KFE A;  3GZR A;  4R4K A;  2D1W A;  1GY5 A;  4HM6 B;  4WYK B;  3SOY A;  3X40 A;  1EG9 B;  1TFO A;  1E3R A;  2P05 A;  3NXJ A;  2GBX B;  2RSX A;  3Q1C A;  2QGU A;  1O7G B;  4HM3 B;  3HK4 A;  3EX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...