1YI2P

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yi2P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yi2P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yi2P02
3CMAP 3CCVP 1VQPP 1YITP 1YJWP 1NJIQ 3CMEP 1M90Q 3CCUP 3CCEP 3CXCO 1K8AQ 3OW2O 1VQ9P 1YI2P 1Q86Q 1Q7YQ 3CCLP 2OTLP 3CCRP 1Q81Q 1YJ9P 1QVGO 3G71P 1YIJP 1YHQP 1VQ7P 3CC2P 1M1KQ 1VQMP 1VQ5P 1S72P 3CCQP 3CCSP 3CPWO 3CCMP 1W2BO 1N8RQ 1Q82Q 3G6EP 1YJNP 1JJ2O 3CD6P 2QEXP 3CCJP 3I55P 1VQ6P 2OTJP 1KD1Q 3G4SP 3CC4P 1K73Q 1VQKP 1VQ4P 2QA4P 1VQOP 1QVFO 1VQNP 1VQLP 3I56P 1KC8Q 1KQSO 1K9MQ 3CC7P 1VQ8P
chains in the Genus database with same CATH superfamily
2AFEA 1NTMG 1SQXD 2C9NY 4R4LA 3CX5E 1Q81Q 3L74G 1Y9BA 4PJ0H 4H44C 1LTGC 2WPVB 3JCUH 4EOTA 3WBHA 3G4SP 3FWNA 2V7QJ 1M1JA 1EIAA 2QM8A 1RF1B 2JQ4A 1L4AD 3SWFA 1EC5A 2IZ0A 3DS3A 4PXHB 4U0FA 2AEMA 4GR6A 2WPQA 1JTHB 1NU1J 4IFMA 3AE4C 3FXEA 3AE5C 1N7SB 3B5ND 2Z4EA 3DPHA 5F2KA 3CX5H 1JY3P 1KYOE 2Z5IA 1IMPA 3M91A 4NPEA 1RNIA 2LIUA 3H1KD 1YTZT 4I2LC 2YMYA 1T8KA 1IZNB 1DD4A 1GW4A 2XV5A 4RO0A 3BCCG 3OA7A 3TYYA 1IFPA 2FYUE 2N5HA 2B87B 1MZ8A 2EIAA 1JM0A 2GZFA 3P7KA 2BQ1E 5BS1A 1X8YA 2FADA 4I7ZB 1XTCC 1RE4C 4ZMDA 2P58A 3H1IE 1KQGB 2MKVA 4JYCA 2PEOA 1KYOH 1EMVA 1KLPA 3M9QA 3A2AA 2E76B 3RK3D 3KHUA 1RO2A 1OFCX 4DZOA 2KG8A 4I1LA 3VP9A 2KZIA 1YJNP 2M5RA 5KJ7A 2N9BA 4C7NB 1NU1G 2FKWB 2OTKE 3VRLC 3DS1A 1ZR2A 3SSUA 5AVTB 3GZLA 4OWFA 1DX7A 3IFMA 2K9JB 3GF7A 2PRRA 1VQ7P 3L4FA 3CXHE 3HRNA 2C9LY 1DNYA 5EW5E 5AW4B 4DT0A 2E74C 4W7ZA 3Q3DA 1KZUB 3H1KJ 2LR2A 1NU1K 1HJBA 1YHQP 3CCQP 2M8LA 3TK1A 3AEDC 2LXCB 4WY4B 1Q90D 2WSSH 2W90A 1FAVA 1NTME 1HY8A 1X0TA 3B5IA 3BVHA 3GZMA 2HYNA 4WB4A 1SQXG 1ZR4A 3L74E 3CXHH 1IC2A 1JOCA 2NPSA 2KXPB 3DS5A 3JC22 2XXMA 1LT9A 3U1CA 4QMAA 1KN7A 1KFNA 2L9FA 4M3LA 1SQPJ 2NZ2A 3HE5A 5KP8B 1L2PA 5APSA 2Z45A 2Z46A 4IPYA 2RN0A 1ZMEC 3KXDA 1CEIA 4Z1MH 4ZKUA 2P7JA 1RE3A 3VOPA 2JO1A 2K94A 3GHGC 1SQXK 3RG6C 3AEEC 3G3ZA 2W83C 3B4SA 1GK4A 1CSBA 1KB9I 1BGYD 3D70A 1OW6A 1KORA 5AVWB 2YO2A 3H1KG 5H2FE 2QJKB 2E75C 3G0VA 4H13C 1H89A 3BCCE 2HPCA 1AVYA 1M1JC 2YKOA 3G26A 5JPAA 3TDKA 2Q7CA 1M90Q 3OW2O 1SS1A 1JCCA 1YIJP 3V4QA 2XDJA 2WWWA 5APYA 1CI6B 1JY2P 1L4AB 2YMKA 4IFFA 1A8OA 2GYKA 4W80A 3VN0A 1ZXGA 1BCCD 1S9KD 1P84D 1M57D 3AE6C 1JO5A 2E74D 3PRJA 3B8EB 2G8YA 2M5AB 3G29A 5HGLA 3GMAA 2KP8A 2ZXXA 1IFDA 2O3JA 1NU1E 2WVRA 2XNDH 1L0IA 5KLIC 1KC8Q 3MD0A 2RKLA 2K88A 1J1EC 4OGQC 1ZP0C 3VMAA 5AVQB 1NKNA 2PFXA 2Y9YA 2YIUB 2PY8A 1BSNA 4PH1A 1MZ9A 3N4XA 2FYNC 3SFDC 1YJWP 3EJDA 3V2RA 2KOPA 4TT3H 2HFED 5BS2A 4QNBA 4WWIA 5HGNA 4A7PA 1N73A 3VTPC 1JMBA 1S1CX 3RG2A 2C0WA 1U7MA 2QIWA 3QH9A 4GODA 2LKMA 1HF9A 2WT7A 2K0XA 1PFIA 4JBZA 1SQXE 1LP1B 1NTMD 1VQ9P 3GJNA 2AEJA 1BDCA 3TNUA 4COPA 1HVVA 1IK9A 3A3YB 1DV5A 2L0QA 1LTTC 3H4EA 1BCCJ 3HD7D 3PTZA 2E75D 4H13D 3EFGA 2KOGA 2Q6QA 1HGVA 4KHXA 5CCGA 1T3JA 3Q2YA 3CCVP 2ITAA 4OVNF 5CBNA 3C8VA 2QG4A 4GKGA 4L74A 4XFJA 1D1DA 2KS1A 1DEEG 5F2OA 1OW7A 2HODB 1PEUA 4H0LB 1BGYG 1OXZA 2JKVA 1NQ4A 5I4TG 3CMAP 3NXSA 2Z44A 3CCEP 2NPSC 4BPHA 3CXCO 1HJ0A 3L72D 1LT9C 3KQGA 1NHLA 1IUQA 3H1KE 4U0CA 3HE4A 1IO4A 2X2BA 1X3OA 3H25A 2JEEA 2LTEA 2CNRA 2ROQA 1GL2B 3I5CA 2LXBA 1MV8A 1S4XA 4JPZB 2N1TD 2BCCD 5DCKA 2PEIA 1K05A 3BCCD 2QJYB 2OYHA 1X9VA 1KTMA 2K5XA 2E1MA 2GZJA 1YI2P 2CWOA 1Q86Q 1PEOA 1RE3C 2PEQA 3FWLA 2KW2A 1ZMBA 3PHLA 1PP9D 1HQBA 3ITKA 1K04A 1NO4A 1G2CA 3E1IA 2BEZF 3GF3A 1NTMJ 2N98A 1FOSE 1BCCG 5GTIE 2JJLA 2WSEJ 3RK3E 1IFIA 2R3CA 4BRYA 4HJGH 1KILA 2MVVA 1N2DC 2JAZA 2CGQA 5APVA 4XFZA 5AVRB 3BRTB 5KP6B 3CD6P 1S3JA 1AUMA 3RBZA 5AVUB 3RGUA 4IFDK 2EG5A 2B88A 1KQLA 4PD4I 3AE9C 3CC7P 4F37A 3L75G 1JCDA 1D7MA 2WPRA 2WTYA 2KOSA 2YKQA 3DS2A 2QJPB 4UB8H 2HR3A 1EZVI 1OVRA 2A45G 2J59M 2UWJE 1EDLA 2Q5UA 3L72J 4OH8B 4GR2A 1AQTA 1SFCD 4ASWA 1JMMA 2R5BA 4YXDC 3BCCJ 2JB0A 4XFYA 3WU2E 2KGAA 2ZT9D 1RF1A 3L70G 2OGUA 2YXRB 2M8NA 2VLNA 1OWAA 5KAIE 1JTHA 1T8ZA 3CCRP 1N7SA 2HG5D 3MTUE 1M8OB 1RF0A 3E1RA 1S5LE 3SFEC 1KV4A 1H88A 4AYCA 4KT0J 1DEBA 2WMMA 3G1IA 2KNCB 2H8PD 3H32B 5APTA 1ZOYC 2W6BA 1N73C 2OYIB 3L73D 3CC2P 3WU2H 2B87A 4L73A 1QL1A 1Q2NA 2JDIH 4EDFA 1NTMK 2OTJP 1KD1Q 5KAIH 2KWLA 4U3FG 1BGYE 2ERHA 2DNWA 1U7JA 2QM7A 3H1LD 4ZKPA 5CMZA 1IFMA 1JB0J 3L72G 3CX5I 3GKLC 1M1KQ 1H0TB 4LC1A 1S5LH 1NTKD 2VLQA 1YQ4C 5CCGC 1IFNA 2YO3A 3L37A 2BCCG 3Q20A 2R3SA 4PV1B 4EI2A 2Q3EA 1PV3A 3HD7B 2ZJSE 2E75B 4C7NA 3B71A 4ASVA 1GU5A 1PP9G 1IFJA 3BRVB 2P67A 3KYQA 1GPJA 4GDOA 1SQXJ 2KOOA 2K9JA 1BCCE 1S9KE 2DGYA 1P84E 1PIXA 3LW5H 1KYOI 2EHSA 3MP7B 2L5GB 1W5CE 2XV6A 5CHXA 4K3AA 1FE6A 4CPGA 2IYOA 2O1JA 2C0XA 2OYHC 1MFZA 2GDYA 2JBGA 2ZAEB 1HUCA 3L75E 1G1IA 4WY4A 1FZCB 1BDDA 2N1TB 3EQ2A 2GZEA 2XZ0D 2L4BA 1LTJB 2QNWA 3H1LJ 1OVUA 1P84H 4H44D 1E5WA 3FGAD 2IZ1A 3TF5A 3T97A 3V2PA 3GLMA 2FY8A 3M0DA 4U0EA 3BATA 4BXLA 3R2PA 1KILC 3CMEP 5KTBA 2M3EA 2V4HA 3S9OA 1NTKJ 3HTKB 1QVGO 3G21A 2IBZI 5E79E 2QEXP 4N78E 1ZLLA 3L70E 1AV1A 3JSVC 2GA1A 1Y8AA 2GM4A 2B9BA 1FR2A 2MVUA 2A45H 2O1KA 2W27A 2QVAA 1L0LD 1M6NA 2I1JA 1LWUB 3CXHI 1GU4A 3LIDA 2JU2A 2XZRA 5KKZB 1OIPA 1J1DB 3II6A 3AE1C 3MUDA 2H88C 2IFMA 2N6ZA 5BU5A 3L73G 3MZWB 2A06D 2IYPA 1OX3A 2Q3IA 1RF1C 3OAKA 4U3FE 1SFCB 3SWYA 3ABVC 3NTNA 2FFDB 2M8RA 2AEFA 3H1LG 2L91A 1N7SC 2WSEH 4MRTC 1DIPA 3L72E 4H2WC 1VKUA 1CI6A 2ZT9B 1L4AA 1IJDB 4CA3A 2HLOA 3HUSB 1RF0C 2D2CB 1LTSC 1WRGA 3CCMP 5AVZB 1NTKG 1KQFB 2G3AA 2PAJA 2BCCE 3H1HE 1N7LA 1PPJD 2M5AA 4D6TE 3U43A 5BVZA 3NTEA 1JY3O 2L6EA 4Y99B 4R0MA 1PP9E 3GW6A 5CJ0A 5AW2B 2E5TA 1ZRTD 1FDMA 4I7ZC 4AQRD 2KB7P 3D6ZA 2FVAA 1VHNA 3M06A 1M74A 3LRYA 1L0LJ 1NTKK 1YTZI 4WBAA 5BU8B 4BPGA 1KILD 3B5NB 1EDKA 5H2FH 1GMJA 3V5BA 4RJTA 1AQ5A 2E76C 1T2KC 2XNXA 2XKMA 3AE2C 3L75D 1A02J 3GG2A 1MKMA 2FAEA 3PJSK 1BGYJ 2FVFA 4WVZA 3D71A 1LP1A 1R8EA 1NWQA 3U59A 1MUUA 2KGCA 2E43A 3LW5J 1T3UA 1Q7YQ 3M9HA 2RMZA 5KJ7C 1VQMP 1BSHA 2JYLA 3RK3B 2FQ1A 2AXTE 3C1LA 1NH4A 3M0AA 4N78D 3L70D 3B4QA 4WY4C 2HODA 1L0LG 2FYZA 4W7YA 3DTJA 2LPKA 3RK2C 5CCHA 1NKZB 3LIEA 3TGUG 3M0DC 2ONTA 1RH5B 3PH0A 4PWVB 5DJTB 3VYIA 3O6QB 1SQQD 1URQA 2JWDA 3K5BA 3H0DA 1VQLP 5APUA 1KB9D 2MY5A 1JNMA 4H44B 2LMLA 3PP5A 2K2QA 2K92A 3L73E 1GL2A 1H8AA 1LTAC 5AVYB 2A06G 1WMKA 3Q1MA 2IX7C 4LLHA 4HB1A 4PH0A 3PLNA 4U3FD 1L0LK 3H1LE 3L75J 2WPSA 3Q5RA 1K9MQ 2NO8A 1UJZA 1LJ2A 1Y47A 5AW9B 4JQ0D 1S5LX 1IMQA 2KK7A 2H43A 1LTIC 1FDOA 2LKIA 1OW8A 1NTKE 1KMIZ 1NTZD 2Q1KA 2FVEA 2N50A 3CCJP 1VPCA 4YPCA 2ZYGA 2E76D 3SWKA 2MJZA 2QJKC 2KSEA 1PPJG 3MUDC 1T2KD 2YNYA 3DS4A 3H1HD 1QRJA 4BWNA 3FXDA 1GZLA 2KI7B 1EXIA 4D6TD 1RY3A 1NGMB 3H1JD 3L70J 1JJ2O 4OGQD 1FZEA 2EFJA 1VQ4P 4GIFA 4ZNCA 4QKOA 3WUUA 1VQPP 7CEIA 1NVOA 2ZYAA 3AEBC 3NMDA 1QGKB 1QX8A 1NAFA 1FOSF 2N6YA 1S72P 1SQQJ 1OMIA 5KJ7D 2H7HA 3EJEA 4I6MC 1JY2O 1VF5C 3V6IA 4HH2A 2FXPA 4EYYQ 4L76A 3V2NA 4RKUJ 4WY4D 2BASA 2KG6A 1GXHA 2IBZG 4H2XC 2KUBA 5EJDA 1UIXA 4U3FJ 3AECC 4O9BA 2B89A 1Z6MA 3RK2D 1T6AA 4UHPB 1K73Q 2PEJA 5GTIH 1AFOA 5KLVE 4XA4A 4R4MA 3WUVA 1EOQA 2XT1A 2PP6A 1NTZJ 3TSIA 1HGZA 3VMXA 1YJ9P 1JY3N 2R44A 2XU6A 1AF8A 1CZQA 2SPZA 2BCCJ 3H1HJ 2E74B 2KNCA 1W2EA 1JEKA 2OYIA 1CW5A 4D6TJ 2PEKA 4IL6E 2M3BA 3UIAA 3H1JJ 4HKZH 2K0DX 1PP9J 1L0LE 1TU3F 2Y9ZA 5AW1B 2J58A 2NPSD 1FC2C 3VMYA 2K9YA 4TLFA 3TGUE 2LIWA 4AUWA 1G1JA 2POHA 4K35A 2ZYDA 1SQQG 1A43A 1EDIA 1VDFA 1PGJA 2GZGA 3H47A 5AW6B 1H0TA 2QE7H 2K1AA 4KJMA 3HYBA 2A06E 3AEFC 3WMM0 1UNKA 1L0ND 2O01N 2QSIA 4LGDE 3KZIE 4IOIH 3P8MC 4IL6H 1PZQA 1VQKP 3HD7A 5K5GB 2QA4P 3WUTA 5AVVB 1A02F 4H2YC 5C39A 3P32A 4XFXA 4H0LC 1YITP 1X79B 2AXCA 1SQQK 5CCHC 3GHGB 2WPTA 2LOLA 2GDXA 3LMOA 1NTZG 3CPWO 1URQC 2JYGA 1JUNA 1EXJA 3CC4P 3F5HA 1HBWA 1PPJE 1BE3D 1XTGB 3BASA 3H1HG 1SQVD 4JF7A 1GL2C 5EFWB 1VF5D 3MGEA 2GZIA 3MHVA 2OARA 2PENA 2M0BA 3CWBD 4D6TG 4H13B 3KZIH 2BHVA 5KP7B 1HTLC 2QJYC 5AW0B 1ZRTE 3EWKA 3H1JG 2WSFJ 5HGMA 1M1JB 4C7RA 3EFFK 2DW3A 1QLED 3AEAC 2JU1A 1FZCA 2N1TA 4WYMA 3KDPB 3KPEA 1NTZK 4PD4D 4U7JA 1KILE 1LTJA 2BEQD 2KODA 2KR5A 3RL0C 3Q5SA 2FBWC 1USDA 3HZQA 2P1JA 2W8ZA 2K3RA 1DD3A 2CG5B 2IDBA 1EZVD 5CJ4A 2AVAA 3HTKA 1GW3A 4JYBA 2WZ7A 1HH0A 1SQPD 4YTPC 3VP8A 3L73J 1L0NJ 1BAJA 1NJIQ 3IN6A 3H6PA 2IBZE 1HWTC 1DH3A 1AYIA 2M8PA 5KLIB 1PGPA 3NFQA 2ZVNB 2K93A 5GTHE 1ZV8A 1PGQA 2QJPC 1J1EB 1P84I 5DJUB 2JR8A 5KLVD 3E2DA 1QL2A 1LTBC 4OGQB 5AW8B 1IK7A 1LWUA 3MIWA 2CPSA 1LT1A 2WSCJ 3CI9A 3NY7B 5L8RJ 1BE3J 1E79H 2I1KA 1ZN5A 1MFTA 4BPFA 1SQVJ 2FYNB 1ZW0A 1FJKA 2Q9IA 1N86A 4U0BA 2GDWA 3E7KA 1ZNVA 2FACA 3CWBJ 1GK6A 2W6JH 2KORA 2GUVA 2PGDA 4H0LD 1SFCA 2OTLP 1AVOA 1LGHB 1EQ7A 2FFDA 1FZAA 5GTHH 5CCHD 3L71D 2JP3A 1SQBD 2PEMA 2A45I 4M0IA 1OR5A 2CQ8A 3TGUD 1SQQE 1M7LA 1URQD 1KB9E 5CBOA 1JY2N 4U0AA 2N9YB 3ZDMA 3HUSA 2KOQA 5CCGD 3Q5PA 3RK2B 2VLOA 2R32A 2I8DA 1GL2D 4NPDA 3T97B 5AW3B 1AJYA 2O01J 5APWA 4NPFX 5E79H 3CX5D 1L0NG 2OQQA 1YYCA 2VLPA 2LL8A 2MD9A 2OYIC 1VQ6P 1UIIA 3AEGC 3RBXA 2JWAA 5AVSB 1GTWA 2QRXA 1RQVA 2MR8A 1L0HA 2K37A 3P05A 3RL0D 1NTZE 3QWOC 5B5EE 2KGDA 1KB9H 4XE5B 5CZDB 3VMZA 5KLVJ 2NRGA 1Z56A 1YQ3C 1BE3G 2NPSB 3B5NA 3O8ZA 1L0NK 2GUSA 1SQVG 1LT9B 3IF4A 2WQYC 1KFMA 2JO0A 2VRSA 5TJHA 3CWBG 3HE5B 2E5YA 3G9RA 1SLQA 4NEOA 1KYOD 4PV1C 3USSA 3H1JE 3HD7C 5HVCA 1N8RQ 3D6YA 3IAOA 2KGEA 3W68A 1QEXA 3EJBA 5B66E 2AFDA 2CPBA 5APXA 2FYUD 3L71J 1SQBJ 2MR7A 4HKGA 5B5EH 3TGUJ 2Y0DA 1YBKA 1SQVK 4XRQA 2J5UA 3H1ID 4YXWH 4RESB 1EZVG 3P8CE 2ZVOB 1RHZB 5HV8A 2Y0EA 1SQPG 2LF4A 4Y28J 2HPCB 2ZXEB 2KIKA 4MN4C 2IBZD 1VF5B 1FZCC 2MF4A 2N1TC 3AE3C 5B66H 3V4WA 3U1AA 3C9IA 1LTJC 2VSQA 2OYOA 5AVXB 2P2UA 5KLVG 3S4RA 4DOJA 2KG9A 2P9XA 3R4YA 1R5LA 1FZGA 4IZ6A 1GXGA 1X22A 3O6QA 4COCA 2KLUA 3CLQA 1SQPK 1FS0E 1E6JP 1SVFA 4GOEA 3CXHD 1PL5A 2V7QH 4DJGA 1RQUA 1KQSO 4DG9A 3FX0A 2BUOA 3CE7A 5KAFE 2Y0CA 3DS0A 1K30A 1N7SD 1NYHA 3L71G 1FJPA 4UB6E 1J2JB 5KLVK 1SQBG 2E42A 3IR9A 2EHTA 1U57A 3A5TA 2FYUJ 1WT6A 5AW5B 1LWUC 5TISE 1F80D 1FBMA 2FXOA 3A0BE 2JGPA 5KKZC 4HYTB 1SP4A 3CCUP 5APQA 1K8AQ 1J1DC 3H1IJ 3CCLP 3L74D 1L0NE 3G71P 1OZHA 2KZJA 4IL6X 2WSFH 4PV1D 5M1BA 1ACPA 3V2QA 2AXTH 1BXIA 5KAFH 1SQBK 1N73B 1SFCC 2N5IA 2FFDC 4UB6H 3M1MA 2PNGA 2WT7B 2R5DA 2ZT9C 1OVVA 1RE4A 2Z5HA 5TISH 3N7NA 3HUSC 3A0BH 1BE3E 2D2CC 2KYVA 3TNUB 1E0HA 3OJAB 1SQVE 3I56P 1PEMA 2IFNA 3CWBE 3F89A 1NOHA 1FZFA 1URQB 1M56D 2FQ0A 2XZ1C 4B86A 3CL3D 3L35A 2YXQB 4XROA 3A0HE 1W2BO 3G6EP 4GT1A 2YKPA 2KLVA 4Y99C 1FU1A 2FHSC 1PGOA 4PD4E 1GDTA 2KS1B 1RO0A 1EDJA 1L4AC 2FYUG 2WSCH 3S1KA 3A7OA 3AE8C 3H1IG 1EZVE 3B5NC 2L22A 1FZBA 4UB8E 3RL0B 3HE4B 1VQNP 1SQPE 3P8CD 3L36A 3W67A 3AE7C 3L74J 5HGOA 1S2EA 1VQ8P 4DCKA 1AA0A 1VL2A 2ZFCA 2KSJA 3A0HH 1VQ5P 2OYHB 1PEQA 2FYUK 3MGNA 4PD4H 3G28A 4GOFA 2FQ2A 1NU1D 4L75A 1GD2E 4N6JA 2W6AA 3G1GA 2YIUC 1G2CB 2O01H 2FXMA 1R5SA 4C46A 1M6EX 4BRYB 4PJ0E 2WITA 1LNQA 1KILB 1USEA 3H32A 1VQOP 1QVFO 3JCUE 1NAYA 2RH0A 3M9BA 3RK3C 5AW7B 2AF8A 5F2NA 2K0YA 4N3YB 3L71E 1SQBE 2P10A 2CK3H 3CCSP 4U0DA 1Q82Q 2IPPA 3I55P 4EIJA 1FDIA 3GHGA 2H89C 3RL0g 2D2CD
chains in the Genus database with same CATH topology
4IPYA 5I4TG 2JO0A 3CMAP 1YITP 2BUOA 2Z44A 3CCEP 3CXCO 4GR2A 3DS0A 1RO2A 1K30A 1Q81Q 1IUQA 4U0CA 1M6NA 3CPWO 1N8RQ 1YJNP 2JYGA 3RG6C 4XFYA 3WBHA 3G4SP 1K73Q 3CC4P 4U0BA 2PEJA 4PH0A 2PY8A 1VQNP 4PH1A 2M8NA 2PEIA 5DCKA 2DGYA 3VRLC 3DS1A 1K9MQ 1EOQA 5HGOA 3MGEA 1VQ8P 2XT1A 1YJWP 2OARA 2PENA 3CCUP 1K8AQ 1EIAA 2E1MA 1YI2P 1Q86Q 2CWOA 1PEOA 2PEQA 3CCLP 3CCRP 2BHVA 2OTLP 5BS2A 1YJ9P 4QNBA 3DS3A 3G71P 4U0FA 4GR6A 1ZMBA 1VQ7P 1VQ5P 4XRQA 5HGNA 2PEMA 1PEQA 2XV6A 5HGMA 3G0VA 3G28A 4M0IA 3CCJP 1D1DA 4WYMA 4U0AA 3DS4A 2PEKA 3DPHA 5F2KA 1QRJA 3G26A 3G1GA 5JPAA 3G1IA 1M90Q 2KODA 2LF4A 3OW2O 1VQ9P 3M1MA 1Q7YQ 3HZQA 1YIJP 4COPA 1YHQP 3CC2P 1RNIA 1VQMP 3CCQP 4XFZA 3CCMP 2JYLA 2M8LA 1JJ2O 3CD6P 1VQ6P 2OTJP 1AUMA 3H4EA 1M6EX 1KD1Q 2EFJA 1A8OA 1A43A 1VQ4P 1VQOP 1QVFO 2EG5A 4U0EA 3I56P 3H47A 3CC7P 1PEMA 2EIAA 3B5IA 3CCVP 1VQPP 1BAJA 2P9XA 1NJIQ 3CMEP 5F2NA 2BQ1E 5BS1A 3NTEA 3HYBA 2L6EA 3P05A 3DS2A 1QVGO 3G21A 4COCA 1M1KQ 4XROA 3DTJA 1S72P 3CCSP 2M8PA 3DS5A 2XXMA 3G29A 1E6JP 4U0DA 1W2BO 1Q82Q 5HGLA 3G6EP 2QEXP 3I55P 5F2OA 2ONTA 1PEUA 1VQKP 2PEOA 2QA4P 1M74A 3H0DA 1VQLP 3Q20A 1KC8Q 1KQSO 3LRYA 4XFXA 1RO0A 3E2DA 2Z45A 2Z46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA P;  3CCV P;  1VQP P;  1YIT P;  1YJW P;  1NJI Q;  3CME P;  1M90 Q;  3CCU P;  3CCE P;  3CXC O;  1K8A Q;  3OW2 O;  1VQ9 P;  1YI2 P;  1Q86 Q;  1Q7Y Q;  3CCL P;  2OTL P;  3CCR P;  1Q81 Q;  1YJ9 P;  1QVG O;  3G71 P;  1YIJ P;  1YHQ P;  1VQ7 P;  3CC2 P;  1M1K Q;  1VQM P;  1VQ5 P;  1S72 P;  3CCQ P;  3CCS P;  3CPW O;  3CCM P;  1W2B O;  1N8R Q;  1Q82 Q;  3G6E P;  1YJN P;  1JJ2 O;  3CD6 P;  2QEX P;  3CCJ P;  3I55 P;  1VQ6 P;  2OTJ P;  1KD1 Q;  3G4S P;  3CC4 P;  1K73 Q;  1VQK P;  1VQ4 P;  2QA4 P;  1VQO P;  1QVF O;  1VQN P;  1VQL P;  3I56 P;  1KC8 Q;  1KQS O;  1K9M Q;  3CC7 P;  1VQ8 P; 
#chains in the Genus database with same CATH topology
 2AFE A;  1NTM G;  1SQX D;  2C9N Y;  4R4L A;  3CX5 E;  1Q81 Q;  3L74 G;  1Y9B A;  4PJ0 H;  4H44 C;  1LTG C;  2WPV B;  3JCU H;  4EOT A;  3WBH A;  3G4S P;  3FWN A;  2V7Q J;  1M1J A;  1EIA A;  2QM8 A;  1RF1 B;  2JQ4 A;  1L4A D;  3SWF A;  1EC5 A;  2IZ0 A;  3DS3 A;  4PXH B;  4U0F A;  2AEM A;  4GR6 A;  2WPQ A;  1JTH B;  1NU1 J;  4IFM A;  3AE4 C;  3FXE A;  3AE5 C;  1N7S B;  3B5N D;  2Z4E A;  3DPH A;  5F2K A;  3CX5 H;  1JY3 P;  1KYO E;  2Z5I A;  1IMP A;  3M91 A;  4NPE A;  1RNI A;  2LIU A;  3H1K D;  1YTZ T;  4I2L C;  2YMY A;  1T8K A;  1IZN B;  1DD4 A;  1GW4 A;  2XV5 A;  4RO0 A;  3BCC G;  3OA7 A;  3TYY A;  1IFP A;  2FYU E;  2N5H A;  2B87 B;  1MZ8 A;  2EIA A;  1JM0 A;  2GZF A;  3P7K A;  2BQ1 E;  5BS1 A;  1X8Y A;  2FAD A;  4I7Z B;  1XTC C;  1RE4 C;  4ZMD A;  2P58 A;  3H1I E;  1KQG B;  2MKV A;  4JYC A;  2PEO A;  1KYO H;  1EMV A;  1KLP A;  3M9Q A;  3A2A A;  2E76 B;  3RK3 D;  3KHU A;  1RO2 A;  1OFC X;  4DZO A;  2KG8 A;  4I1L A;  3VP9 A;  2KZI A;  1YJN P;  2M5R A;  5KJ7 A;  2N9B A;  4C7N B;  1NU1 G;  2FKW B;  2OTK E;  3VRL C;  3DS1 A;  1ZR2 A;  3SSU A;  5AVT B;  3GZL A;  4OWF A;  1DX7 A;  3IFM A;  2K9J B;  3GF7 A;  2PRR A;  1VQ7 P;  3L4F A;  3CXH E;  3HRN A;  2C9L Y;  1DNY A;  5EW5 E;  5AW4 B;  4DT0 A;  2E74 C;  4W7Z A;  3Q3D A;  1KZU B;  3H1K J;  2LR2 A;  1NU1 K;  1HJB A;  1YHQ P;  3CCQ P;  2M8L A;  3TK1 A;  3AED C;  2LXC B;  4WY4 B;  1Q90 D;  2WSS H;  2W90 A;  1FAV A;  1NTM E;  1HY8 A;  1X0T A;  3B5I A;  3BVH A;  3GZM A;  2HYN A;  4WB4 A;  1SQX G;  1ZR4 A;  3L74 E;  3CXH H;  1IC2 A;  1JOC A;  2NPS A;  2KXP B;  3DS5 A;  3JC2 2;  2XXM A;  1LT9 A;  3U1C A;  4QMA A;  1KN7 A;  1KFN A;  2L9F A;  4M3L A;  1SQP J;  2NZ2 A;  3HE5 A;  5KP8 B;  1L2P A;  5APS A;  2Z45 A;  2Z46 A;  4IPY A;  2RN0 A;  1ZME C;  3KXD A;  1CEI A;  4Z1M H;  4ZKU A;  2P7J A;  1RE3 A;  3VOP A;  2JO1 A;  2K94 A;  3GHG C;  1SQX K;  3RG6 C;  3AEE C;  3G3Z A;  2W83 C;  3B4S A;  1GK4 A;  1CSB A;  1KB9 I;  1BGY D;  3D70 A;  1OW6 A;  1KOR A;  5AVW B;  2YO2 A;  3H1K G;  5H2F E;  2QJK B;  2E75 C;  3G0V A;  4H13 C;  1H89 A;  3BCC E;  2HPC A;  1AVY A;  1M1J C;  2YKO A;  3G26 A;  5JPA A;  3TDK A;  2Q7C A;  1M90 Q;  3OW2 O;  1SS1 A;  1JCC A;  1YIJ P;  3V4Q A;  2XDJ A;  2WWW A;  5APY A;  1CI6 B;  1JY2 P;  1L4A B;  2YMK A;  4IFF A;  1A8O A;  2GYK A;  4W80 A;  3VN0 A;  1ZXG A;  1BCC D;  1S9K D;  1P84 D;  1M57 D;  3AE6 C;  1JO5 A;  2E74 D;  3PRJ A;  3B8E B;  2G8Y A;  2M5A B;  3G29 A;  5HGL A;  3GMA A;  2KP8 A;  2ZXX A;  1IFD A;  2O3J A;  1NU1 E;  2WVR A;  2XND H;  1L0I A;  5KLI C;  1KC8 Q;  3MD0 A;  2RKL A;  2K88 A;  1J1E C;  4OGQ C;  1ZP0 C;  3VMA A;  5AVQ B;  1NKN A;  2PFX A;  2Y9Y A;  2YIU B;  2PY8 A;  1BSN A;  4PH1 A;  1MZ9 A;  3N4X A;  2FYN C;  3SFD C;  1YJW P;  3EJD A;  3V2R A;  2KOP A;  4TT3 H;  2HFE D;  5BS2 A;  4QNB A;  4WWI A;  5HGN A;  4A7P A;  1N73 A;  3VTP C;  1JMB A;  1S1C X;  3RG2 A;  2C0W A;  1U7M A;  2QIW A;  3QH9 A;  4GOD A;  2LKM A;  1HF9 A;  2WT7 A;  2K0X A;  1PFI A;  4JBZ A;  1SQX E;  1LP1 B;  1NTM D;  1VQ9 P;  3GJN A;  2AEJ A;  1BDC A;  3TNU A;  4COP A;  1HVV A;  1IK9 A;  3A3Y B;  1DV5 A;  2L0Q A;  1LTT C;  3H4E A;  1BCC J;  3HD7 D;  3PTZ A;  2E75 D;  4H13 D;  3EFG A;  2KOG A;  2Q6Q A;  1HGV A;  4KHX A;  5CCG A;  1T3J A;  3Q2Y A;  3CCV P;  2ITA A;  4OVN F;  5CBN A;  3C8V A;  2QG4 A;  4GKG A;  4L74 A;  4XFJ A;  1D1D A;  2KS1 A;  1DEE G;  5F2O A;  1OW7 A;  2HOD B;  1PEU A;  4H0L B;  1BGY G;  1OXZ A;  2JKV A;  1NQ4 A;  5I4T G;  3CMA P;  3NXS A;  2Z44 A;  3CCE P;  2NPS C;  4BPH A;  3CXC O;  1HJ0 A;  3L72 D;  1LT9 C;  3KQG A;  1NHL A;  1IUQ A;  3H1K E;  4U0C A;  3HE4 A;  1IO4 A;  2X2B A;  1X3O A;  3H25 A;  2JEE A;  2LTE A;  2CNR A;  2ROQ A;  1GL2 B;  3I5C A;  2LXB A;  1MV8 A;  1S4X A;  4JPZ B;  2N1T D;  2BCC D;  5DCK A;  2PEI A;  1K05 A;  3BCC D;  2QJY B;  2OYH A;  1X9V A;  1KTM A;  2K5X A;  2E1M A;  2GZJ A;  1YI2 P;  2CWO A;  1Q86 Q;  1PEO A;  1RE3 C;  2PEQ A;  3FWL A;  2KW2 A;  1ZMB A;  3PHL A;  1PP9 D;  1HQB A;  3ITK A;  1K04 A;  1NO4 A;  1G2C A;  3E1I A;  2BEZ F;  3GF3 A;  1NTM J;  2N98 A;  1FOS E;  1BCC G;  5GTI E;  2JJL A;  2WSE J;  3RK3 E;  1IFI A;  2R3C A;  4BRY A;  4HJG H;  1KIL A;  2MVV A;  1N2D C;  2JAZ A;  2CGQ A;  5APV A;  4XFZ A;  5AVR B;  3BRT B;  5KP6 B;  3CD6 P;  1S3J A;  1AUM A;  3RBZ A;  5AVU B;  3RGU A;  4IFD K;  2EG5 A;  2B88 A;  1KQL A;  4PD4 I;  3AE9 C;  3CC7 P;  4F37 A;  3L75 G;  1JCD A;  1D7M A;  2WPR A;  2WTY A;  2KOS A;  2YKQ A;  3DS2 A;  2QJP B;  4UB8 H;  2HR3 A;  1EZV I;  1OVR A;  2A45 G;  2J59 M;  2UWJ E;  1EDL A;  2Q5U A;  3L72 J;  4OH8 B;  4GR2 A;  1AQT A;  1SFC D;  4ASW A;  1JMM A;  2R5B A;  4YXD C;  3BCC J;  2JB0 A;  4XFY A;  3WU2 E;  2KGA A;  2ZT9 D;  1RF1 A;  3L70 G;  2OGU A;  2YXR B;  2M8N A;  2VLN A;  1OWA A;  5KAI E;  1JTH A;  1T8Z A;  3CCR P;  1N7S A;  2HG5 D;  3MTU E;  1M8O B;  1RF0 A;  3E1R A;  1S5L E;  3SFE C;  1KV4 A;  1H88 A;  4AYC A;  4KT0 J;  1DEB A;  2WMM A;  3G1I A;  2KNC B;  2H8P D;  3H32 B;  5APT A;  1ZOY C;  2W6B A;  1N73 C;  2OYI B;  3L73 D;  3CC2 P;  3WU2 H;  2B87 A;  4L73 A;  1QL1 A;  1Q2N A;  2JDI H;  4EDF A;  1NTM K;  2OTJ P;  1KD1 Q;  5KAI H;  2KWL A;  4U3F G;  1BGY E;  2ERH A;  2DNW A;  1U7J A;  2QM7 A;  3H1L D;  4ZKP A;  5CMZ A;  1IFM A;  1JB0 J;  3L72 G;  3CX5 I;  3GKL C;  1M1K Q;  1H0T B;  4LC1 A;  1S5L H;  1NTK D;  2VLQ A;  1YQ4 C;  5CCG C;  1IFN A;  2YO3 A;  3L37 A;  2BCC G;  3Q20 A;  2R3S A;  4PV1 B;  4EI2 A;  2Q3E A;  1PV3 A;  3HD7 B;  2ZJS E;  2E75 B;  4C7N A;  3B71 A;  4ASV A;  1GU5 A;  1PP9 G;  1IFJ A;  3BRV B;  2P67 A;  3KYQ A;  1GPJ A;  4GDO A;  1SQX J;  2KOO A;  2K9J A;  1BCC E;  1S9K E;  2DGY A;  1P84 E;  1PIX A;  3LW5 H;  1KYO I;  2EHS A;  3MP7 B;  2L5G B;  1W5C E;  2XV6 A;  5CHX A;  4K3A A;  1FE6 A;  4CPG A;  2IYO A;  2O1J A;  2C0X A;  2OYH C;  1MFZ A;  2GDY A;  2JBG A;  2ZAE B;  1HUC A;  3L75 E;  1G1I A;  4WY4 A;  1FZC B;  1BDD A;  2N1T B;  3EQ2 A;  2GZE A;  2XZ0 D;  2L4B A;  1LTJ B;  2QNW A;  3H1L J;  1OVU A;  1P84 H;  4H44 D;  1E5W A;  3FGA D;  2IZ1 A;  3TF5 A;  3T97 A;  3V2P A;  3GLM A;  2FY8 A;  3M0D A;  4U0E A;  3BAT A;  4BXL A;  3R2P A;  1KIL C;  3CME P;  5KTB A;  2M3E A;  2V4H A;  3S9O A;  1NTK J;  3HTK B;  1QVG O;  3G21 A;  2IBZ I;  5E79 E;  2QEX P;  4N78 E;  1ZLL A;  3L70 E;  1AV1 A;  3JSV C;  2GA1 A;  1Y8A A;  2GM4 A;  2B9B A;  1FR2 A;  2MVU A;  2A45 H;  2O1K A;  2W27 A;  2QVA A;  1L0L D;  1M6N A;  2I1J A;  1LWU B;  3CXH I;  1GU4 A;  3LID A;  2JU2 A;  2XZR A;  5KKZ B;  1OIP A;  1J1D B;  3II6 A;  3AE1 C;  3MUD A;  2H88 C;  2IFM A;  2N6Z A;  5BU5 A;  3L73 G;  3MZW B;  2A06 D;  2IYP A;  1OX3 A;  2Q3I A;  1RF1 C;  3OAK A;  4U3F E;  1SFC B;  3SWY A;  3ABV C;  3NTN A;  2FFD B;  2M8R A;  2AEF A;  3H1L G;  2L91 A;  1N7S C;  2WSE H;  4MRT C;  1DIP A;  3L72 E;  4H2W C;  1VKU A;  1CI6 A;  2ZT9 B;  1L4A A;  1IJD B;  4CA3 A;  2HLO A;  3HUS B;  1RF0 C;  2D2C B;  1LTS C;  1WRG A;  3CCM P;  5AVZ B;  1NTK G;  1KQF B;  2G3A A;  2PAJ A;  2BCC E;  3H1H E;  1N7L A;  1PPJ D;  2M5A A;  4D6T E;  3U43 A;  5BVZ A;  3NTE A;  1JY3 O;  2L6E A;  4Y99 B;  4R0M A;  1PP9 E;  3GW6 A;  5CJ0 A;  5AW2 B;  2E5T A;  1ZRT D;  1FDM A;  4I7Z C;  4AQR D;  2KB7 P;  3D6Z A;  2FVA A;  1VHN A;  3M06 A;  1M74 A;  3LRY A;  1L0L J;  1NTK K;  1YTZ I;  4WBA A;  5BU8 B;  4BPG A;  1KIL D;  3B5N B;  1EDK A;  5H2F H;  1GMJ A;  3V5B A;  4RJT A;  1AQ5 A;  2E76 C;  1T2K C;  2XNX A;  2XKM A;  3AE2 C;  3L75 D;  1A02 J;  3GG2 A;  1MKM A;  2FAE A;  3PJS K;  1BGY J;  2FVF A;  4WVZ A;  3D71 A;  1LP1 A;  1R8E A;  1NWQ A;  3U59 A;  1MUU A;  2KGC A;  2E43 A;  3LW5 J;  1T3U A;  1Q7Y Q;  3M9H A;  2RMZ A;  5KJ7 C;  1VQM P;  1BSH A;  2JYL A;  3RK3 B;  2FQ1 A;  2AXT E;  3C1L A;  1NH4 A;  3M0A A;  4N78 D;  3L70 D;  3B4Q A;  4WY4 C;  2HOD A;  1L0L G;  2FYZ A;  4W7Y A;  3DTJ A;  2LPK A;  3RK2 C;  5CCH A;  1NKZ B;  3LIE A;  3TGU G;  3M0D C;  2ONT A;  1RH5 B;  3PH0 A;  4PWV B;  5DJT B;  3VYI A;  3O6Q B;  1SQQ D;  1URQ A;  2JWD A;  3K5B A;  3H0D A;  1VQL P;  5APU A;  1KB9 D;  2MY5 A;  1JNM A;  4H44 B;  2LML A;  3PP5 A;  2K2Q A;  2K92 A;  3L73 E;  1GL2 A;  1H8A A;  1LTA C;  5AVY B;  2A06 G;  1WMK A;  3Q1M A;  2IX7 C;  4LLH A;  4HB1 A;  4PH0 A;  3PLN A;  4U3F D;  1L0L K;  3H1L E;  3L75 J;  2WPS A;  3Q5R A;  1K9M Q;  2NO8 A;  1UJZ A;  1LJ2 A;  1Y47 A;  5AW9 B;  4JQ0 D;  1S5L X;  1IMQ A;  2KK7 A;  2H43 A;  1LTI C;  1FDO A;  2LKI A;  1OW8 A;  1NTK E;  1KMI Z;  1NTZ D;  2Q1K A;  2FVE A;  2N50 A;  3CCJ P;  1VPC A;  4YPC A;  2ZYG A;  2E76 D;  3SWK A;  2MJZ A;  2QJK C;  2KSE A;  1PPJ G;  3MUD C;  1T2K D;  2YNY A;  3DS4 A;  3H1H D;  1QRJ A;  4BWN A;  3FXD A;  1GZL A;  2KI7 B;  1EXI A;  4D6T D;  1RY3 A;  1NGM B;  3H1J D;  3L70 J;  1JJ2 O;  4OGQ D;  1FZE A;  2EFJ A;  1VQ4 P;  4GIF A;  4ZNC A;  4QKO A;  3WUU A;  1VQP P;  7CEI A;  1NVO A;  2ZYA A;  3AEB C;  3NMD A;  1QGK B;  1QX8 A;  1NAF A;  1FOS F;  2N6Y A;  1S72 P;  1SQQ J;  1OMI A;  5KJ7 D;  2H7H A;  3EJE A;  4I6M C;  1JY2 O;  1VF5 C;  3V6I A;  4HH2 A;  2FXP A;  4EYY Q;  4L76 A;  3V2N A;  4RKU J;  4WY4 D;  2BAS A;  2KG6 A;  1GXH A;  2IBZ G;  4H2X C;  2KUB A;  5EJD A;  1UIX A;  4U3F J;  3AEC C;  4O9B A;  2B89 A;  1Z6M A;  3RK2 D;  1T6A A;  4UHP B;  1K73 Q;  2PEJ A;  5GTI H;  1AFO A;  5KLV E;  4XA4 A;  4R4M A;  3WUV A;  1EOQ A;  2XT1 A;  2PP6 A;  1NTZ J;  3TSI A;  1HGZ A;  3VMX A;  1YJ9 P;  1JY3 N;  2R44 A;  2XU6 A;  1AF8 A;  1CZQ A;  2SPZ A;  2BCC J;  3H1H J;  2E74 B;  2KNC A;  1W2E A;  1JEK A;  2OYI A;  1CW5 A;  4D6T J;  2PEK A;  4IL6 E;  2M3B A;  3UIA A;  3H1J J;  4HKZ H;  2K0D X;  1PP9 J;  1L0L E;  1TU3 F;  2Y9Z A;  5AW1 B;  2J58 A;  2NPS D;  1FC2 C;  3VMY A;  2K9Y A;  4TLF A;  3TGU E;  2LIW A;  4AUW A;  1G1J A;  2POH A;  4K35 A;  2ZYD A;  1SQQ G;  1A43 A;  1EDI A;  1VDF A;  1PGJ A;  2GZG A;  3H47 A;  5AW6 B;  1H0T A;  2QE7 H;  2K1A A;  4KJM A;  3HYB A;  2A06 E;  3AEF C;  3WMM 0;  1UNK A;  1L0N D;  2O01 N;  2QSI A;  4LGD E;  3KZI E;  4IOI H;  3P8M C;  4IL6 H;  1PZQ A;  1VQK P;  3HD7 A;  5K5G B;  2QA4 P;  3WUT A;  5AVV B;  1A02 F;  4H2Y C;  5C39 A;  3P32 A;  4XFX A;  4H0L C;  1YIT P;  1X79 B;  2AXC A;  1SQQ K;  5CCH C;  3GHG B;  2WPT A;  2LOL A;  2GDX A;  3LMO A;  1NTZ G;  3CPW O;  1URQ C;  2JYG A;  1JUN A;  1EXJ A;  3CC4 P;  3F5H A;  1HBW A;  1PPJ E;  1BE3 D;  1XTG B;  3BAS A;  3H1H G;  1SQV D;  4JF7 A;  1GL2 C;  5EFW B;  1VF5 D;  3MGE A;  2GZI A;  3MHV A;  2OAR A;  2PEN A;  2M0B A;  3CWB D;  4D6T G;  4H13 B;  3KZI H;  2BHV A;  5KP7 B;  1HTL C;  2QJY C;  5AW0 B;  1ZRT E;  3EWK A;  3H1J G;  2WSF J;  5HGM A;  1M1J B;  4C7R A;  3EFF K;  2DW3 A;  1QLE D;  3AEA C;  2JU1 A;  1FZC A;  2N1T A;  4WYM A;  3KDP B;  3KPE A;  1NTZ K;  4PD4 D;  4U7J A;  1KIL E;  1LTJ A;  2BEQ D;  2KOD A;  2KR5 A;  3RL0 C;  3Q5S A;  2FBW C;  1USD A;  3HZQ A;  2P1J A;  2W8Z A;  2K3R A;  1DD3 A;  2CG5 B;  2IDB A;  1EZV D;  5CJ4 A;  2AVA A;  3HTK A;  1GW3 A;  4JYB A;  2WZ7 A;  1HH0 A;  1SQP D;  4YTP C;  3VP8 A;  3L73 J;  1L0N J;  1BAJ A;  1NJI Q;  3IN6 A;  3H6P A;  2IBZ E;  1HWT C;  1DH3 A;  1AYI A;  2M8P A;  5KLI B;  1PGP A;  3NFQ A;  2ZVN B;  2K93 A;  5GTH E;  1ZV8 A;  1PGQ A;  2QJP C;  1J1E B;  1P84 I;  5DJU B;  2JR8 A;  5KLV D;  3E2D A;  1QL2 A;  1LTB C;  4OGQ B;  5AW8 B;  1IK7 A;  1LWU A;  3MIW A;  2CPS A;  1LT1 A;  2WSC J;  3CI9 A;  3NY7 B;  5L8R J;  1BE3 J;  1E79 H;  2I1K A;  1ZN5 A;  1MFT A;  4BPF A;  1SQV J;  2FYN B;  1ZW0 A;  1FJK A;  2Q9I A;  1N86 A;  4U0B A;  2GDW A;  3E7K A;  1ZNV A;  2FAC A;  3CWB J;  1GK6 A;  2W6J H;  2KOR A;  2GUV A;  2PGD A;  4H0L D;  1SFC A;  2OTL P;  1AVO A;  1LGH B;  1EQ7 A;  2FFD A;  1FZA A;  5GTH H;  5CCH D;  3L71 D;  2JP3 A;  1SQB D;  2PEM A;  2A45 I;  4M0I A;  1OR5 A;  2CQ8 A;  3TGU D;  1SQQ E;  1M7L A;  1URQ D;  1KB9 E;  5CBO A;  1JY2 N;  4U0A A;  2N9Y B;  3ZDM A;  3HUS A;  2KOQ A;  5CCG D;  3Q5P A;  3RK2 B;  2VLO A;  2R32 A;  2I8D A;  1GL2 D;  4NPD A;  3T97 B;  5AW3 B;  1AJY A;  2O01 J;  5APW A;  4NPF X;  5E79 H;  3CX5 D;  1L0N G;  2OQQ A;  1YYC A;  2VLP A;  2LL8 A;  2MD9 A;  2OYI C;  1VQ6 P;  1UII A;  3AEG C;  3RBX A;  2JWA A;  5AVS B;  1GTW A;  2QRX A;  1RQV A;  2MR8 A;  1L0H A;  2K37 A;  3P05 A;  3RL0 D;  1NTZ E;  3QWO C;  5B5E E;  2KGD A;  1KB9 H;  4XE5 B;  5CZD B;  3VMZ A;  5KLV J;  2NRG A;  1Z56 A;  1YQ3 C;  1BE3 G;  2NPS B;  3B5N A;  3O8Z A;  1L0N K;  2GUS A;  1SQV G;  1LT9 B;  3IF4 A;  2WQY C;  1KFM A;  2JO0 A;  2VRS A;  5TJH A;  3CWB G;  3HE5 B;  2E5Y A;  3G9R A;  1SLQ A;  4NEO A;  1KYO D;  4PV1 C;  3USS A;  3H1J E;  3HD7 C;  5HVC A;  1N8R Q;  3D6Y A;  3IAO A;  2KGE A;  3W68 A;  1QEX A;  3EJB A;  5B66 E;  2AFD A;  2CPB A;  5APX A;  2FYU D;  3L71 J;  1SQB J;  2MR7 A;  4HKG A;  5B5E H;  3TGU J;  2Y0D A;  1YBK A;  1SQV K;  4XRQ A;  2J5U A;  3H1I D;  4YXW H;  4RES B;  1EZV G;  3P8C E;  2ZVO B;  1RHZ B;  5HV8 A;  2Y0E A;  1SQP G;  2LF4 A;  4Y28 J;  2HPC B;  2ZXE B;  2KIK A;  4MN4 C;  2IBZ D;  1VF5 B;  1FZC C;  2MF4 A;  2N1T C;  3AE3 C;  5B66 H;  3V4W A;  3U1A A;  3C9I A;  1LTJ C;  2VSQ A;  2OYO A;  5AVX B;  2P2U A;  5KLV G;  3S4R A;  4DOJ A;  2KG9 A;  2P9X A;  3R4Y A;  1R5L A;  1FZG A;  4IZ6 A;  1GXG A;  1X22 A;  3O6Q A;  4COC A;  2KLU A;  3CLQ A;  1SQP K;  1FS0 E;  1E6J P;  1SVF A;  4GOE A;  3CXH D;  1PL5 A;  2V7Q H;  4DJG A;  1RQU A;  1KQS O;  4DG9 A;  3FX0 A;  2BUO A;  3CE7 A;  5KAF E;  2Y0C A;  3DS0 A;  1K30 A;  1N7S D;  1NYH A;  3L71 G;  1FJP A;  4UB6 E;  1J2J B;  5KLV K;  1SQB G;  2E42 A;  3IR9 A;  2EHT A;  1U57 A;  3A5T A;  2FYU J;  1WT6 A;  5AW5 B;  1LWU C;  5TIS E;  1F80 D;  1FBM A;  2FXO A;  3A0B E;  2JGP A;  5KKZ C;  4HYT B;  1SP4 A;  3CCU P;  5APQ A;  1K8A Q;  1J1D C;  3H1I J;  3CCL P;  3L74 D;  1L0N E;  3G71 P;  1OZH A;  2KZJ A;  4IL6 X;  2WSF H;  4PV1 D;  5M1B A;  1ACP A;  3V2Q A;  2AXT H;  1BXI A;  5KAF H;  1SQB K;  1N73 B;  1SFC C;  2N5I A;  2FFD C;  4UB6 H;  3M1M A;  2PNG A;  2WT7 B;  2R5D A;  2ZT9 C;  1OVV A;  1RE4 A;  2Z5H A;  5TIS H;  3N7N A;  3HUS C;  3A0B H;  1BE3 E;  2D2C C;  2KYV A;  3TNU B;  1E0H A;  3OJA B;  1SQV E;  3I56 P;  1PEM A;  2IFN A;  3CWB E;  3F89 A;  1NOH A;  1FZF A;  1URQ B;  1M56 D;  2FQ0 A;  2XZ1 C;  4B86 A;  3CL3 D;  3L35 A;  2YXQ B;  4XRO A;  3A0H E;  1W2B O;  3G6E P;  4GT1 A;  2YKP A;  2KLV A;  4Y99 C;  1FU1 A;  2FHS C;  1PGO A;  4PD4 E;  1GDT A;  2KS1 B;  1RO0 A;  1EDJ A;  1L4A C;  2FYU G;  2WSC H;  3S1K A;  3A7O A;  3AE8 C;  3H1I G;  1EZV E;  3B5N C;  2L22 A;  1FZB A;  4UB8 E;  3RL0 B;  3HE4 B;  1VQN P;  1SQP E;  3P8C D;  3L36 A;  3W67 A;  3AE7 C;  3L74 J;  5HGO A;  1S2E A;  1VQ8 P;  4DCK A;  1AA0 A;  1VL2 A;  2ZFC A;  2KSJ A;  3A0H H;  1VQ5 P;  2OYH B;  1PEQ A;  2FYU K;  3MGN A;  4PD4 H;  3G28 A;  4GOF A;  2FQ2 A;  1NU1 D;  4L75 A;  1GD2 E;  4N6J A;  2W6A A;  3G1G A;  2YIU C;  1G2C B;  2O01 H;  2FXM A;  1R5S A;  4C46 A;  1M6E X;  4BRY B;  4PJ0 E;  2WIT A;  1LNQ A;  1KIL B;  1USE A;  3H32 A;  1VQO P;  1QVF O;  3JCU E;  1NAY A;  2RH0 A;  3M9B A;  3RK3 C;  5AW7 B;  2AF8 A;  5F2N A;  2K0Y A;  4N3Y B;  3L71 E;  1SQB E;  2P10 A;  2CK3 H;  3CCS P;  4U0D A;  1Q82 Q;  2IPP A;  3I55 P;  4EIJ A;  1FDI A;  3GHG A;  2H89 C;  3RL0 g;  2D2C D; 
#chains in the Genus database with same CATH homology
 4IPY A;  5I4T G;  2JO0 A;  3CMA P;  1YIT P;  2BUO A;  2Z44 A;  3CCE P;  3CXC O;  4GR2 A;  3DS0 A;  1RO2 A;  1K30 A;  1Q81 Q;  1IUQ A;  4U0C A;  1M6N A;  3CPW O;  1N8R Q;  1YJN P;  2JYG A;  3RG6 C;  4XFY A;  3WBH A;  3G4S P;  1K73 Q;  3CC4 P;  4U0B A;  2PEJ A;  4PH0 A;  2PY8 A;  1VQN P;  4PH1 A;  2M8N A;  2PEI A;  5DCK A;  2DGY A;  3VRL C;  3DS1 A;  1K9M Q;  1EOQ A;  5HGO A;  3MGE A;  1VQ8 P;  2XT1 A;  1YJW P;  2OAR A;  2PEN A;  3CCU P;  1K8A Q;  1EIA A;  2E1M A;  1YI2 P;  1Q86 Q;  2CWO A;  1PEO A;  2PEQ A;  3CCL P;  3CCR P;  2BHV A;  2OTL P;  5BS2 A;  1YJ9 P;  4QNB A;  3DS3 A;  3G71 P;  4U0F A;  4GR6 A;  1ZMB A;  1VQ7 P;  1VQ5 P;  4XRQ A;  5HGN A;  2PEM A;  1PEQ A;  2XV6 A;  5HGM A;  3G0V A;  3G28 A;  4M0I A;  3CCJ P;  1D1D A;  4WYM A;  4U0A A;  3DS4 A;  2PEK A;  3DPH A;  5F2K A;  1QRJ A;  3G26 A;  3G1G A;  5JPA A;  3G1I A;  1M90 Q;  2KOD A;  2LF4 A;  3OW2 O;  1VQ9 P;  3M1M A;  1Q7Y Q;  3HZQ A;  1YIJ P;  4COP A;  1YHQ P;  3CC2 P;  1RNI A;  1VQM P;  3CCQ P;  4XFZ A;  3CCM P;  2JYL A;  2M8L A;  1JJ2 O;  3CD6 P;  1VQ6 P;  2OTJ P;  1AUM A;  3H4E A;  1M6E X;  1KD1 Q;  2EFJ A;  1A8O A;  1A43 A;  1VQ4 P;  1VQO P;  1QVF O;  2EG5 A;  4U0E A;  3I56 P;  3H47 A;  3CC7 P;  1PEM A;  2EIA A;  3B5I A;  3CCV P;  1VQP P;  1BAJ A;  2P9X A;  1NJI Q;  3CME P;  5F2N A;  2BQ1 E;  5BS1 A;  3NTE A;  3HYB A;  2L6E A;  3P05 A;  3DS2 A;  1QVG O;  3G21 A;  4COC A;  1M1K Q;  4XRO A;  3DTJ A;  1S72 P;  3CCS P;  2M8P A;  3DS5 A;  2XXM A;  3G29 A;  1E6J P;  4U0D A;  1W2B O;  1Q82 Q;  5HGL A;  3G6E P;  2QEX P;  3I55 P;  5F2O A;  2ONT A;  1PEU A;  1VQK P;  2PEO A;  2QA4 P;  1M74 A;  3H0D A;  1VQL P;  3Q20 A;  1KC8 Q;  1KQS O;  3LRY A;  4XFX A;  1RO0 A;  3E2D A;  2Z45 A;  2Z46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...