1YI23

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1yi2300
1NJI4 1Q824 1QVF2 1VQ43 2QEX3 1YIJ3 3CCU3 3I563 1KQS2 3CCE3 1KC84 1VQ93 1VQN3 1VQO3 1M904 1YJW3 1N8R4 1VQ83 3CME3 3CPW2 1K734 3CCV3 3G713 3CXC2 3CC23 1JJ22 1VQ53 1Q7Y4 2OTJ3 3CCJ3 2QA43 3CC43 3OW22 1S723 2OTL3 1M1K4 1YJN3 3CCL3 1VQK3 1YI23 1VQL3 1VQM3 1VQP3 1K8A4 1W2B2 1K9M4 1VQ63 3CCR3 3I553 3CC73 3G6E3 1YJ93 1QVG2 3CCM3 3CD63 1Q864 1KD14 1YHQ3 3G4S3 3CMA3 3CCQ3 1YIT3 1VQ73 1Q814 3CCS3
chains in the Genus database with same CATH superfamily
4IPBA 2HMKB 1DMNA 4O2HA 5LC7A 2QEX3 1V57A 1YIJ3 1VQ93 3RGRA 1D6ZA 1JZDA 1WTHA 2SARA 3F8HA 4N6LA 1O7HB 4GSPA 3CC23 4GHOA 1AV4A 2GEXA 1JJ22 1TFKA 1TFOA 1UCKA 3LH4A 3D5GA 5KP1A 3DM8A 4HOHA 1W6GA 3CCL3 1AVLA 1NO3A 2K0MA 2Q07A 3WOEB 2OWPA 3D3LA 1K9M4 2KRTA 1EEJA 3JUQA 1I8VA 3FG1A 5IW9A 5AI1A 1KD14 4FCMA 5AIFA 3G16A 1IQ8A 3NQZA 1GOUA 2FNQA 4KFFA 4BL3A 1UGHI 3EN8A 1STDA 3NBRA 1DETA 3WR2A 3QK9A 1LNIA 2BU4A 3Q1CA 1VQQA 2XSHB 1ASKA 3PZWA 3WHOA 2B24B 2K54A 4G1MB 3IMAB 4K61A 1GMQA 1UI7A 1A2VA 1TP6A 3LT8A 1UUVB 1R4CA 2XFSA 3CXC2 4AEQA 3UNLA 3EE1A 3BIRA 3K9MC 1RSNA 2K3DA 2OTJ3 1DMMA 2R41A 1BNFA 2BT3A 1B20A 3DXOA 2CWTA 3LTCA 1TUHA 1EUIC 1OF5B 3AGOA 3EJVA 5CXOA 1O7MB 3KSED 1RKYA 5DREA 3BB9A 1K8A4 2RFRA 2RBIA 2KF3A 4FMCA 5D83A 1FGQA 5IEPA 1UGIA 1BRKA 4OUQA 3NBJA 4LZIA 4GB5A 4R80A 1QVG2 1EA2A 3DGLA 1RNBA 1DMQA 1UW1A 3EB8A 1AY7A 1OACA 1TTOA 1GOVA 2R4IA 2OOVA 4H3UA 2CW9A 3H51A 5HGRA 1RHLA 1JB4A 1RCKA 2SBLA 1M9GA 3FGYA 3MYTA 3NUVA 4XM4A 9RNTA 1QAKA 1QJGA 2ZA4A 3F7XA 2F4YA 5G1LA 1OPYA 2CIUA 3FCSB 4K1VA 4WP5A 1RGEA 2CFGA 3DH2A 3PGBA 2UUGC 3SYUA 4RBNA 1UCJA 3FG3A 1TRPA 2CH9A 1YJN3 1EG9B 4R9KA 1BRGA 3A76A 1I0XA 2E2VA 3X41A 4LYLB 5CF2A 5M19A 1K41A 4FCZA 1JZOA 4K90B 5ELJA 1B2SA 2FGTA 4AKYA 3FG4A 1L5GB 3G6E3 1F8NA 2W56B 3CCM3 1AR0A 1JN5A 2W03A 4KFEA 3CPOA 4H61A 3LMLA 4N6MA 1TJDA 4STDA 6RNTA 1BVIA 1W4NA 1C7HA 1OHSA 2JDIH 3BNDA 1X1XA 1JNQA 2RSXA 2YX9A 1OHPA 3SX1A 1KQS2 3BNCA 3KFQC 1LNHA 3QRDA 3GZXB 1VQO3 5JPUA 1BNSA 1FUTA 2Y73A 3OWUA 3WODG 2JQ5A 3G713 3EF8A 1VQ53 3HK4A 4DKIA 2OQEA 3F9SA 1KWIA 3NV0B 4K1UA 1UUWB 1RTUA 2D42A 3EBTA 3LXUX 2OOVC 1NNVA 4KFDA 3S27A 3S28A 1W01A 3N54B 1BAOA 1UCIA 1BRJA 3LTBA 4FMAA 4HKVB 1VQK3 4WYKA 1VQP3 1N9JA 3AGNA 1BRHA 1N5HA 4HVNA 3CC73 1WMNA 2F5WA 5EEOA 3J7Yd 3CMA3 1YIT3 2E2UA 2CKFB 1OH0A 3OV4A 4X2OA 1CQSA 4EV5A 3OWSA 1VQ73 1D6UA 3EX9A 1SARA 1BU4A 1Q7HA 2W56A 3LOYA 1MWTA 1IV9A 3KCHA 3BNBA 4EYCA 1BOXA 1HU9A 1W2ZA 2M7OA 4EBGA 1CH0A 2B1XB 2CG0A 4XBYA 3F7SA 1WNHA 1US1A 3CU3A 3CCJ3 3FH1A 3E99A 1LQMB 4FR9A 1S723 2OTL3 2CFWA 1ULJB 3FZWA 1I2FA 2BMRB 4BU4A 8RNTA 1LXEA 1SPUA 2KF6A 5GSPA 2CFDA 1JBTA 2IY2A 3S67A 3RDEA 1B3SA 3GZBA 3LTAA 1IVWA 3NV0A 1BGSA 3D79A 1IQYA 5IG0A 3X3ZA 1FZUA 4CCVA 2HMLB 4N6UA 2CX0A 5D81A 2UGIA 2OQEC 1Q814 1RRHA 2BMOB 5KP3A 3AMOA 3BLZA 1MGWA 2Z7AA 3PS8A 3G0KA 3I563 2V1LA 3VGNA 1B2MA 4QWTA 1A67A 1ZS7A 5M18A 2BNGA 2XGNA 2I9WA 5FW5A 3DGOA 1ZGXA 4O8SA 6STDA 1RCLA 1NB3I 3RGAA 1T5YA 4LGQA 1RGGA 1ROVA 4O3VA 1TIJA 2WGOA 3MPHA 4HM1B 4EC6A 2L4VA 1DE3A 2P09A 2ML5A 1O7WB 3NQYA 2Z6BA 1BRNL 3X3XA 1UI8A 3SXXA 3G4S3 1YNVX 1NDOB 3S29A 1LOWA 2F99A 1T3BA 1Q824 1FYSA 4N6OB 2CX1A 4NPBA 3T0UA 2XGLA 1VQN3 5DRVA 2INXA 1ZO2A 1BNGA 2GBXB 4MMXB 2A15A 3MG1A 1T2IA 2ZL8A 4XDWA 1IT7A 1LVNA 1VZZA 3NHXA 3D9RA 1FGMA 1N8QA 1LOXA 1WMPA 4HJLB 1X1WA 3B8LA 2QA43 1S5AA 3X3YA 1J2BA 4O02B 1JN5B 2LQVA 1YGWA 2GU3A 1EKMA 1Y4KA 1RGCA 1WMOA 1IT8A 4BIRA 1DVDA 3AHWA 3FKAA 1YJ93 2BMQB 1RLSA 2XH9A 4HM0B 1BNRA 1IVVA 2HMNB 3URPA 1YJW3 5FGOA 1SIIA 3GWRA 4JRFA 1CEWI 1NJI4 1GY5A 1AQZA 2H0HA 3FF2A 4J5GA 5JPPA 1JBSA 4HAAA 1IYYA 4J9AA 2KAAA 2ML6A 3DUKA 1MGRA 5G1KA 3TDGA 3CME3 5A0OB 2IMJA 1TRQA 1K734 3D4AA 2HOHA 2W9QA 1M1XB 3OXAA 2F98A 3K63A 3MKIA 1U8CB 3B7CA 4OK0A 4TX4A 4WYKB 5AYSC 2W6JH 8CHOA 1RRLA 2KF5A 1FGTA 4U13A 1FGRA 5M1AA 3OW22 3CC43 1IQXA 1QAFA 3KIIA 2MC8A 1PY3A 1MOLA 1STFI 2QIYA 4RZMA 5AIGA 7STDA 3CCR3 1RMSA 2CWVA 2AAEA 2L1SA 3DMCA 1RN4A 1G02A 1E97A 1CYUA 2Y74A 2P05A 2HMOB 2PNCA 2GXFA 1SIHA 1I3FA 4L8PA 3ZFZA 1I2EA 3CNMA 2W0QA 5LC6A 2IA7A 1JBRA 1N5PA 3EBYA 1W00A 1BNIA 2XEPA 3MG2A 4FMDA 1PYLA 5IG5A 3WA3A 3D5IA 3L0RA 5HOHA 1BSEA 2GBWB 1BUJA 4HBRA 3JVCA 3UL6A 4N3VA 3KSPA 1YGEA 2CK3H 3LYGA 5CF1A 2CFLA 3WA2X 2GEYA 1EQKA 3AMOB 4L7KA 3SLUA 3I553 2BHMA 3PCSA 4FMBA 2F5MA 4FCJA 1T2HA 1GY7A 3IJEB 1I0VA 1I3IA 1U5OA 4XBTA 1DYUA 1W6YA 2P0XA 1Z1SA 3ROBA 3KZTA 1RGAA 2P0MA 2IYJA 1E3VA 7RNTA 3JUPA 1SQWA 2YFIB 3MHEA 1O7GB 1GYBA 2BO9B 4NHFA 3JUNA 3WOFB 1LOYA 1GOYA 4HM2B 1GD3A 1RDSA 4BTWA 3CNXA 4N6NB 2F56A 1A2PA 1RGLA 1Q40A 3JUMA 4HZBB 5EVHA 1GMRA 1V58A 3HZPA 1C54A 3FLJA 1RGFA 2KXGA 2XR8B 3HIGA 3LT9A 1O7PB 3B4PA 4GL6A 3SOYA 5BU4A 1BANA 1BRIA 1FUSA 3K0ZA 6GSPA 1ROAA 4N6TA 4J5KA 3EQQB 1A2KA 1RGHA 3MWZA 3NM2A 5IENA 2P38A 3BNEA 3JUOA 1IK3A 1HZ1A 2C11A 3T8UA 2CFKA 1I70A 1RGKA 3UB1A 1UDII 1KC84 1GD4A 2Z76A 3X42A 4WWUC 2RCDA 2W2CA 3MG3A 3N9HA 1OUNA 2YFLB 7GSPA 1ZX2A 4RNYA 4IT7A 2J8XB 4NREA 5AIHA 2IUJA 1Q7Y4 2XRXB 1FA3A 2GU1A 2W04A 1GMPA 1LRAA 2D1WA 4KT3B 3OWYA 2PZVA 2ZDJA 3Q2PA 2FXTA 4CJNA 3GAXA 4XBXA 4ZM8A 1PFPA 3HX8A 4XDVA 1JKGA 3A5EA 1BSAA 3Q3FA 1YHQ3 5G2GA 4RNZA 1D6YA 1Q42A 3ALAA 1B21A 1TU5A 1BNEA 5IG3A 3HOHA 1BSBA 3LTDA 2WOHA 1IV7A 1MNLA 1IVXA 1B2XA 5AIIA 3CCU3 4MMYB 4WHAA 3H3HA 1VQ83 3FF0A 5IG4A 3GZRA 3PXMA 4L8OA 3IPTA 3Q90A 1OHOA 3K7CA 4HM3B 4HYZA 4KVHA 1X1UA 1YVSA 1IVUA 4AKZA 4XB5A 5BXQA 1RN7A 2UX0A 1M1K4 1WQLB 1BIRA 1VQL3 1W6CA 1X1YA 1I2GA 1VQM3 3F8XA 4LEHA 1ULIB 3EHCA 2W9PA 2KCDA 3EC9A 3VSYA 4EW5A 3BU4A 4BL2A 1BRSA 3UL5A 1W7CA 2LYXA 3ER7A 3G8ZA 3O8YA 5RNTA 3EN1B 4MJDA 5AEUB 3V98A 1KSIA 3GRDA 1QVF2 5STDA 1VQ43 3K5TA 3PYJA 4R4KA 5IEOA 1M904 3B4OA 1CYVA 1GSPA 1G96A 3HI7A 1FUWA 3NXJA 4ORLA 1K28A 1V74A 2MF7A 4RNTA 5TGNA 3UJMA 1Q9EA 1OGXA 4LMIA 5AEWB 1G0TA 3VF1A 1JV2B 3SVAA 3KN4A 4HZ9B 1YI23 1RNTA 1W5ZA 1MWUA 2RNTA 3V99A 4EXRA 1JB2A 2CWUA 2H0GA 3NM7A 1DVCA 4BTYA 1OCVA 3F14A 1JRQA 1BSDA 1B2UA 4J8TA 4PEJA 5JBSA 3F40A 1SJWA 1NWWA 4MEIA 1N8R4 4OVMA 1BUQA 2Z77A 4I4KA 3CPW2 1Q40B 2O9UX 1FGOA 1MWSA 2GSPA 4KZ1A 2C4BA 3ECFA 1AVKA 1R4YA 2ZHXB 5CK6A 1NU3A 2H0IA 3AHSA 3GSPA 4CDLA 1RJOA 2F86B 3U1WA 3M8CA 1QMAA 3ZG0A 1B27A 1A90A 3DGYA 4EV2A 4MMZB 1VQ63 1OF5A 4X2HA 3SEDA 3U97A 4R1KA 1UUGB 3T8NA 1ISKA 1JB5A 1LOVA 2AADA 1FW7A 4JF8A 3X40A 3CCS3 1HKXA 2WO0A 2XFTA 1B2ZA 1QALA 2HMJB 4WFOA 1YVBI 2CHCA 2IUKA 4N6V0 4ILFA 1RN1A 4HM6B 4CPKA 2RGQA 1MWRA 3MSOA 3RNTA 3WMDA 3CCV3 4LSOA 2STDA 3DGMA 2E2TA 2YFJB 1GS3A 3GZYB 3KKGA 1IDPA 1LQGC 2XF3A 2CG1A 4HM4B 4BTXA 1E3RA 5EQLA 5KP4A 1JKGB 4Q53A 2HMMB 1BNJA 1W02A 3LZAA 2WGQA 3NBBA 3S5CA 1W2B2 1OGZA 3N8BA 2O3OA 2XSOB 3V92A 1PU4A 3WDGB 2WOFA 3KE7A 3CCQ3 3DGNA 3HIIA 3OX9A 4HM5B 3SOAA 1UCLA 5ELUA 5IF6A 3CCE3 4I5QA 4HM7B 1GY6A 5BIRA 3FSDA 5AYRB 2C10A 3STDA 1IU7A 1N9EA 1O7NB 2CC3A 2QGUA 3PCRA 4IIAA 3NX0A 4HM8B 5IERA 5BVBA 3DZLA 5CLKA 2OCTA 3ZG5A 2BIRA 5D82A 3CD63 3I0YA 1Q864 3DY5A 1NB5I 4R9LA 1HYFA 1BSCA 2KF4A 5I97A
chains in the Genus database with same CATH topology
4IPBA 2HMKB 1DMNA 4O2HA 5LC7A 2QEX3 1YIJ3 1VQ93 3RGRA 1D6ZA 1WTHA 3F8HA 4N6LA 1O7HB 3CC23 1AV4A 2GEXA 1JJ22 1TFKA 1TFOA 3LH4A 5KP1A 3DM8A 1W6GA 3CCL3 1AVLA 1NO3A 2K0MA 2Q07A 3WOEB 2OWPA 3D3LA 1K9M4 2KRTA 3JUQA 3FG1A 5IW9A 5AI1A 1KD14 4FCMA 5AIFA 3G16A 1IQ8A 3NQZA 4KFFA 2FNQA 3EN8A 1STDA 3NBRA 3QK9A 3Q1CA 3PZWA 2XSHB 1ASKA 2B24B 2K54A 4G1MB 3IMAB 4K61A 1UI7A 1A2VA 1TP6A 3LT8A 1UUVB 1R4CA 2XFSA 3CXC2 4AEQA 3UNLA 3EE1A 3K9MC 2OTJ3 1DMMA 2BT3A 3DXOA 2CWTA 3LTCA 1OF5B 1TUHA 3EJVA 5CXOA 1RKYA 1O7MB 3KSED 5DREA 3BB9A 1K8A4 2RFRA 4FMCA 5D83A 1FGQA 5IEPA 4OUQA 3NBJA 4LZIA 4GB5A 4R80A 1QVG2 1EA2A 3DGLA 1DMQA 1UW1A 3EB8A 1OACA 2R4IA 2OOVA 4H3UA 2CW9A 3H51A 5HGRA 1JB4A 2SBLA 1M9GA 3FGYA 3MYTA 3NUVA 4XM4A 1QAKA 1QJGA 3F7XA 1OPYA 2CIUA 3FCSB 4K1VA 4WP5A 2CFGA 3PGBA 4RBNA 3FG3A 2CH9A 1YJN3 1EG9B 4R9KA 3A76A 3X41A 2E2VA 5CF2A 1K41A 4FCZA 4K90B 5ELJA 2FGTA 4AKYA 3FG4A 1L5GB 3G6E3 1F8NA 2W56B 3CCM3 1AR0A 1JN5A 2W03A 4KFEA 3CPOA 4H61A 3LMLA 4N6MA 4STDA 1W4NA 1C7HA 1OHSA 2JDIH 3BNDA 2YX9A 1JNQA 2RSXA 3SX1A 1OHPA 1KQS2 3BNCA 3KFQC 1LNHA 3QRDA 3GZXB 1VQO3 5JPUA 2Y73A 3OWUA 3WODG 2JQ5A 3G713 3EF8A 1VQ53 3HK4A 2OQEA 3F9SA 1KWIA 3NV0B 4K1UA 1UUWB 2D42A 3EBTA 3LXUX 2OOVC 4KFDA 3S28A 3S27A 1W01A 3N54B 3LTBA 4HKVB 4FMAA 1VQK3 1VQP3 4WYKA 1N9JA 1N5HA 4HVNA 3CC73 1WMNA 5EEOA 3J7Yd 3CMA3 1YIT3 2E2UA 2CKFB 1OH0A 3OV4A 4X2OA 1CQSA 4EV5A 3OWSA 1VQ73 1D6UA 3EX9A 2W56A 3LOYA 1IV9A 4EYCA 3BNBA 1HU9A 1W2ZA 2M7OA 4EBGA 2B1XB 2CG0A 4XBYA 3F7SA 1WNHA 1US1A 3CU3A 3CCJ3 3FH1A 3E99A 4FR9A 1S723 2OTL3 2CFWA 1ULJB 3FZWA 2BMRB 1LXEA 1SPUA 2CFDA 3S67A 3RDEA 3GZBA 3LTAA 1IVWA 3NV0A 1IQYA 5IG0A 3X3ZA 4CCVA 2HMLB 4N6UA 5D81A 2OQEC 1Q814 1RRHA 2BMOB 5KP3A 3AMOA 3BLZA 2Z7AA 3PS8A 3G0KA 3I563 2V1LA 3VGNA 4QWTA 1A67A 2BNGA 2XGNA 2I9WA 5FW5A 3DGOA 4O8SA 6STDA 1NB3I 3RGAA 1T5YA 4LGQA 1ROVA 4O3VA 1TIJA 2WGOA 3MPHA 4HM1B 4EC6A 2L4VA 2P09A 2ML5A 1O7WB 3NQYA 2Z6BA 1UI8A 3SXXA 3G4S3 1NDOB 3S29A 2F99A 1Q824 4N6OB 3T0UA 2XGLA 1VQN3 5DRVA 2INXA 1ZO2A 2GBXB 4MMXB 2A15A 3MG1A 2ZL8A 4XDWA 1IT7A 1LVNA 1VZZA 3NHXA 3D9RA 1FGMA 1N8QA 1LOXA 1WMPA 4HJLB 3B8LA 2QA43 1S5AA 3X3YA 1J2BA 4O02B 1JN5B 2LQVA 2GU3A 1EKMA 1Y4KA 1WMOA 1IT8A 1DVDA 3FKAA 1YJ93 2BMQB 2XH9A 4HM0B 1IVVA 2HMNB 1YJW3 5FGOA 1SIIA 3GWRA 4JRFA 1CEWI 1NJI4 1GY5A 5JPPA 3FF2A 4J9AA 2ML6A 3DUKA 3TDGA 3CME3 5A0OB 2IMJA 1K734 2W9QA 1M1XB 3OXAA 2F98A 3K63A 3MKIA 1U8CB 3B7CA 4OK0A 4WYKB 5AYSC 8CHOA 2W6JH 1RRLA 4U13A 1FGTA 1FGRA 3CC43 3OW22 1IQXA 1QAFA 3KIIA 2MC8A 1MOLA 1STFI 2QIYA 4RZMA 5AIGA 7STDA 3CCR3 2CWVA 3DMCA 1E97A 1CYUA 2Y74A 2P05A 2HMOB 2PNCA 2GXFA 1SIHA 4L8PA 3CNMA 2W0QA 5LC6A 2IA7A 1N5PA 3EBYA 1W00A 2XEPA 3MG2A 4FMDA 5IG5A 3WA3A 3L0RA 2GBWB 4HBRA 3JVCA 3UL6A 4N3VA 3KSPA 1YGEA 2CK3H 3LYGA 5CF1A 2CFLA 3WA2X 2GEYA 1EQKA 3AMOB 4L7KA 3SLUA 3I553 2BHMA 3PCSA 4FMBA 4FCJA 3IJEB 1GY7A 4XBTA 1U5OA 1DYUA 1W6YA 2P0XA 1Z1SA 3ROBA 3KZTA 2P0MA 1E3VA 3JUPA 1SQWA 2YFIB 3MHEA 1O7GB 1GYBA 2BO9B 4NHFA 3JUNA 3WOFB 4HM2B 1GD3A 4BTWA 3CNXA 4N6NB 1Q40A 3JUMA 4HZBB 5EVHA 3HZPA 3FLJA 2KXGA 3HIGA 2XR8B 3LT9A 1O7PB 3B4PA 4GL6A 3SOYA 3K0ZA 1ROAA 4N6TA 3EQQB 1A2KA 3MWZA 3NM2A 5IENA 2P38A 3BNEA 3JUOA 1IK3A 2C11A 3T8UA 2CFKA 3UB1A 1KC84 1GD4A 2Z76A 3X42A 4WWUC 2W2CA 2RCDA 3MG3A 3N9HA 1OUNA 2YFLB 1ZX2A 4RNYA 4IT7A 4NREA 5AIHA 2IUJA 1Q7Y4 2XRXB 1FA3A 2GU1A 2W04A 2D1WA 3OWYA 2PZVA 2ZDJA 3Q2PA 2FXTA 3GAXA 4XBXA 4ZM8A 1PFPA 3HX8A 4XDVA 1JKGA 1YHQ3 5G2GA 4RNZA 1D6YA 1Q42A 3ALAA 1TU5A 5IG3A 3LTDA 2WOHA 1IV7A 1MNLA 1IVXA 5AIIA 3CCU3 4MMYB 4WHAA 3H3HA 1VQ83 3FF0A 5IG4A 3GZRA 3PXMA 4L8OA 3IPTA 3Q90A 1OHOA 3K7CA 4HM3B 4HYZA 4KVHA 1IVUA 4AKZA 4XB5A 5BXQA 1RN7A 2UX0A 1M1K4 1WQLB 1VQL3 1W6CA 1VQM3 3F8XA 4LEHA 1ULIB 3EHCA 2W9PA 2KCDA 3EC9A 3VSYA 3UL5A 1W7CA 2LYXA 3ER7A 3G8ZA 3O8YA 3EN1B 4MJDA 5AEUB 3V98A 1KSIA 3GRDA 1QVF2 5STDA 1VQ43 3K5TA 3PYJA 4R4KA 5IEOA 1M904 3B4OA 1CYVA 1G96A 3HI7A 1FUWA 3NXJA 4ORLA 1K28A 1V74A 2MF7A 3UJMA 5TGNA 1OGXA 4LMIA 5AEWB 3VF1A 1JV2B 3SVAA 3KN4A 4HZ9B 1YI23 1W5ZA 3V99A 4EXRA 1JB2A 2CWUA 3NM7A 1DVCA 4BTYA 1OCVA 3F14A 1JRQA 4J8TA 4PEJA 5JBSA 3F40A 1SJWA 1NWWA 4MEIA 1N8R4 4OVMA 1BUQA 2Z77A 4I4KA 3CPW2 1Q40B 2O9UX 1FGOA 4KZ1A 3ECFA 1AVKA 5CK6A 1NU3A 4CDLA 1RJOA 2F86B 3U1WA 3M8CA 1QMAA 1A90A 4EV2A 4MMZB 1VQ63 1OF5A 4X2HA 3SEDA 3U97A 4R1KA 3T8NA 1ISKA 1JB5A 4JF8A 3X40A 3CCS3 1HKXA 2WO0A 2XFTA 1QALA 2HMJB 4WFOA 1YVBI 2CHCA 2IUKA 4N6V0 4HM6B 2RGQA 3MSOA 3WMDA 3CCV3 4LSOA 2STDA 3DGMA 2E2TA 2YFJB 1GS3A 3GZYB 3KKGA 1IDPA 2XF3A 2CG1A 4BTXA 4HM4B 5KP4A 1E3RA 5EQLA 1JKGB 4Q53A 2HMMB 1W02A 3LZAA 2WGQA 3NBBA 3S5CA 1W2B2 1OGZA 3N8BA 2O3OA 2XSOB 3V92A 1PU4A 3WDGB 2WOFA 3KE7A 3CCQ3 3DGNA 3HIIA 3OX9A 4HM5B 3SOAA 5ELUA 5IF6A 3CCE3 4HM7B 1GY6A 3FSDA 5AYRB 2C10A 3STDA 1IU7A 1N9EA 1O7NB 2CC3A 2QGUA 3PCRA 4IIAA 3NX0A 4HM8B 5IERA 5BVBA 3DZLA 5CLKA 2OCTA 3CD63 5D82A 3I0YA 1Q864 3DY5A 1NB5I 4R9LA 3X3XA 4TX4A 5I97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI 4;  1Q82 4;  1QVF 2;  1VQ4 3;  2QEX 3;  1YIJ 3;  3CCU 3;  3I56 3;  1KQS 2;  3CCE 3;  1KC8 4;  1VQ9 3;  1VQN 3;  1VQO 3;  1M90 4;  1YJW 3;  1N8R 4;  1VQ8 3;  3CME 3;  3CPW 2;  1K73 4;  3CCV 3;  3G71 3;  3CXC 2;  3CC2 3;  1JJ2 2;  1VQ5 3;  1Q7Y 4;  2OTJ 3;  3CCJ 3;  2QA4 3;  3CC4 3;  3OW2 2;  1S72 3;  2OTL 3;  1M1K 4;  1YJN 3;  3CCL 3;  1VQK 3;  1YI2 3;  1VQL 3;  1VQM 3;  1VQP 3;  1K8A 4;  1W2B 2;  1K9M 4;  1VQ6 3;  3CCR 3;  3I55 3;  3CC7 3;  3G6E 3;  1YJ9 3;  1QVG 2;  3CCM 3;  3CD6 3;  1Q86 4;  1KD1 4;  1YHQ 3;  3G4S 3;  3CMA 3;  3CCQ 3;  1YIT 3;  1VQ7 3;  1Q81 4;  3CCS 3; 
#chains in the Genus database with same CATH topology
 4IPB A;  2HMK B;  1DMN A;  4O2H A;  5LC7 A;  2QEX 3;  1V57 A;  1YIJ 3;  1VQ9 3;  3RGR A;  1D6Z A;  1JZD A;  1WTH A;  2SAR A;  3F8H A;  4N6L A;  1O7H B;  4GSP A;  3CC2 3;  4GHO A;  1AV4 A;  2GEX A;  1JJ2 2;  1TFK A;  1TFO A;  1UCK A;  3LH4 A;  3D5G A;  5KP1 A;  3DM8 A;  4HOH A;  1W6G A;  3CCL 3;  1AVL A;  1NO3 A;  2K0M A;  2Q07 A;  3WOE B;  2OWP A;  3D3L A;  1K9M 4;  2KRT A;  1EEJ A;  3JUQ A;  1I8V A;  3FG1 A;  5IW9 A;  5AI1 A;  1KD1 4;  4FCM A;  5AIF A;  3G16 A;  1IQ8 A;  3NQZ A;  1GOU A;  2FNQ A;  4KFF A;  4BL3 A;  1UGH I;  3EN8 A;  1STD A;  3NBR A;  1DET A;  3WR2 A;  3QK9 A;  1LNI A;  2BU4 A;  3Q1C A;  1VQQ A;  2XSH B;  1ASK A;  3PZW A;  3WHO A;  2B24 B;  2K54 A;  4G1M B;  3IMA B;  4K61 A;  1GMQ A;  1UI7 A;  1A2V A;  1TP6 A;  3LT8 A;  1UUV B;  1R4C A;  2XFS A;  3CXC 2;  4AEQ A;  3UNL A;  3EE1 A;  3BIR A;  3K9M C;  1RSN A;  2K3D A;  2OTJ 3;  1DMM A;  2R41 A;  1BNF A;  2BT3 A;  1B20 A;  3DXO A;  2CWT A;  3LTC A;  1TUH A;  1EUI C;  1OF5 B;  3AGO A;  3EJV A;  5CXO A;  1O7M B;  3KSE D;  1RKY A;  5DRE A;  3BB9 A;  1K8A 4;  2RFR A;  2RBI A;  2KF3 A;  4FMC A;  5D83 A;  1FGQ A;  5IEP A;  1UGI A;  1BRK A;  4OUQ A;  3NBJ A;  4LZI A;  4GB5 A;  4R80 A;  1QVG 2;  1EA2 A;  3DGL A;  1RNB A;  1DMQ A;  1UW1 A;  3EB8 A;  1AY7 A;  1OAC A;  1TTO A;  1GOV A;  2R4I A;  2OOV A;  4H3U A;  2CW9 A;  3H51 A;  5HGR A;  1RHL A;  1JB4 A;  1RCK A;  2SBL A;  1M9G A;  3FGY A;  3MYT A;  3NUV A;  4XM4 A;  9RNT A;  1QAK A;  1QJG A;  2ZA4 A;  3F7X A;  2F4Y A;  5G1L A;  1OPY A;  2CIU A;  3FCS B;  4K1V A;  4WP5 A;  1RGE A;  2CFG A;  3DH2 A;  3PGB A;  2UUG C;  3SYU A;  4RBN A;  1UCJ A;  3FG3 A;  1TRP A;  2CH9 A;  1YJN 3;  1EG9 B;  4R9K A;  1BRG A;  3A76 A;  1I0X A;  2E2V A;  3X41 A;  4LYL B;  5CF2 A;  5M19 A;  1K41 A;  4FCZ A;  1JZO A;  4K90 B;  5ELJ A;  1B2S A;  2FGT A;  4AKY A;  3FG4 A;  1L5G B;  3G6E 3;  1F8N A;  2W56 B;  3CCM 3;  1AR0 A;  1JN5 A;  2W03 A;  4KFE A;  3CPO A;  4H61 A;  3LML A;  4N6M A;  1TJD A;  4STD A;  6RNT A;  1BVI A;  1W4N A;  1C7H A;  1OHS A;  2JDI H;  3BND A;  1X1X A;  1JNQ A;  2RSX A;  2YX9 A;  1OHP A;  3SX1 A;  1KQS 2;  3BNC A;  3KFQ C;  1LNH A;  3QRD A;  3GZX B;  1VQO 3;  5JPU A;  1BNS A;  1FUT A;  2Y73 A;  3OWU A;  3WOD G;  2JQ5 A;  3G71 3;  3EF8 A;  1VQ5 3;  3HK4 A;  4DKI A;  2OQE A;  3F9S A;  1KWI A;  3NV0 B;  4K1U A;  1UUW B;  1RTU A;  2D42 A;  3EBT A;  3LXU X;  2OOV C;  1NNV A;  4KFD A;  3S27 A;  3S28 A;  1W01 A;  3N54 B;  1BAO A;  1UCI A;  1BRJ A;  3LTB A;  4FMA A;  4HKV B;  1VQK 3;  4WYK A;  1VQP 3;  1N9J A;  3AGN A;  1BRH A;  1N5H A;  4HVN A;  3CC7 3;  1WMN A;  2F5W A;  5EEO A;  3J7Y d;  3CMA 3;  1YIT 3;  2E2U A;  2CKF B;  1OH0 A;  3OV4 A;  4X2O A;  1CQS A;  4EV5 A;  3OWS A;  1VQ7 3;  1D6U A;  3EX9 A;  1SAR A;  1BU4 A;  1Q7H A;  2W56 A;  3LOY A;  1MWT A;  1IV9 A;  3KCH A;  3BNB A;  4EYC A;  1BOX A;  1HU9 A;  1W2Z A;  2M7O A;  4EBG A;  1CH0 A;  2B1X B;  2CG0 A;  4XBY A;  3F7S A;  1WNH A;  1US1 A;  3CU3 A;  3CCJ 3;  3FH1 A;  3E99 A;  1LQM B;  4FR9 A;  1S72 3;  2OTL 3;  2CFW A;  1ULJ B;  3FZW A;  1I2F A;  2BMR B;  4BU4 A;  8RNT A;  1LXE A;  1SPU A;  2KF6 A;  5GSP A;  2CFD A;  1JBT A;  2IY2 A;  3S67 A;  3RDE A;  1B3S A;  3GZB A;  3LTA A;  1IVW A;  3NV0 A;  1BGS A;  3D79 A;  1IQY A;  5IG0 A;  3X3Z A;  1FZU A;  4CCV A;  2HML B;  4N6U A;  2CX0 A;  5D81 A;  2UGI A;  2OQE C;  1Q81 4;  1RRH A;  2BMO B;  5KP3 A;  3AMO A;  3BLZ A;  1MGW A;  2Z7A A;  3PS8 A;  3G0K A;  3I56 3;  2V1L A;  3VGN A;  1B2M A;  4QWT A;  1A67 A;  1ZS7 A;  5M18 A;  2BNG A;  2XGN A;  2I9W A;  5FW5 A;  3DGO A;  1ZGX A;  4O8S A;  6STD A;  1RCL A;  1NB3 I;  3RGA A;  1T5Y A;  4LGQ A;  1RGG A;  1ROV A;  4O3V A;  1TIJ A;  2WGO A;  3MPH A;  4HM1 B;  4EC6 A;  2L4V A;  1DE3 A;  2P09 A;  2ML5 A;  1O7W B;  3NQY A;  2Z6B A;  1BRN L;  3X3X A;  1UI8 A;  3SXX A;  3G4S 3;  1YNV X;  1NDO B;  3S29 A;  1LOW A;  2F99 A;  1T3B A;  1Q82 4;  1FYS A;  4N6O B;  2CX1 A;  4NPB A;  3T0U A;  2XGL A;  1VQN 3;  5DRV A;  2INX A;  1ZO2 A;  1BNG A;  2GBX B;  4MMX B;  2A15 A;  3MG1 A;  1T2I A;  2ZL8 A;  4XDW A;  1IT7 A;  1LVN A;  1VZZ A;  3NHX A;  3D9R A;  1FGM A;  1N8Q A;  1LOX A;  1WMP A;  4HJL B;  1X1W A;  3B8L A;  2QA4 3;  1S5A A;  3X3Y A;  1J2B A;  4O02 B;  1JN5 B;  2LQV A;  1YGW A;  2GU3 A;  1EKM A;  1Y4K A;  1RGC A;  1WMO A;  1IT8 A;  4BIR A;  1DVD A;  3AHW A;  3FKA A;  1YJ9 3;  2BMQ B;  1RLS A;  2XH9 A;  4HM0 B;  1BNR A;  1IVV A;  2HMN B;  3URP A;  1YJW 3;  5FGO A;  1SII A;  3GWR A;  4JRF A;  1CEW I;  1NJI 4;  1GY5 A;  1AQZ A;  2H0H A;  3FF2 A;  4J5G A;  5JPP A;  1JBS A;  4HAA A;  1IYY A;  4J9A A;  2KAA A;  2ML6 A;  3DUK A;  1MGR A;  5G1K A;  3TDG A;  3CME 3;  5A0O B;  2IMJ A;  1TRQ A;  1K73 4;  3D4A A;  2HOH A;  2W9Q A;  1M1X B;  3OXA A;  2F98 A;  3K63 A;  3MKI A;  1U8C B;  3B7C A;  4OK0 A;  4TX4 A;  4WYK B;  5AYS C;  2W6J H;  8CHO A;  1RRL A;  2KF5 A;  1FGT A;  4U13 A;  1FGR A;  5M1A A;  3OW2 2;  3CC4 3;  1IQX A;  1QAF A;  3KII A;  2MC8 A;  1PY3 A;  1MOL A;  1STF I;  2QIY A;  4RZM A;  5AIG A;  7STD A;  3CCR 3;  1RMS A;  2CWV A;  2AAE A;  2L1S A;  3DMC A;  1RN4 A;  1G02 A;  1E97 A;  1CYU A;  2Y74 A;  2P05 A;  2HMO B;  2PNC A;  2GXF A;  1SIH A;  1I3F A;  4L8P A;  3ZFZ A;  1I2E A;  3CNM A;  2W0Q A;  5LC6 A;  2IA7 A;  1JBR A;  1N5P A;  3EBY A;  1W00 A;  1BNI A;  2XEP A;  3MG2 A;  4FMD A;  1PYL A;  5IG5 A;  3WA3 A;  3D5I A;  3L0R A;  5HOH A;  1BSE A;  2GBW B;  1BUJ A;  4HBR A;  3JVC A;  3UL6 A;  4N3V A;  3KSP A;  1YGE A;  2CK3 H;  3LYG A;  5CF1 A;  2CFL A;  3WA2 X;  2GEY A;  1EQK A;  3AMO B;  4L7K A;  3SLU A;  3I55 3;  2BHM A;  3PCS A;  4FMB A;  2F5M A;  4FCJ A;  1T2H A;  1GY7 A;  3IJE B;  1I0V A;  1I3I A;  1U5O A;  4XBT A;  1DYU A;  1W6Y A;  2P0X A;  1Z1S A;  3ROB A;  3KZT A;  1RGA A;  2P0M A;  2IYJ A;  1E3V A;  7RNT A;  3JUP A;  1SQW A;  2YFI B;  3MHE A;  1O7G B;  1GYB A;  2BO9 B;  4NHF A;  3JUN A;  3WOF B;  1LOY A;  1GOY A;  4HM2 B;  1GD3 A;  1RDS A;  4BTW A;  3CNX A;  4N6N B;  2F56 A;  1A2P A;  1RGL A;  1Q40 A;  3JUM A;  4HZB B;  5EVH A;  1GMR A;  1V58 A;  3HZP A;  1C54 A;  3FLJ A;  1RGF A;  2KXG A;  2XR8 B;  3HIG A;  3LT9 A;  1O7P B;  3B4P A;  4GL6 A;  3SOY A;  5BU4 A;  1BAN A;  1BRI A;  1FUS A;  3K0Z A;  6GSP A;  1ROA A;  4N6T A;  4J5K A;  3EQQ B;  1A2K A;  1RGH A;  3MWZ A;  3NM2 A;  5IEN A;  2P38 A;  3BNE A;  3JUO A;  1IK3 A;  1HZ1 A;  2C11 A;  3T8U A;  2CFK A;  1I70 A;  1RGK A;  3UB1 A;  1UDI I;  1KC8 4;  1GD4 A;  2Z76 A;  3X42 A;  4WWU C;  2RCD A;  2W2C A;  3MG3 A;  3N9H A;  1OUN A;  2YFL B;  7GSP A;  1ZX2 A;  4RNY A;  4IT7 A;  2J8X B;  4NRE A;  5AIH A;  2IUJ A;  1Q7Y 4;  2XRX B;  1FA3 A;  2GU1 A;  2W04 A;  1GMP A;  1LRA A;  2D1W A;  4KT3 B;  3OWY A;  2PZV A;  2ZDJ A;  3Q2P A;  2FXT A;  4CJN A;  3GAX A;  4XBX A;  4ZM8 A;  1PFP A;  3HX8 A;  4XDV A;  1JKG A;  3A5E A;  1BSA A;  3Q3F A;  1YHQ 3;  5G2G A;  4RNZ A;  1D6Y A;  1Q42 A;  3ALA A;  1B21 A;  1TU5 A;  1BNE A;  5IG3 A;  3HOH A;  1BSB A;  3LTD A;  2WOH A;  1IV7 A;  1MNL A;  1IVX A;  1B2X A;  5AII A;  3CCU 3;  4MMY B;  4WHA A;  3H3H A;  1VQ8 3;  3FF0 A;  5IG4 A;  3GZR A;  3PXM A;  4L8O A;  3IPT A;  3Q90 A;  1OHO A;  3K7C A;  4HM3 B;  4HYZ A;  4KVH A;  1X1U A;  1YVS A;  1IVU A;  4AKZ A;  4XB5 A;  5BXQ A;  1RN7 A;  2UX0 A;  1M1K 4;  1WQL B;  1BIR A;  1VQL 3;  1W6C A;  1X1Y A;  1I2G A;  1VQM 3;  3F8X A;  4LEH A;  1ULI B;  3EHC A;  2W9P A;  2KCD A;  3EC9 A;  3VSY A;  4EW5 A;  3BU4 A;  4BL2 A;  1BRS A;  3UL5 A;  1W7C A;  2LYX A;  3ER7 A;  3G8Z A;  3O8Y A;  5RNT A;  3EN1 B;  4MJD A;  5AEU B;  3V98 A;  1KSI A;  3GRD A;  1QVF 2;  5STD A;  1VQ4 3;  3K5T A;  3PYJ A;  4R4K A;  5IEO A;  1M90 4;  3B4O A;  1CYV A;  1GSP A;  1G96 A;  3HI7 A;  1FUW A;  3NXJ A;  4ORL A;  1K28 A;  1V74 A;  2MF7 A;  4RNT A;  5TGN A;  3UJM A;  1Q9E A;  1OGX A;  4LMI A;  5AEW B;  1G0T A;  3VF1 A;  1JV2 B;  3SVA A;  3KN4 A;  4HZ9 B;  1YI2 3;  1RNT A;  1W5Z A;  1MWU A;  2RNT A;  3V99 A;  4EXR A;  1JB2 A;  2CWU A;  2H0G A;  3NM7 A;  1DVC A;  4BTY A;  1OCV A;  3F14 A;  1JRQ A;  1BSD A;  1B2U A;  4J8T A;  4PEJ A;  5JBS A;  3F40 A;  1SJW A;  1NWW A;  4MEI A;  1N8R 4;  4OVM A;  1BUQ A;  2Z77 A;  4I4K A;  3CPW 2;  1Q40 B;  2O9U X;  1FGO A;  1MWS A;  2GSP A;  4KZ1 A;  2C4B A;  3ECF A;  1AVK A;  1R4Y A;  2ZHX B;  5CK6 A;  1NU3 A;  2H0I A;  3AHS A;  3GSP A;  4CDL A;  1RJO A;  2F86 B;  3U1W A;  3M8C A;  1QMA A;  3ZG0 A;  1B27 A;  1A90 A;  3DGY A;  4EV2 A;  4MMZ B;  1VQ6 3;  1OF5 A;  4X2H A;  3SED A;  3U97 A;  4R1K A;  1UUG B;  3T8N A;  1ISK A;  1JB5 A;  1LOV A;  2AAD A;  1FW7 A;  4JF8 A;  3X40 A;  3CCS 3;  1HKX A;  2WO0 A;  2XFT A;  1B2Z A;  1QAL A;  2HMJ B;  4WFO A;  1YVB I;  2CHC A;  2IUK A;  4N6V 0;  4ILF A;  1RN1 A;  4HM6 B;  4CPK A;  2RGQ A;  1MWR A;  3MSO A;  3RNT A;  3WMD A;  3CCV 3;  4LSO A;  2STD A;  3DGM A;  2E2T A;  2YFJ B;  1GS3 A;  3GZY B;  3KKG A;  1IDP A;  1LQG C;  2XF3 A;  2CG1 A;  4HM4 B;  4BTX A;  1E3R A;  5EQL A;  5KP4 A;  1JKG B;  4Q53 A;  2HMM B;  1BNJ A;  1W02 A;  3LZA A;  2WGQ A;  3NBB A;  3S5C A;  1W2B 2;  1OGZ A;  3N8B A;  2O3O A;  2XSO B;  3V92 A;  1PU4 A;  3WDG B;  2WOF A;  3KE7 A;  3CCQ 3;  3DGN A;  3HII A;  3OX9 A;  4HM5 B;  3SOA A;  1UCL A;  5ELU A;  5IF6 A;  3CCE 3;  4I5Q A;  4HM7 B;  1GY6 A;  5BIR A;  3FSD A;  5AYR B;  2C10 A;  3STD A;  1IU7 A;  1N9E A;  1O7N B;  2CC3 A;  2QGU A;  3PCR A;  4IIA A;  3NX0 A;  4HM8 B;  5IER A;  5BVB A;  3DZL A;  5CLK A;  2OCT A;  3ZG5 A;  2BIR A;  5D82 A;  3CD6 3;  3I0Y A;  1Q86 4;  3DY5 A;  1NB5 I;  4R9L A;  1HYF A;  1BSC A;  2KF4 A;  5I97 A; 
#chains in the Genus database with same CATH homology
 4IPB A;  2HMK B;  1DMN A;  4O2H A;  5LC7 A;  2QEX 3;  1YIJ 3;  1VQ9 3;  3RGR A;  1D6Z A;  1WTH A;  3F8H A;  4N6L A;  1O7H B;  3CC2 3;  1AV4 A;  2GEX A;  1JJ2 2;  1TFK A;  1TFO A;  3LH4 A;  5KP1 A;  3DM8 A;  1W6G A;  3CCL 3;  1AVL A;  1NO3 A;  2K0M A;  2Q07 A;  3WOE B;  2OWP A;  3D3L A;  1K9M 4;  2KRT A;  3JUQ A;  3FG1 A;  5IW9 A;  5AI1 A;  1KD1 4;  4FCM A;  5AIF A;  3G16 A;  1IQ8 A;  3NQZ A;  4KFF A;  2FNQ A;  3EN8 A;  1STD A;  3NBR A;  3QK9 A;  3Q1C A;  3PZW A;  2XSH B;  1ASK A;  2B24 B;  2K54 A;  4G1M B;  3IMA B;  4K61 A;  1UI7 A;  1A2V A;  1TP6 A;  3LT8 A;  1UUV B;  1R4C A;  2XFS A;  3CXC 2;  4AEQ A;  3UNL A;  3EE1 A;  3K9M C;  2OTJ 3;  1DMM A;  2BT3 A;  3DXO A;  2CWT A;  3LTC A;  1OF5 B;  1TUH A;  3EJV A;  5CXO A;  1RKY A;  1O7M B;  3KSE D;  5DRE A;  3BB9 A;  1K8A 4;  2RFR A;  4FMC A;  5D83 A;  1FGQ A;  5IEP A;  4OUQ A;  3NBJ A;  4LZI A;  4GB5 A;  4R80 A;  1QVG 2;  1EA2 A;  3DGL A;  1DMQ A;  1UW1 A;  3EB8 A;  1OAC A;  2R4I A;  2OOV A;  4H3U A;  2CW9 A;  3H51 A;  5HGR A;  1JB4 A;  2SBL A;  1M9G A;  3FGY A;  3MYT A;  3NUV A;  4XM4 A;  1QAK A;  1QJG A;  3F7X A;  1OPY A;  2CIU A;  3FCS B;  4K1V A;  4WP5 A;  2CFG A;  3PGB A;  4RBN A;  3FG3 A;  2CH9 A;  1YJN 3;  1EG9 B;  4R9K A;  3A76 A;  3X41 A;  2E2V A;  5CF2 A;  1K41 A;  4FCZ A;  4K90 B;  5ELJ A;  2FGT A;  4AKY A;  3FG4 A;  1L5G B;  3G6E 3;  1F8N A;  2W56 B;  3CCM 3;  1AR0 A;  1JN5 A;  2W03 A;  4KFE A;  3CPO A;  4H61 A;  3LML A;  4N6M A;  4STD A;  1W4N A;  1C7H A;  1OHS A;  2JDI H;  3BND A;  2YX9 A;  1JNQ A;  2RSX A;  3SX1 A;  1OHP A;  1KQS 2;  3BNC A;  3KFQ C;  1LNH A;  3QRD A;  3GZX B;  1VQO 3;  5JPU A;  2Y73 A;  3OWU A;  3WOD G;  2JQ5 A;  3G71 3;  3EF8 A;  1VQ5 3;  3HK4 A;  2OQE A;  3F9S A;  1KWI A;  3NV0 B;  4K1U A;  1UUW B;  2D42 A;  3EBT A;  3LXU X;  2OOV C;  4KFD A;  3S28 A;  3S27 A;  1W01 A;  3N54 B;  3LTB A;  4HKV B;  4FMA A;  1VQK 3;  1VQP 3;  4WYK A;  1N9J A;  1N5H A;  4HVN A;  3CC7 3;  1WMN A;  5EEO A;  3J7Y d;  3CMA 3;  1YIT 3;  2E2U A;  2CKF B;  1OH0 A;  3OV4 A;  4X2O A;  1CQS A;  4EV5 A;  3OWS A;  1VQ7 3;  1D6U A;  3EX9 A;  2W56 A;  3LOY A;  1IV9 A;  4EYC A;  3BNB A;  1HU9 A;  1W2Z A;  2M7O A;  4EBG A;  2B1X B;  2CG0 A;  4XBY A;  3F7S A;  1WNH A;  1US1 A;  3CU3 A;  3CCJ 3;  3FH1 A;  3E99 A;  4FR9 A;  1S72 3;  2OTL 3;  2CFW A;  1ULJ B;  3FZW A;  2BMR B;  1LXE A;  1SPU A;  2CFD A;  3S67 A;  3RDE A;  3GZB A;  3LTA A;  1IVW A;  3NV0 A;  1IQY A;  5IG0 A;  3X3Z A;  4CCV A;  2HML B;  4N6U A;  5D81 A;  2OQE C;  1Q81 4;  1RRH A;  2BMO B;  5KP3 A;  3AMO A;  3BLZ A;  2Z7A A;  3PS8 A;  3G0K A;  3I56 3;  2V1L A;  3VGN A;  4QWT A;  1A67 A;  2BNG A;  2XGN A;  2I9W A;  5FW5 A;  3DGO A;  4O8S A;  6STD A;  1NB3 I;  3RGA A;  1T5Y A;  4LGQ A;  1ROV A;  4O3V A;  1TIJ A;  2WGO A;  3MPH A;  4HM1 B;  4EC6 A;  2L4V A;  2P09 A;  2ML5 A;  1O7W B;  3NQY A;  2Z6B A;  1UI8 A;  3SXX A;  3G4S 3;  1NDO B;  3S29 A;  2F99 A;  1Q82 4;  4N6O B;  3T0U A;  2XGL A;  1VQN 3;  5DRV A;  2INX A;  1ZO2 A;  2GBX B;  4MMX B;  2A15 A;  3MG1 A;  2ZL8 A;  4XDW A;  1IT7 A;  1LVN A;  1VZZ A;  3NHX A;  3D9R A;  1FGM A;  1N8Q A;  1LOX A;  1WMP A;  4HJL B;  3B8L A;  2QA4 3;  1S5A A;  3X3Y A;  1J2B A;  4O02 B;  1JN5 B;  2LQV A;  2GU3 A;  1EKM A;  1Y4K A;  1WMO A;  1IT8 A;  1DVD A;  3FKA A;  1YJ9 3;  2BMQ B;  2XH9 A;  4HM0 B;  1IVV A;  2HMN B;  1YJW 3;  5FGO A;  1SII A;  3GWR A;  4JRF A;  1CEW I;  1NJI 4;  1GY5 A;  5JPP A;  3FF2 A;  4J9A A;  2ML6 A;  3DUK A;  3TDG A;  3CME 3;  5A0O B;  2IMJ A;  1K73 4;  2W9Q A;  1M1X B;  3OXA A;  2F98 A;  3K63 A;  3MKI A;  1U8C B;  3B7C A;  4OK0 A;  4WYK B;  5AYS C;  8CHO A;  2W6J H;  1RRL A;  4U13 A;  1FGT A;  1FGR A;  3CC4 3;  3OW2 2;  1IQX A;  1QAF A;  3KII A;  2MC8 A;  1MOL A;  1STF I;  2QIY A;  4RZM A;  5AIG A;  7STD A;  3CCR 3;  2CWV A;  3DMC A;  1E97 A;  1CYU A;  2Y74 A;  2P05 A;  2HMO B;  2PNC A;  2GXF A;  1SIH A;  4L8P A;  3CNM A;  2W0Q A;  5LC6 A;  2IA7 A;  1N5P A;  3EBY A;  1W00 A;  2XEP A;  3MG2 A;  4FMD A;  5IG5 A;  3WA3 A;  3L0R A;  2GBW B;  4HBR A;  3JVC A;  3UL6 A;  4N3V A;  3KSP A;  1YGE A;  2CK3 H;  3LYG A;  5CF1 A;  2CFL A;  3WA2 X;  2GEY A;  1EQK A;  3AMO B;  4L7K A;  3SLU A;  3I55 3;  2BHM A;  3PCS A;  4FMB A;  4FCJ A;  3IJE B;  1GY7 A;  4XBT A;  1U5O A;  1DYU A;  1W6Y A;  2P0X A;  1Z1S A;  3ROB A;  3KZT A;  2P0M A;  1E3V A;  3JUP A;  1SQW A;  2YFI B;  3MHE A;  1O7G B;  1GYB A;  2BO9 B;  4NHF A;  3JUN A;  3WOF B;  4HM2 B;  1GD3 A;  4BTW A;  3CNX A;  4N6N B;  1Q40 A;  3JUM A;  4HZB B;  5EVH A;  3HZP A;  3FLJ A;  2KXG A;  3HIG A;  2XR8 B;  3LT9 A;  1O7P B;  3B4P A;  4GL6 A;  3SOY A;  3K0Z A;  1ROA A;  4N6T A;  3EQQ B;  1A2K A;  3MWZ A;  3NM2 A;  5IEN A;  2P38 A;  3BNE A;  3JUO A;  1IK3 A;  2C11 A;  3T8U A;  2CFK A;  3UB1 A;  1KC8 4;  1GD4 A;  2Z76 A;  3X42 A;  4WWU C;  2W2C A;  2RCD A;  3MG3 A;  3N9H A;  1OUN A;  2YFL B;  1ZX2 A;  4RNY A;  4IT7 A;  4NRE A;  5AIH A;  2IUJ A;  1Q7Y 4;  2XRX B;  1FA3 A;  2GU1 A;  2W04 A;  2D1W A;  3OWY A;  2PZV A;  2ZDJ A;  3Q2P A;  2FXT A;  3GAX A;  4XBX A;  4ZM8 A;  1PFP A;  3HX8 A;  4XDV A;  1JKG A;  1YHQ 3;  5G2G A;  4RNZ A;  1D6Y A;  1Q42 A;  3ALA A;  1TU5 A;  5IG3 A;  3LTD A;  2WOH A;  1IV7 A;  1MNL A;  1IVX A;  5AII A;  3CCU 3;  4MMY B;  4WHA A;  3H3H A;  1VQ8 3;  3FF0 A;  5IG4 A;  3GZR A;  3PXM A;  4L8O A;  3IPT A;  3Q90 A;  1OHO A;  3K7C A;  4HM3 B;  4HYZ A;  4KVH A;  1IVU A;  4AKZ A;  4XB5 A;  5BXQ A;  1RN7 A;  2UX0 A;  1M1K 4;  1WQL B;  1VQL 3;  1W6C A;  1VQM 3;  3F8X A;  4LEH A;  1ULI B;  3EHC A;  2W9P A;  2KCD A;  3EC9 A;  3VSY A;  3UL5 A;  1W7C A;  2LYX A;  3ER7 A;  3G8Z A;  3O8Y A;  3EN1 B;  4MJD A;  5AEU B;  3V98 A;  1KSI A;  3GRD A;  1QVF 2;  5STD A;  1VQ4 3;  3K5T A;  3PYJ A;  4R4K A;  5IEO A;  1M90 4;  3B4O A;  1CYV A;  1G96 A;  3HI7 A;  1FUW A;  3NXJ A;  4ORL A;  1K28 A;  1V74 A;  2MF7 A;  3UJM A;  5TGN A;  1OGX A;  4LMI A;  5AEW B;  3VF1 A;  1JV2 B;  3SVA A;  3KN4 A;  4HZ9 B;  1YI2 3;  1W5Z A;  3V99 A;  4EXR A;  1JB2 A;  2CWU A;  3NM7 A;  1DVC A;  4BTY A;  1OCV A;  3F14 A;  1JRQ A;  4J8T A;  4PEJ A;  5JBS A;  3F40 A;  1SJW A;  1NWW A;  4MEI A;  1N8R 4;  4OVM A;  1BUQ A;  2Z77 A;  4I4K A;  3CPW 2;  1Q40 B;  2O9U X;  1FGO A;  4KZ1 A;  3ECF A;  1AVK A;  5CK6 A;  1NU3 A;  4CDL A;  1RJO A;  2F86 B;  3U1W A;  3M8C A;  1QMA A;  1A90 A;  4EV2 A;  4MMZ B;  1VQ6 3;  1OF5 A;  4X2H A;  3SED A;  3U97 A;  4R1K A;  3T8N A;  1ISK A;  1JB5 A;  4JF8 A;  3X40 A;  3CCS 3;  1HKX A;  2WO0 A;  2XFT A;  1QAL A;  2HMJ B;  4WFO A;  1YVB I;  2CHC A;  2IUK A;  4N6V 0;  4HM6 B;  2RGQ A;  3MSO A;  3WMD A;  3CCV 3;  4LSO A;  2STD A;  3DGM A;  2E2T A;  2YFJ B;  1GS3 A;  3GZY B;  3KKG A;  1IDP A;  2XF3 A;  2CG1 A;  4BTX A;  4HM4 B;  5KP4 A;  1E3R A;  5EQL A;  1JKG B;  4Q53 A;  2HMM B;  1W02 A;  3LZA A;  2WGQ A;  3NBB A;  3S5C A;  1W2B 2;  1OGZ A;  3N8B A;  2O3O A;  2XSO B;  3V92 A;  1PU4 A;  3WDG B;  2WOF A;  3KE7 A;  3CCQ 3;  3DGN A;  3HII A;  3OX9 A;  4HM5 B;  3SOA A;  5ELU A;  5IF6 A;  3CCE 3;  4HM7 B;  1GY6 A;  3FSD A;  5AYR B;  2C10 A;  3STD A;  1IU7 A;  1N9E A;  1O7N B;  2CC3 A;  2QGU A;  3PCR A;  4IIA A;  3NX0 A;  4HM8 B;  5IER A;  5BVB A;  3DZL A;  5CLK A;  2OCT A;  3CD6 3;  5D82 A;  3I0Y A;  1Q86 4;  3DY5 A;  1NB5 I;  4R9L A;  3X3X A;  4TX4 A;  5I97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...