1YI2V

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yi2V00
1VQ6V 3CCRV 1KC8W 1YI2V 1VQ8V 3CCMV 5DM6V 1YIJV 3CCSV 1JJ2U 1VQLV 2OTJV 3CPWU 1S72V 1M90W 3CCQV 3I55V 4WFAV 4WF9V 3CCEV 1VQKV 1QVGU 3CC4V 3CC7V 1K8AW 1VQPV 1VQNV 3CCJV 4WCEV 1K9MW 1W2BU 1YJNV 3OW2U 1Q86W 1N8RW 2QEXV 1NJIW 1YHQV 2D3OW 1Q82W 1VQMV 1VQ9V 1K73W 3CCLV 1KQSU 3CMEV 1M1KW 3CD6V 3CMAV 1KD1W 1VQ4V 3CCVV 3CCUV 1Q81W 2OTLV 3I56V 1VQOV 1YJ9V 3G6EV 3CXCU 1YJWV 1YITV 4WFBV 2QA4V 1Q7YW 1VQ7V 3G4SV 1VQ5V 1QVFU 3CC2V 3G71V 1R73A
chains in the Genus database with same CATH superfamily
3TXSA 1NTZH 4IYHA 1PV0A 1JFFB 1BQ0A 1GTOA 4D7SA 1N33B 3CRMA 3CC7V 5IT9N 1F51A 4CBCA 4UVCA 2WLLA 1K73W 1N32B 5FLXN 4I0XB 4W4KA 3ABKB 3OR7C 4X1KA 1ZUQA 3ASOB 4RAIA 4TUYB 1Q43A 5DECA 2OT5A 5GONA 2N05A 1FXKA 4DV6O 4YJ3A 4ZIBA 1EN4A 4X20B 1QR9A 2QDOA 4GLXA 1Y76B 3GWKC 2IJJA 1R3IC 1HDJA 3GWOA 2ZT9B 4JI7B 4PDLA 1S77D 5LOVA 1PD3A 4X9QA 4JI1O 2HHHO 2KKWA 2OCCB 1KB9F 4FM1A 2XASA 3DC5A 2P5OA 3ABLC 4NYKA 5L3CA 4LF6B 1XMOB 1G6UA 5D5QA 4LCUC 4JI1B 2HHHB 2CH7B 3T1CA 3WG7B 2X6CA 4YIPA 3J81N 3S3WA 2Y0IA 2GTAA 3P3PA 1E1RG 4I55A 2DYSB 1BSMA 1JMKC 1BGYH 3E83A 4JI5B 1NR1A 2EIMC 3CYOA 3Q4HA 3ZIAG 3ZN1A 4WBNA 1O9GA 5TISZ 1ZAUA 3E8FA 1FFTB 5H6RA 1VQ6V 2M7WA 4UB8Z 5EBLC 4O2AB 3QO7A 5J2TA 3I55V 1XHXA 3CJHA 4FLTA 2EILB 4DV2O 3K79A 2UXCB 1FFXB 4U3JA 3MHHC 4J7ZA 4YY3B 2KQXA 3H01A 2WA3A 2QM7A 1CPYA 5A2QN 3BPZA 4MVOA 1MZEA 3HKCA 2ZM6B 1Q6IA 1XQ8A 2DOSA 1K8AW 2ZE5A 1FJGB 1L0NH 1QCEA 3ETQA 5JJJB 2EJ7A 4I9WA 2R9IA 2QWOB 1YJ9V 4D7TA 1NU1H 3SYPA 5JQGA 3OD4A 1XL6A 4O4HA 2Q5ZA 4IL6Z 1S5HC 3H1JH 4BW5A 4ZOLB 4NXMO 2DMXA 1VIBA 1PM9A 2QR4A 3H1IH 2VWJA 4DV3O 4B3RO 2YDEA 3MDSA 1JPXA 4CS3A 2FB5A 2EULA 3RYFA 1MMMA 2X6AA 4OX9O 4H44B 3CRRA 2EIMB 4ZHQA 1YXBA 3UO2A 3EHBB 1SQVH 1AB3A 5EZYA 4FFBB 1W2BU 4RUEA 1DGSA 1NJIW 1Q8IA 1Q82W 5IYCO 4JF3A 4X64O 1IBKO 4DV4O 1Q81W 4IHJB 1VMGA 2JDIG 1M4UA 2R9RB 3KCYA 2UXDB 1OZ0A 5IYZA 4GKKB 1BHBA 3B8MA 2AW9A 5E1AC 4X64B 2A7WA 2BTOA 2Y4TA 1R3KC 5BXZA 4DV4B 5B5EZ 5IJ0B 1P7GA 2XAGA 1TVKA 2WSSG 4B7KA 2Q73A 5FL7G 4HYOA 3CHXA 3G6EV 2CTRA 3ZJZA 4L87A 4K3AA 2B5UA 2IJKA 5DM6V 3CCSV 1M90W 4JTDB 3SPGA 4GX5A 1NH2B 4KHPO 1GAXA 1K5QA 4UB6Z 2RQ6A 3K0DA 5EYPB 1NZ6A 5D5PA 2P7TC 4DK0A 1ZL8B 4X62B 3CMEV 4DO2A 4AILC 3CXCU 2OYQA 2UXBO 2IH1C 4NXNO 1PPJH 2P06A 5LL6Y 2EZPA 4DUYO 4FLXA 4IYIA 1D5NA 5KX5A 3FKSG 2LGQA 4EB6B 3VOUA 1V54C 5H9CA 2FL4A 1KD1W 3HKDB 4N23A 1SZTA 3G67A 2CE4A 4MVMA 2Q69A 2WLIA 3ZRSA 3VQYA 2HG5C 3K3WA 4LFBB 4PJ0Z 1PNMA 4BIZA 3SYQA 5JVDB 1B04A 1K4CC 4UVAA 3QO8A 2PGGA 4JYAO 1HWYA 2DWDC 2JS5A 4PI0A 2XAQA 4I4TA 4CC5A 4O2BA 4AI8A 3SJQC 1H8EG 2F66C 5A9GA 1YVWA 2JEXA 4HNAA 4J10A 4P9OA 3R66A 2ARHA 4XDLA 4LWSA 2XT9A 1GK9A 2P67A 1K33A 3RBZA 3JAKA 3LNNA 1RSOB 3ZRWA 3VBBA 5BR8O 4J7JA 4LH6A 4QNHB 2V7QG 1R3JC 2DQ3A 3JYCA 4B3TO 3L9DA 3CWBH 1H2SB 4JI4O 3A2FA 4NR1A 1GN2A 1VQ4V 3W7TA 2PYJA 4PDRA 3TETA 5B1OA 3ABTA 1RP3B 4QIWF 1F23A 3THOA 4JI4B 3RYHB 4LFAO 1P49A 2R70A 4X1IB 4U7NA 2EX3A 3CSXA 3TJTA 2Q68A 4IIJA 4O4IB 3ABMB 5KAFZ 3ZMVA 1QLEC 1VEWA 1T5EA 1P4RA 1CEZA 1OCZC 4K0KO 2XAHA 1N34O 4MVQA 2ILMA 1VP7A 2Q9LA 4WFHA 3C3SA 2YSUB 2A9HA 2UUCO 3OW2U 1HW7A 2EIJB 4DV0O 1N34B 4HAMA 5HFLA 2AZ2A 1SC5B 2KG7B 4O4LA 2CTQA 5C93A 2WA4A 5L3FA 4J11A 2UUCB 4JI8B 5ITZB 4QJFB 4MS2A 3FB7C 1I0HA 1FXKC 2CTWA 3OM3B 2D2CB 3MHSC 3H9VA 1R6NA 3AG2C 4R50A 1AILA 3K0GA 1LUWA 5EC2C 2QTOA 1M57C 2GUZB 4O4JB 1GN4A 2MW2B 4PV1B 5B3SB 1P84F 1MSWD 2NLJC 3BAAA 4TV9B 1EFRG 5LGNA 3CC2V 3UT5B 4JAUA 1HNZO 2UUBB 4N21A 5IJ9A 3ZCCA 3N2KA 3AG1B 2O57A 3LDDA 3ZEDA 2RN9A 1MABG 4J7KA 1SESA 4LH7A 3CP1A 4JI3O 1VF7A 4YIOA 3SYAA 1K7DA 4DR2B 3UO3A 3T1HO 3ZMTA 3AK3A 2DYRC 3DXRB 1HNXO 4JYBA 2X7RB 3JALA 1KP3A 2EIKB 2A0LA 4PA7A 2HJDA 2VQFO 4CZZA 5K1XA 2ZNJA 1HNXB 2ZD9A 4FLZA 1TUBA 1GO3F 4ZBMA 4TT3G 4Z1VA 2HR3A 1HNWB 1J5EO 5B1AC 1YTFD 2WLLB 4DR5B 4E4EA 1NS1A 4DR4B 3OMAB 2K9PA 3ZMUA 1S72V 3CCQV 4X1KB 1ZWIC 2ZXWB 1COWG 1R6KA 4UVBA 4LF8B 1QU7A 3T1YO 4MW3A 2Q7HA 2EJRA 3VQVA 4RQEA 3JD3A 5GONB 3ML0A 4UCRA 1FXKB 5B66Z 1AP6A 4X88A 4YJ3B 4XDKA 5F2VO 1VARA 4DV5B 4FMTA 4DR1O 2B1GA 1KU9A 3LSQA 1DK1A 2PI5A 1ZSPA 4WFAV 1MOFA 4LNUA 4ASUG 2Y48A 1M56B 2LP7A 2XHBA 2Q8VA 4JI2B 3K5NA 5HFMA 4GX2A 3UM7A 3B8NA 3HPLC 1G1XB 5L3GA 4TWKA 2YS8A 4JAAA 4TQDA 3APOA 3OMNB 4X1YA 2CGOA 5BY1A 4QGPA 2IU3A 2DYRB 2QWPB 5BMVA 4DR3O 4FFKA 5CB4B 4TV8A 1L0LH 2K1EA 2AZ0A 3K57A 5J2UA 2ZR2A 2YXYA 3D36C 4G28B 4I55B 3C90A 2Y69C 1A32A 2HLDG 3Q4HB 1JOYA 4FLYA 1SETA 2AXTZ 3OUFA 1XL4A 1VQMV 4UFZA 1AI7A 4JZGA 3CJHB 3FFQA 3FB8C 5LP6B 2XAFA 2R72A 4EFBA 4DV6B 4U3JB 5JCOC 5FNVA 1YSCA 1MG1A 4I50A 3L75H 1MZFA 2LO1A 2LFRA 4JV5O 1F7YA 1IURA 3HKCB 3B09A 1H2NA 3D8CA 5KLVH 4KXRA 4LP8A 5LGTA 4RWUA 3FYIB 4CH6A 3OGIB 2YI8A 3FYEB 4J9YB 2ZKOA 1BE3H 4I5SA 3HKEB 2GSMB 2QGNA 5JQGB 4LF7O 4R7CA 4O4HB 3DSQA 3G80A 4NTXA 2OCHA 3JASB 4JASA 1WPBA 3RVZA 4UCSA 5CN0A 1WLEA 4H33A 1NKDA 2HVKC 3AG4C 4I0XA 1SQFA 3FAVA 3RYFB 4I9QA 1N0JA 2ZE8A 3OUSA 2IJHA 1US6A 4ZHQB 4LF5O 1PNKA 3SR2C 3ZMSA 5EZYB 1ORQC 1GH6A 1F4MA 2XNDG 1QVFU 4DV2B 3CB2A 3SYCA 1SQXH 1KC8W 1M5IA 4QE9A 3AG3C 4X20A 3ZRXA 4JTAB 3GB7C 3KCXA 1XBLA 3E2EA 2KB1A 3JATA 1JA8A 2DE0X 5IYZB 3T4ZA 2OIEA 1GN6A 5AG2A 3UQ8A 3OEHG 3ABLB 2WLMA 3ASNC 3RN4A 4WFEA 1DLBA 2ZNIA 1FXHA 1DTOA 1NVPD 4NTWA 4OPAA 1EN6A 1PL0A 2A79B 1VQNV 1Y67A 4AHCA 5LA6B 1Y4MA 1MA1A 4GZRB 3K58A 3EFFK 2QA4V 2HKOA 1EZVH 4NXMB 3D36A 5KHJA 3CRCA 2PYLA 2ZINA 4PI2A 5LMNO 1S0VA 2OTJV 3QG5A 2A3QA 4DV3B 4B3RB 2QKAA 1AJQA 3SJCC 1WJZA 2E3CA 1U97A 1YCIA 1UJWB 1YHQV 2YEVB 4OX9B 3A0RA 5LHIA 2VQEO 3E89A 5H5NA 1Y66A 3W7XA 3U11A 5KX5B 4UXNA 2F95B 1S76D 3O65A 2LW7A 2HVJC 3SPHA 2QM4A 1WAZA 2ZIMA 1ENVA 1N0NA 5LGUA 4DR7O 2X6BA 4JI0O 3S3XA 2ADQB 4YJ2A 1YIJV 5JCOA 1QVGU 2LW1A 1N36O 2HFEC 4B7EA 1IBKB 4R8CA 3AEIA 1E1QG 1WP7A 2WWWA 1EBOA 2M6YA 5K1PA 1ZTEA 1Q90D 2NNUA 4MTFA 4W4LA 3KZIZ 1N36B 5DEDA 1NTKH 3JCUZ 5B1BC 1HR0O 3CRQA 4I4TB 3X2QC 3IC9A 3CPWU 4LF4O 1VQPV 1K9MW 4GKJO 3MAQA 4HNAB 1Q86W 3LSUA 1XMQO 3RW0A 5E79Z 3BY6A 4LWSB 5JWPA 3VQXA 2W0FC 4XDJA 3WFVA 2UUAO 1YITV 2RJZA 1AR1B 4KHPB 4MVUA 3JAKB 1OCCC 1K97A 2DQ0A 5IYDO 2IW5A 3KKYA 4CH3A 3OTOO 3QO5A 2UXBB 2Q6AA 4DYLA 5CA1A 1Q5OA 3W7SA 1V55C 5C8YA 3E22A 5GTIZ 4NXNB 2L35A 4Z1MG 3A8TA 4E2LA 4DUYB 1S5LZ 2BTQA 1H38A 3OTOB 4TSFG 1LNQA 4MVRA 1DF4A 3N27A 1WB8A 3ZHUA 2Y0PA 3JAWA 4WCEV 1OCRC 2A06H 3QVNA 4ZI7B 2VRZA 4DV1O 4FLWA 4ICGA 4H37A 5LMUO 4LFCO 3HKBA 1NQTA 1I5XA 4LF9O 1IBLO 1IDSA 3EVKA 2UU9O 2YXLA 1OCOC 1EM1A 4JYAB 4LFCB 3ZMZA 1RM1C 3RVYA 5KMGA 4LC1A 1S3JA 1R3LC 2QM8A 4DK1A 4B3MO 3I56V 2ODMA 3RYCA 5KUMA 1SA0A 4ZKIA 1XDCA 4IGGA 5EBMC 4F6RB 2EINC 3RYIB 1FPOA 1ZL8A 1Q6HA 3K5OA 3D3QA 3T4DA 1VQKV 1SKVA 5BR8B 5KHIA 1AJNA 5BZBA 2BSKA 5CBGA 2AGAA 2DN9A 4B3SO 5CA0A 3CEIA 4B3TB 3CD6V 3K59A 2JS3A 2UXXA 1WA8B 1LUVA 4BIUA 3OFNG 4FK5C 4PHZA 4X66O 1V54B 1YTFB 2F23A 1BL8A 5LBQA 1I94O 1I7FA 2JJ1G 3FX7A 2YIBA 5IJ9B 2RCVA 1XNQO 3N2KB 2BOCC 4Q6GA 4BR6A 4KFMA 3CCUV 3TCUA 4LFAB 4EEQA 2H94A 1H2KA 2GBOA 1YI2V 1Y6XA 4UV9A 1JCHA 3W7UA 1AI6A 1K3EA 4J41A 4X8AA 1XHZA 2W0XA 5JH7A 1XI1A 1SQBH 1OJHA 1EZJA 3QTCA 4DRXA 4K0KB 4GYCB 4L8JA 3FB6C 1PNLA 1RFYA 1P7BA 1UFIA 2Y4UA 4CH5A 2V1DA 4DV0B 1NBMG 1TUBB 1AVMA 4RQFA 1W0KG 3BRCA 1H2LA 3SJAC 1IVSA 1Y74B 1HP8A 4DR6O 2YIBD 2IM9A 2FKXA 4TQFA 3IAYA 1SERA 3LDEA 3P32A 3E35A 4P30A 5EK0A 1YEWA 4FLVA 3C3TA 1JX9A 2E75B 4UCUA 5L3EA 2HEPA 2Q67A 2EBOA 1XEQA 1HNZB 4OGQB 3G6BA 4X1IA 1K4DC 4JPRA 2RNBA 3I5DA 2ZIOA 1VQ8V 3CX5F 4FVMA 4BWAA 2E5LO 3PJSK 4YHHO 1QLEB 2ZCEA 2XAJA 1TA8A 3N2GB 1G4YB 4MT8A 2JGDA 1DF5A 2NR5A 2BE3A 1OCZB 1OV9A 4JI3B 3JD1A 4AQYO 3T1HB 2PF4E 1NTMH 1BZKA 4X1YB 3P3NA 1IBMO 1K92A 1KP2A 2E5LB 2P4KA 3CE2A 2ITCC 3OEEG 1Q7YW 5BMVB 1X59A 5IDJA 3SJBC 1IZ3A 4TV8B 2JIZG 4DV7O 3SPIA 2VQFB 4DW1A 5J2UB 3SPCA 5B1NA 1E79G 3ABKC 3L72H 3BEHA 3L74H 3APQA 3ASOC 1D2DA 4IT5A 1S5JA 1J5EB 4FZ1A 4D6TH 4JI6O 1EN5A 4H13B 4C7UA 1F4NA 1XNRO 3CXHF 3JD0A 1QQCA 2P6JA 3AG2B 3K06A 1LR1A 1KKCA 2PZSA 5JJNB 3T1YB 1ZX3A 1J95A 4JI6B 1M57B 4JAVA 4O4JA 1XNRB 5LOVB 4HBNA 2H8PC 3ZN0A 2YICA 5KA6A 1WP8A 5DN6G 4DR1B 5FNVB 2OCCC 3R65A 2YIAA 3F5WC 2GV9A 5IE9A 4I50B 2LGWA 3JARA 4G27B 1WN7A 2P90A 5LXTA 2PTMA 1NT2B 3WG7C 2EZOA 1YZBA 5J9PC 3M7MX 2H3OA 3B77A 2Z5UA 3DXRA 4LR3A 1N33O 1G8MA 4J42A 2N04A 4PA9A 1Q3EA 1AP5A 1YDXA 2YIDA 1O9HA 2DYSC 1M93A 3F7YC 3SYOA 2W6JG 1N32O 3T2MA 4X65O 3BA8A 2QKCA 4DR3B 3DTUB 2QJ1A 4JGSA 4WBNB 2WLNA 2Q0AA 1NVPB 3BVOA 5LYJA 3BA9A 1RPOA 5B1AB 4FM2A 4X65B 1FS0G 3CCLV 3FAVB 4MTOA 5J2TB 2NN4A 4OPHA 3OMIB 3BABA 2C2AA 2EILC 2F93B 1Z5VA 1SF9A 1YF2A 4RO2A 4B08A 4YXWG 1BT8A 4I7ZB 2LFSA 3NR7A 4JI7O 3BCCH 4RUFA 1H2GA 2HJFC 4JZ2A 3U0ZA 3OE7G 1JVMA 1X4TA 5GTHZ 4CS4A 1TUEB 1M1KW 1FD9A 3K9AA 1V9PA 3JATB 4LF6O 1XMOO 4FLUA 4PD4F 1CP9A 3IC7A 4JV5B 2FYUH 1ROPA 2YXHA 4MVZA 4F4LA 3JAMN 3QF7A 3AK2A 3BFRA 2YUAA 3JD2A 1YJNV 2PI4A 2OIGA 5CBHA 1JFFA 4QE7A 4JYCA 4LF7B 1K5SA 2E76B 2FMLA 4JI5O 3OAAG 1ZLZA 2ZQMA 5CB4A 3O9OA 4PA4A 5LHGA 1VF6C 3H1LH 1FXVA 3F5TA 2Y69B 2VWKA 2QKSA 4TUYA 2QE7G 4PELA 3CMAV 3CS5A 4KP4A 2OTLV 2ETNA 4DW0A 1AR4A 4CS2A 1VQ5V 2JVDA 2UXCO 3K5MA 3HR0A 2Q0OC 4LF5B 1Y76A 1SRYA 1KUQA 4A5UB 4PA3A 4J9ZB 1PKXA 2JJ2G 5LP6A 2CK3G 2ZR3A 3JCZA 4YY3O 5IY5C 3ZHVA 4CC6A 1AI5A 2Z0AA 1NR7A 4TOIA 3U10A 4YJ2B 2ZM6O 1QBZA 1SS3A 3ZBHA 2GDSA 3ZHTA 2DW4A 5KUKA 3AG7A 1FJGO 2XTAA 1R1BA 5CA3A 2QSAA 1TVKB 4PDMA 1MSDA 5EC1C 3CCMV 2CH7A 3A0BZ 3NXSA 3LSSA 2N74A 1JJOA 3QNEA 2X0LA 1FYJA 3B4SA 2CAZC 3E8HA 3HKEA 1GMGA 4P9PA 3CRAA 3JSLA 1JJ2U 5H6QA 2Q7GA 2YI9A 3TGUH 2UXNA 3JASA 2WAMA 4UCTA 2MK3A 1GN3A 4UUJC 5KHKA 2XUMA 3AG4B 5LMNB 4O2AA 2WLKA 2HP8A 5CA1B 2XOKG 3IFXA 1KECA 3G71V 4EKWA 3E22B 5C8YB 3IGAC 1L1FA 1FFXA 3L73H 2BTQB 2QWRB 4UV8A 2VQEB 4GCZA 3P30A 3OT7A 4BIOA 2IBZH 1U96A 4MTGA 3STZC 2WLIB 3AG3B 2UXDO 3WB1A 4GKKO 4DR7B 4HZ3A 3JAWB 4R6ZA 4JI0B 3ABUA 5IY5B 1OHHG 2KSDA 2F4VO 3RFRA 4NTYA 4NKGB 1QLNA 4P2ZA 3HKBB 3J7AU 4O2BB 3JD4A 3CCJV 1I5YA 3K04A 1N8RW 2F4VB 3RGBA 1FAFA 3ASNB 4GT1A 3K9SA 1BQZA 1GRJA 1SQPH 1HR0B 3KG2A 3K08A 1Z5WA 5KMGB 2ZE7A 4LF4B 1BMFG 4ZOLA 1VF5B 2ATKC 4GKJB 2RDCA 4X62O 5GW7A 5LA6A 1XMQB 1KKDA 3ZRWB 2JK5C 4LBEC 4BAYA 3RYCB 2FTKA 1SA0B 1VF6A 2UUAB 2GHYA 2IJIA 4FZ0A 3OTFA 1Q6UA 2QWNB 2LJ2A 5EIBC 4PDVA 3B40A 4FJCC 3PN1A 4NVPA 2BSKB 2IU0A 4FFBA 3J80N 1GKFA 3CCRV 4WFGA 5CA0B 1KMIZ 2YEVA 2WLJA 2CTPA 3F7VC 4IHJA 5KHGA 4OXSA 4LFBO 1N4CA 5KA5A 1XREA 2AHZA 4IIJB 1AI4A 3ABMC 5IJ0A 2WLHA 1WB7A 2E74B 3ETGA 4DV1B 2ZDIC 4WF9V 5LMUB 5LHHA 3SGIA 2OWOA 4LF9B 1IBLB 2QEXV 3L70H 3D3IA 5B1BB 2UU9B 3X2QB 3DC6A 5JJEB 5JH7B 2IH3C 1TGOA 1PP9H 1BCCH 1B6QA 3ETDA 2EIJC 4DRXB 2ITDC 1B06A 1QR8A 3E8GA 5EYPA 2CUGA 3RT3C 4O4LB 4B3MB 4DUZO 3M8AA 3ZHRA 4U3FH 3HB3B 1B3QA 4X89A 1MNGA 2CDYA 1OCCB 4J80A 4FIPC 4FPPA 1RPRA 1D5AA 1VQOV 3BHPA 2PY5A 3W7WA 2B9ZA 1WPXA 4DUZB 2DWEC 2GTSA 1V55B 3K03A 2Q4PA 4EB6A 1PL4A 4B3SB 5CBFA 5B3SC 1WNSA 3HKDA 4Q20A 2DJVA 2JEUA 3DGEA 3ZX6A 2D3OW 4X66B 3OGCC 3ICXA 3AG1C 3L71H 2PUSA 1I94B 1OCRB 5JVDA 4ZI7A 3WB0A 5H2FZ 1NH2D 1XNQB 5IWAO 1VQLV 2ZE6A 2CGNA 3H1KH 1IX9A 3H1HH 4MSWC 1OCOB 2R9AA 1W59A 2JGDB 5IWAB 3JALB 1RM1B 3ZRVA 2EIKC 2BCCH 1W0JG 3B2EE 1URFA 3EXAA 1RSOA 3M99B 3CC4V 3GVMA 5FPRA 4XBFA 4JI8O 2YC0A 4F6RA 2EINB 1THZA 4K8ZA 1SQGA 3RYIA 3TXQA 4KL1A 4CH4A 1L8DA 2QWQB 3STLC 3ZS8C 2ZXWC 4KUMA 5CMUA 1AJPA 2F1MA 1QHTA 4QPJA 1KYOF 4Z2WA 1M9NA 4WFFA 4DR6B 3ZHQA 5IYBO 4MW8A 2WPDG 2QTSA 4JTCB 1Z2GA 1K34A 1WA8A 2V4DA 1KBHA 2UUBO 3FB5C 3FD9A 5EBWC 3WB2A 3RYHA 4F6EA 4FM0A 4LNUB 4K8XA 1XOUA 3LDCA 1VQ7V 5KAIZ 3K5LA 1M56C 1H2MA 1UPGA 5KHHA 4O4IA 4K35A 5FPOA 2JGUA 3RWRD 1QNMA 3JARB 1I08A 2LQTA 3CCEV 4DR2O 5LXTB 1TAEA 2ZDIA 2BOBC 1H8HG 3SPJA 1KQSU 4MTXA 2G38A 3LNMB 4GX0A 3CCVV 4YHHB 1YJWV 1GM8A 3UCSC 5EIBD 3LUTB 1JR9A 3SDLA 2L6LA 2F43G 4AQYB 4U7OA 3UKMA 1AROP 4NB5A 1IBMB 1HNWO 2P22C 2KG7A 1IXBA 2B1IA 1BS3A 3E86A 4DR5O 2AHYA 4PA6A 4DR4O 1NI8A 5ITZA 3TK1A 4DV7B 4UCVA 1XILA 1SZXA 5L3DA 3JSNA 3OR6C 5LYJB 1R6TA 4LF8O 3ETEA 4H0LB 1GM9A 3ZHSA 4BW9A 1JQ0A 1Y74A 3E8BA 4QPKA 3A0HZ 3IJ4A 4DV5O 5LP6C 2GUZA 3MD0A 2RMKB 1BHAA 1SQQH 4GUNA 4TV9A 2VS0A 3UT5A 1VQ9V 4DXWA 4ABMA 2Z3YA 3WU2Z 1CXZB 3G4SV 2W6IG 4JI2O 1IXMA 4G2KA 1FKAO 4MVSA 2Q7EA 2ADPA 4JYYA 3AK1A 3VQWA 1GM7A 1AR5A 4EFEA 4GX1A 3N2GA 5L3BA 2JRIA 4UCOA 4WFBV 1XUQA 2P4VA 1R73A
chains in the Genus database with same CATH topology
1LNQA 4MVRA 1DF4A 4PDMA 4QJFB 4MS2A 3FB7C 3CCMV 5EC1C 1GTOA 1FXKC 3NXSA 3CC7V 3LSSA 3OM3B 4WCEV 3MHSC 1OCRC 1F51A 4CBCA 1R6NA 3AG2C 3QNEA 2X0LA 4R50A 3K0GA 4UVCA 2WLLA 1K73W 5EC2C 2QTOA 1M57C 4H37A 1NQTA 3E8HA 5B3SB 1I5XA 1MSWD 3ABKB 1GMGA 2NLJC 3OR7C 4P9PA 1EFRG 3ASOB 4RAIA 5LGNA 1JJ2U 5H6QA 3CC2V 2UXNA 4JAUA 2OT5A 1OCOC 4N21A 3ZCCA 3ZMZA 2WAMA 1RM1C 3RVYA 1FXKA 3AG1B 2MK3A 3LDDA 4LC1A 4UUJC 1S3JA 1QR9A 1R3LC 1MABG 1SESA 2QM8A 2IJJA 3AG4B 1R3IC 3GWOA 3CP1A 2WLKA 3I56V 4PDLA 3SYAA 1S77D 1K7DA 5KUMA 2XOKG 3IFXA 1KECA 3G71V 1PD3A 4EKWA 3ZMTA 4ZKIA 3IGAC 1L1FA 5EBMC 2DYRC 2EINC 2OCCB 4UV8A 4JYBA 3T4DA 2XASA 1VQKV 2X7RB 4GCZA 1KP3A 3P30A 1AJNA 5BZBA 2EIKB 2A0LA 3ABLC 5CBGA 5L3CA 4PA7A 4MTGA 3STZC 2WLIB 4CZZA 3AG3B 4LCUC 3CD6V 3T1CA 4HZ3A 2ZD9A 3WG7B 4R6ZA 1GO3F 2X6CA 3ABUA 2UXXA 4ZBMA 4TT3G 2HR3A 5IY5B 1OHHG 5B1AC 1YTFD 2WLLB 4BIUA 3OFNG 4FK5C 1V54B 1QLNA 4P2ZA 1YTFB 3OMAB 3ZMUA 1S72V 3CCQV 1BL8A 5LBQA 3JD4A 1ZWIC 3CCJV 2ZXWB 2JJ1G 1E1RG 1COWG 1R6KA 1I5YA 3K04A 4UVBA 1N8RW 2DYSB 3ASNB 4GT1A 4MW3A 4RQEA 2EJRA 3E83A 3JD3A 1NR1A 2EIMC 3ML0A 2BOCC 3CYOA 3KG2A 4KFMA 3K08A 1FXKB 3TCUA 3ZIAG 3ZN1A 4X88A 3CCUV 4XDKA 3E8FA 2H94A 1FFTB 1BMFG 4FMTA 5H6RA 1YI2V 2ATKC 1VQ6V 2M7WA 2B1GA 4UV9A 5GW7A 5EBLC 3LSQA 1JCHA 2PI5A 1KKDA 3ZRWB 3W7UA 1AI6A 3QO7A 1K3EA 2JK5C 4LBEC 4X8AA 4BAYA 3I55V 4WFAV 1MOFA 2FTKA 2EILB 4ASUG 2Y48A 3K79A 2GHYA 2IJIA 1M56B 2LP7A 1EZJA 4PDVA 5HFMA 3MHHC 4GX2A 4FJCC 3UM7A 3B8NA 3HPLC 5L3GA 4TWKA 2IU0A 3FB6C 1PNLA 1GKFA 3H01A 3CCRV 1P7BA 4WFGA 2QM7A 2YEVA 1CPYA 2V1DA 3OMNB 1NBMG 4MVOA 2WLJA 1K8AW 4RQFA 2IU3A 1QCEA 1W0KG 2DYRB 4I9WA 3F7VC 4OXSA 2R9IA 5KA5A 1YJ9V 2ZR2A 2AHZA 3SYPA 4G28B 2Y69C 1XL6A 1AI4A 3ABMC 2HLDG 2WLHA 1SERA 3LDEA 1JOYA 3ETGA 1S5HC 3P32A 3E35A 4P30A 5EK0A 4BW5A 2ZDIC 4WF9V 5LHHA 1JX9A 1SETA 3OUFA 2QEXV 5L3EA 1XL4A 3D3IA 2Q67A 1VQMV 5B1BB 2EBOA 1AI7A 3X2QB 1JPXA 2IH3C 3FB8C 2XAFA 1K4DC 4JPRA 2X6AA 1B6QA 3ETDA 2EIJC 2EIMB 1VQ8V 2ITDC 1QR8A 3PJSK 3E8GA 1QLEB 2XAJA 1YSCA 1G4YB 3EHBB 4MT8A 1MG1A 1DF5A 1OCZB 2LFRA 1W2BU 4RUEA 3HB3B 4X89A 1NJIW 3JD1A 1OCCB 4FIPC 1Q82W 5IYCO 4FPPA 4JF3A 1K92A 1KP2A 1RPRA 1VQOV 4LP8A 5LGTA 3W7WA 1WPXA 3FYIB 2ITCC 3OEEG 1Q7YW 1Q81W 2JDIG 5IDJA 2DWEC 1V55B 2JIZG 3FYEB 3K03A 4J9YB 3SPIA 2R9RB 5CBFA 1OZ0A 4I5SA 1BHBA 3SPCA 3B8MA 5B3SC 2GSMB 5B1NA 1E79G 3ABKC 5E1AC 3BEHA 4Q20A 3ASOC 4R7CA 1R3KC 2JEUA 3DGEA 2XAGA 2D3OW 2WSSG 4JASA 3OGCC 5FL7G 4HYOA 1F4NA 3RVZA 5CN0A 3G6EV 3AG1C 3ZJZA 4L87A 3JD0A 1WLEA 4H33A 1OCRB 1NKDA 3AG2B 2P6JA 3K06A 2B5UA 2HVKC 2IJKA 5DM6V 1J95A 3AG4C 1NH2D 1M57B 3CCSV 1VQLV 1M90W 4JAVA 4JTDB 3SPGA 4GX5A 2H8PC 1NH2B 3ZN0A 3OUSA 5KA6A 2IJHA 1K5QA 5DN6G 3K0DA 2OCCC 2P7TC 3R65A 1OCOB 1PNKA 4MSWC 3CMEV 3F5WC 3ZMSA 4DO2A 1RM1B 3CXCU 1ORQC 3ZRVA 4G27B 2EIKC 2P90A 1F4MA 2XNDG 1QVFU 1W0JG 2IH1C 3SYCA 1KC8W 4QE9A 3AG3C 3ZRXA 2EZPA 3WG7C 4JTAB 3M99B 3GB7C 3CC4V 2EZOA 3E2EA 4XBFA 2KB1A 5J9PC 3FKSG 3B77A 2Z5UA 3VOUA 1V54C 2EINB 1THZA 5H9CA 3T4ZA 1KD1W 1G8MA 4N23A 4PA9A 3STLC 1SZTA 3OEHG 2ZXWC 3ABLB 2WLMA 4MVMA 2Q69A 2DYSC 3F7YC 4KUMA 3ASNC 3SYOA 2W6JG 4WFEA 1DLBA 5CMUA 1FXHA 2WLIA 3T2MA 1DTOA 3ZRSA 1AJPA 2HG5C 3DTUB 4QPJA 1NVPD 3K3WA 4JGSA 1M9NA 4WFFA 2WLNA 1PNMA 1PL0A 1NVPB 5IYBO 4MW8A 2A79B 2WPDG 4BIZA 1VQNV 3SYQA 4UVAA 1K4CC 4JTCB 1RPOA 1K34A 3QO8A 5B1AB 3FB5C 3CCLV 1FS0G 1Y4MA 5EBWC 1HWYA 4MTOA 2DWDC 2XAQA 3EFFK 3OMIB 2C2AA 2EILC 2QA4V 3LDCA 3SJQC 1H8EG 2HKOA 1VQ7V 1M56C 4RO2A 3D36A 2JEXA 4YXWG 4P9OA 1S0VA 2LFSA 4RUFA 4XDLA 2OTJV 1H2GA 2HJFC 3CCEV 3OE7G 1AJQA 2ZDIA 2BOBC 1GK9A 1JVMA 2P67A 1H8HG 1TUEB 1UJWB 1YHQV 1K33A 2YEVB 3RBZA 3SPJA 3A0RA 1KQSU 5LHIA 4MTXA 1M1KW 3LNMB 3K9AA 4GX0A 3ZRWA 3E89A 3VBBA 3CCVV 1Y66A 3W7XA 4UXNA 1YJWV 1GM8A 4QNHB 1S76D 2V7QG 1R3JC 2HVJC 3SPHA 3LUTB 1CP9A 2DQ3A 3IC7A 3JYCA 1ENVA 1ROPA 2F43G 5LGUA 4U7OA 3UKMA 2X6BA 1YIJV 4MVZA 4F4LA 1AROP 1QVGU 2HFEC 3JD2A 4R8CA 1YJNV 3AEIA 2B1IA 2PI4A 3E86A 1E1QG 2AHYA 4PA6A 2WWWA 1EBOA 3TK1A 1VQ4V 3W7TA 5CBHA 2NNUA 5L3DA 3OR6C 4MTFA 4PDRA 4QE7A 3TETA 4JYCA 3ABTA 5B1OA 4QIWF 1K5SA 1F23A 3ETEA 1GM9A 1JQ0A 3OAAG 3E8BA 2ZQMA 5B1BC 4PA4A 4QPKA 3X2QC 5LHGA 3CPWU 1FXVA 3MD0A 1BHAA 4U7NA 1VQPV 1K9MW 2Q68A 1Q86W 2Y69B 3ABMB 2QKSA 3ZMVA 1VQ9V 3RW0A 2QE7G 4DXWA 4PELA 1QLEC 3BY6A 3CMAV 4KP4A 2OTLV 2W0FC 2Z3YA 4XDJA 3WFVA 1P4RA 1YITV 1CEZA 1OCZC 1AR1B 3G4SV 1VQ5V 2W6IG 4MVUA 2XAHA 1OCCC 1IXMA 1K97A 4G2KA 4MVQA 2DQ0A 5IYDO 2IW5A 4MVSA 1SRYA 4WFHA 4PA3A 2YSUB 4J9ZB 1PKXA 2A9HA 2JJ2G 2CK3G 2ZR3A 3JCZA 3QO5A 2Q6AA 3OW2U 5IY5C 2EIJB 3W7SA 1AI5A 1V55C 1NR7A 1GM7A 4HAMA 1QBZA 4Z1MG 5HFLA 4GX1A 4E2LA 2DW4A 5KUKA 5L3BA 1H38A 5CA3A 5C93A 5L3FA 4WFBV 2K1EA 4TSFG 1R73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 V;  3CCR V;  1KC8 W;  1YI2 V;  1VQ8 V;  3CCM V;  5DM6 V;  1YIJ V;  3CCS V;  1JJ2 U;  1VQL V;  2OTJ V;  3CPW U;  1S72 V;  1M90 W;  3CCQ V;  3I55 V;  4WFA V;  4WF9 V;  3CCE V;  1VQK V;  1QVG U;  3CC4 V;  3CC7 V;  1K8A W;  1VQP V;  1VQN V;  3CCJ V;  4WCE V;  1K9M W;  1W2B U;  1YJN V;  3OW2 U;  1Q86 W;  1N8R W;  2QEX V;  1NJI W;  1YHQ V;  2D3O W;  1Q82 W;  1VQM V;  1VQ9 V;  1K73 W;  3CCL V;  1KQS U;  3CME V;  1M1K W;  3CD6 V;  3CMA V;  1KD1 W;  1VQ4 V;  3CCV V;  3CCU V;  1Q81 W;  2OTL V;  3I56 V;  1VQO V;  1YJ9 V;  3G6E V;  3CXC U;  1YJW V;  1YIT V;  4WFB V;  2QA4 V;  1Q7Y W;  1VQ7 V;  3G4S V;  1VQ5 V;  1QVF U;  3CC2 V;  3G71 V;  1R73 A; 
#chains in the Genus database with same CATH topology
 3TXS A;  1NTZ H;  4IYH A;  1PV0 A;  1JFF B;  1BQ0 A;  1GTO A;  4D7S A;  1N33 B;  3CRM A;  3CC7 V;  5IT9 N;  1F51 A;  4CBC A;  4UVC A;  2WLL A;  1K73 W;  1N32 B;  5FLX N;  4I0X B;  4W4K A;  3ABK B;  3OR7 C;  4X1K A;  1ZUQ A;  3ASO B;  4RAI A;  4TUY B;  1Q43 A;  5DEC A;  2OT5 A;  5GON A;  2N05 A;  1FXK A;  4DV6 O;  4YJ3 A;  4ZIB A;  1EN4 A;  4X20 B;  1QR9 A;  2QDO A;  4GLX A;  1Y76 B;  3GWK C;  2IJJ A;  1R3I C;  1HDJ A;  3GWO A;  2ZT9 B;  4JI7 B;  4PDL A;  1S77 D;  5LOV A;  1PD3 A;  4X9Q A;  4JI1 O;  2HHH O;  2KKW A;  2OCC B;  1KB9 F;  4FM1 A;  2XAS A;  3DC5 A;  2P5O A;  3ABL C;  4NYK A;  5L3C A;  4LF6 B;  1XMO B;  1G6U A;  5D5Q A;  4LCU C;  4JI1 B;  2HHH B;  2CH7 B;  3T1C A;  3WG7 B;  2X6C A;  4YIP A;  3J81 N;  3S3W A;  2Y0I A;  2GTA A;  3P3P A;  1E1R G;  4I55 A;  2DYS B;  1BSM A;  1JMK C;  1BGY H;  3E83 A;  4JI5 B;  1NR1 A;  2EIM C;  3CYO A;  3Q4H A;  3ZIA G;  3ZN1 A;  4WBN A;  1O9G A;  5TIS Z;  1ZAU A;  3E8F A;  1FFT B;  5H6R A;  1VQ6 V;  2M7W A;  4UB8 Z;  5EBL C;  4O2A B;  3QO7 A;  5J2T A;  3I55 V;  1XHX A;  3CJH A;  4FLT A;  2EIL B;  4DV2 O;  3K79 A;  2UXC B;  1FFX B;  4U3J A;  3MHH C;  4J7Z A;  4YY3 B;  2KQX A;  3H01 A;  2WA3 A;  2QM7 A;  1CPY A;  5A2Q N;  3BPZ A;  4MVO A;  1MZE A;  3HKC A;  2ZM6 B;  1Q6I A;  1XQ8 A;  2DOS A;  1K8A W;  2ZE5 A;  1FJG B;  1L0N H;  1QCE A;  3ETQ A;  5JJJ B;  2EJ7 A;  4I9W A;  2R9I A;  2QWO B;  1YJ9 V;  4D7T A;  1NU1 H;  3SYP A;  5JQG A;  3OD4 A;  1XL6 A;  4O4H A;  2Q5Z A;  4IL6 Z;  1S5H C;  3H1J H;  4BW5 A;  4ZOL B;  4NXM O;  2DMX A;  1VIB A;  1PM9 A;  2QR4 A;  3H1I H;  2VWJ A;  4DV3 O;  4B3R O;  2YDE A;  3MDS A;  1JPX A;  4CS3 A;  2FB5 A;  2EUL A;  3RYF A;  1MMM A;  2X6A A;  4OX9 O;  4H44 B;  3CRR A;  2EIM B;  4ZHQ A;  1YXB A;  3UO2 A;  3EHB B;  1SQV H;  1AB3 A;  5EZY A;  4FFB B;  1W2B U;  4RUE A;  1DGS A;  1NJI W;  1Q8I A;  1Q82 W;  5IYC O;  4JF3 A;  4X64 O;  1IBK O;  4DV4 O;  1Q81 W;  4IHJ B;  1VMG A;  2JDI G;  1M4U A;  2R9R B;  3KCY A;  2UXD B;  1OZ0 A;  5IYZ A;  4GKK B;  1BHB A;  3B8M A;  2AW9 A;  5E1A C;  4X64 B;  2A7W A;  2BTO A;  2Y4T A;  1R3K C;  5BXZ A;  4DV4 B;  5B5E Z;  5IJ0 B;  1P7G A;  2XAG A;  1TVK A;  2WSS G;  4B7K A;  2Q73 A;  5FL7 G;  4HYO A;  3CHX A;  3G6E V;  2CTR A;  3ZJZ A;  4L87 A;  4K3A A;  2B5U A;  2IJK A;  5DM6 V;  3CCS V;  1M90 W;  4JTD B;  3SPG A;  4GX5 A;  1NH2 B;  4KHP O;  1GAX A;  1K5Q A;  4UB6 Z;  2RQ6 A;  3K0D A;  5EYP B;  1NZ6 A;  5D5P A;  2P7T C;  4DK0 A;  1ZL8 B;  4X62 B;  3CME V;  4DO2 A;  4AIL C;  3CXC U;  2OYQ A;  2UXB O;  2IH1 C;  4NXN O;  1PPJ H;  2P06 A;  5LL6 Y;  2EZP A;  4DUY O;  4FLX A;  4IYI A;  1D5N A;  5KX5 A;  3FKS G;  2LGQ A;  4EB6 B;  3VOU A;  1V54 C;  5H9C A;  2FL4 A;  1KD1 W;  3HKD B;  4N23 A;  1SZT A;  3G67 A;  2CE4 A;  4MVM A;  2Q69 A;  2WLI A;  3ZRS A;  3VQY A;  2HG5 C;  3K3W A;  4LFB B;  4PJ0 Z;  1PNM A;  4BIZ A;  3SYQ A;  5JVD B;  1B04 A;  1K4C C;  4UVA A;  3QO8 A;  2PGG A;  4JYA O;  1HWY A;  2DWD C;  2JS5 A;  4PI0 A;  2XAQ A;  4I4T A;  4CC5 A;  4O2B A;  4AI8 A;  3SJQ C;  1H8E G;  2F66 C;  5A9G A;  1YVW A;  2JEX A;  4HNA A;  4J10 A;  4P9O A;  3R66 A;  2ARH A;  4XDL A;  4LWS A;  2XT9 A;  1GK9 A;  2P67 A;  1K33 A;  3RBZ A;  3JAK A;  3LNN A;  1RSO B;  3ZRW A;  3VBB A;  5BR8 O;  4J7J A;  4LH6 A;  4QNH B;  2V7Q G;  1R3J C;  2DQ3 A;  3JYC A;  4B3T O;  3L9D A;  3CWB H;  1H2S B;  4JI4 O;  3A2F A;  4NR1 A;  1GN2 A;  1VQ4 V;  3W7T A;  2PYJ A;  4PDR A;  3TET A;  5B1O A;  3ABT A;  1RP3 B;  4QIW F;  1F23 A;  3THO A;  4JI4 B;  3RYH B;  4LFA O;  1P49 A;  2R70 A;  4X1I B;  4U7N A;  2EX3 A;  3CSX A;  3TJT A;  2Q68 A;  4IIJ A;  4O4I B;  3ABM B;  5KAF Z;  3ZMV A;  1QLE C;  1VEW A;  1T5E A;  1P4R A;  1CEZ A;  1OCZ C;  4K0K O;  2XAH A;  1N34 O;  4MVQ A;  2ILM A;  1VP7 A;  2Q9L A;  4WFH A;  3C3S A;  2YSU B;  2A9H A;  2UUC O;  3OW2 U;  1HW7 A;  2EIJ B;  4DV0 O;  1N34 B;  4HAM A;  5HFL A;  2AZ2 A;  1SC5 B;  2KG7 B;  4O4L A;  2CTQ A;  5C93 A;  2WA4 A;  5L3F A;  4J11 A;  2UUC B;  4JI8 B;  5ITZ B;  4QJF B;  4MS2 A;  3FB7 C;  1I0H A;  1FXK C;  2CTW A;  3OM3 B;  2D2C B;  3MHS C;  3H9V A;  1R6N A;  3AG2 C;  4R50 A;  1AIL A;  3K0G A;  1LUW A;  5EC2 C;  2QTO A;  1M57 C;  2GUZ B;  4O4J B;  1GN4 A;  2MW2 B;  4PV1 B;  5B3S B;  1P84 F;  1MSW D;  2NLJ C;  3BAA A;  4TV9 B;  1EFR G;  5LGN A;  3CC2 V;  3UT5 B;  4JAU A;  1HNZ O;  2UUB B;  4N21 A;  5IJ9 A;  3ZCC A;  3N2K A;  3AG1 B;  2O57 A;  3LDD A;  3ZED A;  2RN9 A;  1MAB G;  4J7K A;  1SES A;  4LH7 A;  3CP1 A;  4JI3 O;  1VF7 A;  4YIO A;  3SYA A;  1K7D A;  4DR2 B;  3UO3 A;  3T1H O;  3ZMT A;  3AK3 A;  2DYR C;  3DXR B;  1HNX O;  4JYB A;  2X7R B;  3JAL A;  1KP3 A;  2EIK B;  2A0L A;  4PA7 A;  2HJD A;  2VQF O;  4CZZ A;  5K1X A;  2ZNJ A;  1HNX B;  2ZD9 A;  4FLZ A;  1TUB A;  1GO3 F;  4ZBM A;  4TT3 G;  4Z1V A;  2HR3 A;  1HNW B;  1J5E O;  5B1A C;  1YTF D;  2WLL B;  4DR5 B;  4E4E A;  1NS1 A;  4DR4 B;  3OMA B;  2K9P A;  3ZMU A;  1S72 V;  3CCQ V;  4X1K B;  1ZWI C;  2ZXW B;  1COW G;  1R6K A;  4UVB A;  4LF8 B;  1QU7 A;  3T1Y O;  4MW3 A;  2Q7H A;  2EJR A;  3VQV A;  4RQE A;  3JD3 A;  5GON B;  3ML0 A;  4UCR A;  1FXK B;  5B66 Z;  1AP6 A;  4X88 A;  4YJ3 B;  4XDK A;  5F2V O;  1VAR A;  4DV5 B;  4FMT A;  4DR1 O;  2B1G A;  1KU9 A;  3LSQ A;  1DK1 A;  2PI5 A;  1ZSP A;  4WFA V;  1MOF A;  4LNU A;  4ASU G;  2Y48 A;  1M56 B;  2LP7 A;  2XHB A;  2Q8V A;  4JI2 B;  3K5N A;  5HFM A;  4GX2 A;  3UM7 A;  3B8N A;  3HPL C;  1G1X B;  5L3G A;  4TWK A;  2YS8 A;  4JAA A;  4TQD A;  3APO A;  3OMN B;  4X1Y A;  2CGO A;  5BY1 A;  4QGP A;  2IU3 A;  2DYR B;  2QWP B;  5BMV A;  4DR3 O;  4FFK A;  5CB4 B;  4TV8 A;  1L0L H;  2K1E A;  2AZ0 A;  3K57 A;  5J2U A;  2ZR2 A;  2YXY A;  3D36 C;  4G28 B;  4I55 B;  3C90 A;  2Y69 C;  1A32 A;  2HLD G;  3Q4H B;  1JOY A;  4FLY A;  1SET A;  2AXT Z;  3OUF A;  1XL4 A;  1VQM V;  4UFZ A;  1AI7 A;  4JZG A;  3CJH B;  3FFQ A;  3FB8 C;  5LP6 B;  2XAF A;  2R72 A;  4EFB A;  4DV6 B;  4U3J B;  5JCO C;  5FNV A;  1YSC A;  1MG1 A;  4I50 A;  3L75 H;  1MZF A;  2LO1 A;  2LFR A;  4JV5 O;  1F7Y A;  1IUR A;  3HKC B;  3B09 A;  1H2N A;  3D8C A;  5KLV H;  4KXR A;  4LP8 A;  5LGT A;  4RWU A;  3FYI B;  4CH6 A;  3OGI B;  2YI8 A;  3FYE B;  4J9Y B;  2ZKO A;  1BE3 H;  4I5S A;  3HKE B;  2GSM B;  2QGN A;  5JQG B;  4LF7 O;  4R7C A;  4O4H B;  3DSQ A;  3G80 A;  4NTX A;  2OCH A;  3JAS B;  4JAS A;  1WPB A;  3RVZ A;  4UCS A;  5CN0 A;  1WLE A;  4H33 A;  1NKD A;  2HVK C;  3AG4 C;  4I0X A;  1SQF A;  3FAV A;  3RYF B;  4I9Q A;  1N0J A;  2ZE8 A;  3OUS A;  2IJH A;  1US6 A;  4ZHQ B;  4LF5 O;  1PNK A;  3SR2 C;  3ZMS A;  5EZY B;  1ORQ C;  1GH6 A;  1F4M A;  2XND G;  1QVF U;  4DV2 B;  3CB2 A;  3SYC A;  1SQX H;  1KC8 W;  1M5I A;  4QE9 A;  3AG3 C;  4X20 A;  3ZRX A;  4JTA B;  3GB7 C;  3KCX A;  1XBL A;  3E2E A;  2KB1 A;  3JAT A;  1JA8 A;  2DE0 X;  5IYZ B;  3T4Z A;  2OIE A;  1GN6 A;  5AG2 A;  3UQ8 A;  3OEH G;  3ABL B;  2WLM A;  3ASN C;  3RN4 A;  4WFE A;  1DLB A;  2ZNI A;  1FXH A;  1DTO A;  1NVP D;  4NTW A;  4OPA A;  1EN6 A;  1PL0 A;  2A79 B;  1VQN V;  1Y67 A;  4AHC A;  5LA6 B;  1Y4M A;  1MA1 A;  4GZR B;  3K58 A;  3EFF K;  2QA4 V;  2HKO A;  1EZV H;  4NXM B;  3D36 A;  5KHJ A;  3CRC A;  2PYL A;  2ZIN A;  4PI2 A;  5LMN O;  1S0V A;  2OTJ V;  3QG5 A;  2A3Q A;  4DV3 B;  4B3R B;  2QKA A;  1AJQ A;  3SJC C;  1WJZ A;  2E3C A;  1U97 A;  1YCI A;  1UJW B;  1YHQ V;  2YEV B;  4OX9 B;  3A0R A;  5LHI A;  2VQE O;  3E89 A;  5H5N A;  1Y66 A;  3W7X A;  3U11 A;  5KX5 B;  4UXN A;  2F95 B;  1S76 D;  3O65 A;  2LW7 A;  2HVJ C;  3SPH A;  2QM4 A;  1WAZ A;  2ZIM A;  1ENV A;  1N0N A;  5LGU A;  4DR7 O;  2X6B A;  4JI0 O;  3S3X A;  2ADQ B;  4YJ2 A;  1YIJ V;  5JCO A;  1QVG U;  2LW1 A;  1N36 O;  2HFE C;  4B7E A;  1IBK B;  4R8C A;  3AEI A;  1E1Q G;  1WP7 A;  2WWW A;  1EBO A;  2M6Y A;  5K1P A;  1ZTE A;  1Q90 D;  2NNU A;  4MTF A;  4W4L A;  3KZI Z;  1N36 B;  5DED A;  1NTK H;  3JCU Z;  5B1B C;  1HR0 O;  3CRQ A;  4I4T B;  3X2Q C;  3IC9 A;  3CPW U;  4LF4 O;  1VQP V;  1K9M W;  4GKJ O;  3MAQ A;  4HNA B;  1Q86 W;  3LSU A;  1XMQ O;  3RW0 A;  5E79 Z;  3BY6 A;  4LWS B;  5JWP A;  3VQX A;  2W0F C;  4XDJ A;  3WFV A;  2UUA O;  1YIT V;  2RJZ A;  1AR1 B;  4KHP B;  4MVU A;  3JAK B;  1OCC C;  1K97 A;  2DQ0 A;  5IYD O;  2IW5 A;  3KKY A;  4CH3 A;  3OTO O;  3QO5 A;  2UXB B;  2Q6A A;  4DYL A;  5CA1 A;  1Q5O A;  3W7S A;  1V55 C;  5C8Y A;  3E22 A;  5GTI Z;  4NXN B;  2L35 A;  4Z1M G;  3A8T A;  4E2L A;  4DUY B;  1S5L Z;  2BTQ A;  1H38 A;  3OTO B;  4TSF G;  1LNQ A;  4MVR A;  1DF4 A;  3N27 A;  1WB8 A;  3ZHU A;  2Y0P A;  3JAW A;  4WCE V;  1OCR C;  2A06 H;  3QVN A;  4ZI7 B;  2VRZ A;  4DV1 O;  4FLW A;  4ICG A;  4H37 A;  5LMU O;  4LFC O;  3HKB A;  1NQT A;  1I5X A;  4LF9 O;  1IBL O;  1IDS A;  3EVK A;  2UU9 O;  2YXL A;  1OCO C;  1EM1 A;  4JYA B;  4LFC B;  3ZMZ A;  1RM1 C;  3RVY A;  5KMG A;  4LC1 A;  1S3J A;  1R3L C;  2QM8 A;  4DK1 A;  4B3M O;  3I56 V;  2ODM A;  3RYC A;  5KUM A;  1SA0 A;  4ZKI A;  1XDC A;  4IGG A;  5EBM C;  4F6R B;  2EIN C;  3RYI B;  1FPO A;  1ZL8 A;  1Q6H A;  3K5O A;  3D3Q A;  3T4D A;  1VQK V;  1SKV A;  5BR8 B;  5KHI A;  1AJN A;  5BZB A;  2BSK A;  5CBG A;  2AGA A;  2DN9 A;  4B3S O;  5CA0 A;  3CEI A;  4B3T B;  3CD6 V;  3K59 A;  2JS3 A;  2UXX A;  1WA8 B;  1LUV A;  4BIU A;  3OFN G;  4FK5 C;  4PHZ A;  4X66 O;  1V54 B;  1YTF B;  2F23 A;  1BL8 A;  5LBQ A;  1I94 O;  1I7F A;  2JJ1 G;  3FX7 A;  2YIB A;  5IJ9 B;  2RCV A;  1XNQ O;  3N2K B;  2BOC C;  4Q6G A;  4BR6 A;  4KFM A;  3CCU V;  3TCU A;  4LFA B;  4EEQ A;  2H94 A;  1H2K A;  2GBO A;  1YI2 V;  1Y6X A;  4UV9 A;  1JCH A;  3W7U A;  1AI6 A;  1K3E A;  4J41 A;  4X8A A;  1XHZ A;  2W0X A;  5JH7 A;  1XI1 A;  1SQB H;  1OJH A;  1EZJ A;  3QTC A;  4DRX A;  4K0K B;  4GYC B;  4L8J A;  3FB6 C;  1PNL A;  1RFY A;  1P7B A;  1UFI A;  2Y4U A;  4CH5 A;  2V1D A;  4DV0 B;  1NBM G;  1TUB B;  1AVM A;  4RQF A;  1W0K G;  3BRC A;  1H2L A;  3SJA C;  1IVS A;  1Y74 B;  1HP8 A;  4DR6 O;  2YIB D;  2IM9 A;  2FKX A;  4TQF A;  3IAY A;  1SER A;  3LDE A;  3P32 A;  3E35 A;  4P30 A;  5EK0 A;  1YEW A;  4FLV A;  3C3T A;  1JX9 A;  2E75 B;  4UCU A;  5L3E A;  2HEP A;  2Q67 A;  2EBO A;  1XEQ A;  1HNZ B;  4OGQ B;  3G6B A;  4X1I A;  1K4D C;  4JPR A;  2RNB A;  3I5D A;  2ZIO A;  1VQ8 V;  3CX5 F;  4FVM A;  4BWA A;  2E5L O;  3PJS K;  4YHH O;  1QLE B;  2ZCE A;  2XAJ A;  1TA8 A;  3N2G B;  1G4Y B;  4MT8 A;  2JGD A;  1DF5 A;  2NR5 A;  2BE3 A;  1OCZ B;  1OV9 A;  4JI3 B;  3JD1 A;  4AQY O;  3T1H B;  2PF4 E;  1NTM H;  1BZK A;  4X1Y B;  3P3N A;  1IBM O;  1K92 A;  1KP2 A;  2E5L B;  2P4K A;  3CE2 A;  2ITC C;  3OEE G;  1Q7Y W;  5BMV B;  1X59 A;  5IDJ A;  3SJB C;  1IZ3 A;  4TV8 B;  2JIZ G;  4DV7 O;  3SPI A;  2VQF B;  4DW1 A;  5J2U B;  3SPC A;  5B1N A;  1E79 G;  3ABK C;  3L72 H;  3BEH A;  3L74 H;  3APQ A;  3ASO C;  1D2D A;  4IT5 A;  1S5J A;  1J5E B;  4FZ1 A;  4D6T H;  4JI6 O;  1EN5 A;  4H13 B;  4C7U A;  1F4N A;  1XNR O;  3CXH F;  3JD0 A;  1QQC A;  2P6J A;  3AG2 B;  3K06 A;  1LR1 A;  1KKC A;  2PZS A;  5JJN B;  3T1Y B;  1ZX3 A;  1J95 A;  4JI6 B;  1M57 B;  4JAV A;  4O4J A;  1XNR B;  5LOV B;  4HBN A;  2H8P C;  3ZN0 A;  2YIC A;  5KA6 A;  1WP8 A;  5DN6 G;  4DR1 B;  5FNV B;  2OCC C;  3R65 A;  2YIA A;  3F5W C;  2GV9 A;  5IE9 A;  4I50 B;  2LGW A;  3JAR A;  4G27 B;  1WN7 A;  2P90 A;  5LXT A;  2PTM A;  1NT2 B;  3WG7 C;  2EZO A;  1YZB A;  5J9P C;  3M7M X;  2H3O A;  3B77 A;  2Z5U A;  3DXR A;  4LR3 A;  1N33 O;  1G8M A;  4J42 A;  2N04 A;  4PA9 A;  1Q3E A;  1AP5 A;  1YDX A;  2YID A;  1O9H A;  2DYS C;  1M93 A;  3F7Y C;  3SYO A;  2W6J G;  1N32 O;  3T2M A;  4X65 O;  3BA8 A;  2QKC A;  4DR3 B;  3DTU B;  2QJ1 A;  4JGS A;  4WBN B;  2WLN A;  2Q0A A;  1NVP B;  3BVO A;  5LYJ A;  3BA9 A;  1RPO A;  5B1A B;  4FM2 A;  4X65 B;  1FS0 G;  3CCL V;  3FAV B;  4MTO A;  5J2T B;  2NN4 A;  4OPH A;  3OMI B;  3BAB A;  2C2A A;  2EIL C;  2F93 B;  1Z5V A;  1SF9 A;  1YF2 A;  4RO2 A;  4B08 A;  4YXW G;  1BT8 A;  4I7Z B;  2LFS A;  3NR7 A;  4JI7 O;  3BCC H;  4RUF A;  1H2G A;  2HJF C;  4JZ2 A;  3U0Z A;  3OE7 G;  1JVM A;  1X4T A;  5GTH Z;  4CS4 A;  1TUE B;  1M1K W;  1FD9 A;  3K9A A;  1V9P A;  3JAT B;  4LF6 O;  1XMO O;  4FLU A;  4PD4 F;  1CP9 A;  3IC7 A;  4JV5 B;  2FYU H;  1ROP A;  2YXH A;  4MVZ A;  4F4L A;  3JAM N;  3QF7 A;  3AK2 A;  3BFR A;  2YUA A;  3JD2 A;  1YJN V;  2PI4 A;  2OIG A;  5CBH A;  1JFF A;  4QE7 A;  4JYC A;  4LF7 B;  1K5S A;  2E76 B;  2FML A;  4JI5 O;  3OAA G;  1ZLZ A;  2ZQM A;  5CB4 A;  3O9O A;  4PA4 A;  5LHG A;  1VF6 C;  3H1L H;  1FXV A;  3F5T A;  2Y69 B;  2VWK A;  2QKS A;  4TUY A;  2QE7 G;  4PEL A;  3CMA V;  3CS5 A;  4KP4 A;  2OTL V;  2ETN A;  4DW0 A;  1AR4 A;  4CS2 A;  1VQ5 V;  2JVD A;  2UXC O;  3K5M A;  3HR0 A;  2Q0O C;  4LF5 B;  1Y76 A;  1SRY A;  1KUQ A;  4A5U B;  4PA3 A;  4J9Z B;  1PKX A;  2JJ2 G;  5LP6 A;  2CK3 G;  2ZR3 A;  3JCZ A;  4YY3 O;  5IY5 C;  3ZHV A;  4CC6 A;  1AI5 A;  2Z0A A;  1NR7 A;  4TOI A;  3U10 A;  4YJ2 B;  2ZM6 O;  1QBZ A;  1SS3 A;  3ZBH A;  2GDS A;  3ZHT A;  2DW4 A;  5KUK A;  3AG7 A;  1FJG O;  2XTA A;  1R1B A;  5CA3 A;  2QSA A;  1TVK B;  4PDM A;  1MSD A;  5EC1 C;  3CCM V;  2CH7 A;  3A0B Z;  3NXS A;  3LSS A;  2N74 A;  1JJO A;  3QNE A;  2X0L A;  1FYJ A;  3B4S A;  2CAZ C;  3E8H A;  3HKE A;  1GMG A;  4P9P A;  3CRA A;  3JSL A;  1JJ2 U;  5H6Q A;  2Q7G A;  2YI9 A;  3TGU H;  2UXN A;  3JAS A;  2WAM A;  4UCT A;  2MK3 A;  1GN3 A;  4UUJ C;  5KHK A;  2XUM A;  3AG4 B;  5LMN B;  4O2A A;  2WLK A;  2HP8 A;  5CA1 B;  2XOK G;  3IFX A;  1KEC A;  3G71 V;  4EKW A;  3E22 B;  5C8Y B;  3IGA C;  1L1F A;  1FFX A;  3L73 H;  2BTQ B;  2QWR B;  4UV8 A;  2VQE B;  4GCZ A;  3P30 A;  3OT7 A;  4BIO A;  2IBZ H;  1U96 A;  4MTG A;  3STZ C;  2WLI B;  3AG3 B;  2UXD O;  3WB1 A;  4GKK O;  4DR7 B;  4HZ3 A;  3JAW B;  4R6Z A;  4JI0 B;  3ABU A;  5IY5 B;  1OHH G;  2KSD A;  2F4V O;  3RFR A;  4NTY A;  4NKG B;  1QLN A;  4P2Z A;  3HKB B;  3J7A U;  4O2B B;  3JD4 A;  3CCJ V;  1I5Y A;  3K04 A;  1N8R W;  2F4V B;  3RGB A;  1FAF A;  3ASN B;  4GT1 A;  3K9S A;  1BQZ A;  1GRJ A;  1SQP H;  1HR0 B;  3KG2 A;  3K08 A;  1Z5W A;  5KMG B;  2ZE7 A;  4LF4 B;  1BMF G;  4ZOL A;  1VF5 B;  2ATK C;  4GKJ B;  2RDC A;  4X62 O;  5GW7 A;  5LA6 A;  1XMQ B;  1KKD A;  3ZRW B;  2JK5 C;  4LBE C;  4BAY A;  3RYC B;  2FTK A;  1SA0 B;  1VF6 A;  2UUA B;  2GHY A;  2IJI A;  4FZ0 A;  3OTF A;  1Q6U A;  2QWN B;  2LJ2 A;  5EIB C;  4PDV A;  3B40 A;  4FJC C;  3PN1 A;  4NVP A;  2BSK B;  2IU0 A;  4FFB A;  3J80 N;  1GKF A;  3CCR V;  4WFG A;  5CA0 B;  1KMI Z;  2YEV A;  2WLJ A;  2CTP A;  3F7V C;  4IHJ A;  5KHG A;  4OXS A;  4LFB O;  1N4C A;  5KA5 A;  1XRE A;  2AHZ A;  4IIJ B;  1AI4 A;  3ABM C;  5IJ0 A;  2WLH A;  1WB7 A;  2E74 B;  3ETG A;  4DV1 B;  2ZDI C;  4WF9 V;  5LMU B;  5LHH A;  3SGI A;  2OWO A;  4LF9 B;  1IBL B;  2QEX V;  3L70 H;  3D3I A;  5B1B B;  2UU9 B;  3X2Q B;  3DC6 A;  5JJE B;  5JH7 B;  2IH3 C;  1TGO A;  1PP9 H;  1BCC H;  1B6Q A;  3ETD A;  2EIJ C;  4DRX B;  2ITD C;  1B06 A;  1QR8 A;  3E8G A;  5EYP A;  2CUG A;  3RT3 C;  4O4L B;  4B3M B;  4DUZ O;  3M8A A;  3ZHR A;  4U3F H;  3HB3 B;  1B3Q A;  4X89 A;  1MNG A;  2CDY A;  1OCC B;  4J80 A;  4FIP C;  4FPP A;  1RPR A;  1D5A A;  1VQO V;  3BHP A;  2PY5 A;  3W7W A;  2B9Z A;  1WPX A;  4DUZ B;  2DWE C;  2GTS A;  1V55 B;  3K03 A;  2Q4P A;  4EB6 A;  1PL4 A;  4B3S B;  5CBF A;  5B3S C;  1WNS A;  3HKD A;  4Q20 A;  2DJV A;  2JEU A;  3DGE A;  3ZX6 A;  2D3O W;  4X66 B;  3OGC C;  3ICX A;  3AG1 C;  3L71 H;  2PUS A;  1I94 B;  1OCR B;  5JVD A;  4ZI7 A;  3WB0 A;  5H2F Z;  1NH2 D;  1XNQ B;  5IWA O;  1VQL V;  2ZE6 A;  2CGN A;  3H1K H;  1IX9 A;  3H1H H;  4MSW C;  1OCO B;  2R9A A;  1W59 A;  2JGD B;  5IWA B;  3JAL B;  1RM1 B;  3ZRV A;  2EIK C;  2BCC H;  1W0J G;  3B2E E;  1URF A;  3EXA A;  1RSO A;  3M99 B;  3CC4 V;  3GVM A;  5FPR A;  4XBF A;  4JI8 O;  2YC0 A;  4F6R A;  2EIN B;  1THZ A;  4K8Z A;  1SQG A;  3RYI A;  3TXQ A;  4KL1 A;  4CH4 A;  1L8D A;  2QWQ B;  3STL C;  3ZS8 C;  2ZXW C;  4KUM A;  5CMU A;  1AJP A;  2F1M A;  1QHT A;  4QPJ A;  1KYO F;  4Z2W A;  1M9N A;  4WFF A;  4DR6 B;  3ZHQ A;  5IYB O;  4MW8 A;  2WPD G;  2QTS A;  4JTC B;  1Z2G A;  1K34 A;  1WA8 A;  2V4D A;  1KBH A;  2UUB O;  3FB5 C;  3FD9 A;  5EBW C;  3WB2 A;  3RYH A;  4F6E A;  4FM0 A;  4LNU B;  4K8X A;  1XOU A;  3LDC A;  1VQ7 V;  5KAI Z;  3K5L A;  1M56 C;  1H2M A;  1UPG A;  5KHH A;  4O4I A;  4K35 A;  5FPO A;  2JGU A;  3RWR D;  1QNM A;  3JAR B;  1I08 A;  2LQT A;  3CCE V;  4DR2 O;  5LXT B;  1TAE A;  2ZDI A;  2BOB C;  1H8H G;  3SPJ A;  1KQS U;  4MTX A;  2G38 A;  3LNM B;  4GX0 A;  3CCV V;  4YHH B;  1YJW V;  1GM8 A;  3UCS C;  5EIB D;  3LUT B;  1JR9 A;  3SDL A;  2L6L A;  2F43 G;  4AQY B;  4U7O A;  3UKM A;  1ARO P;  4NB5 A;  1IBM B;  1HNW O;  2P22 C;  2KG7 A;  1IXB A;  2B1I A;  1BS3 A;  3E86 A;  4DR5 O;  2AHY A;  4PA6 A;  4DR4 O;  1NI8 A;  5ITZ A;  3TK1 A;  4DV7 B;  4UCV A;  1XIL A;  1SZX A;  5L3D A;  3JSN A;  3OR6 C;  5LYJ B;  1R6T A;  4LF8 O;  3ETE A;  4H0L B;  1GM9 A;  3ZHS A;  4BW9 A;  1JQ0 A;  1Y74 A;  3E8B A;  4QPK A;  3A0H Z;  3IJ4 A;  4DV5 O;  5LP6 C;  2GUZ A;  3MD0 A;  2RMK B;  1BHA A;  1SQQ H;  4GUN A;  4TV9 A;  2VS0 A;  3UT5 A;  1VQ9 V;  4DXW A;  4ABM A;  2Z3Y A;  3WU2 Z;  1CXZ B;  3G4S V;  2W6I G;  4JI2 O;  1IXM A;  4G2K A;  1FKA O;  4MVS A;  2Q7E A;  2ADP A;  4JYY A;  3AK1 A;  3VQW A;  1GM7 A;  1AR5 A;  4EFE A;  4GX1 A;  3N2G A;  5L3B A;  2JRI A;  4UCO A;  4WFB V;  1XUQ A;  2P4V A;  1R73 A; 
#chains in the Genus database with same CATH homology
 1LNQ A;  4MVR A;  1DF4 A;  4PDM A;  4QJF B;  4MS2 A;  3FB7 C;  3CCM V;  5EC1 C;  1GTO A;  1FXK C;  3NXS A;  3CC7 V;  3LSS A;  3OM3 B;  4WCE V;  3MHS C;  1OCR C;  1F51 A;  4CBC A;  1R6N A;  3AG2 C;  3QNE A;  2X0L A;  4R50 A;  3K0G A;  4UVC A;  2WLL A;  1K73 W;  5EC2 C;  2QTO A;  1M57 C;  4H37 A;  1NQT A;  3E8H A;  5B3S B;  1I5X A;  1MSW D;  3ABK B;  1GMG A;  2NLJ C;  3OR7 C;  4P9P A;  1EFR G;  3ASO B;  4RAI A;  5LGN A;  1JJ2 U;  5H6Q A;  3CC2 V;  2UXN A;  4JAU A;  2OT5 A;  1OCO C;  4N21 A;  3ZCC A;  3ZMZ A;  2WAM A;  1RM1 C;  3RVY A;  1FXK A;  3AG1 B;  2MK3 A;  3LDD A;  4LC1 A;  4UUJ C;  1S3J A;  1QR9 A;  1R3L C;  1MAB G;  1SES A;  2QM8 A;  2IJJ A;  3AG4 B;  1R3I C;  3GWO A;  3CP1 A;  2WLK A;  3I56 V;  4PDL A;  3SYA A;  1S77 D;  1K7D A;  5KUM A;  2XOK G;  3IFX A;  1KEC A;  3G71 V;  1PD3 A;  4EKW A;  3ZMT A;  4ZKI A;  3IGA C;  1L1F A;  5EBM C;  2DYR C;  2EIN C;  2OCC B;  4UV8 A;  4JYB A;  3T4D A;  2XAS A;  1VQK V;  2X7R B;  4GCZ A;  1KP3 A;  3P30 A;  1AJN A;  5BZB A;  2EIK B;  2A0L A;  3ABL C;  5CBG A;  5L3C A;  4PA7 A;  4MTG A;  3STZ C;  2WLI B;  4CZZ A;  3AG3 B;  4LCU C;  3CD6 V;  3T1C A;  4HZ3 A;  2ZD9 A;  3WG7 B;  4R6Z A;  1GO3 F;  2X6C A;  3ABU A;  2UXX A;  4ZBM A;  4TT3 G;  2HR3 A;  5IY5 B;  1OHH G;  5B1A C;  1YTF D;  2WLL B;  4BIU A;  3OFN G;  4FK5 C;  1V54 B;  1QLN A;  4P2Z A;  1YTF B;  3OMA B;  3ZMU A;  1S72 V;  3CCQ V;  1BL8 A;  5LBQ A;  3JD4 A;  1ZWI C;  3CCJ V;  2ZXW B;  2JJ1 G;  1E1R G;  1COW G;  1R6K A;  1I5Y A;  3K04 A;  4UVB A;  1N8R W;  2DYS B;  3ASN B;  4GT1 A;  4MW3 A;  4RQE A;  2EJR A;  3E83 A;  3JD3 A;  1NR1 A;  2EIM C;  3ML0 A;  2BOC C;  3CYO A;  3KG2 A;  4KFM A;  3K08 A;  1FXK B;  3TCU A;  3ZIA G;  3ZN1 A;  4X88 A;  3CCU V;  4XDK A;  3E8F A;  2H94 A;  1FFT B;  1BMF G;  4FMT A;  5H6R A;  1YI2 V;  2ATK C;  1VQ6 V;  2M7W A;  2B1G A;  4UV9 A;  5GW7 A;  5EBL C;  3LSQ A;  1JCH A;  2PI5 A;  1KKD A;  3ZRW B;  3W7U A;  1AI6 A;  3QO7 A;  1K3E A;  2JK5 C;  4LBE C;  4X8A A;  4BAY A;  3I55 V;  4WFA V;  1MOF A;  2FTK A;  2EIL B;  4ASU G;  2Y48 A;  3K79 A;  2GHY A;  2IJI A;  1M56 B;  2LP7 A;  1EZJ A;  4PDV A;  5HFM A;  3MHH C;  4GX2 A;  4FJC C;  3UM7 A;  3B8N A;  3HPL C;  5L3G A;  4TWK A;  2IU0 A;  3FB6 C;  1PNL A;  1GKF A;  3H01 A;  3CCR V;  1P7B A;  4WFG A;  2QM7 A;  2YEV A;  1CPY A;  2V1D A;  3OMN B;  1NBM G;  4MVO A;  2WLJ A;  1K8A W;  4RQF A;  2IU3 A;  1QCE A;  1W0K G;  2DYR B;  4I9W A;  3F7V C;  4OXS A;  2R9I A;  5KA5 A;  1YJ9 V;  2ZR2 A;  2AHZ A;  3SYP A;  4G28 B;  2Y69 C;  1XL6 A;  1AI4 A;  3ABM C;  2HLD G;  2WLH A;  1SER A;  3LDE A;  1JOY A;  3ETG A;  1S5H C;  3P32 A;  3E35 A;  4P30 A;  5EK0 A;  4BW5 A;  2ZDI C;  4WF9 V;  5LHH A;  1JX9 A;  1SET A;  3OUF A;  2QEX V;  5L3E A;  1XL4 A;  3D3I A;  2Q67 A;  1VQM V;  5B1B B;  2EBO A;  1AI7 A;  3X2Q B;  1JPX A;  2IH3 C;  3FB8 C;  2XAF A;  1K4D C;  4JPR A;  2X6A A;  1B6Q A;  3ETD A;  2EIJ C;  2EIM B;  1VQ8 V;  2ITD C;  1QR8 A;  3PJS K;  3E8G A;  1QLE B;  2XAJ A;  1YSC A;  1G4Y B;  3EHB B;  4MT8 A;  1MG1 A;  1DF5 A;  1OCZ B;  2LFR A;  1W2B U;  4RUE A;  3HB3 B;  4X89 A;  1NJI W;  3JD1 A;  1OCC B;  4FIP C;  1Q82 W;  5IYC O;  4FPP A;  4JF3 A;  1K92 A;  1KP2 A;  1RPR A;  1VQO V;  4LP8 A;  5LGT A;  3W7W A;  1WPX A;  3FYI B;  2ITC C;  3OEE G;  1Q7Y W;  1Q81 W;  2JDI G;  5IDJ A;  2DWE C;  1V55 B;  2JIZ G;  3FYE B;  3K03 A;  4J9Y B;  3SPI A;  2R9R B;  5CBF A;  1OZ0 A;  4I5S A;  1BHB A;  3SPC A;  3B8M A;  5B3S C;  2GSM B;  5B1N A;  1E79 G;  3ABK C;  5E1A C;  3BEH A;  4Q20 A;  3ASO C;  4R7C A;  1R3K C;  2JEU A;  3DGE A;  2XAG A;  2D3O W;  2WSS G;  4JAS A;  3OGC C;  5FL7 G;  4HYO A;  1F4N A;  3RVZ A;  5CN0 A;  3G6E V;  3AG1 C;  3ZJZ A;  4L87 A;  3JD0 A;  1WLE A;  4H33 A;  1OCR B;  1NKD A;  3AG2 B;  2P6J A;  3K06 A;  2B5U A;  2HVK C;  2IJK A;  5DM6 V;  1J95 A;  3AG4 C;  1NH2 D;  1M57 B;  3CCS V;  1VQL V;  1M90 W;  4JAV A;  4JTD B;  3SPG A;  4GX5 A;  2H8P C;  1NH2 B;  3ZN0 A;  3OUS A;  5KA6 A;  2IJH A;  1K5Q A;  5DN6 G;  3K0D A;  2OCC C;  2P7T C;  3R65 A;  1OCO B;  1PNK A;  4MSW C;  3CME V;  3F5W C;  3ZMS A;  4DO2 A;  1RM1 B;  3CXC U;  1ORQ C;  3ZRV A;  4G27 B;  2EIK C;  2P90 A;  1F4M A;  2XND G;  1QVF U;  1W0J G;  2IH1 C;  3SYC A;  1KC8 W;  4QE9 A;  3AG3 C;  3ZRX A;  2EZP A;  3WG7 C;  4JTA B;  3M99 B;  3GB7 C;  3CC4 V;  2EZO A;  3E2E A;  4XBF A;  2KB1 A;  5J9P C;  3FKS G;  3B77 A;  2Z5U A;  3VOU A;  1V54 C;  2EIN B;  1THZ A;  5H9C A;  3T4Z A;  1KD1 W;  1G8M A;  4N23 A;  4PA9 A;  3STL C;  1SZT A;  3OEH G;  2ZXW C;  3ABL B;  2WLM A;  4MVM A;  2Q69 A;  2DYS C;  3F7Y C;  4KUM A;  3ASN C;  3SYO A;  2W6J G;  4WFE A;  1DLB A;  5CMU A;  1FXH A;  2WLI A;  3T2M A;  1DTO A;  3ZRS A;  1AJP A;  2HG5 C;  3DTU B;  4QPJ A;  1NVP D;  3K3W A;  4JGS A;  1M9N A;  4WFF A;  2WLN A;  1PNM A;  1PL0 A;  1NVP B;  5IYB O;  4MW8 A;  2A79 B;  2WPD G;  4BIZ A;  1VQN V;  3SYQ A;  4UVA A;  1K4C C;  4JTC B;  1RPO A;  1K34 A;  3QO8 A;  5B1A B;  3FB5 C;  3CCL V;  1FS0 G;  1Y4M A;  5EBW C;  1HWY A;  4MTO A;  2DWD C;  2XAQ A;  3EFF K;  3OMI B;  2C2A A;  2EIL C;  2QA4 V;  3LDC A;  3SJQ C;  1H8E G;  2HKO A;  1VQ7 V;  1M56 C;  4RO2 A;  3D36 A;  2JEX A;  4YXW G;  4P9O A;  1S0V A;  2LFS A;  4RUF A;  4XDL A;  2OTJ V;  1H2G A;  2HJF C;  3CCE V;  3OE7 G;  1AJQ A;  2ZDI A;  2BOB C;  1GK9 A;  1JVM A;  2P67 A;  1H8H G;  1TUE B;  1UJW B;  1YHQ V;  1K33 A;  2YEV B;  3RBZ A;  3SPJ A;  3A0R A;  1KQS U;  5LHI A;  4MTX A;  1M1K W;  3LNM B;  3K9A A;  4GX0 A;  3ZRW A;  3E89 A;  3VBB A;  3CCV V;  1Y66 A;  3W7X A;  4UXN A;  1YJW V;  1GM8 A;  4QNH B;  1S76 D;  2V7Q G;  1R3J C;  2HVJ C;  3SPH A;  3LUT B;  1CP9 A;  2DQ3 A;  3IC7 A;  3JYC A;  1ENV A;  1ROP A;  2F43 G;  5LGU A;  4U7O A;  3UKM A;  2X6B A;  1YIJ V;  4MVZ A;  4F4L A;  1ARO P;  1QVG U;  2HFE C;  3JD2 A;  4R8C A;  1YJN V;  3AEI A;  2B1I A;  2PI4 A;  3E86 A;  1E1Q G;  2AHY A;  4PA6 A;  2WWW A;  1EBO A;  3TK1 A;  1VQ4 V;  3W7T A;  5CBH A;  2NNU A;  5L3D A;  3OR6 C;  4MTF A;  4PDR A;  4QE7 A;  3TET A;  4JYC A;  3ABT A;  5B1O A;  4QIW F;  1K5S A;  1F23 A;  3ETE A;  1GM9 A;  1JQ0 A;  3OAA G;  3E8B A;  2ZQM A;  5B1B C;  4PA4 A;  4QPK A;  3X2Q C;  5LHG A;  3CPW U;  1FXV A;  3MD0 A;  1BHA A;  4U7N A;  1VQP V;  1K9M W;  2Q68 A;  1Q86 W;  2Y69 B;  3ABM B;  2QKS A;  3ZMV A;  1VQ9 V;  3RW0 A;  2QE7 G;  4DXW A;  4PEL A;  1QLE C;  3BY6 A;  3CMA V;  4KP4 A;  2OTL V;  2W0F C;  2Z3Y A;  4XDJ A;  3WFV A;  1P4R A;  1YIT V;  1CEZ A;  1OCZ C;  1AR1 B;  3G4S V;  1VQ5 V;  2W6I G;  4MVU A;  2XAH A;  1OCC C;  1IXM A;  1K97 A;  4G2K A;  4MVQ A;  2DQ0 A;  5IYD O;  2IW5 A;  4MVS A;  1SRY A;  4WFH A;  4PA3 A;  2YSU B;  4J9Z B;  1PKX A;  2A9H A;  2JJ2 G;  2CK3 G;  2ZR3 A;  3JCZ A;  3QO5 A;  2Q6A A;  3OW2 U;  5IY5 C;  2EIJ B;  3W7S A;  1AI5 A;  1V55 C;  1NR7 A;  1GM7 A;  4HAM A;  1QBZ A;  4Z1M G;  5HFL A;  4GX1 A;  4E2L A;  2DW4 A;  5KUK A;  5L3B A;  1H38 A;  5CA3 A;  5C93 A;  5L3F A;  4WFB V;  2K1E A;  4TSF G;  1R73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...