1YI2F

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yi2F00
3N4YA 1IPAA 1VQ5F 1Q86H 3G6EF 3CCEF 1JJ2F 1GO1A 3E1YA 3HJWC 2QEXF 2VGMA 3RA6A 1YITF 3I56F 3FFMA 1Q81H 1ZWZA 3N4ZA 3VMFB 2LBXA 1GO0A 1CN7A 3OW2F 2CZWA 3CCMF 3CMEF 1YI2F 3RA5A 3LWRC 1GZ0A 3CXCF 2JNBA 1KC8H 3CC2F 4BY9D 4NUTA 1SDSA 1RLGA 1YJ9F 3CCVF 5FJ4C 3OBYA 3LWQC 3I55F 2WALA 3CG6A 1VQPF 1H7MA 1VQOF 1QVGF 3V7EA 1W2BF 2I6DA 2KTVA 3G71F 1N8RH 1CK2A 1KQSF 3J81M 3GYQA 3SIUA 3CCQF 2OZBA 3MCAB 5IT9M 2AIFA 3J80M 3NVIB 3ON1A 2HVYD 1M90H 4TZZA 2OTLF 4C4WC 5EO3A 1VQKF 1NJIH 1YJNF 3CMAF 3CCLF 1VQ8F 3HAXD 1K9MH 1VQ7F 5GINC 3CC4F 4X3MA 1DT9A 1Q7YH 3JCMM 1E7KA 1X7OA 3NVKE 1KD1H 4X3LA 1YIJF 2QI2A 5A2QM 3NK6A 5G4UC 3E20B 3IR9A 1VQMF 3PLAC 3LWVC 1VQ9F 3NMUC 1X7PA 5G4VC 3CC7F 1T0KB 4BW0B 1RA4A 2FC3A 1W41A 1W40A 1VQNF 1M1KH 2OTJF 3PAFA 5GAPK 3CCJF 3O85A 4LCKA 1W3EX 2KG4A 3LFOA 1XBIA 5EWRA 3CCSF 1YHQF 3CPQA 3V7QA 1K73H 3AGKA 2OHWA 3VI6A 1Q82H 2BO1A 3LWOC 3CCUF 1VQ4F 3JAMM 1X52A 1W42A 3OBWA 1QVFF 2KTUA 3J7AR 2LBWA 3SIVA 1NMUB 5GIOC 3WXMB 5GANK 3NK7A 2VGNA 5DCVA 1S72F 3CD6F 2QA4F 3CPWF 3LWPC 5FLXM 1YJWF 3G4SF 3CCRF 1PXWA 1VQLF 1VQ6F 5GIPC 2ALEA 1K8AH
chains in the Genus database with same CATH superfamily
4BT5A 2K1SA 4I4TA 1IPAA 1JFFA 1RQ7A 1VQ5F 3CCEF 1JJ2F 5CA0A 2QEXF 4IHJA 4F6RB 4ZHYB 1UI9A 5BMVB 3IEQA 4R40B 1YITF 1W5BA 3K0TA 4O4IB 1ZWZA 3P10A 5GONB 5JVDB 3JASB 3VMFB 5EIBD 3M4SA 1CN7A 2CZWA 3ZP7A 2VAMA 3LWRC 1GZ0A 3JVHA 2JNBA 4O2BB 2VAWA 5EYPB 2CW4A 2RHHA 4YJ3B 5LP6B 1RQ2A 2HRYA 2WALA 3C8LA 4EB6A 1QVGF 2I6DA 3S02A 1CK2A 3WPXA 1KQSF 4C8GA 3GYQA 4F6RA 3C9UA 3D00A 3MCAB 3JARA 2OTMA 4O4LA 1H48A 1SA0A 1ONIA 3IKEA 4TZZA 2HQSC 3Q8HA 4EI8A 2FGYA 2GLZA 3V3TA 4X1IB 5JQGB 5J2UB 2UYKA 4NWOB 4B45A 1W55A 2CSLA 3F0FA 2Z01A 1IV3A 1X7OA 3NVKE 3GTZA 4I55B 3TD5A 5HY1A 5G4UC 3RYIB 3PLAC 3LWVC 1U3LA 1VQ9F 2QTPA 3M1XA 4ZI7A 1T0KB 1SA0B 4BW0B 3GHZA 3WJPA 3JALB 4I4TB 2ZVYA 3HKCA 3QUWA 5LOVB 2B33A 5CA0B 1M1KH 4RHAA 4B62A 2HP3A 3O85A 3OONA 1W3EX 2LBTA 3V4DA 2UYNA 2I6RA 3IEWA 2HS3A 1U3PA 3QHDA 3CCSF 3CPQA 4G4VA 1FSZA 3P0ZA 1UFYA 3N2GA 3N2KA 4DXDA 3S0WA 3JAMM 1X52A 5JH7B 3CB2A 4B5CA 2NMUA 3LDTA 2VXYA 5LA6A 3MBMA 4RQOA 3MQWA 4XCQA 4IIJA 5LP6C 4X20B 4BVTA 5CA1B 3CPWF 4O4LB 3P4EA 3CCRF 1COMA 3VCZA 5B8FA 3KE1A 4C82A 1GO1A 2GZLA 4BT7A 2VGMA 2Z1TA 1W5FA 2AMTA 3RA6A 3F0EA 3I56F 3FFMA 1Q81H 1YQNA 2LBXA 3OW2F 3CCMF 5LA6B 4E6EA 1W581 4IIJB 2BTUA 3RYHA 5EIBC 1IV1A 2Q1XA 3JATB 3I55F 1H7MA 1JFFB 4G4WA 1N8RH 3ZOPA 5LYJB 3FD5A 5JCOC 3EORA 3SIUA 2OZBA 2H8CA 1VHAA 4FFBB 1GX1A 3JASA 3ZO8A 2CHSA 3HTNA 3ON1A 3C9SA 2IQQA 1FNKA 3RYHB 1VQKF 3HKBA 5KX5B 3CCLF 1VQ8F 2CWJA 3RYFA 2R751 2N48A 5GINC 1VQ7F 1YGYA 1DT9A 2BTOA 2F9ZC 3E22B 4O2AB 1XHOA 1YIJF 2QI2A 4I50A 5LYJA 3WGMA 5KMGB 3QTYA 3L7QA 2ZODA 5G4VC 1TVKB 1Q8RA 2HX0A 3CC7F 3CYQA 1RA4A 4DRXA 4C8EA 1FNJA 4C8IA 5JQGA 4WBNA 3VTIC 5J2UA 3K2XA 3WGLA 4TUYB 4BVSA 5GAPK 5CB4A 3CCJF 2H8EA 2KG4A 3LFOA 1IV4A 2PHNA 5HP7A 4TV9B 2IG8A 1TUBB 3S0HA 4X1YB 3AGKA 3VI6A 2RB9A 5EB1B 5CA1A 4B46A 1Q82H 3IKFA 4LNUB 3CCUF 1VQ4F 2RHOA 5IYZB 1W42A 4TV8B 3RYCA 3OBWA 1RLUA 2KTUA 1QVFF 3TD4A 1VH8A 3SIVA 1NMUB 5GIOC 1U40A 2MQEA 2VGNA 3NK7A 5DCVA 2GVIA 3KJKA 3CD6F 2QA4F 3F0GA 3JAWA 4FFBA 2V9YA 5FLXM 5C8YA 5GONA 5JVDA 2R6R1 3WGNA 3C9TA 4O4HB 4ZHWA 5IJ9A 4U3JA 3T80A 3N4YA 5LXTB 5HWEA 4O2BA 2H6LA 5EYPA 5FNVB 3HJWC 4X1KB 3E1YA 2HRUA 5HY4A 3JATA 5MN5A 2DYYA 3F0DA 3N4ZA 1VQVA 1GO0A 1W57A 3CMEF 5EZYA 3DC2A 1YI2F 3CXCF 1KC8H 3CC2F 3FBAA 1RLGA 4O4JB 2HS4A 4ZHVA 5FJ4C 3OBYA 3S06A 5IJ9B 1VQPF 2KTVA 5EB0A 3J81M 1KNKA 2YXZA 5J2TB 2HS0A 3WPWA 4BT6A 3HKDB 5IT9M 2AIFA 3MDOA 5HY0A 3J80M 3B6NA 2CVLA 3NVIB 4I50B 2HP0A 4C4WC 4U39A 5HXZA 5EZYB 3WJRA 5EO3A 1NJIH 1YJNF 4LNUA 4YJ2A 3CMAF 5ITZB 1K9MH 4O4JA 4X3MA 4ZOLB 4IHJB 1CLIA 4DRXB 3JCMM 4G4XA 3HKCB 4PWTA 1KD1H 3DDNA 4X3LA 4BT4A 5HY2A 4X20A 1DBFA 3IR9A 1VQMF 2UYNB 5LP6A 1Z5WA 4X1IA 3VOBA 4O4HA 1H47A 2L26A 3VOAA 3HKEA 5LXTA 4BT2A 3JAKA 1W41A 3HKBB 5KX5A 1W40A 3N2KB 1QU9A 2Z1FA 3MCQA 1JN1A 5IYZA 3D01A 4ZOLA 1W5EA 3S0YA 3I3FA 4ZHQA 4M8IA 4EI9A 1YHQF 1K73H 3I7TA 3WJQA 3TD3A 3IMPA 2BO1A 3LWOC 2ZVZA 4U3JB 1W59A 3UT5A 3J7AR 4O4IA 4TUYA 1S72F 4EI7A 3D54A 1YJWF 4HNAA 3ESJA 2HP0B 4TV9A 1PXWA 1VQ6F 5GIPC 1FFXA 2ALEA 4ERHA 3JALA 1KNJA 5MN6A 1Q86H 2UYPA 3FPIA 3G6EF 3K12A 1VK3A 2BTQB 5JH7A 1QAHA 3CYPB 2Q1YA 3RA5A 2ZAUA 2Z1EA 3WGJA 3HKDA 1W5AA 2IAFA 4BY9D 4NUTA 2CHTA 3BYQA 5C8YB 3KHNA 3HWUA 1YJ9F 1SDSA 3CCVF 1TVKA 2DT4A 3RYFB 4BT3A 1SZQA 3LWQC 5EAZA 3JAKB 3ZP4A 5BMVA 3CG6A 2W8BC 3C9RA 1VQOF 3V7EA 1JY8A 3VIUA 4X1KA 5FNVA 4C81A 5IJ0B 3G71F 4NQ3A 1W2BF 1XRGA 4I55A 1X25A 5CB4B 4ZI7B 3CCQF 3E22A 3RYIA 4KWEA 2ZF8A 2HVYD 1M90H 1TUBA 4BVQA 2OTLF 5HXUA 1PF5A 3RE3A 3F6MA 1OFUA 4G4ZA 5LOVA 2ZOVA 3HAXD 2YYEA 3CC4F 3U0OA 3RYCB 1Q7YH 1T0AA 3HKEB 1J7HA 3VO8A 1E7KA 4WBNB 4G88A 2UZHA 5J2TA 5A2QM 3NK6A 3E20B 4X1YA 3JAWB 1JD1A 3NMUC 2KGWA 4BVRA 1FFXB 1X7PA 1U43A 5JCOA 1R1MA 4TV8A 2FC3A 5MN4A 1XV2A 5ITZA 4EB6B 4YJ2B 4O2AA 1NQ3A 3VYUC 1OAPA 1VQNF 2OTJF 3M84A 2LCAA 3PAFA 4G4YA 2G9IA 3UT5B 1ODEA 4LCKA 2RHJA 1XBIA 1IV2A 3JARB 2RHLA 5EWRA 2P6YA 1QD9A 1Z5VA 5KMGA 3V7QA 2OHWA 3R0PA 3FD6A 4HNAB 3LMEA 5AVMA 3ERNA 2EWCA 2PMPA 3WGKA 2LBWA 2AIZP 3ELCA 5IJ0A 3K14A 3WXMB 5GANK 3S03A 3KJJA 4ZHQB 2Z1UA 3VYSC 3LWPC 3LYBA 3N2GB 5HP8A 2VAPA 4ZK7A 2UYJA 3G4SF 1VQLF 3KIZA 4YJ3A 3VYTC 1K8AH
chains in the Genus database with same CATH topology
3N4YA 1IPAA 1VQ5F 1Q86H 5HWEA 3G6EF 3CCEF 1JJ2F 1GO1A 3E1YA 3HJWC 2QEXF 2VGMA 5HY4A 3RA6A 1YITF 3I56F 3FFMA 1Q81H 1ZWZA 3N4ZA 3VMFB 2LBXA 1GO0A 1CN7A 3OW2F 2CZWA 3CCMF 3CMEF 1YI2F 3RA5A 3LWRC 1GZ0A 3CXCF 2JNBA 1KC8H 3CC2F 4BY9D 4NUTA 1SDSA 1RLGA 1YJ9F 3CCVF 5FJ4C 3OBYA 3LWQC 3I55F 2WALA 3CG6A 1VQPF 1H7MA 1VQOF 1QVGF 3V7EA 1W2BF 2I6DA 2KTVA 3G71F 1N8RH 1CK2A 4NQ3A 1KQSF 3J81M 3GYQA 3SIUA 3CCQF 2OZBA 3D00A 3MCAB 5IT9M 2AIFA 5HY0A 3J80M 3NVIB 3ON1A 2HVYD 1M90H 4BVQA 4TZZA 2OTLF 4C4WC 5HXUA 5HXZA 4EI8A 5EO3A 1VQKF 1NJIH 2FGYA 1YJNF 2GLZA 3V3TA 3CMAF 3CCLF 1VQ8F 3HAXD 1K9MH 1VQ7F 5GINC 3CC4F 4X3MA 1DT9A 1Q7YH 3JCMM 2F9ZC 1E7KA 1X7OA 3NVKE 1KD1H 4X3LA 1YIJF 2QI2A 5A2QM 5HY2A 3NK6A 5HY1A 5G4UC 3E20B 3IR9A 1VQMF 3PLAC 3LWVC 1VQ9F 3NMUC 4BVRA 1X7PA 5G4VC 3CC7F 1T0KB 4BW0B 1RA4A 2FC3A 1W41A 1W40A 4BVSA 1VQNF 1M1KH 2OTJF 3PAFA 5GAPK 3CCJF 3O85A 4LCKA 1W3EX 2KG4A 4EI9A 3LFOA 1XBIA 5EWRA 3CCSF 1YHQF 3CPQA 3V7QA 1K73H 3AGKA 2OHWA 3VI6A 1Q82H 2BO1A 3LWOC 3CCUF 1VQ4F 3JAMM 1X52A 1W42A 3OBWA 1QVFF 2KTUA 3J7AR 2LBWA 3SIVA 1NMUB 5GIOC 3WXMB 5GANK 3NK7A 2VGNA 5DCVA 4XCQA 1S72F 4EI7A 3CD6F 4BVTA 2QA4F 3CPWF 3LWPC 5FLXM 1YJWF 3G4SF 3CCRF 1PXWA 1VQLF 1VQ6F 5GIPC 2ALEA 1K8AH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4Y A;  1IPA A;  1VQ5 F;  1Q86 H;  3G6E F;  3CCE F;  1JJ2 F;  1GO1 A;  3E1Y A;  3HJW C;  2QEX F;  2VGM A;  3RA6 A;  1YIT F;  3I56 F;  3FFM A;  1Q81 H;  1ZWZ A;  3N4Z A;  3VMF B;  2LBX A;  1GO0 A;  1CN7 A;  3OW2 F;  2CZW A;  3CCM F;  3CME F;  1YI2 F;  3RA5 A;  3LWR C;  1GZ0 A;  3CXC F;  2JNB A;  1KC8 H;  3CC2 F;  4BY9 D;  4NUT A;  1SDS A;  1RLG A;  1YJ9 F;  3CCV F;  5FJ4 C;  3OBY A;  3LWQ C;  3I55 F;  2WAL A;  3CG6 A;  1VQP F;  1H7M A;  1VQO F;  1QVG F;  3V7E A;  1W2B F;  2I6D A;  2KTV A;  3G71 F;  1N8R H;  1CK2 A;  1KQS F;  3J81 M;  3GYQ A;  3SIU A;  3CCQ F;  2OZB A;  3MCA B;  5IT9 M;  2AIF A;  3J80 M;  3NVI B;  3ON1 A;  2HVY D;  1M90 H;  4TZZ A;  2OTL F;  4C4W C;  5EO3 A;  1VQK F;  1NJI H;  1YJN F;  3CMA F;  3CCL F;  1VQ8 F;  3HAX D;  1K9M H;  1VQ7 F;  5GIN C;  3CC4 F;  4X3M A;  1DT9 A;  1Q7Y H;  3JCM M;  1E7K A;  1X7O A;  3NVK E;  1KD1 H;  4X3L A;  1YIJ F;  2QI2 A;  5A2Q M;  3NK6 A;  5G4U C;  3E20 B;  3IR9 A;  1VQM F;  3PLA C;  3LWV C;  1VQ9 F;  3NMU C;  1X7P A;  5G4V C;  3CC7 F;  1T0K B;  4BW0 B;  1RA4 A;  2FC3 A;  1W41 A;  1W40 A;  1VQN F;  1M1K H;  2OTJ F;  3PAF A;  5GAP K;  3CCJ F;  3O85 A;  4LCK A;  1W3E X;  2KG4 A;  3LFO A;  1XBI A;  5EWR A;  3CCS F;  1YHQ F;  3CPQ A;  3V7Q A;  1K73 H;  3AGK A;  2OHW A;  3VI6 A;  1Q82 H;  2BO1 A;  3LWO C;  3CCU F;  1VQ4 F;  3JAM M;  1X52 A;  1W42 A;  3OBW A;  1QVF F;  2KTU A;  3J7A R;  2LBW A;  3SIV A;  1NMU B;  5GIO C;  3WXM B;  5GAN K;  3NK7 A;  2VGN A;  5DCV A;  1S72 F;  3CD6 F;  2QA4 F;  3CPW F;  3LWP C;  5FLX M;  1YJW F;  3G4S F;  3CCR F;  1PXW A;  1VQL F;  1VQ6 F;  5GIP C;  2ALE A;  1K8A H; 
#chains in the Genus database with same CATH topology
 4BT5 A;  2K1S A;  4I4T A;  1IPA A;  1JFF A;  1RQ7 A;  1VQ5 F;  3CCE F;  1JJ2 F;  5CA0 A;  2QEX F;  4IHJ A;  4F6R B;  4ZHY B;  1UI9 A;  5BMV B;  3IEQ A;  4R40 B;  1YIT F;  1W5B A;  3K0T A;  4O4I B;  1ZWZ A;  3P10 A;  5GON B;  5JVD B;  3JAS B;  3VMF B;  5EIB D;  3M4S A;  1CN7 A;  2CZW A;  3ZP7 A;  2VAM A;  3LWR C;  1GZ0 A;  3JVH A;  2JNB A;  4O2B B;  2VAW A;  5EYP B;  2CW4 A;  2RHH A;  4YJ3 B;  5LP6 B;  1RQ2 A;  2HRY A;  2WAL A;  3C8L A;  4EB6 A;  1QVG F;  2I6D A;  3S02 A;  1CK2 A;  3WPX A;  1KQS F;  4C8G A;  3GYQ A;  4F6R A;  3C9U A;  3D00 A;  3MCA B;  3JAR A;  2OTM A;  4O4L A;  1H48 A;  1SA0 A;  1ONI A;  3IKE A;  4TZZ A;  2HQS C;  3Q8H A;  4EI8 A;  2FGY A;  2GLZ A;  3V3T A;  4X1I B;  5JQG B;  5J2U B;  2UYK A;  4NWO B;  4B45 A;  1W55 A;  2CSL A;  3F0F A;  2Z01 A;  1IV3 A;  1X7O A;  3NVK E;  3GTZ A;  4I55 B;  3TD5 A;  5HY1 A;  5G4U C;  3RYI B;  3PLA C;  3LWV C;  1U3L A;  1VQ9 F;  2QTP A;  3M1X A;  4ZI7 A;  1T0K B;  1SA0 B;  4BW0 B;  3GHZ A;  3WJP A;  3JAL B;  4I4T B;  2ZVY A;  3HKC A;  3QUW A;  5LOV B;  2B33 A;  5CA0 B;  1M1K H;  4RHA A;  4B62 A;  2HP3 A;  3O85 A;  3OON A;  1W3E X;  2LBT A;  3V4D A;  2UYN A;  2I6R A;  3IEW A;  2HS3 A;  1U3P A;  3QHD A;  3CCS F;  3CPQ A;  4G4V A;  1FSZ A;  3P0Z A;  1UFY A;  3N2G A;  3N2K A;  4DXD A;  3S0W A;  3JAM M;  1X52 A;  5JH7 B;  3CB2 A;  4B5C A;  2NMU A;  3LDT A;  2VXY A;  5LA6 A;  3MBM A;  4RQO A;  3MQW A;  4XCQ A;  4IIJ A;  5LP6 C;  4X20 B;  4BVT A;  5CA1 B;  3CPW F;  4O4L B;  3P4E A;  3CCR F;  1COM A;  3VCZ A;  5B8F A;  3KE1 A;  4C82 A;  1GO1 A;  2GZL A;  4BT7 A;  2VGM A;  2Z1T A;  1W5F A;  2AMT A;  3RA6 A;  3F0E A;  3I56 F;  3FFM A;  1Q81 H;  1YQN A;  2LBX A;  3OW2 F;  3CCM F;  5LA6 B;  4E6E A;  1W58 1;  4IIJ B;  2BTU A;  3RYH A;  5EIB C;  1IV1 A;  2Q1X A;  3JAT B;  3I55 F;  1H7M A;  1JFF B;  4G4W A;  1N8R H;  3ZOP A;  5LYJ B;  3FD5 A;  5JCO C;  3EOR A;  3SIU A;  2OZB A;  2H8C A;  1VHA A;  4FFB B;  1GX1 A;  3JAS A;  3ZO8 A;  2CHS A;  3HTN A;  3ON1 A;  3C9S A;  2IQQ A;  1FNK A;  3RYH B;  1VQK F;  3HKB A;  5KX5 B;  3CCL F;  1VQ8 F;  2CWJ A;  3RYF A;  2R75 1;  2N48 A;  5GIN C;  1VQ7 F;  1YGY A;  1DT9 A;  2BTO A;  2F9Z C;  3E22 B;  4O2A B;  1XHO A;  1YIJ F;  2QI2 A;  4I50 A;  5LYJ A;  3WGM A;  5KMG B;  3QTY A;  3L7Q A;  2ZOD A;  5G4V C;  1TVK B;  1Q8R A;  2HX0 A;  3CC7 F;  3CYQ A;  1RA4 A;  4DRX A;  4C8E A;  1FNJ A;  4C8I A;  5JQG A;  4WBN A;  3VTI C;  5J2U A;  3K2X A;  3WGL A;  4TUY B;  4BVS A;  5GAP K;  5CB4 A;  3CCJ F;  2H8E A;  2KG4 A;  3LFO A;  1IV4 A;  2PHN A;  5HP7 A;  4TV9 B;  2IG8 A;  1TUB B;  3S0H A;  4X1Y B;  3AGK A;  3VI6 A;  2RB9 A;  5EB1 B;  5CA1 A;  4B46 A;  1Q82 H;  3IKF A;  4LNU B;  3CCU F;  1VQ4 F;  2RHO A;  5IYZ B;  1W42 A;  4TV8 B;  3RYC A;  3OBW A;  1RLU A;  2KTU A;  1QVF F;  3TD4 A;  1VH8 A;  3SIV A;  1NMU B;  5GIO C;  1U40 A;  2MQE A;  2VGN A;  3NK7 A;  5DCV A;  2GVI A;  3KJK A;  3CD6 F;  2QA4 F;  3F0G A;  3JAW A;  4FFB A;  2V9Y A;  5FLX M;  5C8Y A;  5GON A;  5JVD A;  2R6R 1;  3WGN A;  3C9T A;  4O4H B;  4ZHW A;  5IJ9 A;  4U3J A;  3T80 A;  3N4Y A;  5LXT B;  5HWE A;  4O2B A;  2H6L A;  5EYP A;  5FNV B;  3HJW C;  4X1K B;  3E1Y A;  2HRU A;  5HY4 A;  3JAT A;  5MN5 A;  2DYY A;  3F0D A;  3N4Z A;  1VQV A;  1GO0 A;  1W57 A;  3CME F;  5EZY A;  3DC2 A;  1YI2 F;  3CXC F;  1KC8 H;  3CC2 F;  3FBA A;  1RLG A;  4O4J B;  2HS4 A;  4ZHV A;  5FJ4 C;  3OBY A;  3S06 A;  5IJ9 B;  1VQP F;  2KTV A;  5EB0 A;  3J81 M;  1KNK A;  2YXZ A;  5J2T B;  2HS0 A;  3WPW A;  4BT6 A;  3HKD B;  5IT9 M;  2AIF A;  3MDO A;  5HY0 A;  3J80 M;  3B6N A;  2CVL A;  3NVI B;  4I50 B;  2HP0 A;  4C4W C;  4U39 A;  5HXZ A;  5EZY B;  3WJR A;  5EO3 A;  1NJI H;  1YJN F;  4LNU A;  4YJ2 A;  3CMA F;  5ITZ B;  1K9M H;  4O4J A;  4X3M A;  4ZOL B;  4IHJ B;  1CLI A;  4DRX B;  3JCM M;  4G4X A;  3HKC B;  4PWT A;  1KD1 H;  3DDN A;  4X3L A;  4BT4 A;  5HY2 A;  4X20 A;  1DBF A;  3IR9 A;  1VQM F;  2UYN B;  5LP6 A;  1Z5W A;  4X1I A;  3VOB A;  4O4H A;  1H47 A;  2L26 A;  3VOA A;  3HKE A;  5LXT A;  4BT2 A;  3JAK A;  1W41 A;  3HKB B;  5KX5 A;  1W40 A;  3N2K B;  1QU9 A;  2Z1F A;  3MCQ A;  1JN1 A;  5IYZ A;  3D01 A;  4ZOL A;  1W5E A;  3S0Y A;  3I3F A;  4ZHQ A;  4M8I A;  4EI9 A;  1YHQ F;  1K73 H;  3I7T A;  3WJQ A;  3TD3 A;  3IMP A;  2BO1 A;  3LWO C;  2ZVZ A;  4U3J B;  1W59 A;  3UT5 A;  3J7A R;  4O4I A;  4TUY A;  1S72 F;  4EI7 A;  3D54 A;  1YJW F;  4HNA A;  3ESJ A;  2HP0 B;  4TV9 A;  1PXW A;  1VQ6 F;  5GIP C;  1FFX A;  2ALE A;  4ERH A;  3JAL A;  1KNJ A;  5MN6 A;  1Q86 H;  2UYP A;  3FPI A;  3G6E F;  3K12 A;  1VK3 A;  2BTQ B;  5JH7 A;  1QAH A;  3CYP B;  2Q1Y A;  3RA5 A;  2ZAU A;  2Z1E A;  3WGJ A;  3HKD A;  1W5A A;  2IAF A;  4BY9 D;  4NUT A;  2CHT A;  3BYQ A;  5C8Y B;  3KHN A;  3HWU A;  1YJ9 F;  1SDS A;  3CCV F;  1TVK A;  2DT4 A;  3RYF B;  4BT3 A;  1SZQ A;  3LWQ C;  5EAZ A;  3JAK B;  3ZP4 A;  5BMV A;  3CG6 A;  2W8B C;  3C9R A;  1VQO F;  3V7E A;  1JY8 A;  3VIU A;  4X1K A;  5FNV A;  4C81 A;  5IJ0 B;  3G71 F;  4NQ3 A;  1W2B F;  1XRG A;  4I55 A;  1X25 A;  5CB4 B;  4ZI7 B;  3CCQ F;  3E22 A;  3RYI A;  4KWE A;  2ZF8 A;  2HVY D;  1M90 H;  1TUB A;  4BVQ A;  2OTL F;  5HXU A;  1PF5 A;  3RE3 A;  3F6M A;  1OFU A;  4G4Z A;  5LOV A;  2ZOV A;  3HAX D;  2YYE A;  3CC4 F;  3U0O A;  3RYC B;  1Q7Y H;  1T0A A;  3HKE B;  1J7H A;  3VO8 A;  1E7K A;  4WBN B;  4G88 A;  2UZH A;  5J2T A;  5A2Q M;  3NK6 A;  3E20 B;  4X1Y A;  3JAW B;  1JD1 A;  3NMU C;  2KGW A;  4BVR A;  1FFX B;  1X7P A;  1U43 A;  5JCO A;  1R1M A;  4TV8 A;  2FC3 A;  5MN4 A;  1XV2 A;  5ITZ A;  4EB6 B;  4YJ2 B;  4O2A A;  1NQ3 A;  3VYU C;  1OAP A;  1VQN F;  2OTJ F;  3M84 A;  2LCA A;  3PAF A;  4G4Y A;  2G9I A;  3UT5 B;  1ODE A;  4LCK A;  2RHJ A;  1XBI A;  1IV2 A;  3JAR B;  2RHL A;  5EWR A;  2P6Y A;  1QD9 A;  1Z5V A;  5KMG A;  3V7Q A;  2OHW A;  3R0P A;  3FD6 A;  4HNA B;  3LME A;  5AVM A;  3ERN A;  2EWC A;  2PMP A;  3WGK A;  2LBW A;  2AIZ P;  3ELC A;  5IJ0 A;  3K14 A;  3WXM B;  5GAN K;  3S03 A;  3KJJ A;  4ZHQ B;  2Z1U A;  3VYS C;  3LWP C;  3LYB A;  3N2G B;  5HP8 A;  2VAP A;  4ZK7 A;  2UYJ A;  3G4S F;  1VQL F;  3KIZ A;  4YJ3 A;  3VYT C;  1K8A H; 
#chains in the Genus database with same CATH homology
 3N4Y A;  1IPA A;  1VQ5 F;  1Q86 H;  5HWE A;  3G6E F;  3CCE F;  1JJ2 F;  1GO1 A;  3E1Y A;  3HJW C;  2QEX F;  2VGM A;  5HY4 A;  3RA6 A;  1YIT F;  3I56 F;  3FFM A;  1Q81 H;  1ZWZ A;  3N4Z A;  3VMF B;  2LBX A;  1GO0 A;  1CN7 A;  3OW2 F;  2CZW A;  3CCM F;  3CME F;  1YI2 F;  3RA5 A;  3LWR C;  1GZ0 A;  3CXC F;  2JNB A;  1KC8 H;  3CC2 F;  4BY9 D;  4NUT A;  1SDS A;  1RLG A;  1YJ9 F;  3CCV F;  5FJ4 C;  3OBY A;  3LWQ C;  3I55 F;  2WAL A;  3CG6 A;  1VQP F;  1H7M A;  1VQO F;  1QVG F;  3V7E A;  1W2B F;  2I6D A;  2KTV A;  3G71 F;  1N8R H;  1CK2 A;  4NQ3 A;  1KQS F;  3J81 M;  3GYQ A;  3SIU A;  3CCQ F;  2OZB A;  3D00 A;  3MCA B;  5IT9 M;  2AIF A;  5HY0 A;  3J80 M;  3NVI B;  3ON1 A;  2HVY D;  1M90 H;  4BVQ A;  4TZZ A;  2OTL F;  4C4W C;  5HXU A;  5HXZ A;  4EI8 A;  5EO3 A;  1VQK F;  1NJI H;  2FGY A;  1YJN F;  2GLZ A;  3V3T A;  3CMA F;  3CCL F;  1VQ8 F;  3HAX D;  1K9M H;  1VQ7 F;  5GIN C;  3CC4 F;  4X3M A;  1DT9 A;  1Q7Y H;  3JCM M;  2F9Z C;  1E7K A;  1X7O A;  3NVK E;  1KD1 H;  4X3L A;  1YIJ F;  2QI2 A;  5A2Q M;  5HY2 A;  3NK6 A;  5HY1 A;  5G4U C;  3E20 B;  3IR9 A;  1VQM F;  3PLA C;  3LWV C;  1VQ9 F;  3NMU C;  4BVR A;  1X7P A;  5G4V C;  3CC7 F;  1T0K B;  4BW0 B;  1RA4 A;  2FC3 A;  1W41 A;  1W40 A;  4BVS A;  1VQN F;  1M1K H;  2OTJ F;  3PAF A;  5GAP K;  3CCJ F;  3O85 A;  4LCK A;  1W3E X;  2KG4 A;  4EI9 A;  3LFO A;  1XBI A;  5EWR A;  3CCS F;  1YHQ F;  3CPQ A;  3V7Q A;  1K73 H;  3AGK A;  2OHW A;  3VI6 A;  1Q82 H;  2BO1 A;  3LWO C;  3CCU F;  1VQ4 F;  3JAM M;  1X52 A;  1W42 A;  3OBW A;  1QVF F;  2KTU A;  3J7A R;  2LBW A;  3SIV A;  1NMU B;  5GIO C;  3WXM B;  5GAN K;  3NK7 A;  2VGN A;  5DCV A;  4XCQ A;  1S72 F;  4EI7 A;  3CD6 F;  4BVT A;  2QA4 F;  3CPW F;  3LWP C;  5FLX M;  1YJW F;  3G4S F;  3CCR F;  1PXW A;  1VQL F;  1VQ6 F;  5GIP C;  2ALE A;  1K8A H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...