1YI2P

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yi2P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yi2P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yi2P02
3CCMP 3G71P 1VQ7P 1QVGO 3CMAP 3CMEP 1NJIQ 1M90Q 1Q86Q 1YITP 3CCQP 1VQ6P 1VQNP 1YHQP 2OTLP 3I55P 1VQMP 2QA4P 3G4SP 3CXCO 1YI2P 1Q82Q 3OW2O 2QEXP 1VQOP 3CC7P 1W2BO 1K9MQ 1VQ9P 3CCEP 1YIJP 3CCUP 3I56P 1YJ9P 1VQ4P 1K73Q 1QVFO 1YJWP 1K8AQ 1Q7YQ 1VQ8P 1YJNP 1VQPP 1Q81Q 3CCJP 1VQLP 3CC4P 1VQ5P 3CC2P 3CCRP 3G6EP 1KC8Q 3CD6P 2OTJP 1N8RQ 1JJ2O 3CCLP 1KQSO 1VQKP 1S72P 3CPWO 3CCVP 3CCSP 1M1KQ 1KD1Q
chains in the Genus database with same CATH superfamily
3T97A 2M0BA 3GHGC 1JY2O 2LMLA 1Z6MA 1YITP 3RBXA 3SSUA 1PGQA 1D1DA 1NTMJ 1U57A 1IJDB 3EWKA 2YIUC 3JSVC 2M8NA 2EG5A 3LMOA 3OJAB 2NRGA 4C46A 1BE3E 2K2QA 3L75J 2M3BA 1URQC 1SQPD 2BHVA 1EDKA 1J2JB 5KLIC 4L74A 5HGMA 2NPSA 2QSIA 2YKPA 2A06D 1Q81Q 3P32A 5GTIE 3RL0C 4XROA 2PEIA 1S4XA 2K0YA 3M0DC 3V4WA 2RN0A 2JO0A 3H1JD 2Q3EA 5AVXB 2VLQA 1VQOP 3M9QA 3K5BA 3CCUP 3FX0A 1CW5A 1L0LG 1KN7A 3KZIH 2GDYA 3P8CE 1OVRA 2J58A 3CXHE 1RHZB 1HJBA 1RE4C 1OFCX 1PP9E 3GLMA 3II6A 3DS1A 1GTWA 4H2YC 2OYHC 2W6JH 3FWLA 3HZQA 2FYUD 3FWNA 1PFIA 3L70D 3MIWA 1NTKG 1W2BO 4BPHA 1KILD 2Y9ZA 2KG9A 1RQUA 1YJWP 3H1HD 3H1LJ 2QVAA 4OH8B 4R0MA 2IPPA 2FFDA 3DPHA 4WY4D 1NTZG 4K3AA 1KMIZ 1N86A 1SQQK 5KLVK 1AVOA 2MVUA 4GOEA 3L74G 2E75D 5B5EH 2KYVA 2IYOA 1NU1K 1KFNA 3MUDA 1ACPA 1QL1A 3RK3D 1K73Q 3GZLA 2R32A 2YMKA 1T6AA 1G1IA 3BRVB 1NTMG 2K5XA 2VLOA 3GJNA 1SQBK 3BATA 4IZ6A 3AEBC 3HD7D 3HUSA 4JYBA 2JO1A 2FQ2A 1HY8A 1KILC 1QVFO 3D6YA 4WY4C 2JQ4A 2FYZA 2JU2A 3AEAC 4UHPB 1LP1B 2PFXA 2YXRB 2OTLP 1ZNVA 2Y9YA 2E75C 4JYCA 3EJBA 2FBWC 4U0DA 1LNQA 2V7QJ 3RK3C 3EJDA 3BCCJ 3RK2B 1S5LX 2M8LA 2ITAA 3NXSA 4L73A 2PEOA 5KP6B 2ERHA 4DG9A 1LTAC 4Y28J 2C9LY 2E76D 3G3ZA 3HD7C 3VN0A 1J1DB 2FVAA 1GW4A 1L0LE 3WU2E 1IFIA 2B87A 1FZFA 2Z44A 3OA7A 3DTJA 2XT1A 3CXCO 1LTBC 1N73C 4LLHA 3L72D 1DD4A 2AVAA 1S3JA 2W27A 1M7LA 1IFMA 2FVEA 2AXTH 2RH0A 3L73D 1G2CA 1A8OA 1SQXE 4TLFA 1KQLA 4PXHB 2L22A 4EI2A 4N3YB 3SWYA 2Z46A 1S5LE 1JY3O 2E43A 2PAJA 1YTZI 2HLOA 1FZGA 3A3YB 5AVSB 2IZ1A 4QNBA 3E1IA 2WT7B 1P84H 3AE4C 3HE5A 3W67A 2EHSA 1NTKE 2WPSA 1KYOD 1GK4A 2E76C 4D6TD 4W80A 3O6QB 4DJGA 2AF8A 1DH3A 4XE5B 1NTZE 3BASA 2MR7A 3P7KA 2AFDA 1JTHA 4YPCA 4AYCA 1IO4A 3CL3D 3L4FA 1QEXA 2WPQA 3L74E 1DEEG 2JB0A 3JCUE 3B5NA 4EIJA 4N6JA 3B8EB 3CCVP 4XRQA 3GMAA 4WVZA 1IMPA 1JM0A 1NTME 3GHGB 2L9FA 5CCHA 2KLVA 3KPEA 1OIPA 3VOPA 3CCEP 2B88A 3S9OA 1S9KD 3AE7C 5KAFH 5CBNA 1KFMA 1ZRTE 2WITA 2YIUB 3DS5A 2KG6A 2KNCA 3L75E 2BEQD 3C9IA 4KHXA 2M5RA 3M9BA 4HB1A 1CI6A 1SFCD 2MY5A 5BS2A 1OMIA 1CZQA 1URQB 3ABVC 4LC1A 4M3LA 2LKMA 1GDTA 3VTPC 1JY3P 2J59M 4JPZB 1FS0E 4WWIA 3HE4B 1E0HA 1KB9H 2AEMA 1AYIA 4U0FA 5CHXA 3BCCG 1AUMA 1DV5A 1BAJA 1JCDA 1FOSE 1EDJA 2BQ1E 1S72P 1WMKA 4ASWA 1J1EC 3LIDA 2QA4P 4BPFA 1XTCC 1QGKB 2FADA 1HGVA 2FHSC 1IUQA 1LTGC 3H1IJ 5B66E 2FYUJ 2FXMA 3RG2A 2ZVOB 5KJ7D 2PGDA 4PD4H 2LIUA 5CMZA 2N6YA 2HODA 1PEUA 1SFCC 2SPZA 1RNIA 5AW4B 1BCCD 2JKVA 1VHNA 4ZKUA 1Q86Q 1KV4A 3KXDA 2N1TA 2P7JA 2KODA 1JUNA 3H1KJ 1M56D 4YTPC 4NPFX 3RGUA 2W90A 1KB9I 1N7SD 2LL8A 2OYHB 1MZ9A 2ZFCA 4I6MC 1ZR2A 3H1LE 1LTTC 1RF1A 1YIJP 1GXHA 2WPTA 3IN6A 5EW5E 1Y8AA 1JY3N 1L0LK 1LTJC 4WBAA 3LIEA 2KOSA 5KJ7C 5GTIH 5CJ0A 2GZGA 3SWKA 1WT6A 1JCCA 2ZT9D 2ZVNB 2IBZI 2WVRA 4PD4I 1VL2A 2N98A 1R8EA 4DT0A 1LWUA 1SQXK 1VQPP 1M1JC 1SVFA 4OWFA 1ZMEC 4UB6E 5E79E 4H13B 4W7YA 1N7SC 2KI7B 1JB0J 2JYGA 1VQMP 1NTKK 2AFEA 1DNYA 1PGPA 3CXHH 2KGAA 1IMQA 1KILB 1L0HA 3V5BA 2FYNB 1BSNA 2O1KA 2KGEA 1NTZK 3L71D 4WY4B 4N78E 2WWWA 3G26A 1NH4A 1P84D 3MGNA 2PEJA 4U3FJ 4WB4A 2LF4A 5BVZA 2ZT9C 1DX7A 3TGUD 1NAYA 3BCCE 1WRGA 2E75B 1K8AQ 1L0ND 1FZBA 2CWOA 4QMAA 3RK3B 2GZJA 1KLPA 1OVUA 1NTMK 3SFEC 3EQ2A 2R5DA 1RQVA 2WSEH 3L37A 3H1IG 2HPCB 1FZCC 3HTKB 3Q20A 2WSFH 3G71P 1PP9G 5F2OA 1VF5D 1M90Q 3I55P 3H0DA 1FBMA 5HV8A 1CSBA 1N73B 3WMM0 2O01J 1X79B 3CXHI 2PP6A 3M06A 4R4LA 5KLVD 3H1KG 3AEDC 1H8AA 4PV1D 4DOJA 2QJYC 1GXGA 2LXCB 2WSCJ 2YO3A 1M57D 2OQQA 1E6JP 1L2PA 2EFJA 1K30A 2XV5A 2W8ZA 1SQBD 3A2AA 1RO2A 1FE6A 4U0CA 1KB9D 1M74A 3IFMA 5HGLA 1NJIQ 1VF5C 3A0BE 3WUUA 2E76B 4KT0J 3TF5A 2XDJA 4O9BA 2M8PA 1SQPE 1EOQA 1VQ8P 1AV1A 1PL5A 2KZIA 2A06E 2ZYAA 3B4SA 1KQGB 2IBZD 3B4QA 2H88C 3CCMP 4PD4D 2Q5UA 1YBKA 3VMYA 4PV1C 3MZWB 3WUTA 1CEIA 2QE7H 2Y0CA 4GKGA 1RF1C 3WU2H 1LGHB 2M3EA 5C39A 5APYA 4BRYB 3TSIA 1GL2A 1PIXA 2OYOA 4OGQB 3CMAP 4U3FG 4L76A 2G3AA 5H2FE 1LT9B 2KB7P 2ONTA 4IL6X 3Q5RA 2BCCD 2OYIC 2OTKE 3TNUA 1LWUC 4KJMA 3KDPB 1BCCJ 1QX8A 4GIFA 3RBZA 2H8PD 3Q5PA 1L4AA 5CCGD 2LKIA 3GKLC 2O3JA 2EHTA 1YHQP 1ZV8A 1J1EB 3PLNA 3H1IE 2FYUE 2IDBA 3P05A 1SQXG 1IFJA 2Z5IA 3H32A 3U1AA 3H1HE 1OZHA 1TU3F 1AQ5A 1USDA 2PNGA 2KS1B 4YXWH 3CC2P 3JCUH 4IL6E 1SFCB 2RMZA 2V4HA 1EZVG 4OVNF 2CQ8A 1Y47A 4JBZA 1OX3A 3H1KE 5DJTB 2R5BA 3CXHD 1JOCA 3RK3E 5CCGC 1VQKP 2P58A 1ZXGA 3VMZA 2WMMA 2QIWA 1GZLA 2N5IA 4XFJA 2Z45A 3NTNA 1T8ZA 3H6PA 5APUA 3CCJP 3NFQA 2JAZA 2XU6A 3CCRP 4H2XC 2GA1A 1A43A 1LTJB 2WSSH 2N9BA 2QM8A 4COCA 5AVVB 1IK7A 1PGJA 5AVWB 4UB8E 3QH9A 2GZEA 2GUVA 2C0WA 3L75G 1DIPA 1PPJG 1FAVA 2OARA 2NPSD 1Q7YQ 2M5AB 3EFGA 2O1JA 2PRRA 1M1JB 3DS2A 4GDOA 1JEKA 1KQSO 1H88A 5B66H 2GUSA 3CCSP 1SP4A 3WUVA 1RF0A 1L0NJ 1VDFA 4ZKPA 3HYBA 1N7SB 4B86A 3VRLC 2XZRA 3AE3C 1R5LA 5DJUB 1SS1A 2L5GB 1G1JA 3CC4P 2NO8A 2L0QA 4U3FE 5APTA 1NAFA 3E1RA 3L72E 5KP7B 1RY3A 1YYCA 1BCCG 3NY7B 2JWAA 2BUOA 3ITKA 2ZT9B 2IFNA 4ZNCA 1DEBA 5KKZB 2MF4A 2NPSC 2JR8A 2C0XA 1VQLP 3VMXA 4HKGA 4U7JA 2VLNA 2XXMA 2WTYA 1HJ0A 1FZCB 4GODA 1VQNP 1KYOE 2QNWA 1PEOA 1YTZT 1EDIA 2BEZF 2Q9IA 2CPBA 2QJKC 2AEFA 3DS3A 3G29A 1HVVA 1L0LD 4PJ0H 1EC5A 1FC2C 3TK1A 3H1LG 2JDIH 1EMVA 5APWA 1EZVE 1KTMA 1BXIA 4UB6H 1K05A 2DW3A 5E79H 2KOGA 3G21A 3OAKA 1HWTC 5L8RJ 4U0BA 2QJYB 1YQ4C 1IFDA 3V2PA 2KWLA 1SQPJ 5AW8B 1LP1A 4YXDC 1S9KE 5HVCA 1N8RQ 2P9XA 5AW7B 3LW5J 5BU8B 2MR8A 2FYUK 5CZDB 2Y0EA 5APVA 4EYYQ 5I4TG 4XFZA 1VF5B 3I56P 1A02J 4TT3H 3EJEA 3QWOC 2WZ7A 3H1JJ 4AQRD 2FFDC 3CX5E 4CPGA 2KGCA 1KZUB 1NTZD 4RO0A 1PPJE 5HGNA 2BCCJ 1MV8A 2CPSA 3AE6C 4XA4A 3AE8C 3L74D 3G28A 3PH0A 5TJHA 2CK3H 3Q2YA 4PV1B 5KLIB 1UIXA 3MUDC 3E2DA 3M0AA 2W6AA 1AA0A 4DCKA 2AXCA 3RL0B 2GDXA 1K04A 1NYHA 3AEEC 3DS0A 5DCKA 3CI9A 2XNDH 3HUSC 2K1AA 3Q5SA 1MFZA 2WT7A 2K94A 1OXZA 1BCCE 2XKMA 5APSA 2P10A 2OYIB 2L4BA 2FACA 1H0TB 3L70J 3P8MC 3O6QA 2FQ0A 3H1HJ 2K9YA 3M91A 2QJPC 2XZ0D 3A0BH 1SQVD 1YJNP 3MD0A 2M8RA 2K9JB 1OW8A 5KP8B 2OTJP 4H0LD 2ZYDA 3GHGA 2D2CD 5AVTB 4C7NB 2W83C 3HRNA 1IZNB 4PWVB 1Q82Q 2K0DX 1BGYD 1AJYA 2PEQA 5AW1B 4I7ZC 1M8OB 1KQFB 3USSA 3V2RA 2JU1A 1MUUA 4HYTB 2E42A 3G1GA 1GMJA 2JGPA 3AEFC 1URQA 3B5ND 1T3JA 1SQPG 1MKMA 2VLPA 5AVZB 3G1IA 2KZJA 3PRJA 3HE4A 3V4QA 1YI2P 3CC7P 3OW2O 5CCHD 2FKWB 2A06G 3AEGC 2AXTE 1BDCA 4Y99C 2FQ1A 5H2FH 4BWNA 2AEJA 1QRJA 4H0LC 3H1JG 2D2CC 1M6EX 5TISE 3CCQP 2K0XA 1P84E 3PJSK 5EFWB 1DD3A 3TGUE 1IK9A 2PY8A 3MHVA 3AECC 3V6IA 1L0NE 1QL2A 3B5NC 2PEKA 3L72J 1GD2E 4H44D 5AVRB 1PEQA 1E79H 3T97B 5CCHC 4GOFA 3VP8A 1RE4A 4CA3A 3AE5C 3L73J 1FZAA 1D7MA 3A7OA 3IAOA 1ZMBA 4C7NA 2OYHA 4RKUJ 2HR3A 1R5SA 2I1JA 2FYUG 3L70G 4IFMA 4PH0A 1RE3A 2P1JA 2X2BA 3HD7B 1QLED 2DNWA 1PZQA 3H1HG 4N78D 5AW9B 2N1TD 3E7KA 4GR2A 3CWBD 1NO4A 3TDKA 2C9NY 2NPSB 3CD6P 4D6TJ 4L75A 3VYIA 1X0TA 3BCCD 2DGYA 3DS4A 1SQQD 4H44C 1SQBE 3FXDA 3G4SP 2KGDA 2WQYC 4UB8H 1NU1D 3C8VA 1M6NA 4NPDA 3CE7A 2QJKB 2ZAEB 3I5CA 2LOLA 2E5YA 2K88A 3AE1C 4HJGH 2ZXEB 3TYYA 1KILA 2PEMA 1NHLA 2N1TC 4WY4A 3IF4A 5AVQB 2KP8A 2N5HA 4BPGA 2JP3A 3IR9A 1RH5B 1BSHA 3H4EA 1IC2A 1PV3A 2IX7C 4C7RA 2H43A 2ZJSE 2P67A 2XV6A 1IFPA 4RESB 1OR5A 3G9RA 3H1JE 3ZDMA 4HKZH 4W7ZA 2HPCA 2IFMA 3JC22 3HTKA 3NMDA 1W2EA 3A0HE 3UIAA 1JJ2O 2BCCE 2FFDB 2JJLA 2OGUA 3HD7A 1N73A 2GM4A 4IFDK 1U7JA 3M1MA 2Q1KA 3L72G 1HTLC 2J5UA 1BE3D 2Z5HA 4M0IA 1KYOH 1S5LH 2JEEA 2N6ZA 2FY8A 3L36A 3L73G 2O01H 1GU4A 3WBHA 1SQVJ 1HQBA 1NWQA 5BU5A 3HUSB 2KSJA 2UWJE 2WSCH 4GT1A 3L70E 2JWDA 2E74D 2KOPA 1PGOA 4U0EA 2KOOA 1KILE 3F5HA 1BGYJ 1VQ7P 4D6TG 1JY2P 2GYKA 3GF7A 3G0VA 1JO5A 1Z56A 2QEXP 1L0NK 3P8CD 2W6BA 2QJPB 3KYQA 4H13D 1EXIA 5KAIE 5KTBA 1KYOI 3H1ID 1FDOA 4JQ0D 3CX5H 2I1KA 2CGQA 2MVVA 1XTGB 7CEIA 2LR2A 5APQA 1PP9D 1RE3C 5HGOA 3Q3DA 1JMMA 2B87B 1F80D 1HH0A 1EZVI 4I7ZB 3EFFK 4BRYA 3G6EP 2E74C 1LTSC 2P2UA 3GZMA 1EDLA 2QM7A 1LT9A 2Q6QA 3H1KD 3BRTB 1G2CB 1ZN5A 1AQTA 2KOQA 4U0AA 2QG4A 2R3CA 3L71J 4WYMA 3LRYA 2FAEA 4H13C 5K5GB 4Y99B 3L35A 3TGUJ 2B89A 2VRSA 3CPWO 3HE5B 1NKNA 1E5WA 1KORA 2E1MA 4H0LB 1ZR4A 4IPYA 4I1LA 1GL2D 3CMEP 1USEA 2XNXA 2D2CB 1JY2N 1T3UA 3CX5I 2FYNC 1LTIC 3U59A 2KR5A 3VP9A 4NPEA 2KS1A 5GTHE 2K93A 4F37A 3MTUE 1SFCA 1JTHB 1L4AD 2Y0DA 3N7NA 3D6ZA 1GU5A 1M1KQ 1SQPK 1OVVA 3B5NB 3CWBJ 2QRXA 4DZOA 2POHA 3L73E 1SQVG 2H89C 5AW6B 3BVHA 2KXPB 1GK6A 5KLVJ 1SQQJ 1FZEA 3B71A 1SLQA 2KNCB 4HH2A 5AW3B 1KD1Q 1NU1J 1X22A 1BGYG 1GL2C 1CI6B 1NKZB 4JF7A 4U3FD 2MKVA 2B9BA 1HUCA 2L6EA 1SQBJ 2N50A 2KLUA 1LTJA 4D6TE 3N4XA 1KC8Q 5KJ7A 2ZYGA 1L4AC 1GPJA 3AE9C 4A7PA 3Q1MA 3FXEA 2HFED 4I2LC 1VKUA 1FJKA 2M5AA 4H44B 2K92A 3KZIE 5TISH 1ZW0A 1M1JA 3H25A 1FOSF 4RJTA 2KSEA 3B5IA 1SQXD 3SWFA 3O8ZA 4GR6A 3NTEA 4OGQD 5AW5B 1N7SA 3GG2A 2R44A 2PENA 3MP7B 3R4YA 3RL0g 4H2WC 3S4RA 4MN4C 2HODB 2KG8A 1AVYA 3S1KA 1VQ4P 1NTKD 1EZVD 2YMYA 2V7QH 2EIAA 2N9YB 2N1TB 1VQ5P 2KIKA 3L71G 2NZ2A 3PP5A 3V2NA 1GW3A 3KQGA 1BDDA 1IFNA 3TGUG 2CG5B 1BE3J 3V2QA 1L0NG 1T8KA 1MFTA 3FGAD 1HBWA 3PTZA 1RF1B 3M9HA 2CNRA 1JMBA 1FZCA 2IYPA 1HF9A 2I8DA 2YKOA 1NTMD 1S2EA 1H89A 2KUBA 4OGQC 5B5EE 1P84I 2G8YA 1LT9C 1UNKA 1ZRTD 5CBOA 3CX5D 3L75D 2GZFA 1VQ9P 3CWBG 2KW2A 1FDIA 4ASVA 1OW7A 2LTEA 1PPJD 4BXLA 4QKOA 1Q2NA 5F2NA 1LWUB 4NEOA 5KLVG 2GDWA 1SQQG 1SQVE 2Q3IA 5AW2B 1RF0C 1L0IA 5AVYB 2MJZA 1NU1G 1EXJA 2VSQA 3U1CA 1ZP0C 1T2KD 1SQBG 1BGYE 2WPVB 2Q7CA 1PP9J 4XFYA 1FU1A 2FVFA 3LW5H 2IZ0A 1HGZA 2E5TA 3PHLA 1AFOA 3CLQA 1PEMA 1N7LA 2KORA 1YJ9P 2YXQB 1NQ4A 3GF3A 4XFXA 4IFFA 1VPCA 2WSEJ 1X8YA 4K35A 2IBZG 3KHUA 2WSFJ 3RG6C 3A0HH 1NOHA 3H47A 1QVGO 2GZIA 1UIIA 3RK2D 5EJDA 4IOIH 1Q90D 3VMAA 2JYLA 1T2KC 3M0DA 2MD9A 2LIWA 2FXPA 2E74B 1RO0A 2HG5D 3H1LD 1FDMA 3L71E 1BE3G 1Y9BA 4PH1A 2BCCG 4PJ0E 2ROQA 2OYIA 3U43A 1H0TA 3SFDC 2A45H 1N2DC 3CCLP 5F2KA 3D70A 2JBGA 4EOTA 2YKQA 1X9VA 3RK2C 4Z1MH 1JNMA 2K9JA 4IL6H 3AE2C 2A45G 1MZ8A 1NVOA 1J1DC 3CWBE 5KAIH 2H7HA 2XZ1C 5JPAA 5M1BA 2KK7A 5APXA 1VQ6P 5KAFE 3D71A 1EIAA 2WPRA 1FJPA 5KKZC 1L0LJ 5KLVE 1SQQE 1ZLLA 4LGDE 5CCGA 1NU1E 2BASA 1OW6A 2A45I 1A02F 4R4MA 2ZXXA 3A5TA 2K37A 5AVUB 1SQXJ 4MRTC 5CJ4A 1KB9E 1GL2B 2FXOA 1K9MQ 2Z4EA 2HYNA 2K3RA 4EDFA 2R3SA 3R2PA 5AW0B 5BS1A 3TNUB 2YNYA 2LXBA 3GW6A 4COPA 1URQD 1NTKJ 2O01N 1L4AB 1FR2A 1AF8A 1YQ3C 1OWAA 1S1CX 1LT1A 3MGEA 1ZOYC 3F89A 2L91A 1NGMB 2LPKA 4ZMDA 1SQVK 1EQ7A 2IBZE 2YO2A 1NTZJ 1U7MA 4PD4E 3RL0D 1X3OA 1W5CE 2RKLA 1LJ2A 3C1LA 3W68A 4AUWA 3L74J 5GTHH 3H32B 1UJZA
chains in the Genus database with same CATH topology
5BS2A 3HZQA 3HYBA 4PH0A 1YITP 3VRLC 1YHQP 2Z44A 5I4TG 3DTJA 2XT1A 3CXCO 3M1MA 4XFZA 1Q82Q 4U0AA 1W2BO 1D1DA 2PEQA 3I56P 1YJWP 3P05A 4GR2A 3LRYA 4M0IA 4WYMA 1VQPP 1E6JP 3CC4P 2M8NA 3DPHA 3B5IA 2EG5A 2EFJA 1K30A 4U0FA 1AUMA 4GR6A 3CD6P 3G1GA 1RO2A 1BAJA 3NTEA 4U0CA 2BQ1E 4XFYA 1S72P 3CPWO 1M74A 2DGYA 3CC2P 1A8OA 3DS4A 2BUOA 2E1MA 2PENA 3WBHA 5HGNA 5JPAA 2BHVA 2JYGA 3G1IA 4IPYA 3CMEP 5HGLA 1VQ6P 1EIAA 1NJIQ 2Z46A 2QA4P 3G4SP 1VQMP 1PEMA 1YI2P 3G28A 3CC7P 3OW2O 5HGMA 1YJ9P 1VQ4P 2M8PA 1K73Q 1IUQA 1EOQA 3E2DA 1VQ8P 1Q81Q 1VQLP 2EIAA 4QNBA 4XROA 1M6NA 2PEIA 4XFXA 1VQ5P 4U0EA 1QRJA 3G26A 1VQKP 2XXMA 2PEJA 1VQ7P 1PEUA 3RG6C 2JO0A 3DS0A 2LF4A 1RNIA 1M1KQ 1M6EX 3CCMP 5DCKA 3H47A 1QVGO 1Q86Q 1VQNP 3CCQP 3G0VA 1VQOP 2QEXP 2Z45A 1K9MQ 1PEOA 2PEMA 3CCUP 1QVFO 1K8AQ 2KODA 2CWOA 3CCJP 2JYLA 3DS3A 2PY8A 3G29A 3CCRP 1A43A 5BS1A 3CCVP 4COPA 1RO0A 4XRQA 2PEKA 4COCA 1KD1Q 3H4EA 3Q20A 3G71P 5F2OA 3G21A 3CMAP 1M90Q 2OTLP 3I55P 3H0DA 1PEQA 2XV6A 3MGEA 5HGOA 4U0DA 4PH1A 1VQ9P 3CCEP 1YIJP 2ONTA 2L6EA 4U0BA 2OARA 1Q7YQ 1YJNP 2M8LA 3DS5A 2PEOA 1ZMBA 3G6EP 1KC8Q 3DS1A 5F2NA 2OTJP 3DS2A 1N8RQ 1JJ2O 3CCLP 2P9XA 1KQSO 3CCSP 5F2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM P;  3G71 P;  1VQ7 P;  1QVG O;  3CMA P;  3CME P;  1NJI Q;  1M90 Q;  1Q86 Q;  1YIT P;  3CCQ P;  1VQ6 P;  1VQN P;  1YHQ P;  2OTL P;  3I55 P;  1VQM P;  2QA4 P;  3G4S P;  3CXC O;  1YI2 P;  1Q82 Q;  3OW2 O;  2QEX P;  1VQO P;  3CC7 P;  1W2B O;  1K9M Q;  1VQ9 P;  3CCE P;  1YIJ P;  3CCU P;  3I56 P;  1YJ9 P;  1VQ4 P;  1K73 Q;  1QVF O;  1YJW P;  1K8A Q;  1Q7Y Q;  1VQ8 P;  1YJN P;  1VQP P;  1Q81 Q;  3CCJ P;  1VQL P;  3CC4 P;  1VQ5 P;  3CC2 P;  3CCR P;  3G6E P;  1KC8 Q;  3CD6 P;  2OTJ P;  1N8R Q;  1JJ2 O;  3CCL P;  1KQS O;  1VQK P;  1S72 P;  3CPW O;  3CCV P;  3CCS P;  1M1K Q;  1KD1 Q; 
#chains in the Genus database with same CATH topology
 3T97 A;  2M0B A;  3GHG C;  1JY2 O;  2LML A;  1Z6M A;  1YIT P;  3RBX A;  3SSU A;  1PGQ A;  1D1D A;  1NTM J;  1U57 A;  1IJD B;  3EWK A;  2YIU C;  3JSV C;  2M8N A;  2EG5 A;  3LMO A;  3OJA B;  2NRG A;  4C46 A;  1BE3 E;  2K2Q A;  3L75 J;  2M3B A;  1URQ C;  1SQP D;  2BHV A;  1EDK A;  1J2J B;  5KLI C;  4L74 A;  5HGM A;  2NPS A;  2QSI A;  2YKP A;  2A06 D;  1Q81 Q;  3P32 A;  5GTI E;  3RL0 C;  4XRO A;  2PEI A;  1S4X A;  2K0Y A;  3M0D C;  3V4W A;  2RN0 A;  2JO0 A;  3H1J D;  2Q3E A;  5AVX B;  2VLQ A;  1VQO P;  3M9Q A;  3K5B A;  3CCU P;  3FX0 A;  1CW5 A;  1L0L G;  1KN7 A;  3KZI H;  2GDY A;  3P8C E;  1OVR A;  2J58 A;  3CXH E;  1RHZ B;  1HJB A;  1RE4 C;  1OFC X;  1PP9 E;  3GLM A;  3II6 A;  3DS1 A;  1GTW A;  4H2Y C;  2OYH C;  2W6J H;  3FWL A;  3HZQ A;  2FYU D;  3FWN A;  1PFI A;  3L70 D;  3MIW A;  1NTK G;  1W2B O;  4BPH A;  1KIL D;  2Y9Z A;  2KG9 A;  1RQU A;  1YJW P;  3H1H D;  3H1L J;  2QVA A;  4OH8 B;  4R0M A;  2IPP A;  2FFD A;  3DPH A;  4WY4 D;  1NTZ G;  4K3A A;  1KMI Z;  1N86 A;  1SQQ K;  5KLV K;  1AVO A;  2MVU A;  4GOE A;  3L74 G;  2E75 D;  5B5E H;  2KYV A;  2IYO A;  1NU1 K;  1KFN A;  3MUD A;  1ACP A;  1QL1 A;  3RK3 D;  1K73 Q;  3GZL A;  2R32 A;  2YMK A;  1T6A A;  1G1I A;  3BRV B;  1NTM G;  2K5X A;  2VLO A;  3GJN A;  1SQB K;  3BAT A;  4IZ6 A;  3AEB C;  3HD7 D;  3HUS A;  4JYB A;  2JO1 A;  2FQ2 A;  1HY8 A;  1KIL C;  1QVF O;  3D6Y A;  4WY4 C;  2JQ4 A;  2FYZ A;  2JU2 A;  3AEA C;  4UHP B;  1LP1 B;  2PFX A;  2YXR B;  2OTL P;  1ZNV A;  2Y9Y A;  2E75 C;  4JYC A;  3EJB A;  2FBW C;  4U0D A;  1LNQ A;  2V7Q J;  3RK3 C;  3EJD A;  3BCC J;  3RK2 B;  1S5L X;  2M8L A;  2ITA A;  3NXS A;  4L73 A;  2PEO A;  5KP6 B;  2ERH A;  4DG9 A;  1LTA C;  4Y28 J;  2C9L Y;  2E76 D;  3G3Z A;  3HD7 C;  3VN0 A;  1J1D B;  2FVA A;  1GW4 A;  1L0L E;  3WU2 E;  1IFI A;  2B87 A;  1FZF A;  2Z44 A;  3OA7 A;  3DTJ A;  2XT1 A;  3CXC O;  1LTB C;  1N73 C;  4LLH A;  3L72 D;  1DD4 A;  2AVA A;  1S3J A;  2W27 A;  1M7L A;  1IFM A;  2FVE A;  2AXT H;  2RH0 A;  3L73 D;  1G2C A;  1A8O A;  1SQX E;  4TLF A;  1KQL A;  4PXH B;  2L22 A;  4EI2 A;  4N3Y B;  3SWY A;  2Z46 A;  1S5L E;  1JY3 O;  2E43 A;  2PAJ A;  1YTZ I;  2HLO A;  1FZG A;  3A3Y B;  5AVS B;  2IZ1 A;  4QNB A;  3E1I A;  2WT7 B;  1P84 H;  3AE4 C;  3HE5 A;  3W67 A;  2EHS A;  1NTK E;  2WPS A;  1KYO D;  1GK4 A;  2E76 C;  4D6T D;  4W80 A;  3O6Q B;  4DJG A;  2AF8 A;  1DH3 A;  4XE5 B;  1NTZ E;  3BAS A;  2MR7 A;  3P7K A;  2AFD A;  1JTH A;  4YPC A;  4AYC A;  1IO4 A;  3CL3 D;  3L4F A;  1QEX A;  2WPQ A;  3L74 E;  1DEE G;  2JB0 A;  3JCU E;  3B5N A;  4EIJ A;  4N6J A;  3B8E B;  3CCV P;  4XRQ A;  3GMA A;  4WVZ A;  1IMP A;  1JM0 A;  1NTM E;  3GHG B;  2L9F A;  5CCH A;  2KLV A;  3KPE A;  1OIP A;  3VOP A;  3CCE P;  2B88 A;  3S9O A;  1S9K D;  3AE7 C;  5KAF H;  5CBN A;  1KFM A;  1ZRT E;  2WIT A;  2YIU B;  3DS5 A;  2KG6 A;  2KNC A;  3L75 E;  2BEQ D;  3C9I A;  4KHX A;  2M5R A;  3M9B A;  4HB1 A;  1CI6 A;  1SFC D;  2MY5 A;  5BS2 A;  1OMI A;  1CZQ A;  1URQ B;  3ABV C;  4LC1 A;  4M3L A;  2LKM A;  1GDT A;  3VTP C;  1JY3 P;  2J59 M;  4JPZ B;  1FS0 E;  4WWI A;  3HE4 B;  1E0H A;  1KB9 H;  2AEM A;  1AYI A;  4U0F A;  5CHX A;  3BCC G;  1AUM A;  1DV5 A;  1BAJ A;  1JCD A;  1FOS E;  1EDJ A;  2BQ1 E;  1S72 P;  1WMK A;  4ASW A;  1J1E C;  3LID A;  2QA4 P;  4BPF A;  1XTC C;  1QGK B;  2FAD A;  1HGV A;  2FHS C;  1IUQ A;  1LTG C;  3H1I J;  5B66 E;  2FYU J;  2FXM A;  3RG2 A;  2ZVO B;  5KJ7 D;  2PGD A;  4PD4 H;  2LIU A;  5CMZ A;  2N6Y A;  2HOD A;  1PEU A;  1SFC C;  2SPZ A;  1RNI A;  5AW4 B;  1BCC D;  2JKV A;  1VHN A;  4ZKU A;  1Q86 Q;  1KV4 A;  3KXD A;  2N1T A;  2P7J A;  2KOD A;  1JUN A;  3H1K J;  1M56 D;  4YTP C;  4NPF X;  3RGU A;  2W90 A;  1KB9 I;  1N7S D;  2LL8 A;  2OYH B;  1MZ9 A;  2ZFC A;  4I6M C;  1ZR2 A;  3H1L E;  1LTT C;  1RF1 A;  1YIJ P;  1GXH A;  2WPT A;  3IN6 A;  5EW5 E;  1Y8A A;  1JY3 N;  1L0L K;  1LTJ C;  4WBA A;  3LIE A;  2KOS A;  5KJ7 C;  5GTI H;  5CJ0 A;  2GZG A;  3SWK A;  1WT6 A;  1JCC A;  2ZT9 D;  2ZVN B;  2IBZ I;  2WVR A;  4PD4 I;  1VL2 A;  2N98 A;  1R8E A;  4DT0 A;  1LWU A;  1SQX K;  1VQP P;  1M1J C;  1SVF A;  4OWF A;  1ZME C;  4UB6 E;  5E79 E;  4H13 B;  4W7Y A;  1N7S C;  2KI7 B;  1JB0 J;  2JYG A;  1VQM P;  1NTK K;  2AFE A;  1DNY A;  1PGP A;  3CXH H;  2KGA A;  1IMQ A;  1KIL B;  1L0H A;  3V5B A;  2FYN B;  1BSN A;  2O1K A;  2KGE A;  1NTZ K;  3L71 D;  4WY4 B;  4N78 E;  2WWW A;  3G26 A;  1NH4 A;  1P84 D;  3MGN A;  2PEJ A;  4U3F J;  4WB4 A;  2LF4 A;  5BVZ A;  2ZT9 C;  1DX7 A;  3TGU D;  1NAY A;  3BCC E;  1WRG A;  2E75 B;  1K8A Q;  1L0N D;  1FZB A;  2CWO A;  4QMA A;  3RK3 B;  2GZJ A;  1KLP A;  1OVU A;  1NTM K;  3SFE C;  3EQ2 A;  2R5D A;  1RQV A;  2WSE H;  3L37 A;  3H1I G;  2HPC B;  1FZC C;  3HTK B;  3Q20 A;  2WSF H;  3G71 P;  1PP9 G;  5F2O A;  1VF5 D;  1M90 Q;  3I55 P;  3H0D A;  1FBM A;  5HV8 A;  1CSB A;  1N73 B;  3WMM 0;  2O01 J;  1X79 B;  3CXH I;  2PP6 A;  3M06 A;  4R4L A;  5KLV D;  3H1K G;  3AED C;  1H8A A;  4PV1 D;  4DOJ A;  2QJY C;  1GXG A;  2LXC B;  2WSC J;  2YO3 A;  1M57 D;  2OQQ A;  1E6J P;  1L2P A;  2EFJ A;  1K30 A;  2XV5 A;  2W8Z A;  1SQB D;  3A2A A;  1RO2 A;  1FE6 A;  4U0C A;  1KB9 D;  1M74 A;  3IFM A;  5HGL A;  1NJI Q;  1VF5 C;  3A0B E;  3WUU A;  2E76 B;  4KT0 J;  3TF5 A;  2XDJ A;  4O9B A;  2M8P A;  1SQP E;  1EOQ A;  1VQ8 P;  1AV1 A;  1PL5 A;  2KZI A;  2A06 E;  2ZYA A;  3B4S A;  1KQG B;  2IBZ D;  3B4Q A;  2H88 C;  3CCM P;  4PD4 D;  2Q5U A;  1YBK A;  3VMY A;  4PV1 C;  3MZW B;  3WUT A;  1CEI A;  2QE7 H;  2Y0C A;  4GKG A;  1RF1 C;  3WU2 H;  1LGH B;  2M3E A;  5C39 A;  5APY A;  4BRY B;  3TSI A;  1GL2 A;  1PIX A;  2OYO A;  4OGQ B;  3CMA P;  4U3F G;  4L76 A;  2G3A A;  5H2F E;  1LT9 B;  2KB7 P;  2ONT A;  4IL6 X;  3Q5R A;  2BCC D;  2OYI C;  2OTK E;  3TNU A;  1LWU C;  4KJM A;  3KDP B;  1BCC J;  1QX8 A;  4GIF A;  3RBZ A;  2H8P D;  3Q5P A;  1L4A A;  5CCG D;  2LKI A;  3GKL C;  2O3J A;  2EHT A;  1YHQ P;  1ZV8 A;  1J1E B;  3PLN A;  3H1I E;  2FYU E;  2IDB A;  3P05 A;  1SQX G;  1IFJ A;  2Z5I A;  3H32 A;  3U1A A;  3H1H E;  1OZH A;  1TU3 F;  1AQ5 A;  1USD A;  2PNG A;  2KS1 B;  4YXW H;  3CC2 P;  3JCU H;  4IL6 E;  1SFC B;  2RMZ A;  2V4H A;  1EZV G;  4OVN F;  2CQ8 A;  1Y47 A;  4JBZ A;  1OX3 A;  3H1K E;  5DJT B;  2R5B A;  3CXH D;  1JOC A;  3RK3 E;  5CCG C;  1VQK P;  2P58 A;  1ZXG A;  3VMZ A;  2WMM A;  2QIW A;  1GZL A;  2N5I A;  4XFJ A;  2Z45 A;  3NTN A;  1T8Z A;  3H6P A;  5APU A;  3CCJ P;  3NFQ A;  2JAZ A;  2XU6 A;  3CCR P;  4H2X C;  2GA1 A;  1A43 A;  1LTJ B;  2WSS H;  2N9B A;  2QM8 A;  4COC A;  5AVV B;  1IK7 A;  1PGJ A;  5AVW B;  4UB8 E;  3QH9 A;  2GZE A;  2GUV A;  2C0W A;  3L75 G;  1DIP A;  1PPJ G;  1FAV A;  2OAR A;  2NPS D;  1Q7Y Q;  2M5A B;  3EFG A;  2O1J A;  2PRR A;  1M1J B;  3DS2 A;  4GDO A;  1JEK A;  1KQS O;  1H88 A;  5B66 H;  2GUS A;  3CCS P;  1SP4 A;  3WUV A;  1RF0 A;  1L0N J;  1VDF A;  4ZKP A;  3HYB A;  1N7S B;  4B86 A;  3VRL C;  2XZR A;  3AE3 C;  1R5L A;  5DJU B;  1SS1 A;  2L5G B;  1G1J A;  3CC4 P;  2NO8 A;  2L0Q A;  4U3F E;  5APT A;  1NAF A;  3E1R A;  3L72 E;  5KP7 B;  1RY3 A;  1YYC A;  1BCC G;  3NY7 B;  2JWA A;  2BUO A;  3ITK A;  2ZT9 B;  2IFN A;  4ZNC A;  1DEB A;  5KKZ B;  2MF4 A;  2NPS C;  2JR8 A;  2C0X A;  1VQL P;  3VMX A;  4HKG A;  4U7J A;  2VLN A;  2XXM A;  2WTY A;  1HJ0 A;  1FZC B;  4GOD A;  1VQN P;  1KYO E;  2QNW A;  1PEO A;  1YTZ T;  1EDI A;  2BEZ F;  2Q9I A;  2CPB A;  2QJK C;  2AEF A;  3DS3 A;  3G29 A;  1HVV A;  1L0L D;  4PJ0 H;  1EC5 A;  1FC2 C;  3TK1 A;  3H1L G;  2JDI H;  1EMV A;  5APW A;  1EZV E;  1KTM A;  1BXI A;  4UB6 H;  1K05 A;  2DW3 A;  5E79 H;  2KOG A;  3G21 A;  3OAK A;  1HWT C;  5L8R J;  4U0B A;  2QJY B;  1YQ4 C;  1IFD A;  3V2P A;  2KWL A;  1SQP J;  5AW8 B;  1LP1 A;  4YXD C;  1S9K E;  5HVC A;  1N8R Q;  2P9X A;  5AW7 B;  3LW5 J;  5BU8 B;  2MR8 A;  2FYU K;  5CZD B;  2Y0E A;  5APV A;  4EYY Q;  5I4T G;  4XFZ A;  1VF5 B;  3I56 P;  1A02 J;  4TT3 H;  3EJE A;  3QWO C;  2WZ7 A;  3H1J J;  4AQR D;  2FFD C;  3CX5 E;  4CPG A;  2KGC A;  1KZU B;  1NTZ D;  4RO0 A;  1PPJ E;  5HGN A;  2BCC J;  1MV8 A;  2CPS A;  3AE6 C;  4XA4 A;  3AE8 C;  3L74 D;  3G28 A;  3PH0 A;  5TJH A;  2CK3 H;  3Q2Y A;  4PV1 B;  5KLI B;  1UIX A;  3MUD C;  3E2D A;  3M0A A;  2W6A A;  1AA0 A;  4DCK A;  2AXC A;  3RL0 B;  2GDX A;  1K04 A;  1NYH A;  3AEE C;  3DS0 A;  5DCK A;  3CI9 A;  2XND H;  3HUS C;  2K1A A;  3Q5S A;  1MFZ A;  2WT7 A;  2K94 A;  1OXZ A;  1BCC E;  2XKM A;  5APS A;  2P10 A;  2OYI B;  2L4B A;  2FAC A;  1H0T B;  3L70 J;  3P8M C;  3O6Q A;  2FQ0 A;  3H1H J;  2K9Y A;  3M91 A;  2QJP C;  2XZ0 D;  3A0B H;  1SQV D;  1YJN P;  3MD0 A;  2M8R A;  2K9J B;  1OW8 A;  5KP8 B;  2OTJ P;  4H0L D;  2ZYD A;  3GHG A;  2D2C D;  5AVT B;  4C7N B;  2W83 C;  3HRN A;  1IZN B;  4PWV B;  1Q82 Q;  2K0D X;  1BGY D;  1AJY A;  2PEQ A;  5AW1 B;  4I7Z C;  1M8O B;  1KQF B;  3USS A;  3V2R A;  2JU1 A;  1MUU A;  4HYT B;  2E42 A;  3G1G A;  1GMJ A;  2JGP A;  3AEF C;  1URQ A;  3B5N D;  1T3J A;  1SQP G;  1MKM A;  2VLP A;  5AVZ B;  3G1I A;  2KZJ A;  3PRJ A;  3HE4 A;  3V4Q A;  1YI2 P;  3CC7 P;  3OW2 O;  5CCH D;  2FKW B;  2A06 G;  3AEG C;  2AXT E;  1BDC A;  4Y99 C;  2FQ1 A;  5H2F H;  4BWN A;  2AEJ A;  1QRJ A;  4H0L C;  3H1J G;  2D2C C;  1M6E X;  5TIS E;  3CCQ P;  2K0X A;  1P84 E;  3PJS K;  5EFW B;  1DD3 A;  3TGU E;  1IK9 A;  2PY8 A;  3MHV A;  3AEC C;  3V6I A;  1L0N E;  1QL2 A;  3B5N C;  2PEK A;  3L72 J;  1GD2 E;  4H44 D;  5AVR B;  1PEQ A;  1E79 H;  3T97 B;  5CCH C;  4GOF A;  3VP8 A;  1RE4 A;  4CA3 A;  3AE5 C;  3L73 J;  1FZA A;  1D7M A;  3A7O A;  3IAO A;  1ZMB A;  4C7N A;  2OYH A;  4RKU J;  2HR3 A;  1R5S A;  2I1J A;  2FYU G;  3L70 G;  4IFM A;  4PH0 A;  1RE3 A;  2P1J A;  2X2B A;  3HD7 B;  1QLE D;  2DNW A;  1PZQ A;  3H1H G;  4N78 D;  5AW9 B;  2N1T D;  3E7K A;  4GR2 A;  3CWB D;  1NO4 A;  3TDK A;  2C9N Y;  2NPS B;  3CD6 P;  4D6T J;  4L75 A;  3VYI A;  1X0T A;  3BCC D;  2DGY A;  3DS4 A;  1SQQ D;  4H44 C;  1SQB E;  3FXD A;  3G4S P;  2KGD A;  2WQY C;  4UB8 H;  1NU1 D;  3C8V A;  1M6N A;  4NPD A;  3CE7 A;  2QJK B;  2ZAE B;  3I5C A;  2LOL A;  2E5Y A;  2K88 A;  3AE1 C;  4HJG H;  2ZXE B;  3TYY A;  1KIL A;  2PEM A;  1NHL A;  2N1T C;  4WY4 A;  3IF4 A;  5AVQ B;  2KP8 A;  2N5H A;  4BPG A;  2JP3 A;  3IR9 A;  1RH5 B;  1BSH A;  3H4E A;  1IC2 A;  1PV3 A;  2IX7 C;  4C7R A;  2H43 A;  2ZJS E;  2P67 A;  2XV6 A;  1IFP A;  4RES B;  1OR5 A;  3G9R A;  3H1J E;  3ZDM A;  4HKZ H;  4W7Z A;  2HPC A;  2IFM A;  3JC2 2;  3HTK A;  3NMD A;  1W2E A;  3A0H E;  3UIA A;  1JJ2 O;  2BCC E;  2FFD B;  2JJL A;  2OGU A;  3HD7 A;  1N73 A;  2GM4 A;  4IFD K;  1U7J A;  3M1M A;  2Q1K A;  3L72 G;  1HTL C;  2J5U A;  1BE3 D;  2Z5H A;  4M0I A;  1KYO H;  1S5L H;  2JEE A;  2N6Z A;  2FY8 A;  3L36 A;  3L73 G;  2O01 H;  1GU4 A;  3WBH A;  1SQV J;  1HQB A;  1NWQ A;  5BU5 A;  3HUS B;  2KSJ A;  2UWJ E;  2WSC H;  4GT1 A;  3L70 E;  2JWD A;  2E74 D;  2KOP A;  1PGO A;  4U0E A;  2KOO A;  1KIL E;  3F5H A;  1BGY J;  1VQ7 P;  4D6T G;  1JY2 P;  2GYK A;  3GF7 A;  3G0V A;  1JO5 A;  1Z56 A;  2QEX P;  1L0N K;  3P8C D;  2W6B A;  2QJP B;  3KYQ A;  4H13 D;  1EXI A;  5KAI E;  5KTB A;  1KYO I;  3H1I D;  1FDO A;  4JQ0 D;  3CX5 H;  2I1K A;  2CGQ A;  2MVV A;  1XTG B;  7CEI A;  2LR2 A;  5APQ A;  1PP9 D;  1RE3 C;  5HGO A;  3Q3D A;  1JMM A;  2B87 B;  1F80 D;  1HH0 A;  1EZV I;  4I7Z B;  3EFF K;  4BRY A;  3G6E P;  2E74 C;  1LTS C;  2P2U A;  3GZM A;  1EDL A;  2QM7 A;  1LT9 A;  2Q6Q A;  3H1K D;  3BRT B;  1G2C B;  1ZN5 A;  1AQT A;  2KOQ A;  4U0A A;  2QG4 A;  2R3C A;  3L71 J;  4WYM A;  3LRY A;  2FAE A;  4H13 C;  5K5G B;  4Y99 B;  3L35 A;  3TGU J;  2B89 A;  2VRS A;  3CPW O;  3HE5 B;  1NKN A;  1E5W A;  1KOR A;  2E1M A;  4H0L B;  1ZR4 A;  4IPY A;  4I1L A;  1GL2 D;  3CME P;  1USE A;  2XNX A;  2D2C B;  1JY2 N;  1T3U A;  3CX5 I;  2FYN C;  1LTI C;  3U59 A;  2KR5 A;  3VP9 A;  4NPE A;  2KS1 A;  5GTH E;  2K93 A;  4F37 A;  3MTU E;  1SFC A;  1JTH B;  1L4A D;  2Y0D A;  3N7N A;  3D6Z A;  1GU5 A;  1M1K Q;  1SQP K;  1OVV A;  3B5N B;  3CWB J;  2QRX A;  4DZO A;  2POH A;  3L73 E;  1SQV G;  2H89 C;  5AW6 B;  3BVH A;  2KXP B;  1GK6 A;  5KLV J;  1SQQ J;  1FZE A;  3B71 A;  1SLQ A;  2KNC B;  4HH2 A;  5AW3 B;  1KD1 Q;  1NU1 J;  1X22 A;  1BGY G;  1GL2 C;  1CI6 B;  1NKZ B;  4JF7 A;  4U3F D;  2MKV A;  2B9B A;  1HUC A;  2L6E A;  1SQB J;  2N50 A;  2KLU A;  1LTJ A;  4D6T E;  3N4X A;  1KC8 Q;  5KJ7 A;  2ZYG A;  1L4A C;  1GPJ A;  3AE9 C;  4A7P A;  3Q1M A;  3FXE A;  2HFE D;  4I2L C;  1VKU A;  1FJK A;  2M5A A;  4H44 B;  2K92 A;  3KZI E;  5TIS H;  1ZW0 A;  1M1J A;  3H25 A;  1FOS F;  4RJT A;  2KSE A;  3B5I A;  1SQX D;  3SWF A;  3O8Z A;  4GR6 A;  3NTE A;  4OGQ D;  5AW5 B;  1N7S A;  3GG2 A;  2R44 A;  2PEN A;  3MP7 B;  3R4Y A;  3RL0 g;  4H2W C;  3S4R A;  4MN4 C;  2HOD B;  2KG8 A;  1AVY A;  3S1K A;  1VQ4 P;  1NTK D;  1EZV D;  2YMY A;  2V7Q H;  2EIA A;  2N9Y B;  2N1T B;  1VQ5 P;  2KIK A;  3L71 G;  2NZ2 A;  3PP5 A;  3V2N A;  1GW3 A;  3KQG A;  1BDD A;  1IFN A;  3TGU G;  2CG5 B;  1BE3 J;  3V2Q A;  1L0N G;  1T8K A;  1MFT A;  3FGA D;  1HBW A;  3PTZ A;  1RF1 B;  3M9H A;  2CNR A;  1JMB A;  1FZC A;  2IYP A;  1HF9 A;  2I8D A;  2YKO A;  1NTM D;  1S2E A;  1H89 A;  2KUB A;  4OGQ C;  5B5E E;  1P84 I;  2G8Y A;  1LT9 C;  1UNK A;  1ZRT D;  5CBO A;  3CX5 D;  3L75 D;  2GZF A;  1VQ9 P;  3CWB G;  2KW2 A;  1FDI A;  4ASV A;  1OW7 A;  2LTE A;  1PPJ D;  4BXL A;  4QKO A;  1Q2N A;  5F2N A;  1LWU B;  4NEO A;  5KLV G;  2GDW A;  1SQQ G;  1SQV E;  2Q3I A;  5AW2 B;  1RF0 C;  1L0I A;  5AVY B;  2MJZ A;  1NU1 G;  1EXJ A;  2VSQ A;  3U1C A;  1ZP0 C;  1T2K D;  1SQB G;  1BGY E;  2WPV B;  2Q7C A;  1PP9 J;  4XFY A;  1FU1 A;  2FVF A;  3LW5 H;  2IZ0 A;  1HGZ A;  2E5T A;  3PHL A;  1AFO A;  3CLQ A;  1PEM A;  1N7L A;  2KOR A;  1YJ9 P;  2YXQ B;  1NQ4 A;  3GF3 A;  4XFX A;  4IFF A;  1VPC A;  2WSE J;  1X8Y A;  4K35 A;  2IBZ G;  3KHU A;  2WSF J;  3RG6 C;  3A0H H;  1NOH A;  3H47 A;  1QVG O;  2GZI A;  1UII A;  3RK2 D;  5EJD A;  4IOI H;  1Q90 D;  3VMA A;  2JYL A;  1T2K C;  3M0D A;  2MD9 A;  2LIW A;  2FXP A;  2E74 B;  1RO0 A;  2HG5 D;  3H1L D;  1FDM A;  3L71 E;  1BE3 G;  1Y9B A;  4PH1 A;  2BCC G;  4PJ0 E;  2ROQ A;  2OYI A;  3U43 A;  1H0T A;  3SFD C;  2A45 H;  1N2D C;  3CCL P;  5F2K A;  3D70 A;  2JBG A;  4EOT A;  2YKQ A;  1X9V A;  3RK2 C;  4Z1M H;  1JNM A;  2K9J A;  4IL6 H;  3AE2 C;  2A45 G;  1MZ8 A;  1NVO A;  1J1D C;  3CWB E;  5KAI H;  2H7H A;  2XZ1 C;  5JPA A;  5M1B A;  2KK7 A;  5APX A;  1VQ6 P;  5KAF E;  3D71 A;  1EIA A;  2WPR A;  1FJP A;  5KKZ C;  1L0L J;  5KLV E;  1SQQ E;  1ZLL A;  4LGD E;  5CCG A;  1NU1 E;  2BAS A;  1OW6 A;  2A45 I;  1A02 F;  4R4M A;  2ZXX A;  3A5T A;  2K37 A;  5AVU B;  1SQX J;  4MRT C;  5CJ4 A;  1KB9 E;  1GL2 B;  2FXO A;  1K9M Q;  2Z4E A;  2HYN A;  2K3R A;  4EDF A;  2R3S A;  3R2P A;  5AW0 B;  5BS1 A;  3TNU B;  2YNY A;  2LXB A;  3GW6 A;  4COP A;  1URQ D;  1NTK J;  2O01 N;  1L4A B;  1FR2 A;  1AF8 A;  1YQ3 C;  1OWA A;  1S1C X;  1LT1 A;  3MGE A;  1ZOY C;  3F89 A;  2L91 A;  1NGM B;  2LPK A;  4ZMD A;  1SQV K;  1EQ7 A;  2IBZ E;  2YO2 A;  1NTZ J;  1U7M A;  4PD4 E;  3RL0 D;  1X3O A;  1W5C E;  2RKL A;  1LJ2 A;  3C1L A;  3W68 A;  4AUW A;  3L74 J;  5GTH H;  3H32 B;  1UJZ A; 
#chains in the Genus database with same CATH homology
 5BS2 A;  3HZQ A;  3HYB A;  4PH0 A;  1YIT P;  3VRL C;  1YHQ P;  2Z44 A;  5I4T G;  3DTJ A;  2XT1 A;  3CXC O;  3M1M A;  4XFZ A;  1Q82 Q;  4U0A A;  1W2B O;  1D1D A;  2PEQ A;  3I56 P;  1YJW P;  3P05 A;  4GR2 A;  3LRY A;  4M0I A;  4WYM A;  1VQP P;  1E6J P;  3CC4 P;  2M8N A;  3DPH A;  3B5I A;  2EG5 A;  2EFJ A;  1K30 A;  4U0F A;  1AUM A;  4GR6 A;  3CD6 P;  3G1G A;  1RO2 A;  1BAJ A;  3NTE A;  4U0C A;  2BQ1 E;  4XFY A;  1S72 P;  3CPW O;  1M74 A;  2DGY A;  3CC2 P;  1A8O A;  3DS4 A;  2BUO A;  2E1M A;  2PEN A;  3WBH A;  5HGN A;  5JPA A;  2BHV A;  2JYG A;  3G1I A;  4IPY A;  3CME P;  5HGL A;  1VQ6 P;  1EIA A;  1NJI Q;  2Z46 A;  2QA4 P;  3G4S P;  1VQM P;  1PEM A;  1YI2 P;  3G28 A;  3CC7 P;  3OW2 O;  5HGM A;  1YJ9 P;  1VQ4 P;  2M8P A;  1K73 Q;  1IUQ A;  1EOQ A;  3E2D A;  1VQ8 P;  1Q81 Q;  1VQL P;  2EIA A;  4QNB A;  4XRO A;  1M6N A;  2PEI A;  4XFX A;  1VQ5 P;  4U0E A;  1QRJ A;  3G26 A;  1VQK P;  2XXM A;  2PEJ A;  1VQ7 P;  1PEU A;  3RG6 C;  2JO0 A;  3DS0 A;  2LF4 A;  1RNI A;  1M1K Q;  1M6E X;  3CCM P;  5DCK A;  3H47 A;  1QVG O;  1Q86 Q;  1VQN P;  3CCQ P;  3G0V A;  1VQO P;  2QEX P;  2Z45 A;  1K9M Q;  1PEO A;  2PEM A;  3CCU P;  1QVF O;  1K8A Q;  2KOD A;  2CWO A;  3CCJ P;  2JYL A;  3DS3 A;  2PY8 A;  3G29 A;  3CCR P;  1A43 A;  5BS1 A;  3CCV P;  4COP A;  1RO0 A;  4XRQ A;  2PEK A;  4COC A;  1KD1 Q;  3H4E A;  3Q20 A;  3G71 P;  5F2O A;  3G21 A;  3CMA P;  1M90 Q;  2OTL P;  3I55 P;  3H0D A;  1PEQ A;  2XV6 A;  3MGE A;  5HGO A;  4U0D A;  4PH1 A;  1VQ9 P;  3CCE P;  1YIJ P;  2ONT A;  2L6E A;  4U0B A;  2OAR A;  1Q7Y Q;  1YJN P;  2M8L A;  3DS5 A;  2PEO A;  1ZMB A;  3G6E P;  1KC8 Q;  3DS1 A;  5F2N A;  2OTJ P;  3DS2 A;  1N8R Q;  1JJ2 O;  3CCL P;  2P9X A;  1KQS O;  3CCS P;  5F2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...