1YI2P

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yi2P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yi2P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yi2P02
1VQ4P 3I56P 3OW2O 1YJNP 2QEXP 1YJ9P 1YJWP 3CMAP 1Q82Q 1K9MQ 1KQSO 1JJ2O 1VQ7P 1VQMP 3CCLP 3CCUP 1M1KQ 1VQ5P 1VQ8P 1QVFO 3CC4P 1YITP 1VQKP 3CCJP 1Q86Q 3CMEP 1Q7YQ 1K73Q 3CXCO 1Q81Q 1VQ6P 3CCEP 1VQOP 1N8RQ 1YIJP 3CC7P 2OTLP 1YHQP 1NJIQ 3CCSP 3G6EP 3CC2P 1S72P 1KD1Q 1M90Q 2OTJP 3CCMP 3CCRP 1K8AQ 1KC8Q 3CD6P 3CCVP 3I55P 3CPWO 1QVGO 1VQ9P 1VQPP 1VQLP 3CCQP 1W2BO 3G4SP 2QA4P 3G71P 1YI2P 1VQNP
chains in the Genus database with same CATH superfamily
2E76D 5F2NA 2L0QA 1GW3A 3MZWB 3B5NA 1QL2A 5CCHC 1OZHA 3F5HA 1OR5A 3GLMA 3IF4A 2KG6A 1PP9G 5TISE 1OVVA 1SQBD 2QE7H 4XFXA 1EZVE 1T3UA 5AW8B 2PY8A 3L72G 1SQVG 2FACA 1ZRTD 3V2RA 2WZ7A 3KZIE 1L4AD 1UIIA 5AW4B 2JDIH 3RK2D 2KOPA 4IOIH 1VQOP 3TK1A 1IFMA 4BPGA 2E5TA 1EXIA 1NAYA 3VOPA 2HLOA 1MUUA 2JB0A 2M5AA 2VRSA 4KT0J 2ZT9D 3GHGC 2NO8A 1ZOYC 4ASWA 2WQYC 3HYBA 2G3AA 3P8MC 2PEKA 2FFDB 4L75A 2K2QA 1OW6A 4L76A 3CWBG 2KG9A 1SFCA 2LKIA 3G29A 1YQ4C 4H44D 2K0YA 1URQB 2LL8A 3WMM0 1T8ZA 2Q3IA 3G3ZA 2YXQB 2KORA 5M1BA 1E0HA 4XA4A 3TGUG 3H1KE 2QM7A 3A5TA 1FZCC 1FC2C 3L73E 3HZQA 2L22A 1VF5D 3V5BA 3L70E 2EG5A 1BE3D 4IFDK 1KILB 1NU1G 3LMOA 1NTZD 5KKZB 2Z5IA 1USEA 4XFYA 2QIWA 1HJBA 3GKLC 1F80D 3NMDA 5KLVD 3L71G 1FU1A 2VSQA 1CI6A 4WBAA 3AEGC 2IYPA 1S5LX 4H2XC 1HTLC 5DJTB 2N5HA 1PL5A 2H88C 3T97B 2N98A 2IYOA 1NU1K 3TNUA 1OXZA 1KB9D 5KP6B 3A2AA 1FE6A 2W8ZA 2FYUG 3MTUE 3RG6C 4YTPC 3KPEA 2L91A 4W7YA 3CCMP 2LXBA 1M1JA 3SSUA 1PPJE 3B5NB 3PLNA 2QSIA 4M3LA 4F37A 5GTHE 1KQLA 4I7ZC 1YQ3C 2NPSA 1Q2NA 2Y0EA 2WPRA 2YO2A 2FQ0A 3H1JE 1SQXD 1L2PA 2CPBA 1PP9J 2FYUK 1RF1C 2JBGA 1YTZT 4PV1C 1URQD 2FVAA 5AW6B 4U0EA 2GDWA 1IFPA 2B88A 3CXHE 2J59M 2ZAEB 4YXDC 3L72J 2XDJA 1NTMD 2M5AB 4OGQB 3ABVC 2QM8A 1IFIA 1RHZB 5CMZA 2E5YA 2LIWA 2ZVNB 2M3EA 2QA4P 4IL6E 3F89A 5HGNA 3A7OA 5GTIE 3RK3D 4XE5B 1M6EX 1BSNA 2QJKC 2N5IA 1SQQD 1SFCB 4R0MA 1DNYA 1LWUC 4H2YC 5APSA 4CA3A 4PH0A 1VKUA 4PD4I 2KP8A 3K5BA 1CZQA 1VQ9P 3FX0A 1VQPP 3FWLA 4GIFA 4D6TJ 2JGPA 2K93A 2Q5UA 3TSIA 1BGYG 1K9MQ 5KJ7A 2AEJA 1OW8A 1JUNA 1OIPA 2PFXA 2K5XA 1NTKE 2FVEA 3OA7A 5E79H 1PIXA 1YIJP 3V2QA 2GDYA 1NU1J 3BCCD 4PD4H 3JCUE 2N50A 1CI6B 3G26A 3FXDA 1L0IA 3L71J 5CCHA 1VHNA 3C8VA 3DS4A 3HD7C 2XKMA 2OYIC 1AQTA 1J1EC 1KORA 2N6YA 3P7KA 3S1KA 3TNUB 4XFJA 1PEOA 2QEXP 1J1DC 3H1LJ 2W90A 1M1JB 1JCCA 1Q81Q 1N7SC 1SQBG 3B5IA 1AA0A 3QH9A 2FYUJ 2CWOA 1H89A 2MY5A 1SQVD 5KLIB 3OAKA 2Z46A 1T2KC 1IFNA 1W2BO 1CEIA 3G4SP 2R32A 2NPSB 5KAIH 3Q20A 3GHGA 2WITA 3TYYA 4BPHA 3VTPC 1SFCD 2AXTH 2B9BA 2BCCG 2IZ0A 4NPFX 2ZYDA 1SQBK 2FQ2A 2W83C 1P84I 1DV5A 1S2EA 3CWBD 1ZXGA 1HY8A 1N86A 1G2CA 2W6AA 1QVFO 1OX3A 2BEZF 4PJ0E 4KJMA 1KQFB 2R5BA 3H4EA 1S1CX 2UWJE 1FZCA 1M57D 2D2CB 3B71A 3TGUD 5B5EE 2A45G 2XV6A 1N73B 2YMYA 3M0DC 1YTZI 4WY4C 3HE5A 1P84H 1AF8A 1BE3G 4AQRD 2GZIA 1NTZG 3S9OA 3RL0B 5AW1B 5APQA 3H1LE 3IN6A 3M9HA 3CC2P 5B66H 1KQGB 2MR7A 1RH5B 3WU2E 1JY2N 2OYOA 2FXPA 2KR5A 2YO3A 2NZ2A 1JY3P 1BGYJ 5AVYB 3P8CE 3B4QA 2VLPA 1NTZK 1LT9A 3U43A 1G1IA 1JCDA 2NPSD 1FZBA 4BPFA 5APVA 2E74D 2LXCB 2AEFA 1EOQA 1FBMA 1LNQA 2ZYAA 2A45I 2GDXA 1E79H 1QGKB 2WPVB 1OW7A 3CCSP 1HQBA 4A7PA 4YPCA 2FAEA 2RN0A 5BU8B 1L0NG 2KLVA 3H1IE 4UB8E 1RF1A 1M7LA 5F2OA 4MN4C 1SQXG 2ZXEB 1ZLLA 3AEFC 1SQBJ 2A45H 1U57A 1IK7A 3VMXA 2JJLA 3GHGB 2KIKA 2Z45A 1JTHA 4GODA 2P58A 1PFIA 1L0NK 2IFNA 4LGDE 4UB6E 3MP7B 1E5WA 3RL0D 1Y9BA 1KYOE 5CZDB 1SQXK 1EIAA 1S4XA 2YIUC 3NY7B 3AECC 2CG5B 3KQGA 4H0LC 1PGQA 1LTGC 3PRJA 1G2CB 2E75C 1VQLP 2X2BA 5H2FH 1BCCE 1RO2A 2QRXA 2K1AA 2M0BA 4N6JA 1HH0A 1UIXA 1FZCB 1DIPA 1H88A 2DW3A 5KAFE 2C0XA 3L75E 1FZGA 1T3JA 1XTCC 1S9KD 1L0LG 2KZJA 3HE5B 3AE1C 1CW5A 1EDKA 4AUWA 1SP4A 5CCHD 1H0TA 4U3FG 1A43A 4XROA 4H2WC 2PEIA 3T97A 1SQQK 1G1JA 1BE3J 1S5LE 1NTZJ 1YHQP 1DD3A 3HD7A 2OYIA 5KLVJ 3PH0A 1P84D 1L0LK 4C7RA 2N1TD 1NO4A 1LT9B 1MZ9A 1K73Q 1OVRA 1N7SA 1KV4A 4HKGA 4HYTB 3SWKA 2OTKE 2QG4A 5AW0B 4EOTA 2E1MA 4XRQA 2DGYA 2H89C 4I7ZB 3LIDA 1YJNP 2FYNC 2IX7C 1X79B 3FWNA 1SLQA 3ZDMA 2K88A 2XV5A 1SQPD 1RF1B 4PV1B 1U7MA 1K8AQ 3L74E 1QEXA 3G71P 3E2DA 1L0NJ 1AV1A 2K92A 1LTJC 1M56D 2BCCD 5AVUB 5CCGD 2E76C 3B8EB 1GZLA 1SQXJ 1ZMBA 3AEEC 2KGDA 4L74A 2L4BA 4U0BA 3CC7P 1SQVK 1MZ8A 1JTHB 2A06E 3G0VA 3WUTA 4DT0A 1EZVD 1SS1A 2IZ1A 2WT7A 2QJKB 5KLVE 2MVVA 4Z1MH 3M0DA 4WY4A 1NTMJ 1L4AC 4I1LA 1FJPA 1X0TA 3RK2C 3GJNA 3AE3C 1JM0A 1W2EA 5K5GB 1Z6MA 2JYGA 4GDOA 2WWWA 3G9RA 1SQQJ 1KB9E 2ZT9C 4ZKPA 2RH0A 1QRJA 3CC4P 4B86A 1GW4A 1Q86Q 1GK6A 2LR2A 2L6EA 4JBZA 4Y28J 1IFDA 4JYCA 1H0TB 3I55P 3DS3A 4HB1A 5AW5B 4H44C 3RG2A 4LLHA 1VQNP 3GG2A 2W6JH 2AEMA 1JMMA 3HD7B 2FY8A 4JPZB 2OYIB 2E42A 3A0BH 3WBHA 3H1KD 3CLQA 3SFDC 1J1EB 1DH3A 3L70D 1FS0E 3BCCJ 2CK3H 3ITKA 1RF0C 1XTGB 3CX5I 1VF5C 4N78D 4RO0A 4WVZA 5HVCA 3L4FA 2K0XA 2MR8A 5KTBA 2WPTA 3C1LA 1KMIZ 1J1DB 1N7SB 2PENA 1L0ND 2GZEA 5BS1A 2XU6A 2G8YA 2HR3A 2OTLP 4U0AA 4L73A 4YXWH 4IFMA 4WB4A 1PEUA 4DZOA 5TJHA 3CX5H 2IBZE 3SWFA 3DS0A 3R4YA 3RK3E 1IJDB 4ASVA 2J5UA 2HODA 1SQVJ 5BS2A 2YKOA 2Z5HA 2M3BA 1AUMA 2KOOA 1KILD 1PPJD 3H25A 3Q5SA 4TLFA 2IDBA 1HGVA 1U7JA 2K37A 2EHTA 1PGJA 3MIWA 2KOGA 3M91A 3H1IG 2CPSA 1VL2A 2O01N 2Q6QA 5KP7B 1N73A 3E1RA 5AW2B 1RE3C 2KSEA 3G6EP 5CJ0A 2WT7B 1IZNB 2PAJA 3CWBJ 4GR2A 1EMVA 1M8OB 4WY4B 2QJYC 3D70A 2QJPC 3BATA 1OFCX 2R5DA 1L0LD 3V6IA 4R4MA 1FZFA 5AVWB 4U3FD 3TGUJ 1USDA 1RQUA 3KDPB 1NGMB 2HFED 3B5ND 1DEBA 2ERHA 1BSHA 1PP9E 2H8PD 1YJ9P 2FXOA 2Y9ZA 3EFGA 3D71A 3RL0g 2GYKA 1LP1A 2MF4A 1W5CE 3RK3C 1R8EA 1GU5A 1BXIA 2K94A 1N8RQ 3H1HG 3L72E 1FOSF 1T2KD 2M8NA 4N3YB 3VRLC 3A0HH 3PJSK 3L75G 3CCEP 2EHSA 1HUCA 2MD9A 5AVSB 1RY3A 1NTKD 3DS5A 1KFMA 1RE4C 1KFNA 3H6PA 4OGQD 4O9BA 2NRGA 3JC22 2MVUA 3NXSA 1GDTA 2K3RA 1SQPG 1A02F 1MKMA 1AYIA 3CWBE 2KSJA 2WSFH 2JAZA 4D6TE 4Y99C 3BRVB 4BXLA 3EJDA 2N9YB 1X9VA 2ONTA 1HF9A 2FADA 3TGUE 2Q3EA 4WY4D 2KWLA 2HODB 1YI2P 2R3SA 3II6A 1ZV8A 3O6QA 1JY2P 1NU1E 4LC1A 1S3JA 1LTIC 1SQPK 2YIUB 2M8PA 1EZVG 4H0LB 2OARA 2P2UA 1L4AA 3L71E 2E75B 3CX5D 3HUSC 4K35A 4HH2A 4PXHB 1JMBA 1M74A 3L74G 1LTBC 1SVFA 1PV3A 2LPKA 1LTAC 1SFCC 5EFWB 3P32A 1EDIA 2FYUE 4PH1A 2LTEA 5BU5A 2FQ1A 3GZLA 2P67A 2KYVA 1FOSE 5E79E 3U59A 2HYNA 3MUDC 3Q3DA 3DPHA 2WSEH 5APYA 1IMQA 2H43A 3OJAB 4PD4E 3B4SA 3Q5RA 1GL2C 1RF0A 3S4RA 5AW3B 3TDKA 2QVAA 1EZVI 2K9JA 1LP1B 3AE2C 3H1KG 4KHXA 1RNIA 1GU4A 3L73G 2KNCA 1YJWP 3L70G 5AW7B 3VP8A 1FZEA 1K04A 2JKVA 4WWIA 4QNBA 4DOJA 3H1HJ 4XFZA 2O1KA 4C7NA 5TISH 4EYYQ 2L9FA 2FYNB 4M0IA 2J58A 2FXMA 2HPCA 1R5LA 1MFTA 1Y47A 3CCLP 2Q1KA 4U0FA 3U1AA 3JSVC 3P8CD 2JU2A 3KZIH 4GT1A 2AFDA 1JY3N 2E75D 1IC2A 1X3OA 2D2CD 2WPQA 5KAIE 5KLIC 2KOQA 3KHUA 4GKGA 2WSEJ 2MJZA 5L8RJ 1SQPJ 3Q2YA 3RBZA 4DG9A 1PPJG 2E74C 2AXTE 2PEJA 1TU3F 4NPEA 2WTYA 1JY3O 3PHLA 3AE4C 1BGYE 1LWUA 1RE3A 1S9KE 1RQVA 3W68A 4HJGH 3O6QB 1K05A 1BAJA 2BCCJ 2JWAA 3M9QA 3H1ID 5KJ7D 2L5GB 3U1CA 1VQ4P 3H1JG 2RMZA 3VMYA 1L4AB 4U0DA 1NKZB 2K9YA 1D1DA 1X8YA 1EQ7A 3HE4A 1NQ4A 5APWA 2PEMA 1HVVA 1D7MA 3AEBC 3C9IA 3HRNA 5DJUB 4H13C 5CHXA 3KXDA 3SWYA 1P84E 2V7QH 2ZT9B 2ZXXA 2WSCH 3I56P 2ITAA 3DS1A 1KQSO 1VDFA 2V4HA 2WSSH 2KB7P 5B66E 3AEDC 4GOEA 3FGAD 1EXJA 3G21A 3LW5H 2P10A 1KTMA 5APTA 4H44B 1SQBE 1YYCA 1BCCD 2PP6A 1GD2E 3H1HD 2AF8A 2GA1A 1ZRTE 2YKQA 1ZN5A 3Q5PA 1VF5B 3L75D 3O8ZA 2Q9IA 2K9JB 1RE4A 1VPCA 2KNCB 1FJKA 1NTKG 2PNGA 2BCCE 3N7NA 1GPJA 3H1KJ 3CXHI 3L73J 3VN0A 3L70J 3MGEA 3NTEA 1GXGA 5GTHH 4C7NB 3CXCO 2LF4A 2V7QJ 2WSCJ 2BASA 2HPCB 2Y9YA 4W80A 1GMJA 3LIEA 2KG8A 2YXRB 3LW5J 3P05A 1NTKK 2FKWB 3CXHH 1KLPA 2ZFCA 2N1TC 1JB0J 2YMKA 2GZGA 2VLNA 1BE3E 1GXHA 5I4TG 1NTZE 3AE7C 2O3JA 5DCKA 1FDMA 3HUSA 4COPA 3FXEA 2JQ4A 1OWAA 4IL6H 5GTIH 4AYCA 1RO0A 1LWUB 1QX8A 2JWDA 3D6YA 2LIUA 2AXCA 3CMEP 2KGAA 4RJTA 2PRRA 1ZR2A 2BUOA 2P7JA 4NEOA 5EJDA 1HWTC 1S72P 3G1GA 4D6TG 4GOFA 5H2FE 2GZJA 3L74D 2QJYB 3GF3A 2QJPB 2BHVA 1R5SA 2JU1A 3HE4B 5AVZB 5CCGC 1AVYA 3H1JJ 2PGDA 1NAFA 1MV8A 3MUDA 2FHSC 1T8KA 2QNWA 4N78E 2A06D 3DTJA 1GL2A 1L0LJ 2B87A 2OYHC 3RK3B 3JCUH 1X22A 4U3FJ 1L0NE 1ZR4A 3VMZA 2O01H 4OWFA 1JEKA 3L73D 1SQXE 2FVFA 4PV1D 2VLQA 3USSA 2KGCA 2Z4EA 3H1LG 2KXPB 5HGMA 1ZMEC 1YBKA 1BDDA 1FZAA 3M0AA 5BVZA 5F2KA 2Y0DA 1LT9C 1NTME 1DEEG 1KILE 1EC5A 2XZRA 2N6ZA 1GK4A 1IK9A 3V4WA 4R4LA 2RKLA 4OVNF 2E43A 1MFZA 2AFEA 3OW2O 1NTKJ 4Y99B 5AVQB 2JO0A 4BRYA 3L37A 1SQQE 1IFJA 4EI2A 2Q7CA 2ZVOB 3VP9A 3G1IA 3R2PA 3H32A 4PWVB 2O01J 4RESB 2BQ1E 4IZ6A 3CI9A 2JYLA 2WVRA 3BASA 3E7KA 2K0DX 4ZNCA 3MGNA 1L0LE 4CPGA 3EFFK 3V2NA 1VQ8P 2LKMA 5CBOA 4RKUJ 3GZMA 3Q1MA 1JNMA 2BEQD 3M06A 4K3AA 4PJ0H 3MD0A 4U3FE 1ACPA 3HUSB 3H1JD 4DCKA 2FFDC 1OVUA 1FDOA 3QWOC 5AVXB 1WMKA 3BCCE 4QMAA 2IBZD 1T6AA 3RBXA 1URQC 3V2PA 4JYBA 1NOHA 5B5EH 1JJ2O 2O1JA 3CXHD 4U0CA 3HD7D 5APUA 5EW5E 3W67A 1LTTC 3G28A 4W7ZA 1KILC 5KKZC 3WU2H 3D6ZA 3CL3D 2ROQA 4QKOA 3TF5A 3GMAA 5HGOA 3GW6A 2M5RA 4NPDA 3LRYA 1N7SD 2WMMA 1HJ0A 2M8LA 1BCCG 2OQQA 2XZ0D 1GL2B 1N2DC 3IR9A 1L0HA 1SQVE 2B87B 2KW2A 1K30A 1IMPA 1J2JB 2KS1A 3NTNA 4HKZH 1Y8AA 1DD4A 3A0BE 2PEQA 4GR6A 2CQ8A 1NWQA 2KGEA 2WPSA 2KK7A 2OTJP 2ZYGA 3HTKA 4MRTC 1PEQA 1LGHB 2GUVA 2I8DA 3B5NC 1PP9D 2KOSA 3IFMA 4UB8H 1PGOA 1FDIA 1EDLA 1LTJA 5AVVB 3CCJP 1WRGA 1LT1A 3PTZA 1KYOI 1NKNA 2KZIA 2I1JA 3L72D 2GZFA 2N1TA 3VYIA 3CX5E 1QL1A 3EQ2A 3H0DA 1FAVA 4BRYB 1A8OA 3BRTB 4UHPB 1IUQA 2E74B 1IO4A 1ZP0C 1YITP 1VQKP 3BVHA 1EDJA 4TT3H 3I5CA 4UB6H 1OMIA 3EJBA 3H32B 1KYOH 1KD1Q 2JO1A 1NVOA 2JEEA 3WUVA 4OGQC 2FBWC 3AE8C 3L35A 4IL6X 2XNXA 4IFFA 2KODA 1PZQA 1A02J 3CCUP 1M1KQ 3N4XA 3AE5C 4D6TD 3EWKA 1JO5A 3E1IA 1ZW0A 5CCGA 2LMLA 4C46A 4JF7A 3H1IJ 2N9BA 5KAFH 2P9XA 1GL2D 2GUSA 4H13B 4I2LC 2WSFJ 1KZUB 1QLED 3UIAA 2POHA 2JR8A 2Z44A 3AE9C 4EIJA 2H7HA 2P1JA 1NYHA 3V4QA 1E6JP 1ZNVA 1AFOA 1NU1D 2HG5D 2OYHA 3SFEC 2A06G 5HGLA 2DNWA 4U7JA 1PEMA 2XZ1C 7CEIA 5KLVG 5JPAA 1NHLA 3L71D 1S5LH 1KC8Q 3H47A 1Q90D 4IPYA 5AVRB 1HBWA 5HV8A 3EJEA 5AW9B 4ZMDA 1VQ7P 2AVAA 2GM4A 2M8RA 3RGUA 2FYZA 1Q7YQ 1HGZA 2KS1B 1JY2O 3H1LD 4WYMA 4I6MC 1BCCJ 3AEAC 3CCVP 1QVGO 3A0HE 2FYUD 5C39A 2C9LY 2YKPA 5KLVK 5APXA 2OGUA 1Q82Q 5CBNA 2EIAA 3GF7A 3L75J 3A3YB 3HTKB 4OH8B 2IPPA 2B89A 1M1JC 1NJIQ 4H0LD 3VMAA 2R44A 3NFQA 4PD4D 1UJZA 1BDCA 3CCQP 1LTJB 2C9NY 3M9BA 2E76B 1AJYA 4COCA 2R3CA 2NPSC 2N1TB 1KN7A 1H8AA 1DX7A 5CJ4A 1LJ2A 2ZJSE 3L36A 2KI7B 3CD6P 4H13D 2FFDA 2MKVA 3IAOA 1CSBA 4BWNA 2XXMA 1NTMG 2LOLA 1GTWA 1KB9I 1URQA 2W27A 1JOCA 2EFJA 2PEOA 3RK2B 3DS2A 2IBZG 1NH4A 2CGQA 1FR2A 2SPZA 5AVTB 1M90Q 3CPWO 1SQQG 3MHVA 3CE7A 2D2CC 5KP8B 1KILA 2C0WA 3H1HE 2JP3A 1VQMP 3KYQA 1N73C 2KUBA 1VQ5P 2W6BA 2CNRA 1KB9H 2I1KA 2XNDH 1AQ5A 1NTMK 1AVOA 1KYOD 1BGYD 2VLOA 1Z56A 3L74J 3RL0C 1UNKA 3CCRP 4EDFA 3M1MA 2XT1A 2IFMA 2OYHB 5KJ7C 3CMAP 4ZKUA 1M6NA 3BCCG 4JQ0D 1SQPE 1LTSC 2KLUA 1VQ6P 3AE6C 4DJGA 3WUUA 1PGPA 3PP5A 1N7LA 1WT6A 2Y0CA 2IBZI 2YNYA
chains in the Genus database with same CATH topology
1VQ4P 5HGNA 5F2NA 3DS0A 3Q20A 1A43A 5HGMA 4COCA 3CCEP 2KODA 4XROA 3P05A 5HGOA 3CCUP 1M1KQ 1M6EX 1EOQA 2PEIA 5F2KA 4U0DA 3LRYA 1D1DA 3DS5A 5BS2A 3DPHA 2M8LA 2PEMA 1YHQP 2P9XA 3CCSP 1AUMA 4PH0A 5I4TG 3CD6P 5DCKA 1VQ9P 1VQPP 1K30A 2Z44A 4XFXA 2JYGA 4COPA 1RNIA 5F2OA 3I56P 2PY8A 2XXMA 3OW2O 1E6JP 1K9MQ 3DS1A 1YJWP 1KQSO 2JO0A 2PEQA 1QRJA 4GR6A 1QVFO 1RO0A 3CC4P 5HGLA 1Q86Q 3RG6C 3CMEP 1K73Q 2EFJA 2PEOA 2BUOA 2L6EA 3DS2A 1PEMA 1VQOP 3G21A 3H4EA 1YIJP 3G6EP 5JPAA 1S72P 4QNBA 1M90Q 2OTJP 3CCMP 1KC8Q 3G1GA 4XFZA 1PEQA 3H47A 3I55P 2ONTA 3CPWO 4IPYA 2E1MA 3DS3A 4XRQA 3G1IA 4GR2A 2DGYA 4M0IA 1YI2P 2BQ1E 2BHVA 2XV6A 2Z45A 2JYLA 1VQNP 1YJNP 3G26A 1VQ7P 1VQMP 3CCLP 1VQ5P 1VQ8P 3HYBA 4U0FA 3CCJP 3WBHA 2PEKA 3DS4A 1Q7YQ 2M8PA 1EIAA 2OARA 4WYMA 3CC2P 3CCRP 1K8AQ 3M1MA 2XT1A 3G29A 3CCVP 1QVGO 1PEOA 1VQLP 3H0DA 3DTJA 3G71P 3E2DA 1RO2A 4U0EA 1A8OA 1M74A 1IUQA 2QEXP 1YJ9P 3CMAP 1Q82Q 1JJ2O 2EIAA 4U0CA 1YITP 2PENA 1VQKP 1M6NA 2PEJA 3MGEA 3NTEA 3CXCO 5BS1A 1Q81Q 1ZMBA 3B5IA 2LF4A 1VQ6P 3HZQA 4U0BA 1N8RQ 3CC7P 2OTLP 2CWOA 1NJIQ 4U0AA 2EG5A 1KD1Q 2M8NA 3G28A 2Z46A 1BAJA 1PEUA 3G0VA 3CCQP 4XFYA 1W2BO 3VRLC 3G4SP 2QA4P 4PH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 P;  3I56 P;  3OW2 O;  1YJN P;  2QEX P;  1YJ9 P;  1YJW P;  3CMA P;  1Q82 Q;  1K9M Q;  1KQS O;  1JJ2 O;  1VQ7 P;  1VQM P;  3CCL P;  3CCU P;  1M1K Q;  1VQ5 P;  1VQ8 P;  1QVF O;  3CC4 P;  1YIT P;  1VQK P;  3CCJ P;  1Q86 Q;  3CME P;  1Q7Y Q;  1K73 Q;  3CXC O;  1Q81 Q;  1VQ6 P;  3CCE P;  1VQO P;  1N8R Q;  1YIJ P;  3CC7 P;  2OTL P;  1YHQ P;  1NJI Q;  3CCS P;  3G6E P;  3CC2 P;  1S72 P;  1KD1 Q;  1M90 Q;  2OTJ P;  3CCM P;  3CCR P;  1K8A Q;  1KC8 Q;  3CD6 P;  3CCV P;  3I55 P;  3CPW O;  1QVG O;  1VQ9 P;  1VQP P;  1VQL P;  3CCQ P;  1W2B O;  3G4S P;  2QA4 P;  3G71 P;  1YI2 P;  1VQN P; 
#chains in the Genus database with same CATH topology
 2E76 D;  5F2N A;  2L0Q A;  1GW3 A;  3MZW B;  3B5N A;  1QL2 A;  5CCH C;  1OZH A;  3F5H A;  1OR5 A;  3GLM A;  3IF4 A;  2KG6 A;  1PP9 G;  5TIS E;  1OVV A;  1SQB D;  2QE7 H;  4XFX A;  1EZV E;  1T3U A;  5AW8 B;  2PY8 A;  3L72 G;  1SQV G;  2FAC A;  1ZRT D;  3V2R A;  2WZ7 A;  3KZI E;  1L4A D;  1UII A;  5AW4 B;  2JDI H;  3RK2 D;  2KOP A;  4IOI H;  1VQO P;  3TK1 A;  1IFM A;  4BPG A;  2E5T A;  1EXI A;  1NAY A;  3VOP A;  2HLO A;  1MUU A;  2JB0 A;  2M5A A;  2VRS A;  4KT0 J;  2ZT9 D;  3GHG C;  2NO8 A;  1ZOY C;  4ASW A;  2WQY C;  3HYB A;  2G3A A;  3P8M C;  2PEK A;  2FFD B;  4L75 A;  2K2Q A;  1OW6 A;  4L76 A;  3CWB G;  2KG9 A;  1SFC A;  2LKI A;  3G29 A;  1YQ4 C;  4H44 D;  2K0Y A;  1URQ B;  2LL8 A;  3WMM 0;  1T8Z A;  2Q3I A;  3G3Z A;  2YXQ B;  2KOR A;  5M1B A;  1E0H A;  4XA4 A;  3TGU G;  3H1K E;  2QM7 A;  3A5T A;  1FZC C;  1FC2 C;  3L73 E;  3HZQ A;  2L22 A;  1VF5 D;  3V5B A;  3L70 E;  2EG5 A;  1BE3 D;  4IFD K;  1KIL B;  1NU1 G;  3LMO A;  1NTZ D;  5KKZ B;  2Z5I A;  1USE A;  4XFY A;  2QIW A;  1HJB A;  3GKL C;  1F80 D;  3NMD A;  5KLV D;  3L71 G;  1FU1 A;  2VSQ A;  1CI6 A;  4WBA A;  3AEG C;  2IYP A;  1S5L X;  4H2X C;  1HTL C;  5DJT B;  2N5H A;  1PL5 A;  2H88 C;  3T97 B;  2N98 A;  2IYO A;  1NU1 K;  3TNU A;  1OXZ A;  1KB9 D;  5KP6 B;  3A2A A;  1FE6 A;  2W8Z A;  2FYU G;  3MTU E;  3RG6 C;  4YTP C;  3KPE A;  2L91 A;  4W7Y A;  3CCM P;  2LXB A;  1M1J A;  3SSU A;  1PPJ E;  3B5N B;  3PLN A;  2QSI A;  4M3L A;  4F37 A;  5GTH E;  1KQL A;  4I7Z C;  1YQ3 C;  2NPS A;  1Q2N A;  2Y0E A;  2WPR A;  2YO2 A;  2FQ0 A;  3H1J E;  1SQX D;  1L2P A;  2CPB A;  1PP9 J;  2FYU K;  1RF1 C;  2JBG A;  1YTZ T;  4PV1 C;  1URQ D;  2FVA A;  5AW6 B;  4U0E A;  2GDW A;  1IFP A;  2B88 A;  3CXH E;  2J59 M;  2ZAE B;  4YXD C;  3L72 J;  2XDJ A;  1NTM D;  2M5A B;  4OGQ B;  3ABV C;  2QM8 A;  1IFI A;  1RHZ B;  5CMZ A;  2E5Y A;  2LIW A;  2ZVN B;  2M3E A;  2QA4 P;  4IL6 E;  3F89 A;  5HGN A;  3A7O A;  5GTI E;  3RK3 D;  4XE5 B;  1M6E X;  1BSN A;  2QJK C;  2N5I A;  1SQQ D;  1SFC B;  4R0M A;  1DNY A;  1LWU C;  4H2Y C;  5APS A;  4CA3 A;  4PH0 A;  1VKU A;  4PD4 I;  2KP8 A;  3K5B A;  1CZQ A;  1VQ9 P;  3FX0 A;  1VQP P;  3FWL A;  4GIF A;  4D6T J;  2JGP A;  2K93 A;  2Q5U A;  3TSI A;  1BGY G;  1K9M Q;  5KJ7 A;  2AEJ A;  1OW8 A;  1JUN A;  1OIP A;  2PFX A;  2K5X A;  1NTK E;  2FVE A;  3OA7 A;  5E79 H;  1PIX A;  1YIJ P;  3V2Q A;  2GDY A;  1NU1 J;  3BCC D;  4PD4 H;  3JCU E;  2N50 A;  1CI6 B;  3G26 A;  3FXD A;  1L0I A;  3L71 J;  5CCH A;  1VHN A;  3C8V A;  3DS4 A;  3HD7 C;  2XKM A;  2OYI C;  1AQT A;  1J1E C;  1KOR A;  2N6Y A;  3P7K A;  3S1K A;  3TNU B;  4XFJ A;  1PEO A;  2QEX P;  1J1D C;  3H1L J;  2W90 A;  1M1J B;  1JCC A;  1Q81 Q;  1N7S C;  1SQB G;  3B5I A;  1AA0 A;  3QH9 A;  2FYU J;  2CWO A;  1H89 A;  2MY5 A;  1SQV D;  5KLI B;  3OAK A;  2Z46 A;  1T2K C;  1IFN A;  1W2B O;  1CEI A;  3G4S P;  2R32 A;  2NPS B;  5KAI H;  3Q20 A;  3GHG A;  2WIT A;  3TYY A;  4BPH A;  3VTP C;  1SFC D;  2AXT H;  2B9B A;  2BCC G;  2IZ0 A;  4NPF X;  2ZYD A;  1SQB K;  2FQ2 A;  2W83 C;  1P84 I;  1DV5 A;  1S2E A;  3CWB D;  1ZXG A;  1HY8 A;  1N86 A;  1G2C A;  2W6A A;  1QVF O;  1OX3 A;  2BEZ F;  4PJ0 E;  4KJM A;  1KQF B;  2R5B A;  3H4E A;  1S1C X;  2UWJ E;  1FZC A;  1M57 D;  2D2C B;  3B71 A;  3TGU D;  5B5E E;  2A45 G;  2XV6 A;  1N73 B;  2YMY A;  3M0D C;  1YTZ I;  4WY4 C;  3HE5 A;  1P84 H;  1AF8 A;  1BE3 G;  4AQR D;  2GZI A;  1NTZ G;  3S9O A;  3RL0 B;  5AW1 B;  5APQ A;  3H1L E;  3IN6 A;  3M9H A;  3CC2 P;  5B66 H;  1KQG B;  2MR7 A;  1RH5 B;  3WU2 E;  1JY2 N;  2OYO A;  2FXP A;  2KR5 A;  2YO3 A;  2NZ2 A;  1JY3 P;  1BGY J;  5AVY B;  3P8C E;  3B4Q A;  2VLP A;  1NTZ K;  1LT9 A;  3U43 A;  1G1I A;  1JCD A;  2NPS D;  1FZB A;  4BPF A;  5APV A;  2E74 D;  2LXC B;  2AEF A;  1EOQ A;  1FBM A;  1LNQ A;  2ZYA A;  2A45 I;  2GDX A;  1E79 H;  1QGK B;  2WPV B;  1OW7 A;  3CCS P;  1HQB A;  4A7P A;  4YPC A;  2FAE A;  2RN0 A;  5BU8 B;  1L0N G;  2KLV A;  3H1I E;  4UB8 E;  1RF1 A;  1M7L A;  5F2O A;  4MN4 C;  1SQX G;  2ZXE B;  1ZLL A;  3AEF C;  1SQB J;  2A45 H;  1U57 A;  1IK7 A;  3VMX A;  2JJL A;  3GHG B;  2KIK A;  2Z45 A;  1JTH A;  4GOD A;  2P58 A;  1PFI A;  1L0N K;  2IFN A;  4LGD E;  4UB6 E;  3MP7 B;  1E5W A;  3RL0 D;  1Y9B A;  1KYO E;  5CZD B;  1SQX K;  1EIA A;  1S4X A;  2YIU C;  3NY7 B;  3AEC C;  2CG5 B;  3KQG A;  4H0L C;  1PGQ A;  1LTG C;  3PRJ A;  1G2C B;  2E75 C;  1VQL P;  2X2B A;  5H2F H;  1BCC E;  1RO2 A;  2QRX A;  2K1A A;  2M0B A;  4N6J A;  1HH0 A;  1UIX A;  1FZC B;  1DIP A;  1H88 A;  2DW3 A;  5KAF E;  2C0X A;  3L75 E;  1FZG A;  1T3J A;  1XTC C;  1S9K D;  1L0L G;  2KZJ A;  3HE5 B;  3AE1 C;  1CW5 A;  1EDK A;  4AUW A;  1SP4 A;  5CCH D;  1H0T A;  4U3F G;  1A43 A;  4XRO A;  4H2W C;  2PEI A;  3T97 A;  1SQQ K;  1G1J A;  1BE3 J;  1S5L E;  1NTZ J;  1YHQ P;  1DD3 A;  3HD7 A;  2OYI A;  5KLV J;  3PH0 A;  1P84 D;  1L0L K;  4C7R A;  2N1T D;  1NO4 A;  1LT9 B;  1MZ9 A;  1K73 Q;  1OVR A;  1N7S A;  1KV4 A;  4HKG A;  4HYT B;  3SWK A;  2OTK E;  2QG4 A;  5AW0 B;  4EOT A;  2E1M A;  4XRQ A;  2DGY A;  2H89 C;  4I7Z B;  3LID A;  1YJN P;  2FYN C;  2IX7 C;  1X79 B;  3FWN A;  1SLQ A;  3ZDM A;  2K88 A;  2XV5 A;  1SQP D;  1RF1 B;  4PV1 B;  1U7M A;  1K8A Q;  3L74 E;  1QEX A;  3G71 P;  3E2D A;  1L0N J;  1AV1 A;  2K92 A;  1LTJ C;  1M56 D;  2BCC D;  5AVU B;  5CCG D;  2E76 C;  3B8E B;  1GZL A;  1SQX J;  1ZMB A;  3AEE C;  2KGD A;  4L74 A;  2L4B A;  4U0B A;  3CC7 P;  1SQV K;  1MZ8 A;  1JTH B;  2A06 E;  3G0V A;  3WUT A;  4DT0 A;  1EZV D;  1SS1 A;  2IZ1 A;  2WT7 A;  2QJK B;  5KLV E;  2MVV A;  4Z1M H;  3M0D A;  4WY4 A;  1NTM J;  1L4A C;  4I1L A;  1FJP A;  1X0T A;  3RK2 C;  3GJN A;  3AE3 C;  1JM0 A;  1W2E A;  5K5G B;  1Z6M A;  2JYG A;  4GDO A;  2WWW A;  3G9R A;  1SQQ J;  1KB9 E;  2ZT9 C;  4ZKP A;  2RH0 A;  1QRJ A;  3CC4 P;  4B86 A;  1GW4 A;  1Q86 Q;  1GK6 A;  2LR2 A;  2L6E A;  4JBZ A;  4Y28 J;  1IFD A;  4JYC A;  1H0T B;  3I55 P;  3DS3 A;  4HB1 A;  5AW5 B;  4H44 C;  3RG2 A;  4LLH A;  1VQN P;  3GG2 A;  2W6J H;  2AEM A;  1JMM A;  3HD7 B;  2FY8 A;  4JPZ B;  2OYI B;  2E42 A;  3A0B H;  3WBH A;  3H1K D;  3CLQ A;  3SFD C;  1J1E B;  1DH3 A;  3L70 D;  1FS0 E;  3BCC J;  2CK3 H;  3ITK A;  1RF0 C;  1XTG B;  3CX5 I;  1VF5 C;  4N78 D;  4RO0 A;  4WVZ A;  5HVC A;  3L4F A;  2K0X A;  2MR8 A;  5KTB A;  2WPT A;  3C1L A;  1KMI Z;  1J1D B;  1N7S B;  2PEN A;  1L0N D;  2GZE A;  5BS1 A;  2XU6 A;  2G8Y A;  2HR3 A;  2OTL P;  4U0A A;  4L73 A;  4YXW H;  4IFM A;  4WB4 A;  1PEU A;  4DZO A;  5TJH A;  3CX5 H;  2IBZ E;  3SWF A;  3DS0 A;  3R4Y A;  3RK3 E;  1IJD B;  4ASV A;  2J5U A;  2HOD A;  1SQV J;  5BS2 A;  2YKO A;  2Z5H A;  2M3B A;  1AUM A;  2KOO A;  1KIL D;  1PPJ D;  3H25 A;  3Q5S A;  4TLF A;  2IDB A;  1HGV A;  1U7J A;  2K37 A;  2EHT A;  1PGJ A;  3MIW A;  2KOG A;  3M91 A;  3H1I G;  2CPS A;  1VL2 A;  2O01 N;  2Q6Q A;  5KP7 B;  1N73 A;  3E1R A;  5AW2 B;  1RE3 C;  2KSE A;  3G6E P;  5CJ0 A;  2WT7 B;  1IZN B;  2PAJ A;  3CWB J;  4GR2 A;  1EMV A;  1M8O B;  4WY4 B;  2QJY C;  3D70 A;  2QJP C;  3BAT A;  1OFC X;  2R5D A;  1L0L D;  3V6I A;  4R4M A;  1FZF A;  5AVW B;  4U3F D;  3TGU J;  1USD A;  1RQU A;  3KDP B;  1NGM B;  2HFE D;  3B5N D;  1DEB A;  2ERH A;  1BSH A;  1PP9 E;  2H8P D;  1YJ9 P;  2FXO A;  2Y9Z A;  3EFG A;  3D71 A;  3RL0 g;  2GYK A;  1LP1 A;  2MF4 A;  1W5C E;  3RK3 C;  1R8E A;  1GU5 A;  1BXI A;  2K94 A;  1N8R Q;  3H1H G;  3L72 E;  1FOS F;  1T2K D;  2M8N A;  4N3Y B;  3VRL C;  3A0H H;  3PJS K;  3L75 G;  3CCE P;  2EHS A;  1HUC A;  2MD9 A;  5AVS B;  1RY3 A;  1NTK D;  3DS5 A;  1KFM A;  1RE4 C;  1KFN A;  3H6P A;  4OGQ D;  4O9B A;  2NRG A;  3JC2 2;  2MVU A;  3NXS A;  1GDT A;  2K3R A;  1SQP G;  1A02 F;  1MKM A;  1AYI A;  3CWB E;  2KSJ A;  2WSF H;  2JAZ A;  4D6T E;  4Y99 C;  3BRV B;  4BXL A;  3EJD A;  2N9Y B;  1X9V A;  2ONT A;  1HF9 A;  2FAD A;  3TGU E;  2Q3E A;  4WY4 D;  2KWL A;  2HOD B;  1YI2 P;  2R3S A;  3II6 A;  1ZV8 A;  3O6Q A;  1JY2 P;  1NU1 E;  4LC1 A;  1S3J A;  1LTI C;  1SQP K;  2YIU B;  2M8P A;  1EZV G;  4H0L B;  2OAR A;  2P2U A;  1L4A A;  3L71 E;  2E75 B;  3CX5 D;  3HUS C;  4K35 A;  4HH2 A;  4PXH B;  1JMB A;  1M74 A;  3L74 G;  1LTB C;  1SVF A;  1PV3 A;  2LPK A;  1LTA C;  1SFC C;  5EFW B;  3P32 A;  1EDI A;  2FYU E;  4PH1 A;  2LTE A;  5BU5 A;  2FQ1 A;  3GZL A;  2P67 A;  2KYV A;  1FOS E;  5E79 E;  3U59 A;  2HYN A;  3MUD C;  3Q3D A;  3DPH A;  2WSE H;  5APY A;  1IMQ A;  2H43 A;  3OJA B;  4PD4 E;  3B4S A;  3Q5R A;  1GL2 C;  1RF0 A;  3S4R A;  5AW3 B;  3TDK A;  2QVA A;  1EZV I;  2K9J A;  1LP1 B;  3AE2 C;  3H1K G;  4KHX A;  1RNI A;  1GU4 A;  3L73 G;  2KNC A;  1YJW P;  3L70 G;  5AW7 B;  3VP8 A;  1FZE A;  1K04 A;  2JKV A;  4WWI A;  4QNB A;  4DOJ A;  3H1H J;  4XFZ A;  2O1K A;  4C7N A;  5TIS H;  4EYY Q;  2L9F A;  2FYN B;  4M0I A;  2J58 A;  2FXM A;  2HPC A;  1R5L A;  1MFT A;  1Y47 A;  3CCL P;  2Q1K A;  4U0F A;  3U1A A;  3JSV C;  3P8C D;  2JU2 A;  3KZI H;  4GT1 A;  2AFD A;  1JY3 N;  2E75 D;  1IC2 A;  1X3O A;  2D2C D;  2WPQ A;  5KAI E;  5KLI C;  2KOQ A;  3KHU A;  4GKG A;  2WSE J;  2MJZ A;  5L8R J;  1SQP J;  3Q2Y A;  3RBZ A;  4DG9 A;  1PPJ G;  2E74 C;  2AXT E;  2PEJ A;  1TU3 F;  4NPE A;  2WTY A;  1JY3 O;  3PHL A;  3AE4 C;  1BGY E;  1LWU A;  1RE3 A;  1S9K E;  1RQV A;  3W68 A;  4HJG H;  3O6Q B;  1K05 A;  1BAJ A;  2BCC J;  2JWA A;  3M9Q A;  3H1I D;  5KJ7 D;  2L5G B;  3U1C A;  1VQ4 P;  3H1J G;  2RMZ A;  3VMY A;  1L4A B;  4U0D A;  1NKZ B;  2K9Y A;  1D1D A;  1X8Y A;  1EQ7 A;  3HE4 A;  1NQ4 A;  5APW A;  2PEM A;  1HVV A;  1D7M A;  3AEB C;  3C9I A;  3HRN A;  5DJU B;  4H13 C;  5CHX A;  3KXD A;  3SWY A;  1P84 E;  2V7Q H;  2ZT9 B;  2ZXX A;  2WSC H;  3I56 P;  2ITA A;  3DS1 A;  1KQS O;  1VDF A;  2V4H A;  2WSS H;  2KB7 P;  5B66 E;  3AED C;  4GOE A;  3FGA D;  1EXJ A;  3G21 A;  3LW5 H;  2P10 A;  1KTM A;  5APT A;  4H44 B;  1SQB E;  1YYC A;  1BCC D;  2PP6 A;  1GD2 E;  3H1H D;  2AF8 A;  2GA1 A;  1ZRT E;  2YKQ A;  1ZN5 A;  3Q5P A;  1VF5 B;  3L75 D;  3O8Z A;  2Q9I A;  2K9J B;  1RE4 A;  1VPC A;  2KNC B;  1FJK A;  1NTK G;  2PNG A;  2BCC E;  3N7N A;  1GPJ A;  3H1K J;  3CXH I;  3L73 J;  3VN0 A;  3L70 J;  3MGE A;  3NTE A;  1GXG A;  5GTH H;  4C7N B;  3CXC O;  2LF4 A;  2V7Q J;  2WSC J;  2BAS A;  2HPC B;  2Y9Y A;  4W80 A;  1GMJ A;  3LIE A;  2KG8 A;  2YXR B;  3LW5 J;  3P05 A;  1NTK K;  2FKW B;  3CXH H;  1KLP A;  2ZFC A;  2N1T C;  1JB0 J;  2YMK A;  2GZG A;  2VLN A;  1BE3 E;  1GXH A;  5I4T G;  1NTZ E;  3AE7 C;  2O3J A;  5DCK A;  1FDM A;  3HUS A;  4COP A;  3FXE A;  2JQ4 A;  1OWA A;  4IL6 H;  5GTI H;  4AYC A;  1RO0 A;  1LWU B;  1QX8 A;  2JWD A;  3D6Y A;  2LIU A;  2AXC A;  3CME P;  2KGA A;  4RJT A;  2PRR A;  1ZR2 A;  2BUO A;  2P7J A;  4NEO A;  5EJD A;  1HWT C;  1S72 P;  3G1G A;  4D6T G;  4GOF A;  5H2F E;  2GZJ A;  3L74 D;  2QJY B;  3GF3 A;  2QJP B;  2BHV A;  1R5S A;  2JU1 A;  3HE4 B;  5AVZ B;  5CCG C;  1AVY A;  3H1J J;  2PGD A;  1NAF A;  1MV8 A;  3MUD A;  2FHS C;  1T8K A;  2QNW A;  4N78 E;  2A06 D;  3DTJ A;  1GL2 A;  1L0L J;  2B87 A;  2OYH C;  3RK3 B;  3JCU H;  1X22 A;  4U3F J;  1L0N E;  1ZR4 A;  3VMZ A;  2O01 H;  4OWF A;  1JEK A;  3L73 D;  1SQX E;  2FVF A;  4PV1 D;  2VLQ A;  3USS A;  2KGC A;  2Z4E A;  3H1L G;  2KXP B;  5HGM A;  1ZME C;  1YBK A;  1BDD A;  1FZA A;  3M0A A;  5BVZ A;  5F2K A;  2Y0D A;  1LT9 C;  1NTM E;  1DEE G;  1KIL E;  1EC5 A;  2XZR A;  2N6Z A;  1GK4 A;  1IK9 A;  3V4W A;  4R4L A;  2RKL A;  4OVN F;  2E43 A;  1MFZ A;  2AFE A;  3OW2 O;  1NTK J;  4Y99 B;  5AVQ B;  2JO0 A;  4BRY A;  3L37 A;  1SQQ E;  1IFJ A;  4EI2 A;  2Q7C A;  2ZVO B;  3VP9 A;  3G1I A;  3R2P A;  3H32 A;  4PWV B;  2O01 J;  4RES B;  2BQ1 E;  4IZ6 A;  3CI9 A;  2JYL A;  2WVR A;  3BAS A;  3E7K A;  2K0D X;  4ZNC A;  3MGN A;  1L0L E;  4CPG A;  3EFF K;  3V2N A;  1VQ8 P;  2LKM A;  5CBO A;  4RKU J;  3GZM A;  3Q1M A;  1JNM A;  2BEQ D;  3M06 A;  4K3A A;  4PJ0 H;  3MD0 A;  4U3F E;  1ACP A;  3HUS B;  3H1J D;  4DCK A;  2FFD C;  1OVU A;  1FDO A;  3QWO C;  5AVX B;  1WMK A;  3BCC E;  4QMA A;  2IBZ D;  1T6A A;  3RBX A;  1URQ C;  3V2P A;  4JYB A;  1NOH A;  5B5E H;  1JJ2 O;  2O1J A;  3CXH D;  4U0C A;  3HD7 D;  5APU A;  5EW5 E;  3W67 A;  1LTT C;  3G28 A;  4W7Z A;  1KIL C;  5KKZ C;  3WU2 H;  3D6Z A;  3CL3 D;  2ROQ A;  4QKO A;  3TF5 A;  3GMA A;  5HGO A;  3GW6 A;  2M5R A;  4NPD A;  3LRY A;  1N7S D;  2WMM A;  1HJ0 A;  2M8L A;  1BCC G;  2OQQ A;  2XZ0 D;  1GL2 B;  1N2D C;  3IR9 A;  1L0H A;  1SQV E;  2B87 B;  2KW2 A;  1K30 A;  1IMP A;  1J2J B;  2KS1 A;  3NTN A;  4HKZ H;  1Y8A A;  1DD4 A;  3A0B E;  2PEQ A;  4GR6 A;  2CQ8 A;  1NWQ A;  2KGE A;  2WPS A;  2KK7 A;  2OTJ P;  2ZYG A;  3HTK A;  4MRT C;  1PEQ A;  1LGH B;  2GUV A;  2I8D A;  3B5N C;  1PP9 D;  2KOS A;  3IFM A;  4UB8 H;  1PGO A;  1FDI A;  1EDL A;  1LTJ A;  5AVV B;  3CCJ P;  1WRG A;  1LT1 A;  3PTZ A;  1KYO I;  1NKN A;  2KZI A;  2I1J A;  3L72 D;  2GZF A;  2N1T A;  3VYI A;  3CX5 E;  1QL1 A;  3EQ2 A;  3H0D A;  1FAV A;  4BRY B;  1A8O A;  3BRT B;  4UHP B;  1IUQ A;  2E74 B;  1IO4 A;  1ZP0 C;  1YIT P;  1VQK P;  3BVH A;  1EDJ A;  4TT3 H;  3I5C A;  4UB6 H;  1OMI A;  3EJB A;  3H32 B;  1KYO H;  1KD1 Q;  2JO1 A;  1NVO A;  2JEE A;  3WUV A;  4OGQ C;  2FBW C;  3AE8 C;  3L35 A;  4IL6 X;  2XNX A;  4IFF A;  2KOD A;  1PZQ A;  1A02 J;  3CCU P;  1M1K Q;  3N4X A;  3AE5 C;  4D6T D;  3EWK A;  1JO5 A;  3E1I A;  1ZW0 A;  5CCG A;  2LML A;  4C46 A;  4JF7 A;  3H1I J;  2N9B A;  5KAF H;  2P9X A;  1GL2 D;  2GUS A;  4H13 B;  4I2L C;  2WSF J;  1KZU B;  1QLE D;  3UIA A;  2POH A;  2JR8 A;  2Z44 A;  3AE9 C;  4EIJ A;  2H7H A;  2P1J A;  1NYH A;  3V4Q A;  1E6J P;  1ZNV A;  1AFO A;  1NU1 D;  2HG5 D;  2OYH A;  3SFE C;  2A06 G;  5HGL A;  2DNW A;  4U7J A;  1PEM A;  2XZ1 C;  7CEI A;  5KLV G;  5JPA A;  1NHL A;  3L71 D;  1S5L H;  1KC8 Q;  3H47 A;  1Q90 D;  4IPY A;  5AVR B;  1HBW A;  5HV8 A;  3EJE A;  5AW9 B;  4ZMD A;  1VQ7 P;  2AVA A;  2GM4 A;  2M8R A;  3RGU A;  2FYZ A;  1Q7Y Q;  1HGZ A;  2KS1 B;  1JY2 O;  3H1L D;  4WYM A;  4I6M C;  1BCC J;  3AEA C;  3CCV P;  1QVG O;  3A0H E;  2FYU D;  5C39 A;  2C9L Y;  2YKP A;  5KLV K;  5APX A;  2OGU A;  1Q82 Q;  5CBN A;  2EIA A;  3GF7 A;  3L75 J;  3A3Y B;  3HTK B;  4OH8 B;  2IPP A;  2B89 A;  1M1J C;  1NJI Q;  4H0L D;  3VMA A;  2R44 A;  3NFQ A;  4PD4 D;  1UJZ A;  1BDC A;  3CCQ P;  1LTJ B;  2C9N Y;  3M9B A;  2E76 B;  1AJY A;  4COC A;  2R3C A;  2NPS C;  2N1T B;  1KN7 A;  1H8A A;  1DX7 A;  5CJ4 A;  1LJ2 A;  2ZJS E;  3L36 A;  2KI7 B;  3CD6 P;  4H13 D;  2FFD A;  2MKV A;  3IAO A;  1CSB A;  4BWN A;  2XXM A;  1NTM G;  2LOL A;  1GTW A;  1KB9 I;  1URQ A;  2W27 A;  1JOC A;  2EFJ A;  2PEO A;  3RK2 B;  3DS2 A;  2IBZ G;  1NH4 A;  2CGQ A;  1FR2 A;  2SPZ A;  5AVT B;  1M90 Q;  3CPW O;  1SQQ G;  3MHV A;  3CE7 A;  2D2C C;  5KP8 B;  1KIL A;  2C0W A;  3H1H E;  2JP3 A;  1VQM P;  3KYQ A;  1N73 C;  2KUB A;  1VQ5 P;  2W6B A;  2CNR A;  1KB9 H;  2I1K A;  2XND H;  1AQ5 A;  1NTM K;  1AVO A;  1KYO D;  1BGY D;  2VLO A;  1Z56 A;  3L74 J;  3RL0 C;  1UNK A;  3CCR P;  4EDF A;  3M1M A;  2XT1 A;  2IFM A;  2OYH B;  5KJ7 C;  3CMA P;  4ZKU A;  1M6N A;  3BCC G;  4JQ0 D;  1SQP E;  1LTS C;  2KLU A;  1VQ6 P;  3AE6 C;  4DJG A;  3WUU A;  1PGP A;  3PP5 A;  1N7L A;  1WT6 A;  2Y0C A;  2IBZ I;  2YNY A; 
#chains in the Genus database with same CATH homology
 1VQ4 P;  5HGN A;  5F2N A;  3DS0 A;  3Q20 A;  1A43 A;  5HGM A;  4COC A;  3CCE P;  2KOD A;  4XRO A;  3P05 A;  5HGO A;  3CCU P;  1M1K Q;  1M6E X;  1EOQ A;  2PEI A;  5F2K A;  4U0D A;  3LRY A;  1D1D A;  3DS5 A;  5BS2 A;  3DPH A;  2M8L A;  2PEM A;  1YHQ P;  2P9X A;  3CCS P;  1AUM A;  4PH0 A;  5I4T G;  3CD6 P;  5DCK A;  1VQ9 P;  1VQP P;  1K30 A;  2Z44 A;  4XFX A;  2JYG A;  4COP A;  1RNI A;  5F2O A;  3I56 P;  2PY8 A;  2XXM A;  3OW2 O;  1E6J P;  1K9M Q;  3DS1 A;  1YJW P;  1KQS O;  2JO0 A;  2PEQ A;  1QRJ A;  4GR6 A;  1QVF O;  1RO0 A;  3CC4 P;  5HGL A;  1Q86 Q;  3RG6 C;  3CME P;  1K73 Q;  2EFJ A;  2PEO A;  2BUO A;  2L6E A;  3DS2 A;  1PEM A;  1VQO P;  3G21 A;  3H4E A;  1YIJ P;  3G6E P;  5JPA A;  1S72 P;  4QNB A;  1M90 Q;  2OTJ P;  3CCM P;  1KC8 Q;  3G1G A;  4XFZ A;  1PEQ A;  3H47 A;  3I55 P;  2ONT A;  3CPW O;  4IPY A;  2E1M A;  3DS3 A;  4XRQ A;  3G1I A;  4GR2 A;  2DGY A;  4M0I A;  1YI2 P;  2BQ1 E;  2BHV A;  2XV6 A;  2Z45 A;  2JYL A;  1VQN P;  1YJN P;  3G26 A;  1VQ7 P;  1VQM P;  3CCL P;  1VQ5 P;  1VQ8 P;  3HYB A;  4U0F A;  3CCJ P;  3WBH A;  2PEK A;  3DS4 A;  1Q7Y Q;  2M8P A;  1EIA A;  2OAR A;  4WYM A;  3CC2 P;  3CCR P;  1K8A Q;  3M1M A;  2XT1 A;  3G29 A;  3CCV P;  1QVG O;  1PEO A;  1VQL P;  3H0D A;  3DTJ A;  3G71 P;  3E2D A;  1RO2 A;  4U0E A;  1A8O A;  1M74 A;  1IUQ A;  2QEX P;  1YJ9 P;  3CMA P;  1Q82 Q;  1JJ2 O;  2EIA A;  4U0C A;  1YIT P;  2PEN A;  1VQK P;  1M6N A;  2PEJ A;  3MGE A;  3NTE A;  3CXC O;  5BS1 A;  1Q81 Q;  1ZMB A;  3B5I A;  2LF4 A;  1VQ6 P;  3HZQ A;  4U0B A;  1N8R Q;  3CC7 P;  2OTL P;  2CWO A;  1NJI Q;  4U0A A;  2EG5 A;  1KD1 Q;  2M8N A;  3G28 A;  2Z46 A;  1BAJ A;  1PEU A;  3G0V A;  3CCQ P;  4XFY A;  1W2B O;  3VRL C;  3G4S P;  2QA4 P;  4PH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...