1YI2O

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1yi2O00
3CCQL 1YJWO 3CCJL 1W2BN 1NJIM 3I55L 2OTLO 3CCVL 1VQ6L 1VQML 3CD6O 1VQNL 3CPWK 1VQLL 1Q86P 3CCEL 2QA4L 3CC2L 3CCRO 3CCLL 1VQ7O 2OTJL 3OW2N 1YI2O 3G71O 1QVGK 3CC7L 1Q81P 1KQSK 1YIJL 1Q86M 3CCMO 1VQ5O 3CMEO 1VQPL 1YJNO 1Q82P 1M1KP 2QEXL 1VQKO 1Q81M 1YHQL 1YJ9L 3G4SL 1VQOO 1S72O 1K73P 1YJWL 1M1KM 1Q82M 2OTLL 1VQ8O 1K9MP 3CCUO 3CXCK 3CD6L 1K73M 3CCSO 1VQ4O 1W2BK 1K9MM 1N8RP 3CCRL 1JJ2N 1YITO 1QVFN 3CC4O 1VQ7L 3I56O 1YI2L 3G6EO 3G71L 3CMAO 3CCML 1VQ5L 1VQ9O 1N8RM 3CMEL 1YJNL 1Q7YP 3CCQO 1VQKL 3OW2K 3CCJO 3I55O 1VQOL 3CCVO 1S72L 1M90P 1VQ6O 1JJ2K 1Q7YM 1KD1M 1VQMO 1QVGN 1QVFK 1KC8P 1KQSN 1VQ8L 3CCUL 1VQNO 1VQLO 1K8AP 3CCEO 2QA4O 3CC2O 1M90M 3CCSL 1VQ4L 3CCLO 2OTJO 1KC8M 3CC7O 1YIJO 1K8AM 1YITL 3CC4L 3CPWN 3I56L 1KD1P 3G6EL 3CMAL 1VQPO 1NJIP 2QEXO 1VQ9L 3CXCN 1YHQO 1YJ9O 3G4SO
chains in the Genus database with same CATH superfamily
3CCQL 5FCLA 1YJWO 3CCJL 1W2BN 1NJIM 3I55L 2OTLO 3NKDA 3CCVL 1VQ6L 1VQML 3CD6O 1VQNL 3CPWK 4XTKA 1VQLL 5DS6A 1Q86P 3CCEL 2QA4L 3CC2L 3CCRO 4W8KA 3CCLL 1VQ7O 2OTJL 3OW2N 1YI2O 3G71O 1QVGK 3CC7L 1Q81P 1KQSK 1YIJL 1Q86M 3CCMO 1VQ5O 2YZSA 5DS4A 4P6IC 3CMEO 1VQPL 1YJNO 1Q82P 1M1KP 2QEXL 1VQKO 1Q81M 5DQTA 1YHQL 4N06A 1YJ9L 3G4SL 1VQOO 1S72O 1K73P 1YJWL 1M1KM 1Q82M 2OTLL 1VQ8O 1K9MP 3CCUO 3CXCK 3CD6L 1K73M 3CCSO 1VQ4O 1W2BK 1K9MM 1N8RP 3CCRL 1JJ2N 1YITO 1QVFN 3CC4O 1VQ7L 3I56O 1YI2L 3G6EO 3G71L 3CMAO 3CCML 4QDLA 1VQ5L 1VQ9O 1N8RM 3CMEL 1YJNL 1Q7YP 3CCQO 1VQKL 4WJ0A 3OW2K 3CCJO 3GODA 3I55O 1VQOL 3CCVO 1S72L 1M90P 1VQ6O 1JJ2K 1Q7YM 1KD1M 1VQMO 1QVGN 1QVFK 1KC8P 1KQSN 1VQ8L 5DS5A 3CCUL 1VQNO 1VQLO 1K8AP 3CCEO 2QA4O 3CC2O 1M90M 3CCSL 1VQ4L 3CCLO 2OTJO 5DQZA 1KC8M 3CC7O 1YIJO 1K8AM 5DLJA 1YITL 3CC4L 3CPWN 3I56L 1KD1P 3G6EL 3CMAL 1VQPO 1NJIP 2QEXO 1VQ9L 3CXCN 1YHQO 1YJ9O 3G4SO
chains in the Genus database with same CATH topology
3CCQL 5FCLA 1YJWO 3CCJL 1W2BN 1NJIM 3I55L 2OTLO 3NKDA 3CCVL 1VQ6L 1VQML 3CD6O 1VQNL 3CPWK 4XTKA 1VQLL 5DS6A 1Q86P 3CCEL 2QA4L 3CC2L 3CCRO 4W8KA 3CCLL 1VQ7O 2OTJL 3OW2N 1YI2O 3G71O 1QVGK 3CC7L 1Q81P 1KQSK 1YIJL 1Q86M 3CCMO 1VQ5O 2YZSA 5DS4A 4P6IC 3CMEO 1VQPL 1YJNO 1Q82P 1M1KP 2QEXL 1VQKO 1Q81M 5DQTA 1YHQL 4N06A 1YJ9L 3G4SL 1VQOO 1S72O 1K73P 1YJWL 1M1KM 1Q82M 2OTLL 1VQ8O 1K9MP 3CCUO 3CXCK 3CD6L 1K73M 3CCSO 1VQ4O 1W2BK 1K9MM 1N8RP 3CCRL 1JJ2N 1YITO 1QVFN 3CC4O 1VQ7L 3I56O 1YI2L 3G6EO 3G71L 3CMAO 3CCML 4QDLA 1VQ5L 1VQ9O 1N8RM 3CMEL 1YJNL 1Q7YP 3CCQO 1VQKL 4WJ0A 3OW2K 3CCJO 3GODA 3I55O 1VQOL 3CCVO 1S72L 1M90P 1VQ6O 1JJ2K 1Q7YM 1KD1M 1VQMO 1QVGN 1QVFK 1KC8P 1KQSN 1VQ8L 5DS5A 3CCUL 1VQNO 1VQLO 1K8AP 3CCEO 2QA4O 3CC2O 1M90M 3CCSL 1VQ4L 3CCLO 2OTJO 5DQZA 1KC8M 3CC7O 1YIJO 1K8AM 5DLJA 1YITL 3CC4L 3CPWN 3I56L 1KD1P 3G6EL 3CMAL 1VQPO 1NJIP 2QEXO 1VQ9L 3CXCN 1YHQO 1YJ9O 3G4SO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ L;  1YJW O;  3CCJ L;  1W2B N;  1NJI M;  3I55 L;  2OTL O;  3CCV L;  1VQ6 L;  1VQM L;  3CD6 O;  1VQN L;  3CPW K;  1VQL L;  1Q86 P;  3CCE L;  2QA4 L;  3CC2 L;  3CCR O;  3CCL L;  1VQ7 O;  2OTJ L;  3OW2 N;  1YI2 O;  3G71 O;  1QVG K;  3CC7 L;  1Q81 P;  1KQS K;  1YIJ L;  1Q86 M;  3CCM O;  1VQ5 O;  3CME O;  1VQP L;  1YJN O;  1Q82 P;  1M1K P;  2QEX L;  1VQK O;  1Q81 M;  1YHQ L;  1YJ9 L;  3G4S L;  1VQO O;  1S72 O;  1K73 P;  1YJW L;  1M1K M;  1Q82 M;  2OTL L;  1VQ8 O;  1K9M P;  3CCU O;  3CXC K;  3CD6 L;  1K73 M;  3CCS O;  1VQ4 O;  1W2B K;  1K9M M;  1N8R P;  3CCR L;  1JJ2 N;  1YIT O;  1QVF N;  3CC4 O;  1VQ7 L;  3I56 O;  1YI2 L;  3G6E O;  3G71 L;  3CMA O;  3CCM L;  1VQ5 L;  1VQ9 O;  1N8R M;  3CME L;  1YJN L;  1Q7Y P;  3CCQ O;  1VQK L;  3OW2 K;  3CCJ O;  3I55 O;  1VQO L;  3CCV O;  1S72 L;  1M90 P;  1VQ6 O;  1JJ2 K;  1Q7Y M;  1KD1 M;  1VQM O;  1QVG N;  1QVF K;  1KC8 P;  1KQS N;  1VQ8 L;  3CCU L;  1VQN O;  1VQL O;  1K8A P;  3CCE O;  2QA4 O;  3CC2 O;  1M90 M;  3CCS L;  1VQ4 L;  3CCL O;  2OTJ O;  1KC8 M;  3CC7 O;  1YIJ O;  1K8A M;  1YIT L;  3CC4 L;  3CPW N;  3I56 L;  1KD1 P;  3G6E L;  3CMA L;  1VQP O;  1NJI P;  2QEX O;  1VQ9 L;  3CXC N;  1YHQ O;  1YJ9 O;  3G4S O; 
#chains in the Genus database with same CATH topology
 3CCQ L;  5FCL A;  1YJW O;  3CCJ L;  1W2B N;  1NJI M;  3I55 L;  2OTL O;  3NKD A;  3CCV L;  1VQ6 L;  1VQM L;  3CD6 O;  1VQN L;  3CPW K;  4XTK A;  1VQL L;  5DS6 A;  1Q86 P;  3CCE L;  2QA4 L;  3CC2 L;  3CCR O;  4W8K A;  3CCL L;  1VQ7 O;  2OTJ L;  3OW2 N;  1YI2 O;  3G71 O;  1QVG K;  3CC7 L;  1Q81 P;  1KQS K;  1YIJ L;  1Q86 M;  3CCM O;  1VQ5 O;  2YZS A;  5DS4 A;  4P6I C;  3CME O;  1VQP L;  1YJN O;  1Q82 P;  1M1K P;  2QEX L;  1VQK O;  1Q81 M;  5DQT A;  1YHQ L;  4N06 A;  1YJ9 L;  3G4S L;  1VQO O;  1S72 O;  1K73 P;  1YJW L;  1M1K M;  1Q82 M;  2OTL L;  1VQ8 O;  1K9M P;  3CCU O;  3CXC K;  3CD6 L;  1K73 M;  3CCS O;  1VQ4 O;  1W2B K;  1K9M M;  1N8R P;  3CCR L;  1JJ2 N;  1YIT O;  1QVF N;  3CC4 O;  1VQ7 L;  3I56 O;  1YI2 L;  3G6E O;  3G71 L;  3CMA O;  3CCM L;  4QDL A;  1VQ5 L;  1VQ9 O;  1N8R M;  3CME L;  1YJN L;  1Q7Y P;  3CCQ O;  1VQK L;  4WJ0 A;  3OW2 K;  3CCJ O;  3GOD A;  3I55 O;  1VQO L;  3CCV O;  1S72 L;  1M90 P;  1VQ6 O;  1JJ2 K;  1Q7Y M;  1KD1 M;  1VQM O;  1QVG N;  1QVF K;  1KC8 P;  1KQS N;  1VQ8 L;  5DS5 A;  3CCU L;  1VQN O;  1VQL O;  1K8A P;  3CCE O;  2QA4 O;  3CC2 O;  1M90 M;  3CCS L;  1VQ4 L;  3CCL O;  2OTJ O;  5DQZ A;  1KC8 M;  3CC7 O;  1YIJ O;  1K8A M;  5DLJ A;  1YIT L;  3CC4 L;  3CPW N;  3I56 L;  1KD1 P;  3G6E L;  3CMA L;  1VQP O;  1NJI P;  2QEX O;  1VQ9 L;  3CXC N;  1YHQ O;  1YJ9 O;  3G4S O; 
#chains in the Genus database with same CATH homology
 3CCQ L;  5FCL A;  1YJW O;  3CCJ L;  1W2B N;  1NJI M;  3I55 L;  2OTL O;  3NKD A;  3CCV L;  1VQ6 L;  1VQM L;  3CD6 O;  1VQN L;  3CPW K;  4XTK A;  1VQL L;  5DS6 A;  1Q86 P;  3CCE L;  2QA4 L;  3CC2 L;  3CCR O;  4W8K A;  3CCL L;  1VQ7 O;  2OTJ L;  3OW2 N;  1YI2 O;  3G71 O;  1QVG K;  3CC7 L;  1Q81 P;  1KQS K;  1YIJ L;  1Q86 M;  3CCM O;  1VQ5 O;  2YZS A;  5DS4 A;  4P6I C;  3CME O;  1VQP L;  1YJN O;  1Q82 P;  1M1K P;  2QEX L;  1VQK O;  1Q81 M;  5DQT A;  1YHQ L;  4N06 A;  1YJ9 L;  3G4S L;  1VQO O;  1S72 O;  1K73 P;  1YJW L;  1M1K M;  1Q82 M;  2OTL L;  1VQ8 O;  1K9M P;  3CCU O;  3CXC K;  3CD6 L;  1K73 M;  3CCS O;  1VQ4 O;  1W2B K;  1K9M M;  1N8R P;  3CCR L;  1JJ2 N;  1YIT O;  1QVF N;  3CC4 O;  1VQ7 L;  3I56 O;  1YI2 L;  3G6E O;  3G71 L;  3CMA O;  3CCM L;  4QDL A;  1VQ5 L;  1VQ9 O;  1N8R M;  3CME L;  1YJN L;  1Q7Y P;  3CCQ O;  1VQK L;  4WJ0 A;  3OW2 K;  3CCJ O;  3GOD A;  3I55 O;  1VQO L;  3CCV O;  1S72 L;  1M90 P;  1VQ6 O;  1JJ2 K;  1Q7Y M;  1KD1 M;  1VQM O;  1QVG N;  1QVF K;  1KC8 P;  1KQS N;  1VQ8 L;  5DS5 A;  3CCU L;  1VQN O;  1VQL O;  1K8A P;  3CCE O;  2QA4 O;  3CC2 O;  1M90 M;  3CCS L;  1VQ4 L;  3CCL O;  2OTJ O;  5DQZ A;  1KC8 M;  3CC7 O;  1YIJ O;  1K8A M;  5DLJ A;  1YIT L;  3CC4 L;  3CPW N;  3I56 L;  1KD1 P;  3G6E L;  3CMA L;  1VQP O;  1NJI P;  2QEX O;  1VQ9 L;  3CXC N;  1YHQ O;  1YJ9 O;  3G4S O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...