1YI2V

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yi2V00
3I55V 3CMEV 1N8RW 3G6EV 1KC8W 1K73W 1VQPV 1K9MW 3CCEV 1YITV 2OTLV 3CC2V 1VQMV 3CC4V 4WCEV 1VQNV 4WFBV 1R73A 1YI2V 1K8AW 3OW2U 1VQ6V 1VQ9V 1VQLV 3CCUV 5DM6V 1YJNV 1VQ7V 3CPWU 1YHQV 1YIJV 3CXCU 3CCSV 2QA4V 1YJ9V 1KQSU 3CCQV 1VQOV 1S72V 1W2BU 1Q7YW 1Q82W 1Q86W 1QVFU 3CCMV 1VQKV 1NJIW 2QEXV 1KD1W 4WFAV 3CCLV 2OTJV 3CCVV 3CC7V 2D3OW 4WF9V 3CMAV 3I56V 1VQ8V 1JJ2U 1M90W 1VQ4V 1Q81W 1QVGU 3G71V 1VQ5V 1M1KW 3G4SV 3CCRV 3CCJV 3CD6V 1YJWV
chains in the Genus database with same CATH superfamily
4ABMA 2ZM6O 1G1XB 2R9AA 5LHGA 4WFGA 3JATB 1NH2D 3ZMVA 3E8BA 3L75H 1XNRB 5DM6V 2LW7A 4NVPA 5EYPA 2EIJB 4DV2B 2QM4A 5BY1A 4NTXA 3U0ZA 2UXDO 1XHZA 1IBKO 3RYCB 3AG7A 2E76B 3CXHF 1BQZA 2QR4A 1GTOA 5LXTB 2CGOA 1V54C 4LF9B 1GM7A 5FNVA 1AROP 1Q43A 3JCZA 2EJ7A 2Y0PA 3CCQV 5LYJA 1OCOB 2CK3G 1PV0A 1GO3F 5FLXN 3CMAV 3Q4HA 1QVGU 2LP7A 3FB5C 3E86A 1E79G 3K03A 1GK9A 5CBHA 3A8TA 4I50A 1VF6A 1XNQO 3HKEA 4NXNO 4UVBA 2GSMB 2RNBA 3UT5B 4LBEC 2ZNIA 4D7SA 2HHHB 5JWPA 2CH7B 2VQEB 1RFYA 1YXBA 2L35A 2LFSA 3CP1A 4JAUA 4K0KO 1GAXA 3KCYA 4PHZA 1JVMA 4EFBA 2IJKA 4UUJC 1K4CC 5A9GA 1N0JA 2AHZA 3BABA 2P22C 1KKCA 1TGOA 2F93B 4AQYB 1N34O 3ZHRA 3ASOB 1JJOA 2GUZA 3WG7C 5LGUA 4QPKA 5GTIZ 3CX5F 3LNMB 2EBOA 4I55A 5CB4A 1NR7A 1R3KC 3LDDA 3UQ8A 4LFCO 5FPOA 4P30A 3QO8A 2JEXA 3HKDA 5LHIA 1TUEB 3SJCC 1T5EA 2BE3A 4A5UB 5LMNO 5FNVB 1ZL8A 1SKVA 5EBMC 4JI0O 5LYJB 2DYRB 4B7EA 4IYIA 3Q4HB 2AHYA 2ODMA 1GN2A 2NLJC 3E89A 2JIZG 2IJIA 3AK2A 5EIBC 2HFEC 3WB0A 1GRJA 3EVKA 3UO2A 4JI1B 4X66O 3JD1A 2Y4UA 3HKEB 3FYEB 1M56C 4DRXA 4Q6GA 5D5PA 2RDCA 5HFMA 1EFRG 2PTMA 1W2BU 5ITZA 4W4LA 4UV9A 4U7OA 4X65B 1JFFA 1I08A 5TISZ 5CMUA 4AHCA 3M8AA 3ICXA 1URFA 1XL4A 2GUZB 3OW2U 2CUGA 3H1HH 1YHQV 4CH5A 2V1DA 3FD9A 1R3IC 2VWJA 5CB4B 1V9PA 2YICA 1BS3A 3J7AU 5KHKA 1QBZA 3HKDB 1FXKC 1Q81W 1GN4A 2QJ1A 5DEDA 4DR3B 1DF5A 1OCRC 3CC4V 2GDSA 2Q69A 5KAFZ 2UUBB 1H2GA 3SYOA 4P9PA 2KG7A 5KLVH 4JI7O 4UCRA 3T1YB 3K5OA 4DW0A 5J2TA 4I4TB 3CCLV 4PDMA 2WLNA 4DR2B 2GV9A 4DW1A 3T4ZA 2V7QG 5IJ0A 4JAVA 5LOVA 1H38A 3RFRA 4J7KA 3RBZA 1QLNA 1SS3A 3BA9A 3JARB 4DRXB 4H0LB 4GCZA 4FJCC 3JAWA 2Q73A 4JAAA 2GTSA 5E1AC 3ABLC 4JYAB 3CRMA 2ZKOA 3JALB 1JFFB 3N2GA 2FTKA 1XQ8A 2DMXA 3L70H 3ZMUA 2ZNJA 1K9MW 1G4YB 5EC2C 3AK1A 4OPAA 1K97A 4IYHA 2B1IA 2CTQA 5H6RA 5B1AB 5FPRA 2B9ZA 1Y67A 2YEVA 4LP8A 4TOIA 4JYCA 1ZSPA 3THOA 4FLWA 1AJPA 1P4RA 4F6EA 1YVWA 5KX5A 2Q0AA 3AG2B 3ZRVA 2AZ0A 1VQNV 1B6QA 2DWDC 1AR1B 1DK1A 1OV9A 2RMKB 1R6TA 3AG1B 3OR6C 1PM9A 3DSQA 5IJ0B 1BHBA 4KL1A 2FKXA 1FXHA 2Q0OC 3SGIA 3E35A 1WB8A 5IYZB 3JAWB 4X88A 3OGCC 5B66Z 1IBLB 4WFEA 1IDSA 3N2GB 4JI2B 1BZKA 1V55C 4GUNA 2CTWA 1HNWO 4BW9A 1SETA 4X20B 4DR6O 1FFTB 2EINB 4LFAO 3ZEDA 3LDEA 4DV7O 3JD4A 4FFBA 2P4KA 2YEVB 2XAJA 3EHBB 3K0GA 1HP8A 1N33O 2DQ3A 2BSKA 4CS3A 3ETEA 2CTRA 1BT8A 3GWOA 4LH6A 3K5LA 4UVCA 4KHPO 3CCEV 3G80A 2ZIMA 3ETDA 3LSUA 1K5SA 4J41A 1IBKB 3VQVA 3ZHUA 2ZCEA 5L3GA 3K57A 2EIMC 4DV6O 2EZPA 3RW0A 1SESA 4J10A 5H5NA 1H2SB 3CD6V 2Q6AA 5LHHA 1G8MA 4ZBMA 1MZEA 2YIAA 3OTFA 1GMGA 1FKAO 2ITDC 4DUYB 1Q82W 1D2DA 5CBFA 2NR5A 4XDJA 3JSNA 3P3NA 1KD1W 4YIOA 4CC5A 4GX1A 2LO1A 4NYKA 4B3RO 4FFBB 2IU0A 1Y6XA 2LGWA 1F7YA 1AI4A 4K3AA 4FLZA 1R73A 5CA3A 3HKCA 4K0KB 4KXRA 3NXSA 1FFXA 4GKKB 2BSKB 1PKXA 5JCOC 3RVZA 5IWAO 3TJTA 3CCVV 1N34B 2QKAA 3HKBA 3JD2A 1YSCA 2A79B 2RJZA 4OX9O 2PY5A 3ABUA 4DV3B 3K9SA 4CH6A 1UFIA 4LFCB 3CCUV 4AI8A 4D6TH 4ZOLA 2YI9A 5LMNB 3X2QC 4DV1O 3BPZA 1PPJH 1NI8A 3JYCA 2WSSG 3FB6C 3ETQA 1O9HA 1OCCC 1I7FA 1N8RW 3L71H 5LMUO 1GKFA 1M57C 1V54B 1VQMV 3B09A 2LGQA 3VQWA 4BIZA 2E5LO 5JH7A 3SJQC 4X66B 4H33A 4UCSA 2ETNA 4YXWG 4LF5O 1PD3A 4CBCA 3KCXA 1KP2A 4PJ0Z 4WBNA 4U3FH 1MMMA 4B3TB 4JI8B 2IJHA 3BCCH 1LNQA 1YEWA 2XAFA 4OXSA 1J5EO 3CCJV 2UXBO 3OTOB 2QSAA 3FAVB 3HKCB 4IL6Z 1RPRA 1VARA 1Y74A 2HVKC 2M6YA 3TETA 4QIWF 1QVFU 3HKBB 1MSDA 4FM0A 4X1IA 4YY3O 4DUZB 2OCCC 2X6AA 1QNMA 4DYLA 3CHXA 5GW7A 2DJVA 2W0FC 1E1QG 2ZE7A 3P30A 2QTOA 4DR7O 1GM9A 3WG7B 1K4DC 4LF4O 4GT1A 4I9QA 1JA8A 4JI5O 4UB8Z 4O4JA 2WPDG 1FXKA 3FFQA 3H1LH 4JI7B 3RT3C 2Y69C 1U97A 5GONB 3WB2A 4NTYA 5JH7B 4JZ2A 1F23A 2UXCO 4WBNB 2JEUA 2QGNA 1KMIZ 1VMGA 1Z2GA 4GX2A 4JI3O 1L0LH 3F7VC 1NQTA 4LC1A 4BW5A 1H8EG 3E83A 2JS3A 5L3BA 5EBLC 1KUQA 1VQPV 1M56B 2UU9O 3CRQA 4BIOA 2ZDIC 4X1IB 3WFVA 1XI1A 5K1XA 1Q7YW 1COWG 4PA4A 3W7XA 2P90A 1AR5A 5KA6A 3ZN1A 5IY5C 1IBMO 3QO5A 4CZZA 3CMEV 1AJQA 2YDEA 1HNXO 4AILC 1AR4A 1L1FA 3W7WA 4TQDA 1ZWIC 2IU3A 4LH7A 5H6QA 4RUEA 4O4JB 1HDJA 1FXKB 2WLLA 2AW9A 5EZYA 1PNMA 3TXQA 4CC6A 3B8NA 1I94B 1OCRB 3L9DA 2JRIA 1Y4MA 2R72A 2HKOA 4HZ3A 4TV8A 1NBMG 3W7SA 2YXYA 5BR8O 1WA8A 3BAAA 1EBOA 3KZIZ 1BGYH 2UUCO 5B1NA 2A06H 2CE4A 4J42A 4U7NA 4NTWA 2DN9A 1TAEA 3D3QA 3F5TA 4PELA 3LSSA 1L8DA 2DWEC 2YC0A 2YXHA 3EXAA 4K35A 4N21A 1YITV 2OTLV 5J9PC 4FVMA 3ABKC 4DR1O 4H44B 4LFAB 4DV7B 4L87A 3UKMA 4B3SO 5L3FA 3SJAC 4IHJB 4ZHQA 4IIJA 1ZX3A 1Q6UA 1VQ5V 5D5QA 1WNSA 2CAZC 3H01A 2ZQMA 3B77A 4C7UA 2Q7HA 2O57A 4UV8A 3RVYA 4TT3G 2Q8VA 4LCUC 1Q6IA 5JJJB 2PI5A 1BHAA 2WLLB 3WB1A 5EZYB 1DTOA 3S3XA 2P4VA 2OCHA 2KKWA 4FLVA 2EIKC 4CS2A 1RM1C 4RWUA 1NS1A 4TV8B 4QNHB 1M1KW 4I4TA 1WA8B 2QEXV 1P84F 1D5AA 4LF8B 1CEZA 3CB2A 3VQYA 3JARA 1QQCA 1IVSA 1CXZB 3UO3A 1QCEA 3D36A 4FMTA 5JVDA 4JYYA 3OMAB 2N74A 1SA0A 1OHHG 1VQ4V 5EK0A 4FK5C 4O4IB 2DE0X 4Z1VA 3E2EA 4IGGA 3JALA 1XL6A 2QWNB 1N36O 2Z3YA 1M93A 1VQ6V 3K79A 4MTFA 4I9WA 4LF7O 3DXRA 3QO7A 2BOBC 2UUAB 1V55B 2F4VB 1SRYA 4ZHQB 4IIJB 4ASUG 3J80N 2EULA 4LFBO 3ZHTA 3ZX6A 1S3JA 3DC6A 2VRZA 3CWBH 2P5OA 1MSWD 2XAQA 4L8JA 1LUWA 5LP6C 1AP6A 2YS8A 4OX9B 2Q68A 1NVPD 2WLHA 4UVAA 4EEQA 3SPIA 5DN6G 2EILC 2RCVA 1TVKB 2XNDG 1EN4A 5JCOA 1A32A 3KG2A 1FPOA 3IFXA 3HPLC 3VOUA 3CS5A 4JF3A 4LF6O 1Y76A 4DV1B 3QTCA 2NN4A 3KKYA 1UPGA 4R50A 2P7TC 3QF7A 3SYCA 2X6CA 3LSQA 5IYZA 5LBQA 3K0DA 3MDSA 1RPOA 5JVDB 2WLMA 4N23A 1SA0B 1TUBB 2EZOA 2EIMB 3ZMZA 2Y0IA 4DV5O 2A7WA 4X8AA 3IGAC 1B04A 2GHYA 3F7YC 5C93A 4LF5B 1X59A 1JR9A 2WLKA 1BMFG 1NKDA 4X20A 3K3WA 3DXRB 1HR0O 2HJFC 4TUYA 1VEWA 1J5EB 4MTOA 4ZI7B 4PA6A 3AK3A 4GLXA 3CYOA 3BA8A 3I56V 2XASA 3CJHA 4YY3B 1S76D 2FL4A 2ZE5A 1Q90D 2DW4A 3I5DA 1AB3A 1BCCH 2ARHA 3RYFB 1XBLA 1LR1A 2NNUA 2DYRC 5IYCO 4TWKA 4DR7B 1Y76B 3JSLA 3K04A 2FMLA 1RP3B 3BVOA 1K33A 3ZRWA 4JI5B 1VF6C 2F23A 3G6BA 4LNUB 2XT9A 5J2UB 1Q5OA 4PD4F 4RUFA 2CTPA 2IW5A 5CN0A 5FL7G 3TXSA 3M99B 3X2QB 1CPYA 1S5HC 2OIEA 3JD3A 4JV5O 3LUTB 5L3EA 2DYSB 4I5SA 4K8XA 1OCCB 4HNAA 2UXCB 3STZC 1ROPA 1M57B 2QDOA 3B2EE 4TUYB 4JI3B 3P32A 3QNEA 2VQEO 1FJGB 2JJ2G 4RQFA 4O2AA 1SZXA 3GWKC 1PNLA 3BY6A 1B06A 1H2MA 2AGAA 1UJWB 2ZM6B 2UU9B 4EB6B 1IXBA 3CJHB 1QHTA 4J9YB 5KHGA 3K5NA 4R7CA 2QWOB 1WPXA 3OMIB 1DLBA 4PA3A 4FLXA 3E8GA 2UXDB 1Z5VA 1EN6A 1IBMB 3O65A 3CE2A 5C8YA 1HNZO 2QA4V 2OCCB 4ICGA 4X89A 4WFAV 1R6KA 3MHSC 4DR4O 3ZRWB 1Y66A 4DV0O 2EJRA 4YJ2A 4HYOA 3ETGA 4FLUA 1XILA 3K08A 4QPJA 2CDYA 2JDIG 1NH2B 4Q20A 2IM9A 1F4NA 3ZBHA 5BR8B 1Q86W 3ASNC 4HNAB 1XNQB 1I5XA 4JASA 2HJDA 3ABMB 4NXNB 2Y69B 2PZSA 2ADQB 2JGUA 2WA4A 3I55V 4RQEA 4Z1MG 3FX7A 3O9OA 4O2AB 2W0XA 3OR7C 1YDXA 1XOUA 2IBZH 2Y4TA 4LWSB 3FAVA 2PUSA 3OUSA 4X65O 1HW7A 4D7TA 1IURA 1QLEC 1US6A 4DR1B 1XUQA 3APQA 3T1CA 2WAMA 5LA6B 2PGGA 3BFRA 4UCTA 4O4LA 1KU9A 2Z0AA 2Z5UA 3G6EV 4YHHO 3JASA 5C8YB 4B3SB 1OCZC 4TSFG 2X0LA 5B1BC 2Q7GA 4DXWA 1P7BA 2WLJA 1EZJA 4DR3O 1R1BA 1U96A 2UUBO 5IY5B 3SR2C 2XAHA 2A3QA 4KP4A 4JI0B 4YJ2B 1GH6A 1ZTEA 3T1YO 3C3SA 2HVJC 2LFRA 3C3TA 1K34A 4UFZA 3SJBC 2H3OA 4DR2O 4KFMA 5GONA 3E8FA 4FM1A 5KUMA 4JZGA 2QWRB 5CBGA 1VQOV 3JAMN 5L3DA 3CRAA 4X1KA 1QR8A 4NKGB 1SQFA 1IZ3A 3B40A 1K92A 1M5IA 3TK1A 4QE9A 1JMKC 4O2BB 4RAIA 2ATKC 2DQ0A 4DO2A 3ZIAG 1JOYA 5GTHZ 1K8AW 2BTOA 2VQFO 3ZJZA 2X6BA 1D5NA 1OZ0A 1YTFB 1N36B 2HEPA 2QM8A 1YF2A 4BAYA 4O4LB 5B3SC 1P49A 2F43G 5KMGB 3AEIA 4BR6A 5JQGB 3JASB 1K73W 2R9IA 3ABKB 1Z5WA 1P7GA 1VP7A 3SPJA 4WFBV 2WA3A 3JD0A 4MVUA 3QG5A 1N32O 5BMVA 1N4CA 3W7TA 4FLYA 2VWKA 2IJJA 2XOKG 4J80A 1X4TA 2F66C 1M9NA 2B5UA 3JAKA 2IH1C 2JS5A 1EM1A 1K7DA 2QKSA 2MW2B 2G38A 4MS2A 4CH4A 4LF6B 2LQTA 4X1KB 1S72V 3D3IA 1MOFA 4WFFA 3CCMV 1RM1B 3CC7V 3P3PA 1MG1A 5L3CA 1SQPH 2C2AA 2WLIA 2YXLA 4DV5B 1SQVH 4JI2O 1B3QA 1XHXA 5BZBA 1VQLV 3H1KH 1YIJV 3AG3C 2W6IG 2V4DA 1KQSU 4KUMA 1WB7A 1FXVA 2YI8A 1N0NA 3OEHG 2JGDA 2QM7A 1KBHA 1W0KG 4MTGA 4IHJA 4I0XA 3DTUB 3AG4C 3L74H 5CA0A 1WJZA 5BMVB 1AI5A 3ZHQA 2ZR3A 1WLEA 3PN1A 2AZ2A 4TQFA 5EBWC 2Q4PA 1FS0G 1JCHA 3JAKB 1VQ8V 2CGNA 3F5WC 1XMOO 2ZXWC 5LP6B 3ZS8C 4Z2WA 3CC2V 2XHBA 1LUVA 1KB9F 3SYQA 3MD0A 2EILB 4FIPC 2ILMA 2W6JG 3CSXA 1XDCA 4B3MO 2XUMA 2OTJV 4FM2A 2WLIB 4JV5B 4PV1B 5B1OA 2HR3A 4GKJO 1SQBH 4DUYO 5IJ9A 4O4IA 2PI4A 5F2VO 2P6JA 4PI0A 3K06A 4GX0A 4JTAB 1HNWB 1PNKA 1R3JC 2P06A 3ABLB 4FFKA 4DR6B 2JGDB 3SPHA 2OYQA 2A0LA 4I0XB 2YIBA 1VIBA 4GKKO 5CA0B 1KC8W 1WP7A 1N33B 5EYPB 4PI2A 3IJ4A 2KB1A 4XDKA 4MVQA 3ZN0A 2Q9LA 4MT8A 1Q6HA 1S5JA 4DV3O 4KHPB 5EC1C 1KP3A 2FYUH 1JPXA 1TVKA 3EFFK 1XREA 3J81N 1HNZB 1AVMA 2YSUB 2HG5C 2LJ2A 1AJNA 4JI6O 4DR4B 3CRCA 4DV0B 4DV6B 4R6ZA 1RSOA 1YTFD 3IAYA 1F51A 2Y48A 5AG2A 2JJ1G 3W7UA 3CCSV 4R8CA 2QWPB 1TUBA 4I50B 5IJ9B 3G71V 1SQQH 1XMQO 2A9HA 1YJWV 5KHIA 3U10A 2LW1A 3UCSC 3IC9A 3SPGA 3G67A 4PA9A 4B3TO 4JI8O 1FAFA 3FYIB 3T1HO 2H94A 4B3RB 3OTOO 4DK1A 2EIJC 4ZI7A 2RQ6A 4BIUA 2ZR2A 5LL6Y 3BRCA 4H37A 5IWAB 3OM3B 2DOSA 5KA5A 3CEIA 1WP8A 4DUZO 1XEQA 3JCUZ 1NR1A 1YJNV 4X64O 5IYDO 3R66A 3QVNA 4HAMA 4QGPA 4I55B 1WAZA 1MA1A 2E75B 3H9VA 5EIBD 4YHHB 1I0HA 2F95B 4LR3A 4MTXA 1M4UA 5HFLA 2KQXA 3RYFA 1G6UA 3H1JH 4JI4O 3E22A 1OCOC 1ZL8B 3BEHA 4DV4O 3FB8C 3DGEA 1W0JG 3RWRD 4E2LA 4X62O 2ZE8A 3NR7A 2OWOA 1NTKH 1RSOB 2KSDA 4UCOA 2P67A 2FB5A 1J95A 4LNUA 4GX5A 5J2UA 4NXMO 2AXTZ 1HWYA 5BXZA 2Q67A 2RN9A 5DECA 5LMUB 4DR5O 1PL0A 2E5LB 1ORQC 2JK5C 3G4SV 3HR0A 3K59A 3RYIA 3LDCA 5ITZB 2IH3C 3ASNB 2UXBB 3ASOC 3TCUA 2VQFB 4J7ZA 2XTAA 4H13B 3VQXA 1S5LZ 1XNRO 3E8HA 1ZAUA 4JTCB 1K3EA 4EB6A 1KYOF 4FLTA 5IT9N 4DV2O 4PDLA 1KECA 1YCIA 4YJ3A 5A2QN 4MVSA 1ZLZA 1DF4A 3OD4A 4NR1A 2H8PC 3OEEG 1MZFA 3A0RA 2GBOA 1WN7A 2QE7G 3E22B 1QLEB 4ZKIA 3WU2Z 4JTDB 2YIDA 3UM7A 2F1MA 4LF9O 1N32B 4LF4B 5H9CA 3T4DA 3FB7C 3R65A 4G2KA 5JJNB 4MW8A 1OCZB 3VBBA 2KG7B 1MNGA 4QE7A 5B1BB 2BTQA 3S3WA 4RO2A 5J2TB 1I94O 1S77D 4UCUA 3LNNA 3RGBA 1CP9A 4EFEA 1AP5A 5LOVB 2OT5A 1QR9A 4J11A 2PYJA 2X7RB 4X9QA 1GN3A 3APOA 3OFNG 1SQXH 3HB3B 3RYIB 2N05A 4GZRB 4MVOA 2HP8A 2R70A 3STLC 1IX9A 2ZT9B 1VF7A 2HHHO 3MHHC 3D8CA 4PDRA 4EKWA 2Q5ZA 3K58A 3DC5A 4FPPA 4LWSA 4MVMA 4O4HA 4YIPA 3L72H 1WPBA 2PF4E 4AQYO 4YJ3B 3ZHVA 3N2KA 1SF9A 4HBNA 5LA6A 4UB6Z 1YI2V 2VS0A 4W4KA 2GTAA 3TGUH 2ZDIA 1HNXB 5B3SB 1ZUQA 2WWWA 1IXMA 5KX5B 2ADPA 2E74B 4OPHA 5LGTA 1BQ0A 4U3JA 1S0VA 1E1RG 4MSWC 3OMNB 4DK0A 1EZVH 2BTQB 4PA7A 3C90A 4P9OA 3ABTA 1XMOB 4B08A 4F6RA 1NZ6A 3D36C 4F4LA 2B1GA 1ENVA 1FD9A 1Q8IA 2YIBD 1W59A 4JI1O 2BOCC 4IT5A 4LF8O 1GM8A 2UUCB 2QTSA 3N27A 1R3LC 1JX9A 5KHJA 4B3MB 4O2BA 4JPRA 3OAAG 3RN4A 4PDVA 4GKJB 2K9PA 4BWAA 5KUKA 4O4HB 4FZ0A 1OJHA 1KKDA 4CS4A 5B1AC 4J9ZB 1NJIW 3SYPA 5E79Z 1K5QA 3N2KB 3H1IH 2E3CA 4E4EA 3U11A 3A2FA 2UUAO 5KMGA 2F4VO 4QJFB 3AG2C 3A0HZ 4JGSA 5JQGA 3AG3B 4X1YA 1H2NA 1VQ7V 4CH3A 5IYBO 2ITCC 1YJ9V 3OE7G 3OT7A 1R6NA 1I5YA 1BSMA 1H8HG 3ZMSA 2UXXA 3AG1C 3ML0A 1NTMH 2JVDA 2EX3A 4U3JB 1M90W 3IC7A 1QU7A 3BHPA 3RYHA 3SPCA 2L6LA 4MVZA 1O9GA 4UCVA 1FYJA 3AG4B 3CRRA 1YZBA 1PP9H 1F4MA 4F6RB 2ZD9A 2MK3A 1NU1H 1PL4A 5KHHA 4JI6B 5K1PA 2DYSC 3B8MA 2YUAA 2ZXWB 3A0BZ 3GVMA 1MABG 3OGIB 5H2FZ 5CA1A 1Q3EA 2BCCH 4JYAO 2EINC 3ZCCA 1VQ9V 3L73H 1XMQB 1SERA 1BL8A 4TV9A 1H2KA 3ZMTA 4B7KA 3ZHSA 3ZRSA 3T1HB 3K5MA 4LF7B 3M7MX 2ZIOA 2UXNA 4MW3A 4X1YB 3B4SA 2M7WA 1FFXB 4WCEV 1NTZH 4LFBB 4XBFA 4K8ZA 2PYLA 2OIGA 3CPWU 2Q7EA 3FKSG 3JATA 3K9AA 4MVRA 5B5EZ 3ZRXA 1AI7A 2K1EA 1NT2B 4XDLA 3RYHB 2QKCA 1H2LA 1JJ2U 4X64B 5IDJA 3OUFA 4GYCB 3GB7C 1TA8A 4FZ1A 4JI4B 3RYCA 4ZOLB 1BE3H 5JJEB 5LP6A 2ZINA 5LXTA 4UXNA 4DV4B 3SDLA 4ZIBA 4J7JA 1JQ0A 4NB5A 1DGSA 4X62B 2D2CB 1SZTA 2R9RB 4G28B 2EIKB 1VQKV 1L0NH 1GN6A 2D3OW 4WF9V 3MAQA 4G27B 4NXMB 5CA1B 1IBLO 3ABMC 2HLDG 1EN5A 3SYAA 2N04A 5KAIZ 4DR5B 3T2MA 2XAGA 4I7ZB 1AI6A 5IE9A 4JYBA 1SQGA 4TV9B 1AILA 1SC5B 4WFHA 1NVPB 4P2ZA 3CXCU 3UT5A 2QWQB 1HR0B 4OGQB 5LGNA 1FJGO 2ZE6A 1VF5B 1THZA 2CH7A 3PJSK 1Y74B 3CCRV
chains in the Genus database with same CATH topology
5LHGA 4WFGA 4RUFA 1NH2D 3ZMVA 3E8BA 2IW5A 3SPGA 3CCUV 5CN0A 5FL7G 4PA9A 5DM6V 3M99B 3X2QB 1CPYA 1S5HC 2EIJB 3FYIB 2H94A 3JD3A 3X2QC 2EIJC 3LUTB 3JYCA 5L3EA 2WSSG 2DYSB 3FB6C 4I5SA 1OCCB 1OCCC 4BIUA 2ZR2A 3STZC 1ROPA 1M57B 1N8RW 4H37A 1GTOA 1GKFA 1M57C 1V54B 3OM3B 3P32A 3QNEA 5KA5A 1VQMV 2JJ2G 1V54C 4BIZA 4RQFA 1GM7A 1NR1A 1YJNV 3SJQC 1PNLA 3BY6A 5IYDO 1AROP 4HAMA 3JCZA 4H33A 4YXWG 1PD3A 3CCQV 4CBCA 1UJWB 4MTXA 1KP2A 5HFLA 1OCOB 2CK3G 1GO3F 4J9YB 1OCOC 3CMAV 3CCRV 1QVGU 2LP7A 2IJHA 3FB5C 1LNQA 2XAFA 3E86A 4OXSA 1E79G 3BEHA 1GK9A 3K03A 3FB8C 3CCJV 5CBHA 4R7CA 3DGEA 1W0JG 4E2LA 1WPXA 3OMIB 1DLBA 4PA3A 1RPRA 3E8GA 2P67A 2HVKC 1J95A 4GX5A 3TETA 4UVBA 2QA4V 1HWYA 2GSMB 4QIWF 2Q67A 4LBEC 1QVFU 2OCCB 1PL0A 4X89A 4WFAV 2OCCC 1R6KA 3MHSC 3ZRWB 2X6AA 1Y66A 1ORQC 2LFSA 3CP1A 4JAUA 2EJRA 1JVMA 2JK5C 2IJKA 3G4SV 4UUJC 5GW7A 1K4CC 2W0FC 2AHZA 4HYOA 1E1QG 3ETGA 3P30A 2QTOA 3LDCA 3K08A 4QPJA 1GM9A 3WG7B 2JDIG 1NH2B 4Q20A 3ASOB 1K4DC 2IH3C 4GT1A 3WG7C 3ASNB 5LGUA 1F4NA 3ASOC 4QPKA 1Q86W 3ASNC 3TCUA 3LNMB 2EBOA 1I5XA 1NR7A 4JASA 1R3KC 3LDDA 2WPDG 1FXKA 3ABMB 4P30A 3E8HA 3QO8A 4JTCB 1K3EA 2JEXA 2Y69B 5LHIA 1TUEB 3I55V 4PDLA 2Y69C 1KECA 4RQEA 4Z1MG 4MVSA 3OR7C 1DF4A 5EBMC 2H8PC 1F23A 3OEEG 3A0RA 3OUSA 2DYRB 2JEUA 2QE7G 1QLEB 4ZKIA 2AHYA 2NLJC 3E89A 2JIZG 1QLEC 4GX2A 2IJIA 3T1CA 2HFEC 2WAMA 4JTDB 3F7VC 1NQTA 4LC1A 4BW5A 3UM7A 1H8EG 5H9CA 3T4DA 3FB7C 3R65A 4G2KA 3E83A 3JD1A 5L3BA 4MW8A 5EBLC 3G6EV 2Z5UA 1OCZB 1VQPV 3VBBA 4QE7A 1M56B 3FYEB 1OCZC 5B1BB 1M56C 4TSFG 2X0LA 5B1BC 4RO2A 4DXWA 1P7BA 2ZDIC 2WLJA 1EZJA 1S77D 5HFMA 1EFRG 3WFVA 1CP9A 1W2BU 1Q7YW 1COWG 4PA4A 3W7XA 2OT5A 2P90A 5IY5B 1QR9A 4UV9A 5KA6A 2X7RB 2XAHA 3ZN1A 4KP4A 4U7OA 5IY5C 3QO5A 4CZZA 3OFNG 3HB3B 3CMEV 4MVOA 1AJQA 5CMUA 3STLC 2HVJC 2LFRA 1K34A 1XL4A 3MHHC 1L1FA 3OW2U 3W7WA 1ZWIC 4KFMA 2IU3A 4PDRA 4EKWA 1YHQV 5H6QA 2V1DA 3E8FA 4RUEA 1R3IC 5KUMA 5CBGA 4FPPA 1VQOV 4MVMA 5L3DA 1FXKB 2WLLA 1QR8A 1PNMA 1QBZA 1FXKC 1K92A 3TK1A 1Q81W 4QE9A 3B8NA 1OCRB 4RAIA 2ATKC 2DQ0A 4DO2A 1DF5A 1OCRC 1Y4MA 2HKOA 4HZ3A 3ZIAG 1NBMG 3W7SA 1JOYA 3CC4V 2Q69A 1H2GA 1YI2V 1K8AW 1EBOA 3SYOA 2X6BA 3ZJZA 4P9PA 5B1NA 1OZ0A 1YTFB 4U7NA 2ZDIA 2QM8A 5B3SB 3CCLV 2WWWA 1IXMA 4PDMA 2WLNA 4BAYA 4PELA 2F43G 3LSSA 5B3SC 3AEIA 3T4ZA 2V7QG 4JAVA 2DWEC 1H38A 5LGTA 1S0VA 1E1RG 4MSWC 3RBZA 3OMNB 1K73W 1QLNA 4N21A 4PA7A 2R9IA 3ABKB 1YITV 2OTLV 5J9PC 3SPJA 4WFBV 3ABKC 4GCZA 4P9OA 3JD0A 4FJCC 4MVUA 3ABTA 5E1AC 3ABLC 4F4LA 2B1GA 3W7TA 1ENVA 2BOCC 4L87A 2XOKG 2IJJA 3UKMA 5L3FA 1GM8A 2FTKA 1M9NA 2B5UA 1VQ5V 2IH1C 3ZMUA 3H01A 1K7DA 2QKSA 1R3LC 1JX9A 2ZQMA 3B77A 1K9MW 1G4YB 5EC2C 4JPRA 4UV8A 3RVYA 3OAAG 1K97A 4MS2A 4TT3G 4LCUC 4PDVA 5KUKA 2B1IA 5H6RA 5B1AB 2PI5A 1BHAA 2WLLB 1KKDA 1DTOA 1S72V 5B1AC 4J9ZB 3D3IA 1MOFA 2YEVA 4LP8A 4WFFA 3CCMV 1RM1B 1NJIW 4JYCA 2EIKC 3SYPA 1K5QA 3CC7V 1AJPA 1RM1C 1P4RA 1MG1A 4QNHB 1M1KW 5L3CA 2QEXV 3AG2B 2C2AA 2WLIA 4QJFB 3ZRVA 1VQNV 3AG2C 1B6QA 2DWDC 4JGSA 1AR1B 1CEZA 5BZBA 3AG3B 1VQLV 1VQ7V 1YIJV 3AG3C 5IYBO 2W6IG 2ITCC 1YJ9V 3OE7G 1KQSU 1R6NA 3AG1B 1QCEA 1I5YA 3D36A 3OR6C 1H8HG 3ZMSA 4FMTA 4KUMA 2UXXA 3AG1C 1BHBA 1FXVA 3ML0A 3OMAB 1FXHA 1OHHG 3OEHG 1VQ4V 1M90W 3IC7A 5EK0A 4FK5C 2QM7A 3SPCA 4MVZA 3E2EA 3AG4B 3E35A 1W0KG 4MTGA 3DTUB 3AG4C 4X88A 1XL6A 1F4MA 2Z3YA 3OGCC 1AI5A 1VQ6V 2ZR3A 3K79A 1WLEA 2ZD9A 2MK3A 4MTFA 4I9WA 4WFEA 3QO7A 2BOBC 5EBWC 1V55B 1FS0G 1JCHA 1SRYA 4ASUG 1V55C 2DYSC 3B8MA 1S3JA 1VQ8V 2ZXWB 3F5WC 1SETA 2ZXWC 1MABG 1MSWD 2XAQA 1FFTB 2EINB 3LDEA 3JD4A 3CC2V 2EINC 3ZCCA 3SYQA 3MD0A 2EILB 1VQ9V 4FIPC 2Q68A 2W6JG 1NVPD 2WLHA 4UVAA 3SPIA 5DN6G 2YEVB 2EILC 1SERA 2XAJA 3EHBB 1BL8A 3K0GA 2XNDG 2DQ3A 3ZMTA 2OTJV 3KG2A 3ETEA 3ZRSA 3GWOA 3IFXA 2WLIB 3HPLC 3VOUA 5B1OA 2HR3A 4JF3A 4UVCA 2UXNA 4MW3A 4R50A 3CCEV 2P7TC 2M7WA 2PI4A 2P6JA 4WCEV 3K06A 4GX0A 4JTAB 3SYCA 3ETDA 4XBFA 1PNKA 1R3JC 1K5SA 2X6CA 3LSQA 5LBQA 3K0DA 3ABLB 3CPWU 3FKSG 1RPOA 3K9AA 2WLMA 4MVRA 3ZRXA 1AI7A 2K1EA 4N23A 5L3GA 2EZOA 4XDLA 2EIMB 3SPHA 3ZMZA 2EIMC 2A0LA 2EZPA 3RW0A 5IDJA 1JJ2U 4X8AA 1SESA 3IGAC 3F7YC 2GHYA 5C93A 3OUFA 3CD6V 2Q6AA 2WLKA 3GB7C 1KC8W 1BMFG 5LHHA 1G8MA 4ZBMA 1NKDA 3K3WA 2HJFC 2KB1A 4XDKA 4MVQA 4MTOA 4UXNA 3ZN0A 1GMGA 1JQ0A 4MT8A 4PA6A 2ITDC 1Q82W 1SZTA 2R9RB 4G28B 2EIKB 1VQKV 5EC1C 5CBFA 1KP3A 3CYOA 1KD1W 4XDJA 1JPXA 2D3OW 4WF9V 3I56V 3EFFK 4G27B 2XASA 4GX1A 3ABMC 2HLDG 3SYAA 2IU0A 3T2MA 2YSUB 2HG5C 1S76D 1AJNA 1AI4A 2XAGA 2DW4A 1AI6A 1R73A 5CA3A 4JYBA 4R6ZA 1YTFD 3NXSA 4WFHA 1NVPB 1F51A 2Y48A 4P2ZA 2JJ1G 3W7UA 3CXCU 3CCSV 1PKXA 2NNUA 2DYRC 3RVZA 5IYCO 4TWKA 3CCVV 5LGNA 4R8CA 3JD2A 1YSCA 2A79B 3K04A 1THZA 3G71V 1K33A 3PJSK 3ABUA 3ZRWA 2A9HA 1YJWV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 V;  3CME V;  1N8R W;  3G6E V;  1KC8 W;  1K73 W;  1VQP V;  1K9M W;  3CCE V;  1YIT V;  2OTL V;  3CC2 V;  1VQM V;  3CC4 V;  4WCE V;  1VQN V;  4WFB V;  1R73 A;  1YI2 V;  1K8A W;  3OW2 U;  1VQ6 V;  1VQ9 V;  1VQL V;  3CCU V;  5DM6 V;  1YJN V;  1VQ7 V;  3CPW U;  1YHQ V;  1YIJ V;  3CXC U;  3CCS V;  2QA4 V;  1YJ9 V;  1KQS U;  3CCQ V;  1VQO V;  1S72 V;  1W2B U;  1Q7Y W;  1Q82 W;  1Q86 W;  1QVF U;  3CCM V;  1VQK V;  1NJI W;  2QEX V;  1KD1 W;  4WFA V;  3CCL V;  2OTJ V;  3CCV V;  3CC7 V;  2D3O W;  4WF9 V;  3CMA V;  3I56 V;  1VQ8 V;  1JJ2 U;  1M90 W;  1VQ4 V;  1Q81 W;  1QVG U;  3G71 V;  1VQ5 V;  1M1K W;  3G4S V;  3CCR V;  3CCJ V;  3CD6 V;  1YJW V; 
#chains in the Genus database with same CATH topology
 4ABM A;  2ZM6 O;  1G1X B;  2R9A A;  5LHG A;  4WFG A;  3JAT B;  1NH2 D;  3ZMV A;  3E8B A;  3L75 H;  1XNR B;  5DM6 V;  2LW7 A;  4NVP A;  5EYP A;  2EIJ B;  4DV2 B;  2QM4 A;  5BY1 A;  4NTX A;  3U0Z A;  2UXD O;  1XHZ A;  1IBK O;  3RYC B;  3AG7 A;  2E76 B;  3CXH F;  1BQZ A;  2QR4 A;  1GTO A;  5LXT B;  2CGO A;  1V54 C;  4LF9 B;  1GM7 A;  5FNV A;  1ARO P;  1Q43 A;  3JCZ A;  2EJ7 A;  2Y0P A;  3CCQ V;  5LYJ A;  1OCO B;  2CK3 G;  1PV0 A;  1GO3 F;  5FLX N;  3CMA V;  3Q4H A;  1QVG U;  2LP7 A;  3FB5 C;  3E86 A;  1E79 G;  3K03 A;  1GK9 A;  5CBH A;  3A8T A;  4I50 A;  1VF6 A;  1XNQ O;  3HKE A;  4NXN O;  4UVB A;  2GSM B;  2RNB A;  3UT5 B;  4LBE C;  2ZNI A;  4D7S A;  2HHH B;  5JWP A;  2CH7 B;  2VQE B;  1RFY A;  1YXB A;  2L35 A;  2LFS A;  3CP1 A;  4JAU A;  4K0K O;  1GAX A;  3KCY A;  4PHZ A;  1JVM A;  4EFB A;  2IJK A;  4UUJ C;  1K4C C;  5A9G A;  1N0J A;  2AHZ A;  3BAB A;  2P22 C;  1KKC A;  1TGO A;  2F93 B;  4AQY B;  1N34 O;  3ZHR A;  3ASO B;  1JJO A;  2GUZ A;  3WG7 C;  5LGU A;  4QPK A;  5GTI Z;  3CX5 F;  3LNM B;  2EBO A;  4I55 A;  5CB4 A;  1NR7 A;  1R3K C;  3LDD A;  3UQ8 A;  4LFC O;  5FPO A;  4P30 A;  3QO8 A;  2JEX A;  3HKD A;  5LHI A;  1TUE B;  3SJC C;  1T5E A;  2BE3 A;  4A5U B;  5LMN O;  5FNV B;  1ZL8 A;  1SKV A;  5EBM C;  4JI0 O;  5LYJ B;  2DYR B;  4B7E A;  4IYI A;  3Q4H B;  2AHY A;  2ODM A;  1GN2 A;  2NLJ C;  3E89 A;  2JIZ G;  2IJI A;  3AK2 A;  5EIB C;  2HFE C;  3WB0 A;  1GRJ A;  3EVK A;  3UO2 A;  4JI1 B;  4X66 O;  3JD1 A;  2Y4U A;  3HKE B;  3FYE B;  1M56 C;  4DRX A;  4Q6G A;  5D5P A;  2RDC A;  5HFM A;  1EFR G;  2PTM A;  1W2B U;  5ITZ A;  4W4L A;  4UV9 A;  4U7O A;  4X65 B;  1JFF A;  1I08 A;  5TIS Z;  5CMU A;  4AHC A;  3M8A A;  3ICX A;  1URF A;  1XL4 A;  2GUZ B;  3OW2 U;  2CUG A;  3H1H H;  1YHQ V;  4CH5 A;  2V1D A;  3FD9 A;  1R3I C;  2VWJ A;  5CB4 B;  1V9P A;  2YIC A;  1BS3 A;  3J7A U;  5KHK A;  1QBZ A;  3HKD B;  1FXK C;  1Q81 W;  1GN4 A;  2QJ1 A;  5DED A;  4DR3 B;  1DF5 A;  1OCR C;  3CC4 V;  2GDS A;  2Q69 A;  5KAF Z;  2UUB B;  1H2G A;  3SYO A;  4P9P A;  2KG7 A;  5KLV H;  4JI7 O;  4UCR A;  3T1Y B;  3K5O A;  4DW0 A;  5J2T A;  4I4T B;  3CCL V;  4PDM A;  2WLN A;  4DR2 B;  2GV9 A;  4DW1 A;  3T4Z A;  2V7Q G;  5IJ0 A;  4JAV A;  5LOV A;  1H38 A;  3RFR A;  4J7K A;  3RBZ A;  1QLN A;  1SS3 A;  3BA9 A;  3JAR B;  4DRX B;  4H0L B;  4GCZ A;  4FJC C;  3JAW A;  2Q73 A;  4JAA A;  2GTS A;  5E1A C;  3ABL C;  4JYA B;  3CRM A;  2ZKO A;  3JAL B;  1JFF B;  3N2G A;  2FTK A;  1XQ8 A;  2DMX A;  3L70 H;  3ZMU A;  2ZNJ A;  1K9M W;  1G4Y B;  5EC2 C;  3AK1 A;  4OPA A;  1K97 A;  4IYH A;  2B1I A;  2CTQ A;  5H6R A;  5B1A B;  5FPR A;  2B9Z A;  1Y67 A;  2YEV A;  4LP8 A;  4TOI A;  4JYC A;  1ZSP A;  3THO A;  4FLW A;  1AJP A;  1P4R A;  4F6E A;  1YVW A;  5KX5 A;  2Q0A A;  3AG2 B;  3ZRV A;  2AZ0 A;  1VQN V;  1B6Q A;  2DWD C;  1AR1 B;  1DK1 A;  1OV9 A;  2RMK B;  1R6T A;  3AG1 B;  3OR6 C;  1PM9 A;  3DSQ A;  5IJ0 B;  1BHB A;  4KL1 A;  2FKX A;  1FXH A;  2Q0O C;  3SGI A;  3E35 A;  1WB8 A;  5IYZ B;  3JAW B;  4X88 A;  3OGC C;  5B66 Z;  1IBL B;  4WFE A;  1IDS A;  3N2G B;  4JI2 B;  1BZK A;  1V55 C;  4GUN A;  2CTW A;  1HNW O;  4BW9 A;  1SET A;  4X20 B;  4DR6 O;  1FFT B;  2EIN B;  4LFA O;  3ZED A;  3LDE A;  4DV7 O;  3JD4 A;  4FFB A;  2P4K A;  2YEV B;  2XAJ A;  3EHB B;  3K0G A;  1HP8 A;  1N33 O;  2DQ3 A;  2BSK A;  4CS3 A;  3ETE A;  2CTR A;  1BT8 A;  3GWO A;  4LH6 A;  3K5L A;  4UVC A;  4KHP O;  3CCE V;  3G80 A;  2ZIM A;  3ETD A;  3LSU A;  1K5S A;  4J41 A;  1IBK B;  3VQV A;  3ZHU A;  2ZCE A;  5L3G A;  3K57 A;  2EIM C;  4DV6 O;  2EZP A;  3RW0 A;  1SES A;  4J10 A;  5H5N A;  1H2S B;  3CD6 V;  2Q6A A;  5LHH A;  1G8M A;  4ZBM A;  1MZE A;  2YIA A;  3OTF A;  1GMG A;  1FKA O;  2ITD C;  4DUY B;  1Q82 W;  1D2D A;  5CBF A;  2NR5 A;  4XDJ A;  3JSN A;  3P3N A;  1KD1 W;  4YIO A;  4CC5 A;  4GX1 A;  2LO1 A;  4NYK A;  4B3R O;  4FFB B;  2IU0 A;  1Y6X A;  2LGW A;  1F7Y A;  1AI4 A;  4K3A A;  4FLZ A;  1R73 A;  5CA3 A;  3HKC A;  4K0K B;  4KXR A;  3NXS A;  1FFX A;  4GKK B;  2BSK B;  1PKX A;  5JCO C;  3RVZ A;  5IWA O;  3TJT A;  3CCV V;  1N34 B;  2QKA A;  3HKB A;  3JD2 A;  1YSC A;  2A79 B;  2RJZ A;  4OX9 O;  2PY5 A;  3ABU A;  4DV3 B;  3K9S A;  4CH6 A;  1UFI A;  4LFC B;  3CCU V;  4AI8 A;  4D6T H;  4ZOL A;  2YI9 A;  5LMN B;  3X2Q C;  4DV1 O;  3BPZ A;  1PPJ H;  1NI8 A;  3JYC A;  2WSS G;  3FB6 C;  3ETQ A;  1O9H A;  1OCC C;  1I7F A;  1N8R W;  3L71 H;  5LMU O;  1GKF A;  1M57 C;  1V54 B;  1VQM V;  3B09 A;  2LGQ A;  3VQW A;  4BIZ A;  2E5L O;  5JH7 A;  3SJQ C;  4X66 B;  4H33 A;  4UCS A;  2ETN A;  4YXW G;  4LF5 O;  1PD3 A;  4CBC A;  3KCX A;  1KP2 A;  4PJ0 Z;  4WBN A;  4U3F H;  1MMM A;  4B3T B;  4JI8 B;  2IJH A;  3BCC H;  1LNQ A;  1YEW A;  2XAF A;  4OXS A;  1J5E O;  3CCJ V;  2UXB O;  3OTO B;  2QSA A;  3FAV B;  3HKC B;  4IL6 Z;  1RPR A;  1VAR A;  1Y74 A;  2HVK C;  2M6Y A;  3TET A;  4QIW F;  1QVF U;  3HKB B;  1MSD A;  4FM0 A;  4X1I A;  4YY3 O;  4DUZ B;  2OCC C;  2X6A A;  1QNM A;  4DYL A;  3CHX A;  5GW7 A;  2DJV A;  2W0F C;  1E1Q G;  2ZE7 A;  3P30 A;  2QTO A;  4DR7 O;  1GM9 A;  3WG7 B;  1K4D C;  4LF4 O;  4GT1 A;  4I9Q A;  1JA8 A;  4JI5 O;  4UB8 Z;  4O4J A;  2WPD G;  1FXK A;  3FFQ A;  3H1L H;  4JI7 B;  3RT3 C;  2Y69 C;  1U97 A;  5GON B;  3WB2 A;  4NTY A;  5JH7 B;  4JZ2 A;  1F23 A;  2UXC O;  4WBN B;  2JEU A;  2QGN A;  1KMI Z;  1VMG A;  1Z2G A;  4GX2 A;  4JI3 O;  1L0L H;  3F7V C;  1NQT A;  4LC1 A;  4BW5 A;  1H8E G;  3E83 A;  2JS3 A;  5L3B A;  5EBL C;  1KUQ A;  1VQP V;  1M56 B;  2UU9 O;  3CRQ A;  4BIO A;  2ZDI C;  4X1I B;  3WFV A;  1XI1 A;  5K1X A;  1Q7Y W;  1COW G;  4PA4 A;  3W7X A;  2P90 A;  1AR5 A;  5KA6 A;  3ZN1 A;  5IY5 C;  1IBM O;  3QO5 A;  4CZZ A;  3CME V;  1AJQ A;  2YDE A;  1HNX O;  4AIL C;  1AR4 A;  1L1F A;  3W7W A;  4TQD A;  1ZWI C;  2IU3 A;  4LH7 A;  5H6Q A;  4RUE A;  4O4J B;  1HDJ A;  1FXK B;  2WLL A;  2AW9 A;  5EZY A;  1PNM A;  3TXQ A;  4CC6 A;  3B8N A;  1I94 B;  1OCR B;  3L9D A;  2JRI A;  1Y4M A;  2R72 A;  2HKO A;  4HZ3 A;  4TV8 A;  1NBM G;  3W7S A;  2YXY A;  5BR8 O;  1WA8 A;  3BAA A;  1EBO A;  3KZI Z;  1BGY H;  2UUC O;  5B1N A;  2A06 H;  2CE4 A;  4J42 A;  4U7N A;  4NTW A;  2DN9 A;  1TAE A;  3D3Q A;  3F5T A;  4PEL A;  3LSS A;  1L8D A;  2DWE C;  2YC0 A;  2YXH A;  3EXA A;  4K35 A;  4N21 A;  1YIT V;  2OTL V;  5J9P C;  4FVM A;  3ABK C;  4DR1 O;  4H44 B;  4LFA B;  4DV7 B;  4L87 A;  3UKM A;  4B3S O;  5L3F A;  3SJA C;  4IHJ B;  4ZHQ A;  4IIJ A;  1ZX3 A;  1Q6U A;  1VQ5 V;  5D5Q A;  1WNS A;  2CAZ C;  3H01 A;  2ZQM A;  3B77 A;  4C7U A;  2Q7H A;  2O57 A;  4UV8 A;  3RVY A;  4TT3 G;  2Q8V A;  4LCU C;  1Q6I A;  5JJJ B;  2PI5 A;  1BHA A;  2WLL B;  3WB1 A;  5EZY B;  1DTO A;  3S3X A;  2P4V A;  2OCH A;  2KKW A;  4FLV A;  2EIK C;  4CS2 A;  1RM1 C;  4RWU A;  1NS1 A;  4TV8 B;  4QNH B;  1M1K W;  4I4T A;  1WA8 B;  2QEX V;  1P84 F;  1D5A A;  4LF8 B;  1CEZ A;  3CB2 A;  3VQY A;  3JAR A;  1QQC A;  1IVS A;  1CXZ B;  3UO3 A;  1QCE A;  3D36 A;  4FMT A;  5JVD A;  4JYY A;  3OMA B;  2N74 A;  1SA0 A;  1OHH G;  1VQ4 V;  5EK0 A;  4FK5 C;  4O4I B;  2DE0 X;  4Z1V A;  3E2E A;  4IGG A;  3JAL A;  1XL6 A;  2QWN B;  1N36 O;  2Z3Y A;  1M93 A;  1VQ6 V;  3K79 A;  4MTF A;  4I9W A;  4LF7 O;  3DXR A;  3QO7 A;  2BOB C;  2UUA B;  1V55 B;  2F4V B;  1SRY A;  4ZHQ B;  4IIJ B;  4ASU G;  3J80 N;  2EUL A;  4LFB O;  3ZHT A;  3ZX6 A;  1S3J A;  3DC6 A;  2VRZ A;  3CWB H;  2P5O A;  1MSW D;  2XAQ A;  4L8J A;  1LUW A;  5LP6 C;  1AP6 A;  2YS8 A;  4OX9 B;  2Q68 A;  1NVP D;  2WLH A;  4UVA A;  4EEQ A;  3SPI A;  5DN6 G;  2EIL C;  2RCV A;  1TVK B;  2XND G;  1EN4 A;  5JCO A;  1A32 A;  3KG2 A;  1FPO A;  3IFX A;  3HPL C;  3VOU A;  3CS5 A;  4JF3 A;  4LF6 O;  1Y76 A;  4DV1 B;  3QTC A;  2NN4 A;  3KKY A;  1UPG A;  4R50 A;  2P7T C;  3QF7 A;  3SYC A;  2X6C A;  3LSQ A;  5IYZ A;  5LBQ A;  3K0D A;  3MDS A;  1RPO A;  5JVD B;  2WLM A;  4N23 A;  1SA0 B;  1TUB B;  2EZO A;  2EIM B;  3ZMZ A;  2Y0I A;  4DV5 O;  2A7W A;  4X8A A;  3IGA C;  1B04 A;  2GHY A;  3F7Y C;  5C93 A;  4LF5 B;  1X59 A;  1JR9 A;  2WLK A;  1BMF G;  1NKD A;  4X20 A;  3K3W A;  3DXR B;  1HR0 O;  2HJF C;  4TUY A;  1VEW A;  1J5E B;  4MTO A;  4ZI7 B;  4PA6 A;  3AK3 A;  4GLX A;  3CYO A;  3BA8 A;  3I56 V;  2XAS A;  3CJH A;  4YY3 B;  1S76 D;  2FL4 A;  2ZE5 A;  1Q90 D;  2DW4 A;  3I5D A;  1AB3 A;  1BCC H;  2ARH A;  3RYF B;  1XBL A;  1LR1 A;  2NNU A;  2DYR C;  5IYC O;  4TWK A;  4DR7 B;  1Y76 B;  3JSL A;  3K04 A;  2FML A;  1RP3 B;  3BVO A;  1K33 A;  3ZRW A;  4JI5 B;  1VF6 C;  2F23 A;  3G6B A;  4LNU B;  2XT9 A;  5J2U B;  1Q5O A;  4PD4 F;  4RUF A;  2CTP A;  2IW5 A;  5CN0 A;  5FL7 G;  3TXS A;  3M99 B;  3X2Q B;  1CPY A;  1S5H C;  2OIE A;  3JD3 A;  4JV5 O;  3LUT B;  5L3E A;  2DYS B;  4I5S A;  4K8X A;  1OCC B;  4HNA A;  2UXC B;  3STZ C;  1ROP A;  1M57 B;  2QDO A;  3B2E E;  4TUY B;  4JI3 B;  3P32 A;  3QNE A;  2VQE O;  1FJG B;  2JJ2 G;  4RQF A;  4O2A A;  1SZX A;  3GWK C;  1PNL A;  3BY6 A;  1B06 A;  1H2M A;  2AGA A;  1UJW B;  2ZM6 B;  2UU9 B;  4EB6 B;  1IXB A;  3CJH B;  1QHT A;  4J9Y B;  5KHG A;  3K5N A;  4R7C A;  2QWO B;  1WPX A;  3OMI B;  1DLB A;  4PA3 A;  4FLX A;  3E8G A;  2UXD B;  1Z5V A;  1EN6 A;  1IBM B;  3O65 A;  3CE2 A;  5C8Y A;  1HNZ O;  2QA4 V;  2OCC B;  4ICG A;  4X89 A;  4WFA V;  1R6K A;  3MHS C;  4DR4 O;  3ZRW B;  1Y66 A;  4DV0 O;  2EJR A;  4YJ2 A;  4HYO A;  3ETG A;  4FLU A;  1XIL A;  3K08 A;  4QPJ A;  2CDY A;  2JDI G;  1NH2 B;  4Q20 A;  2IM9 A;  1F4N A;  3ZBH A;  5BR8 B;  1Q86 W;  3ASN C;  4HNA B;  1XNQ B;  1I5X A;  4JAS A;  2HJD A;  3ABM B;  4NXN B;  2Y69 B;  2PZS A;  2ADQ B;  2JGU A;  2WA4 A;  3I55 V;  4RQE A;  4Z1M G;  3FX7 A;  3O9O A;  4O2A B;  2W0X A;  3OR7 C;  1YDX A;  1XOU A;  2IBZ H;  2Y4T A;  4LWS B;  3FAV A;  2PUS A;  3OUS A;  4X65 O;  1HW7 A;  4D7T A;  1IUR A;  1QLE C;  1US6 A;  4DR1 B;  1XUQ A;  3APQ A;  3T1C A;  2WAM A;  5LA6 B;  2PGG A;  3BFR A;  4UCT A;  4O4L A;  1KU9 A;  2Z0A A;  2Z5U A;  3G6E V;  4YHH O;  3JAS A;  5C8Y B;  4B3S B;  1OCZ C;  4TSF G;  2X0L A;  5B1B C;  2Q7G A;  4DXW A;  1P7B A;  2WLJ A;  1EZJ A;  4DR3 O;  1R1B A;  1U96 A;  2UUB O;  5IY5 B;  3SR2 C;  2XAH A;  2A3Q A;  4KP4 A;  4JI0 B;  4YJ2 B;  1GH6 A;  1ZTE A;  3T1Y O;  3C3S A;  2HVJ C;  2LFR A;  3C3T A;  1K34 A;  4UFZ A;  3SJB C;  2H3O A;  4DR2 O;  4KFM A;  5GON A;  3E8F A;  4FM1 A;  5KUM A;  4JZG A;  2QWR B;  5CBG A;  1VQO V;  3JAM N;  5L3D A;  3CRA A;  4X1K A;  1QR8 A;  4NKG B;  1SQF A;  1IZ3 A;  3B40 A;  1K92 A;  1M5I A;  3TK1 A;  4QE9 A;  1JMK C;  4O2B B;  4RAI A;  2ATK C;  2DQ0 A;  4DO2 A;  3ZIA G;  1JOY A;  5GTH Z;  1K8A W;  2BTO A;  2VQF O;  3ZJZ A;  2X6B A;  1D5N A;  1OZ0 A;  1YTF B;  1N36 B;  2HEP A;  2QM8 A;  1YF2 A;  4BAY A;  4O4L B;  5B3S C;  1P49 A;  2F43 G;  5KMG B;  3AEI A;  4BR6 A;  5JQG B;  3JAS B;  1K73 W;  2R9I A;  3ABK B;  1Z5W A;  1P7G A;  1VP7 A;  3SPJ A;  4WFB V;  2WA3 A;  3JD0 A;  4MVU A;  3QG5 A;  1N32 O;  5BMV A;  1N4C A;  3W7T A;  4FLY A;  2VWK A;  2IJJ A;  2XOK G;  4J80 A;  1X4T A;  2F66 C;  1M9N A;  2B5U A;  3JAK A;  2IH1 C;  2JS5 A;  1EM1 A;  1K7D A;  2QKS A;  2MW2 B;  2G38 A;  4MS2 A;  4CH4 A;  4LF6 B;  2LQT A;  4X1K B;  1S72 V;  3D3I A;  1MOF A;  4WFF A;  3CCM V;  1RM1 B;  3CC7 V;  3P3P A;  1MG1 A;  5L3C A;  1SQP H;  2C2A A;  2WLI A;  2YXL A;  4DV5 B;  1SQV H;  4JI2 O;  1B3Q A;  1XHX A;  5BZB A;  1VQL V;  3H1K H;  1YIJ V;  3AG3 C;  2W6I G;  2V4D A;  1KQS U;  4KUM A;  1WB7 A;  1FXV A;  2YI8 A;  1N0N A;  3OEH G;  2JGD A;  2QM7 A;  1KBH A;  1W0K G;  4MTG A;  4IHJ A;  4I0X A;  3DTU B;  3AG4 C;  3L74 H;  5CA0 A;  1WJZ A;  5BMV B;  1AI5 A;  3ZHQ A;  2ZR3 A;  1WLE A;  3PN1 A;  2AZ2 A;  4TQF A;  5EBW C;  2Q4P A;  1FS0 G;  1JCH A;  3JAK B;  1VQ8 V;  2CGN A;  3F5W C;  1XMO O;  2ZXW C;  5LP6 B;  3ZS8 C;  4Z2W A;  3CC2 V;  2XHB A;  1LUV A;  1KB9 F;  3SYQ A;  3MD0 A;  2EIL B;  4FIP C;  2ILM A;  2W6J G;  3CSX A;  1XDC A;  4B3M O;  2XUM A;  2OTJ V;  4FM2 A;  2WLI B;  4JV5 B;  4PV1 B;  5B1O A;  2HR3 A;  4GKJ O;  1SQB H;  4DUY O;  5IJ9 A;  4O4I A;  2PI4 A;  5F2V O;  2P6J A;  4PI0 A;  3K06 A;  4GX0 A;  4JTA B;  1HNW B;  1PNK A;  1R3J C;  2P06 A;  3ABL B;  4FFK A;  4DR6 B;  2JGD B;  3SPH A;  2OYQ A;  2A0L A;  4I0X B;  2YIB A;  1VIB A;  4GKK O;  5CA0 B;  1KC8 W;  1WP7 A;  1N33 B;  5EYP B;  4PI2 A;  3IJ4 A;  2KB1 A;  4XDK A;  4MVQ A;  3ZN0 A;  2Q9L A;  4MT8 A;  1Q6H A;  1S5J A;  4DV3 O;  4KHP B;  5EC1 C;  1KP3 A;  2FYU H;  1JPX A;  1TVK A;  3EFF K;  1XRE A;  3J81 N;  1HNZ B;  1AVM A;  2YSU B;  2HG5 C;  2LJ2 A;  1AJN A;  4JI6 O;  4DR4 B;  3CRC A;  4DV0 B;  4DV6 B;  4R6Z A;  1RSO A;  1YTF D;  3IAY A;  1F51 A;  2Y48 A;  5AG2 A;  2JJ1 G;  3W7U A;  3CCS V;  4R8C A;  2QWP B;  1TUB A;  4I50 B;  5IJ9 B;  3G71 V;  1SQQ H;  1XMQ O;  2A9H A;  1YJW V;  5KHI A;  3U10 A;  2LW1 A;  3UCS C;  3IC9 A;  3SPG A;  3G67 A;  4PA9 A;  4B3T O;  4JI8 O;  1FAF A;  3FYI B;  3T1H O;  2H94 A;  4B3R B;  3OTO O;  4DK1 A;  2EIJ C;  4ZI7 A;  2RQ6 A;  4BIU A;  2ZR2 A;  5LL6 Y;  3BRC A;  4H37 A;  5IWA B;  3OM3 B;  2DOS A;  5KA5 A;  3CEI A;  1WP8 A;  4DUZ O;  1XEQ A;  3JCU Z;  1NR1 A;  1YJN V;  4X64 O;  5IYD O;  3R66 A;  3QVN A;  4HAM A;  4QGP A;  4I55 B;  1WAZ A;  1MA1 A;  2E75 B;  3H9V A;  5EIB D;  4YHH B;  1I0H A;  2F95 B;  4LR3 A;  4MTX A;  1M4U A;  5HFL A;  2KQX A;  3RYF A;  1G6U A;  3H1J H;  4JI4 O;  3E22 A;  1OCO C;  1ZL8 B;  3BEH A;  4DV4 O;  3FB8 C;  3DGE A;  1W0J G;  3RWR D;  4E2L A;  4X62 O;  2ZE8 A;  3NR7 A;  2OWO A;  1NTK H;  1RSO B;  2KSD A;  4UCO A;  2P67 A;  2FB5 A;  1J95 A;  4LNU A;  4GX5 A;  5J2U A;  4NXM O;  2AXT Z;  1HWY A;  5BXZ A;  2Q67 A;  2RN9 A;  5DEC A;  5LMU B;  4DR5 O;  1PL0 A;  2E5L B;  1ORQ C;  2JK5 C;  3G4S V;  3HR0 A;  3K59 A;  3RYI A;  3LDC A;  5ITZ B;  2IH3 C;  3ASN B;  2UXB B;  3ASO C;  3TCU A;  2VQF B;  4J7Z A;  2XTA A;  4H13 B;  3VQX A;  1S5L Z;  1XNR O;  3E8H A;  1ZAU A;  4JTC B;  1K3E A;  4EB6 A;  1KYO F;  4FLT A;  5IT9 N;  4DV2 O;  4PDL A;  1KEC A;  1YCI A;  4YJ3 A;  5A2Q N;  4MVS A;  1ZLZ A;  1DF4 A;  3OD4 A;  4NR1 A;  2H8P C;  3OEE G;  1MZF A;  3A0R A;  2GBO A;  1WN7 A;  2QE7 G;  3E22 B;  1QLE B;  4ZKI A;  3WU2 Z;  4JTD B;  2YID A;  3UM7 A;  2F1M A;  4LF9 O;  1N32 B;  4LF4 B;  5H9C A;  3T4D A;  3FB7 C;  3R65 A;  4G2K A;  5JJN B;  4MW8 A;  1OCZ B;  3VBB A;  2KG7 B;  1MNG A;  4QE7 A;  5B1B B;  2BTQ A;  3S3W A;  4RO2 A;  5J2T B;  1I94 O;  1S77 D;  4UCU A;  3LNN A;  3RGB A;  1CP9 A;  4EFE A;  1AP5 A;  5LOV B;  2OT5 A;  1QR9 A;  4J11 A;  2PYJ A;  2X7R B;  4X9Q A;  1GN3 A;  3APO A;  3OFN G;  1SQX H;  3HB3 B;  3RYI B;  2N05 A;  4GZR B;  4MVO A;  2HP8 A;  2R70 A;  3STL C;  1IX9 A;  2ZT9 B;  1VF7 A;  2HHH O;  3MHH C;  3D8C A;  4PDR A;  4EKW A;  2Q5Z A;  3K58 A;  3DC5 A;  4FPP A;  4LWS A;  4MVM A;  4O4H A;  4YIP A;  3L72 H;  1WPB A;  2PF4 E;  4AQY O;  4YJ3 B;  3ZHV A;  3N2K A;  1SF9 A;  4HBN A;  5LA6 A;  4UB6 Z;  1YI2 V;  2VS0 A;  4W4K A;  2GTA A;  3TGU H;  2ZDI A;  1HNX B;  5B3S B;  1ZUQ A;  2WWW A;  1IXM A;  5KX5 B;  2ADP A;  2E74 B;  4OPH A;  5LGT A;  1BQ0 A;  4U3J A;  1S0V A;  1E1R G;  4MSW C;  3OMN B;  4DK0 A;  1EZV H;  2BTQ B;  4PA7 A;  3C90 A;  4P9O A;  3ABT A;  1XMO B;  4B08 A;  4F6R A;  1NZ6 A;  3D36 C;  4F4L A;  2B1G A;  1ENV A;  1FD9 A;  1Q8I A;  2YIB D;  1W59 A;  4JI1 O;  2BOC C;  4IT5 A;  4LF8 O;  1GM8 A;  2UUC B;  2QTS A;  3N27 A;  1R3L C;  1JX9 A;  5KHJ A;  4B3M B;  4O2B A;  4JPR A;  3OAA G;  3RN4 A;  4PDV A;  4GKJ B;  2K9P A;  4BWA A;  5KUK A;  4O4H B;  4FZ0 A;  1OJH A;  1KKD A;  4CS4 A;  5B1A C;  4J9Z B;  1NJI W;  3SYP A;  5E79 Z;  1K5Q A;  3N2K B;  3H1I H;  2E3C A;  4E4E A;  3U11 A;  3A2F A;  2UUA O;  5KMG A;  2F4V O;  4QJF B;  3AG2 C;  3A0H Z;  4JGS A;  5JQG A;  3AG3 B;  4X1Y A;  1H2N A;  1VQ7 V;  4CH3 A;  5IYB O;  2ITC C;  1YJ9 V;  3OE7 G;  3OT7 A;  1R6N A;  1I5Y A;  1BSM A;  1H8H G;  3ZMS A;  2UXX A;  3AG1 C;  3ML0 A;  1NTM H;  2JVD A;  2EX3 A;  4U3J B;  1M90 W;  3IC7 A;  1QU7 A;  3BHP A;  3RYH A;  3SPC A;  2L6L A;  4MVZ A;  1O9G A;  4UCV A;  1FYJ A;  3AG4 B;  3CRR A;  1YZB A;  1PP9 H;  1F4M A;  4F6R B;  2ZD9 A;  2MK3 A;  1NU1 H;  1PL4 A;  5KHH A;  4JI6 B;  5K1P A;  2DYS C;  3B8M A;  2YUA A;  2ZXW B;  3A0B Z;  3GVM A;  1MAB G;  3OGI B;  5H2F Z;  5CA1 A;  1Q3E A;  2BCC H;  4JYA O;  2EIN C;  3ZCC A;  1VQ9 V;  3L73 H;  1XMQ B;  1SER A;  1BL8 A;  4TV9 A;  1H2K A;  3ZMT A;  4B7K A;  3ZHS A;  3ZRS A;  3T1H B;  3K5M A;  4LF7 B;  3M7M X;  2ZIO A;  2UXN A;  4MW3 A;  4X1Y B;  3B4S A;  2M7W A;  1FFX B;  4WCE V;  1NTZ H;  4LFB B;  4XBF A;  4K8Z A;  2PYL A;  2OIG A;  3CPW U;  2Q7E A;  3FKS G;  3JAT A;  3K9A A;  4MVR A;  5B5E Z;  3ZRX A;  1AI7 A;  2K1E A;  1NT2 B;  4XDL A;  3RYH B;  2QKC A;  1H2L A;  1JJ2 U;  4X64 B;  5IDJ A;  3OUF A;  4GYC B;  3GB7 C;  1TA8 A;  4FZ1 A;  4JI4 B;  3RYC A;  4ZOL B;  1BE3 H;  5JJE B;  5LP6 A;  2ZIN A;  5LXT A;  4UXN A;  4DV4 B;  3SDL A;  4ZIB A;  4J7J A;  1JQ0 A;  4NB5 A;  1DGS A;  4X62 B;  2D2C B;  1SZT A;  2R9R B;  4G28 B;  2EIK B;  1VQK V;  1L0N H;  1GN6 A;  2D3O W;  4WF9 V;  3MAQ A;  4G27 B;  4NXM B;  5CA1 B;  1IBL O;  3ABM C;  2HLD G;  1EN5 A;  3SYA A;  2N04 A;  5KAI Z;  4DR5 B;  3T2M A;  2XAG A;  4I7Z B;  1AI6 A;  5IE9 A;  4JYB A;  1SQG A;  4TV9 B;  1AIL A;  1SC5 B;  4WFH A;  1NVP B;  4P2Z A;  3CXC U;  3UT5 A;  2QWQ B;  1HR0 B;  4OGQ B;  5LGN A;  1FJG O;  2ZE6 A;  1VF5 B;  1THZ A;  2CH7 A;  3PJS K;  1Y74 B;  3CCR V; 
#chains in the Genus database with same CATH homology
 5LHG A;  4WFG A;  4RUF A;  1NH2 D;  3ZMV A;  3E8B A;  2IW5 A;  3SPG A;  3CCU V;  5CN0 A;  5FL7 G;  4PA9 A;  5DM6 V;  3M99 B;  3X2Q B;  1CPY A;  1S5H C;  2EIJ B;  3FYI B;  2H94 A;  3JD3 A;  3X2Q C;  2EIJ C;  3LUT B;  3JYC A;  5L3E A;  2WSS G;  2DYS B;  3FB6 C;  4I5S A;  1OCC B;  1OCC C;  4BIU A;  2ZR2 A;  3STZ C;  1ROP A;  1M57 B;  1N8R W;  4H37 A;  1GTO A;  1GKF A;  1M57 C;  1V54 B;  3OM3 B;  3P32 A;  3QNE A;  5KA5 A;  1VQM V;  2JJ2 G;  1V54 C;  4BIZ A;  4RQF A;  1GM7 A;  1NR1 A;  1YJN V;  3SJQ C;  1PNL A;  3BY6 A;  5IYD O;  1ARO P;  4HAM A;  3JCZ A;  4H33 A;  4YXW G;  1PD3 A;  3CCQ V;  4CBC A;  1UJW B;  4MTX A;  1KP2 A;  5HFL A;  1OCO B;  2CK3 G;  1GO3 F;  4J9Y B;  1OCO C;  3CMA V;  3CCR V;  1QVG U;  2LP7 A;  2IJH A;  3FB5 C;  1LNQ A;  2XAF A;  3E86 A;  4OXS A;  1E79 G;  3BEH A;  1GK9 A;  3K03 A;  3FB8 C;  3CCJ V;  5CBH A;  4R7C A;  3DGE A;  1W0J G;  4E2L A;  1WPX A;  3OMI B;  1DLB A;  4PA3 A;  1RPR A;  3E8G A;  2P67 A;  2HVK C;  1J95 A;  4GX5 A;  3TET A;  4UVB A;  2QA4 V;  1HWY A;  2GSM B;  4QIW F;  2Q67 A;  4LBE C;  1QVF U;  2OCC B;  1PL0 A;  4X89 A;  4WFA V;  2OCC C;  1R6K A;  3MHS C;  3ZRW B;  2X6A A;  1Y66 A;  1ORQ C;  2LFS A;  3CP1 A;  4JAU A;  2EJR A;  1JVM A;  2JK5 C;  2IJK A;  3G4S V;  4UUJ C;  5GW7 A;  1K4C C;  2W0F C;  2AHZ A;  4HYO A;  1E1Q G;  3ETG A;  3P30 A;  2QTO A;  3LDC A;  3K08 A;  4QPJ A;  1GM9 A;  3WG7 B;  2JDI G;  1NH2 B;  4Q20 A;  3ASO B;  1K4D C;  2IH3 C;  4GT1 A;  3WG7 C;  3ASN B;  5LGU A;  1F4N A;  3ASO C;  4QPK A;  1Q86 W;  3ASN C;  3TCU A;  3LNM B;  2EBO A;  1I5X A;  1NR7 A;  4JAS A;  1R3K C;  3LDD A;  2WPD G;  1FXK A;  3ABM B;  4P30 A;  3E8H A;  3QO8 A;  4JTC B;  1K3E A;  2JEX A;  2Y69 B;  5LHI A;  1TUE B;  3I55 V;  4PDL A;  2Y69 C;  1KEC A;  4RQE A;  4Z1M G;  4MVS A;  3OR7 C;  1DF4 A;  5EBM C;  2H8P C;  1F23 A;  3OEE G;  3A0R A;  3OUS A;  2DYR B;  2JEU A;  2QE7 G;  1QLE B;  4ZKI A;  2AHY A;  2NLJ C;  3E89 A;  2JIZ G;  1QLE C;  4GX2 A;  2IJI A;  3T1C A;  2HFE C;  2WAM A;  4JTD B;  3F7V C;  1NQT A;  4LC1 A;  4BW5 A;  3UM7 A;  1H8E G;  5H9C A;  3T4D A;  3FB7 C;  3R65 A;  4G2K A;  3E83 A;  3JD1 A;  5L3B A;  4MW8 A;  5EBL C;  3G6E V;  2Z5U A;  1OCZ B;  1VQP V;  3VBB A;  4QE7 A;  1M56 B;  3FYE B;  1OCZ C;  5B1B B;  1M56 C;  4TSF G;  2X0L A;  5B1B C;  4RO2 A;  4DXW A;  1P7B A;  2ZDI C;  2WLJ A;  1EZJ A;  1S77 D;  5HFM A;  1EFR G;  3WFV A;  1CP9 A;  1W2B U;  1Q7Y W;  1COW G;  4PA4 A;  3W7X A;  2OT5 A;  2P90 A;  5IY5 B;  1QR9 A;  4UV9 A;  5KA6 A;  2X7R B;  2XAH A;  3ZN1 A;  4KP4 A;  4U7O A;  5IY5 C;  3QO5 A;  4CZZ A;  3OFN G;  3HB3 B;  3CME V;  4MVO A;  1AJQ A;  5CMU A;  3STL C;  2HVJ C;  2LFR A;  1K34 A;  1XL4 A;  3MHH C;  1L1F A;  3OW2 U;  3W7W A;  1ZWI C;  4KFM A;  2IU3 A;  4PDR A;  4EKW A;  1YHQ V;  5H6Q A;  2V1D A;  3E8F A;  4RUE A;  1R3I C;  5KUM A;  5CBG A;  4FPP A;  1VQO V;  4MVM A;  5L3D A;  1FXK B;  2WLL A;  1QR8 A;  1PNM A;  1QBZ A;  1FXK C;  1K92 A;  3TK1 A;  1Q81 W;  4QE9 A;  3B8N A;  1OCR B;  4RAI A;  2ATK C;  2DQ0 A;  4DO2 A;  1DF5 A;  1OCR C;  1Y4M A;  2HKO A;  4HZ3 A;  3ZIA G;  1NBM G;  3W7S A;  1JOY A;  3CC4 V;  2Q69 A;  1H2G A;  1YI2 V;  1K8A W;  1EBO A;  3SYO A;  2X6B A;  3ZJZ A;  4P9P A;  5B1N A;  1OZ0 A;  1YTF B;  4U7N A;  2ZDI A;  2QM8 A;  5B3S B;  3CCL V;  2WWW A;  1IXM A;  4PDM A;  2WLN A;  4BAY A;  4PEL A;  2F43 G;  3LSS A;  5B3S C;  3AEI A;  3T4Z A;  2V7Q G;  4JAV A;  2DWE C;  1H38 A;  5LGT A;  1S0V A;  1E1R G;  4MSW C;  3RBZ A;  3OMN B;  1K73 W;  1QLN A;  4N21 A;  4PA7 A;  2R9I A;  3ABK B;  1YIT V;  2OTL V;  5J9P C;  3SPJ A;  4WFB V;  3ABK C;  4GCZ A;  4P9O A;  3JD0 A;  4FJC C;  4MVU A;  3ABT A;  5E1A C;  3ABL C;  4F4L A;  2B1G A;  3W7T A;  1ENV A;  2BOC C;  4L87 A;  2XOK G;  2IJJ A;  3UKM A;  5L3F A;  1GM8 A;  2FTK A;  1M9N A;  2B5U A;  1VQ5 V;  2IH1 C;  3ZMU A;  3H01 A;  1K7D A;  2QKS A;  1R3L C;  1JX9 A;  2ZQM A;  3B77 A;  1K9M W;  1G4Y B;  5EC2 C;  4JPR A;  4UV8 A;  3RVY A;  3OAA G;  1K97 A;  4MS2 A;  4TT3 G;  4LCU C;  4PDV A;  5KUK A;  2B1I A;  5H6R A;  5B1A B;  2PI5 A;  1BHA A;  2WLL B;  1KKD A;  1DTO A;  1S72 V;  5B1A C;  4J9Z B;  3D3I A;  1MOF A;  2YEV A;  4LP8 A;  4WFF A;  3CCM V;  1RM1 B;  1NJI W;  4JYC A;  2EIK C;  3SYP A;  1K5Q A;  3CC7 V;  1AJP A;  1RM1 C;  1P4R A;  1MG1 A;  4QNH B;  1M1K W;  5L3C A;  2QEX V;  3AG2 B;  2C2A A;  2WLI A;  4QJF B;  3ZRV A;  1VQN V;  3AG2 C;  1B6Q A;  2DWD C;  4JGS A;  1AR1 B;  1CEZ A;  5BZB A;  3AG3 B;  1VQL V;  1VQ7 V;  1YIJ V;  3AG3 C;  5IYB O;  2W6I G;  2ITC C;  1YJ9 V;  3OE7 G;  1KQS U;  1R6N A;  3AG1 B;  1QCE A;  1I5Y A;  3D36 A;  3OR6 C;  1H8H G;  3ZMS A;  4FMT A;  4KUM A;  2UXX A;  3AG1 C;  1BHB A;  1FXV A;  3ML0 A;  3OMA B;  1FXH A;  1OHH G;  3OEH G;  1VQ4 V;  1M90 W;  3IC7 A;  5EK0 A;  4FK5 C;  2QM7 A;  3SPC A;  4MVZ A;  3E2E A;  3AG4 B;  3E35 A;  1W0K G;  4MTG A;  3DTU B;  3AG4 C;  4X88 A;  1XL6 A;  1F4M A;  2Z3Y A;  3OGC C;  1AI5 A;  1VQ6 V;  2ZR3 A;  3K79 A;  1WLE A;  2ZD9 A;  2MK3 A;  4MTF A;  4I9W A;  4WFE A;  3QO7 A;  2BOB C;  5EBW C;  1V55 B;  1FS0 G;  1JCH A;  1SRY A;  4ASU G;  1V55 C;  2DYS C;  3B8M A;  1S3J A;  1VQ8 V;  2ZXW B;  3F5W C;  1SET A;  2ZXW C;  1MAB G;  1MSW D;  2XAQ A;  1FFT B;  2EIN B;  3LDE A;  3JD4 A;  3CC2 V;  2EIN C;  3ZCC A;  3SYQ A;  3MD0 A;  2EIL B;  1VQ9 V;  4FIP C;  2Q68 A;  2W6J G;  1NVP D;  2WLH A;  4UVA A;  3SPI A;  5DN6 G;  2YEV B;  2EIL C;  1SER A;  2XAJ A;  3EHB B;  1BL8 A;  3K0G A;  2XND G;  2DQ3 A;  3ZMT A;  2OTJ V;  3KG2 A;  3ETE A;  3ZRS A;  3GWO A;  3IFX A;  2WLI B;  3HPL C;  3VOU A;  5B1O A;  2HR3 A;  4JF3 A;  4UVC A;  2UXN A;  4MW3 A;  4R50 A;  3CCE V;  2P7T C;  2M7W A;  2PI4 A;  2P6J A;  4WCE V;  3K06 A;  4GX0 A;  4JTA B;  3SYC A;  3ETD A;  4XBF A;  1PNK A;  1R3J C;  1K5S A;  2X6C A;  3LSQ A;  5LBQ A;  3K0D A;  3ABL B;  3CPW U;  3FKS G;  1RPO A;  3K9A A;  2WLM A;  4MVR A;  3ZRX A;  1AI7 A;  2K1E A;  4N23 A;  5L3G A;  2EZO A;  4XDL A;  2EIM B;  3SPH A;  3ZMZ A;  2EIM C;  2A0L A;  2EZP A;  3RW0 A;  5IDJ A;  1JJ2 U;  4X8A A;  1SES A;  3IGA C;  3F7Y C;  2GHY A;  5C93 A;  3OUF A;  3CD6 V;  2Q6A A;  2WLK A;  3GB7 C;  1KC8 W;  1BMF G;  5LHH A;  1G8M A;  4ZBM A;  1NKD A;  3K3W A;  2HJF C;  2KB1 A;  4XDK A;  4MVQ A;  4MTO A;  4UXN A;  3ZN0 A;  1GMG A;  1JQ0 A;  4MT8 A;  4PA6 A;  2ITD C;  1Q82 W;  1SZT A;  2R9R B;  4G28 B;  2EIK B;  1VQK V;  5EC1 C;  5CBF A;  1KP3 A;  3CYO A;  1KD1 W;  4XDJ A;  1JPX A;  2D3O W;  4WF9 V;  3I56 V;  3EFF K;  4G27 B;  2XAS A;  4GX1 A;  3ABM C;  2HLD G;  3SYA A;  2IU0 A;  3T2M A;  2YSU B;  2HG5 C;  1S76 D;  1AJN A;  1AI4 A;  2XAG A;  2DW4 A;  1AI6 A;  1R73 A;  5CA3 A;  4JYB A;  4R6Z A;  1YTF D;  3NXS A;  4WFH A;  1NVP B;  1F51 A;  2Y48 A;  4P2Z A;  2JJ1 G;  3W7U A;  3CXC U;  3CCS V;  1PKX A;  2NNU A;  2DYR C;  3RVZ A;  5IYC O;  4TWK A;  3CCV V;  5LGN A;  4R8C A;  3JD2 A;  1YSC A;  2A79 B;  3K04 A;  1THZ A;  3G71 V;  1K33 A;  3PJS K;  3ABU A;  3ZRW A;  2A9H A;  1YJW V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...