1YI2V

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yi2V00
1N8RW 5DM6V 3G6EV 1Q86W 1KQSU 4WFAV 2QA4V 1VQMV 1QVGU 1VQ5V 1VQOV 2OTJV 1VQNV 3CCLV 1YJNV 1YJWV 1YJ9V 2D3OW 3CC2V 3CC4V 3OW2U 3CD6V 4WCEV 3G4SV 1YITV 1Q7YW 1VQ9V 1K73W 3I56V 4WFBV 1R73A 3G71V 3CCSV 1VQLV 1Q82W 1VQKV 1VQ7V 2QEXV 1VQ4V 3CCQV 3CCUV 1Q81W 1K9MW 4WF9V 2OTLV 3CCVV 3CCRV 1K8AW 1M90W 1YIJV 3CXCU 1QVFU 3CCMV 3CC7V 1M1KW 1YI2V 1YHQV 1KC8W 1JJ2U 1VQPV 1NJIW 1VQ8V 3CMAV 3CCEV 1KD1W 3CMEV 1VQ6V 1W2BU 3CCJV 1S72V 3I55V 3CPWU
chains in the Genus database with same CATH superfamily
1DGSA 3AK1A 1Q6UA 2E3CA 5F2VO 3ZRSA 4RQEA 3AG2B 2EIJB 3BPZA 3Q4HA 4X8AA 1VARA 3K59A 4I9QA 3CD6V 4JI5O 2PY5A 5DEDA 4I7ZB 5J2TB 4EB6B 1Q8IA 3N2GB 4L8JA 1B06A 4ZBMA 1JFFB 1KD1W 4DR5O 2DWEC 3H1JH 2ZE7A 4YIPA 3SJAC 1R6KA 3SYCA 3LDCA 4JI8O 4CC5A 4K0KO 1S77D 5EIBD 1Q6IA 1NTMH 5BR8B 2W0XA 5LA6B 5K1XA 4WFBV 1ROPA 1D5AA 3CCQV 1EFRG 4D7TA 4DR4B 2D2CB 5EYPB 2YSUB 1JQ0A 3ZHTA 2OTJV 3E83A 1Z5WA 1NS1A 4L87A 4F4LA 4X9QA 1GRJA 4X20B 3TXQA 1NH2D 1H2KA 1SERA 1DK1A 2E76B 1TUBB 2KG7A 5LGUA 3CHXA 1VQ8V 4I50B 1IVSA 4AHCA 4UB6Z 4DV7O 5KLVH 4JI2B 4J11A 2IJJA 2KB1A 2QGNA 4LF5B 1B3QA 1BHAA 1NTKH 2A3QA 1THZA 1XILA 4NR1A 5ITZB 1MABG 2YI9A 4BWAA 4WF9V 2H94A 4DV1O 1AILA 2X6BA 1MA1A 3W7TA 2V1DA 1KECA 2ZM6B 3APQA 2EILC 3EFFK 4QGPA 1OHHG 2AGAA 5LYJB 2F93B 4DW1A 5L3FA 2JJ1G 1AI7A 4F6EA 3ZEDA 5LA6A 5BXZA 4O2AA 5BY1A 2QWPB 2VWJA 4JI4O 1QVFU 4RUEA 4I9WA 1AJNA 1AI6A 2VS0A 3H9VA 3R66A 2P22C 1QNMA 3E86A 1RPRA 5E1AC 4IYIA 1DF4A 3K79A 5K1PA 1SKVA 4O4LB 1VQNV 1PL0A 2AZ0A 1TUBA 3SYAA 4DR1O 1IDSA 4FLYA 4JZ2A 2CE4A 4O4IA 1COWG 5LGTA 3D3IA 1U97A 4O4JB 5JQGB 5JJEB 3JAKB 2JS3A 4DW0A 1BS3A 4X1YB 2X6CA 1M93A 4X64B 5LP6A 1QLNA 3ZN1A 3SYPA 1FFXB 2ZE5A 1XMOO 1PPJH 1ZX3A 2DOSA 3CYOA 4ZOLA 4JPRA 4NTWA 2DN9A 1K34A 3T1CA 3UCSC 1WNSA 5LYJA 5CB4A 2LGQA 4CH5A 3D36C 3ML0A 4LR3A 2IJIA 1SESA 2XUMA 4ZI7B 4WCEV 2UU9B 1BGYH 3HKEB 1XUQA 3PJSK 3HKBB 5CMUA 1YTFD 1SQPH 1OCCC 4DUZB 1JA8A 3BHPA 3ETQA 4KHPB 1WPXA 3K9SA 3I55V 4LF6B 3ZIAG 1NBMG 5B1AC 5LXTB 4U7NA 4MS2A 2R9RB 1JJOA 4WFAV 3BABA 3H1KH 4K3AA 1QLEB 1FAFA 1LNQA 1VQLV 2HHHO 3OFNG 4XDKA 5L3BA 3ZRWB 5KHGA 3UO2A 3BFRA 4AI8A 1YHQV 2Q67A 4MSWC 4XDJA 2OYQA 1FFTB 1XL4A 1RM1C 3UKMA 2X7RB 5EK0A 1SF9A 1N33O 4N21A 1GN2A 4U3JB 5B1OA 1T5EA 1FFXA 1KB9F 4H44B 5EBWC 5CBHA 3ZMTA 2E5LB 2EX3A 4ASUG 2NNUA 1XDCA 2ITDC 3ZHSA 5IY5B 4PA4A 3C3SA 4PDLA 5A9GA 4HNAA 3NXSA 2A9HA 5E79Z 2Y48A 2F1MA 4I4TA 4K35A 3JCUZ 3SJQC 5LMNB 1WP8A 2N04A 3M8AA 3B40A 4TV8B 3B8NA 1VQ7V 1AJPA 1EN4A 3CEIA 3AG2C 2EIJC 3OTOO 2PYJA 4U7OA 4B7KA 1ZL8A 1VP7A 4MVSA 4P9OA 3CCJV 4X1IB 1GH6A 4UVBA 2YDEA 4JI5B 2QE7G 4JI6O 3D3QA 2P4KA 1LR1A 1TA8A 2L6LA 5KX5B 5LL6Y 4DR5B 1FJGO 2ZIMA 2CK3G 1KC8W 5CA0B 1JVMA 2HKOA 1FD9A 4JI1B 3W7UA 4JI8B 4ABMA 4K0KB 2WLLB 1GN3A 1IXMA 4I0XA 2QTSA 4U3JA 2LP7A 3HPLC 3F7YC 3UM7A 3TGUH 1LUVA 2JRIA 3QTCA 2WLIB 3M7MX 1HNWO 4DUYO 4I5SA 3OR7C 2LFRA 3L73H 2BCCH 4TV9B 4GX0A 3KCYA 3T4DA 2RQ6A 1IBKO 1IBLO 1OV9A 2GBOA 4CH6A 4FFBA 5TISZ 2B1GA 4CBCA 3BA8A 4J10A 4TV8A 3I56V 5FL7G 5L3EA 3P3NA 3ABUA 2IW5A 4X66O 4J7JA 5EBLC 4DV7B 4E2LA 4LH7A 1VF6C 4X1IA 4LCUC 2ZDIC 4ZHQA 1ZSPA 4H33A 4FM1A 3OTFA 1ZWIC 1IURA 1NTZH 3RN4A 4DV1B 4FK5C 4LFCO 1GO3F 5KX5A 1PP9H 4G28B 5LHIA 3SPGA 4JGSA 2EILB 4Q20A 1I08A 2WWWA 2GHYA 2A7WA 1QQCA 1GTOA 2BTOA 1JPXA 2OIEA 5D5PA 3KCXA 3ZHRA 3VOUA 5JWPA 4DRXA 1GM9A 1ZUQA 4LWSA 5JJJB 1VQOV 1XREA 3RVYA 1Q7YW 4JI4B 3CCSV 2ZKOA 3TJTA 1S0VA 1ZLZA 1EN6A 2W6JG 2IJKA 4JV5O 3OAAG 2ZR2A 1B04A 4X62O 2IU3A 1E79G 5IT9N 4IL6Z 4FVMA 1WJZA 2EULA 3RYHA 4B3MO 3CRMA 1XMQO 1KQSU 5DECA 1O9GA 1I5XA 2VQFO 2DJVA 1W0KG 4JAUA 4PD4F 5BMVB 3HR0A 4X89A 1SETA 1YITV 1L8DA 4DR1B 2ITCC 4ZIBA 3HKCA 4DV6O 4FLTA 5B1BB 4OX9O 4JF3A 1EN5A 3ASOC 2Q7GA 1TVKA 3JARB 4P2ZA 3FKSG 4TUYB 5FPOA 3K5NA 2IH3C 1NVPB 2CGOA 5C93A 1Y76B 2YIBA 2Q7HA 3KZIZ 2QJ1A 2AHYA 4AQYO 1QVGU 1BCCH 2PGGA 4PHZA 2CDYA 1WLEA 1VF5B 1GM7A 1IXBA 4LNUA 4NXNO 1XMOB 4NKGB 5KMGB 3FD9A 4NXMO 1FXKB 3OUSA 4R6ZA 3GVMA 1K33A 1H2SB 2WPDG 2UXCO 5KUKA 2NLJC 1DLBA 4IGGA 2ATKC 2HP8A 2LW1A 4GLXA 4MW3A 3DSQA 1QLEC 3ZRVA 1SA0A 3DXRB 4JTAB 1TGOA 3O9OA 4X1KB 3CXHF 2HHHB 3AK3A 4PDVA 2PUSA 5H2FZ 4FLXA 4UVCA 5EZYB 5EIBC 4LF8O 1I94O 1JMKC 4DV4O 3IGAC 1RM1B 1U96A 5LMUO 2AW9A 3DTUB 4TUYA 3OT7A 2JGDB 3CWBH 4WFGA 3CSXA 4YJ3B 1NU1H 1K4DC 4C7UA 1N33B 1YXBA 3OR6C 3JYCA 1OCZC 1Y76A 3OGCC 2RN9A 2R9AA 5IY5C 2YEVB 3OW2U 1DTOA 5KMGA 1VQ9V 3T1YO 4JASA 3EVKA 3CXCU 1PL4A 3B09A 4FIPC 3OM3B 2JGUA 1AR1B 4GZRB 4J7KA 2Z0AA 5CBGA 1P84F 2FB5A 2XT9A 2ETNA 4J9YB 5IWAO 1H2LA 3B8MA 5DN6G 4LF7O 1N32O 2IBZH 4BAYA 4LFAO 3CRAA 2P90A 2Q6AA 3OTOB 4NVPA 4YJ2A 1YCIA 2Q73A 3S3WA 3JASB 2XAFA 2GTAA 1FKAO 4JTDB 4J42A 2R9IA 3MHSC 3JD0A 3OUFA 4KUMA 2GUZB 4X65O 4JI6B 2E74B 3CRQA 3ZJZA 2VQEO 2A79B 5EZYA 1JCHA 4OXSA 4GUNA 1FXVA 1SQGA 1FJGB 4TOIA 2CUGA 2H8PC 4PELA 1BQZA 4B08A 1UPGA 1PNMA 4BR6A 3CS5A 3R65A 4H13B 2PI5A 3CP1A 3A0RA 1HNWB 4P9PA 4DUYB 2D3OW 5IYZB 1NR1A 2YXHA 2EIMC 3K0GA 2JDIG 3UT5A 4GKJO 5L3GA 3L70H 3SJBC 5IYDO 2CTWA 2PF4E 3LSQA 2DE0X 4B3SO 1BZKA 1IBKB 1Q6HA 1IBLB 5H9CA 1X59A 4J7ZA 1YDXA 3K9AA 1YEWA 3ZHQA 2V4DA 2A0LA 1RFYA 1J5EO 1L0LH 1K97A 4X66B 3T2MA 4PA6A 5J2TA 4EB6A 2Z3YA 3QO7A 3N2GA 1JFFA 3SR2C 4DYLA 1H8HG 1S3JA 3FB7C 5C8YB 2CTQA 2JJ2G 3BAAA 3G6EV 1PV0A 4LFCB 4LF9O 2F95B 2Q69A 1VF7A 3K08A 1SQVH 3IC7A 1PKXA 2UXDO 2CTRA 2UUCO 4CS3A 3J80N 3RT3C 3E8HA 3ZS8C 4WFHA 3A0HZ 2QWRB 5EC2C 1N36O 4JYYA 5GTIZ 3ZMUA 5EYPA 4J80A 3DC5A 2Y69C 1YJWV 3TETA 4PV1B 2Y4UA 2LQTA 4X20A 4JV5B 1P49A 5LHGA 2HVKC 2BTQB 2BE3A 1X4TA 1MNGA 4X62B 3CCMV 2YICA 1UFIA 4PJ0Z 3ZCCA 5L3DA 4I50A 1SC5B 1SQXH 1BL8A 2OIGA 4DK1A 3C90A 4JYBA 4B3MB 2F4VO 1W59A 5B1BC 5B1NA 2XTAA 2VQFB 5CA1B 2EIKB 1QR9A 5GONB 2WLJA 2P06A 2WLHA 4DV6B 4OX9B 3ASOB 1YJ9V 1VF6A 5ITZA 1K73W 3D8CA 4CH4A 2ZDIA 3FFQA 1NI8A 1PNLA 3FAVB 2EZPA 3RYIB 3ZX6A 4G2KA 1K7DA 4XBFA 1P7GA 5IYBO 4DV0O 5C8YA 4AQYB 3F5WC 4NXNB 1FXKC 2ZNIA 4ICGA 3ASNB 5CBFA 2YIBD 4NXMB 2UXXA 2YC0A 1G8MA 4B7EA 2QWNB 4LFBO 1AP6A 3VQWA 2X6AA 5H6QA 4XDLA 1EZVH 5EC1C 2Y4TA 1Y4MA 2UXCB 3ETEA 3JALB 4HZ3A 2MW2B 1HWYA 5KAFZ 1R3IC 3HKDB 4O4LA 1R73A 3CE2A 2EINC 4BW9A 1R1BA 4WFFA 4CS2A 3P30A 4R50A 1N8RW 2QTOA 4O4JA 5JQGA 4LF8B 1I94B 4DV4B 3JAKA 3ZMVA 1VQ5V 3L71H 4X1YA 5LMUB 1V9PA 2BSKB 3FAVA 4W4LA 3AG1B 3RYIA 1R6NA 4GCZA 2RJZA 3CCRV 1OCZB 2QR4A 2K1EA 4H0LB 3KG2A 2HLDG 1K92A 3F7VC 3CPWU 3CJHB 2WA3A 1NH2B 4R7CA 3CRCA 3T1YB 3P3PA 2C2AA 4ZI7A 1A32A 2YXLA 1XHXA 4WFEA 3E35A 3HKEA 3H1HH 4UXNA 3HKBA 3SYOA 1HR0O 1JR9A 2RCVA 1I5YA 1TAEA 4I55B 2EJRA 3OE7G 3AG3B 5IWAB 3E2EA 4LF7B 4DR7O 2PTMA 5LXTA 1N32B 1XNQO 4LFAB 5KHIA 3HKDA 1N0NA 3EXAA 3G71V 3L9DA 2E75B 3ZRWA 3OGIB 1QU7A 3VBBA 4EFEA 1N0JA 3L74H 1M1KW 4MTOA 2RMKB 4X65B 1AR5A 2XOKG 3FYEB 2VQEB 2FTKA 3E8GA 3A8TA 4ZKIA 1H2NA 3VQVA 1ZTEA 3SYQA 1MSWD 2EBOA 2LJ2A 2EZOA 1YIJV 3RYFB 3K04A 4KL1A 1TUEB 1AVMA 1YVWA 3EHBB 2DMXA 3AG4C 4E4EA 4GKKO 3A2FA 4IIJB 2IM9A 3CJHA 2EIMB 5L3CA 1GM8A 4UCRA 4JAVA 3ZN0A 4UUJC 4FLVA 2UUAO 4GKJB 4K8XA 1K5QA 3UQ8A 4B3SB 2DW4A 1HNXO 1NQTA 4IHJB 4MT8A 4I55A 1BE3H 4O4HB 1E1QG 1YF2A 2RDCA 4QPKA 4TWKA 5KHJA 1M57B 1J5EB 4UVAA 5JVDB 4D6TH 4JI3O 5J9PC 3CX5F 2ZQMA 3E22B 2QKSA 4CC6A 2GV9A 3E89A 1BHBA 2V7QG 3CB2A 4LP8A 2LO1A 3MDSA 2WSSG 5JJNB 5CA0A 2DYRC 4PA3A 1UJWB 1V55C 2WLLA 2ADPA 4U3FH 4LF9B 1OZ0A 4RUFA 2Q0OC 2ZM6O 2R70A 3LDDA 1S76D 1AB3A 2UUCB 3JD4A 1OJHA 2WLIA 4TQFA 2QM8A 4JI7O 2P6JA 1YTFB 1NZ6A 2ZNJA 2WLNA 5HFMA 1WA8B 4UCUA 4CS4A 2ZE6A 4N23A 4BIUA 5JCOC 1N36B 3ABMB 3AEIA 4TV9A 2XAGA 2Y69B 2P4VA 2WAMA 2XAJA 1H2MA 3O65A 4PA7A 1KBHA 4TQDA 1K5SA 1VQMV 1GAXA 2ZR3A 4MW8A 5LHHA 2QEXV 2EIKC 3JATB 3J81N 3QVNA 3TXSA 2L35A 4B3RO 2F4VB 2AZ2A 1GKFA 1W2BU 4UFZA 5JVDA 2JS5A 1ORQC 2Q4PA 1CPYA 4MVQA 1IZ3A 4EFBA 2JK5C 4YXWG 2PZSA 1WP7A 3STZC 4GX5A 4UV8A 4YY3O 3QO5A 4UCOA 2BOCC 3N2KB 1G1XB 2QM7A 2XHBA 4DV0B 3ASNC 1F7YA 1MSDA 2DQ3A 3K3WA 4RAIA 1EZJA 5KHKA 2XASA 2YIDA 1P7BA 3SPIA 3CCLV 5IE9A 3U11A 4LFBB 1XBLA 3DGEA 4D7SA 4WBNB 3CCVV 4AILC 1GMGA 1KU9A 1RSOB 1V54C 2IJHA 2ARHA 3WU2Z 2ZXWB 3W7XA 3K5MA 3KKYA 1XHZA 2B5UA 1US6A 2EINB 2Y0IA 5KAIZ 5B5EZ 3Q4HB 5BMVA 3CC2V 2HVJC 2YS8A 5IJ0B 1AI5A 3LUTB 2G38A 1URFA 3JATA 1F51A 1D2DA 3LSUA 4OPHA 1IX9A 3JARA 2HEPA 1IBMO 5H5NA 3LNMB 2QSAA 3AG1C 2OWOA 3BEHA 5LOVB 4P30A 1G6UA 3ABLC 2BOBC 2CTPA 2DQ0A 4RWUA 3G67A 1EBOA 4DR6O 4IT5A 1FXKA 3D36A 2N05A 1M4UA 3WB2A 4A5UB 1O9HA 1Q90D 1F4MA 4EKWA 3WB0A 5CN0A 3S3XA 3JD2A 5GW7A 3AG3C 1HR0B 2UXNA 1I7FA 3RVZA 3WFVA 2QKCA 4LF4O 1RSOA 3ZHUA 3ZMZA 2WA4A 1FPOA 2KG7B 3QNEA 4DR7B 4Q6GA 3DXRA 1XNQB 4F6RB 2XNDG 1NR7A 2LFSA 3SDLA 4DR2O 3PN1A 4X1KA 1FXHA 5KHHA 1KYOF 5IJ0A 3DC6A 5EBMC 5FNVB 1Q82W 2HR3A 3M99B 2FYUH 2JGDA 4YJ3A 3H1LH 3OEHG 5J2UB 4JI1O 5LOVA 2IU0A 4DV3O 3T1HO 2HJFC 4O2AB 2OT5A 2YEVA 1PNKA 3FB5C 2JEXA 3AG4B 4YHHO 3OMNB 4GKKB 2YUAA 4FZ0A 2CH7B 2ZIOA 2IH1C 3H1IH 4QIWF 2UUAB 3IFXA 3ETDA 1QHTA 4JYAO 4NTYA 4OPAA 1HNXB 1M57C 4PA9A 3K03A 3CCUV 3JASA 4B3TO 1S5JA 2XAHA 1Q43A 1K8AW 1CP9A 2Z5UA 2DYSB 1YI2V 4F6RA 2WLMA 4O4IB 3RYCB 1XL6A 1K4CC 4QNHB 5LGNA 4JI3B 3K57A 2GUZA 2Q8VA 1QBZA 1XOUA 4FLUA 1SRYA 4FMTA 2F66C 4QPJA 4GT1A 1MOFA 5H6RA 4FM2A 1KKCA 5FNVA 2DYRB 5LP6B 5KUMA 2HFEC 4LC1A 1V55B 2MK3A 3F5TA 3X2QC 3VQYA 1AR4A 4HAMA 4JAAA 4ZOLB 5J2UA 2UUBO 2F23A 2YI8A 5CB4B 3ABMC 4JI7B 1YZBA 4GX1A 1PM9A 5B3SB 5IJ9B 5IYZA 4DK0A 2ADQB 3L72H 3LDEA 1KUQA 1WB8A 1VQ4V 1Q81W 2CH7A 2ZE8A 1AROP 3K5OA 1S5LZ 5B66Z 2WLKA 1XMQB 1AI4A 1ZAUA 4QE9A 5GTHZ 3ABKC 3GWOA 4Z2WA 3K5LA 4X88A 1EM1A 4UCVA 1M56B 4B3RB 2JVDA 1SQBH 3K06A 1N4CA 1F23A 3L75H 1SZXA 1LUWA 2F43G 4MVRA 3RYCA 1Q3EA 2KSDA 1Z5VA 3GB7C 1GK9A 1PD3A 4KP4A 2RNBA 4QE7A 3WG7C 2N74A 1DF5A 2B1IA 3MHHC 2B9ZA 4YY3B 3CC4V 4EEQA 2O57A 1M9NA 3JAMN 4DV5O 3JD1A 1K9MW 2YXYA 1OCOC 2VRZA 1XNRO 3LSSA 2GSMB 3THOA 1OCRB 2JIZG 4NTXA 1BT8A 1HP8A 5JCOA 1QR8A 2HJDA 1Q5OA 4DR3O 1Y74B 4HNAB 5IJ9A 2ZXWC 4DV2O 4I4TB 1V54B 3ICXA 1CXZB 1ENVA 2BTQA 2H3OA 3HB3B 1M90W 4KXRA 3STLC 1VQPV 5BZBA 4JI0O 5A2QN 3U0ZA 1ZL8B 3ABTA 3B77A 5CA1A 5DM6V 5GONA 1XI1A 2QDOA 3J7AU 1WPBA 3I5DA 4J41A 2UXBO 4JYCA 1G4YB 2ZT9B 1HNZO 1IBMB 3CC7V 1KP3A 3ABLB 3CRRA 4FZ1A 3FB6C 4RO2A 4FLWA 3JAWB 4I0XB 4KFMA 1NVPD 4CH3A 4RQFA 4PDMA 4DR6B 1JOYA 4DXWA 1VQKV 3IC9A 5JH7B 2P7TC 1N34O 4FLZA 3CMAV 1RPOA 4UCTA 3JALA 3JSLA 1Y74A 4FFBB 2KQXA 2OCCB 4LF4B 4MVMA 4MTFA 1VIBA 2VWKA 3U10A 1SZTA 4MVOA 2CGNA 1YSCA 2KKWA 3E8BA 1W0JG 3AK2A 4UB8Z 3JD3A 4Z1VA 4Z1MG 4DR2B 2GTSA 4GYCB 4ZHQB 2CAZC 2M6YA 3ETGA 4UCSA 1RP3B 1S5HC 4TT3G 4NB5A 2BSKA 5FPRA 1NKDA 5BR8O 4LBEC 3RWRD 3IJ4A 2ZD9A 4IYHA 1BMFG 3TCUA 1VEWA 4DV3B 3BCCH 3T1HB 3FYIB 4FPPA 3JAWA 4DRXB 4YHHB 4DR4O 4LWSB 5IYCO 4NYKA 1SQFA 3FB8C 3OEEG 2ZINA 3MAQA 1FYJA 1XQ8A 4BW5A 2OCHA 3P32A 5JH7A 1Y67A 3B2EE 3C3TA 2Y0PA 3IAYA 5HFLA 4JYAB 4FFKA 1BSMA 4FM0A 5D5QA 2DYSC 3RYHB 1MZFA 4JI2O 1J95A 1WN7A 2QWQB 2P67A 4B3TB 1MMMA 4OGQB 3JSNA 3G4SV 4LF5O 3APOA 2M7WA 3HKCB 2GDSA 3BY6A 1SQQH 2PYLA 1JJ2U 3NR7A 1TVKB 1GN4A 1Z2GA 1K3EA 5LP6C 4CZZA 2FKXA 5LBQA 3T4ZA 2A06H 2DWDC 3OD4A 1Q86W 3SPCA 1H8EG 3X2QB 2Q9LA 2UXDB 3QO8A 4LNUB 1HW7A 3E8FA 2OTLV 3W7SA 1FS0G 4QJFB 3RYFA 2P5OA 5B3SC 2UUBB 2YIAA 5KA5A 2Q5ZA 2LW7A 4IIJA 5CA3A 2Q0AA 2QKAA 3WB1A 3ZBHA 4MVUA 1L0NH 4TSFG 2Q7EA 2W6IG 3K58A 2X0LA 3BRCA 1AJQA 4IHJA 1NT2B 3ABKB 4O4HA 1WAZA 1SS3A 1P4RA 1NJIW 1SA0B 1Y6XA 1M56C 3CCEV 3MD0A 3JCZA 3H01A 2AXTZ 3ZHVA 4DO2A 2EJ7A 4G27B 3GWKC 4W4KA 4PDRA 4MTGA 4YIOA 1MZEA 1I0HA 3E22A 4LH6A 3A0BZ 2JEUA 4O2BB 2AHZA 3QF7A 3OMIB 3BA9A 3WG7B 4X64O 4HYOA 1MG1A 1R3JC 3K0DA 3UO3A 2NR5A 1H38A 2ZCEA 4FJCC 1BQ0A 1KP2A 1L1FA 1OCOB 1JX9A 2NN4A 3QG5A 1OCRC 3ZRXA 4DV5B 4JZGA 1H2GA 3BVOA 1WA8A 4UV9A 1XNRB 2UU9O 1QCEA 3SJCC 4H37A 2LGWA 1VMGA 3AG7A 1S72V 4DR3B 3ZMSA 1GN6A 4DUZO 4DV2B 4KHPO 2QA4V 1AP5A 4R8CA 4LF6O 3SGIA 1YJNV 3N27A 2QM4A 3OMAB 1R6TA 1OCCB 1KMIZ 3SPHA 2R72A 4YJ2B 2K9PA 4JI0B 5B1AB 3SPJA 1CEZA 5FLXN 5IDJA 4J9ZB 1VQ6V 2PI4A 4MTXA 3TK1A 1E1RG 3LNNA 4HBNA 4PI0A 3FX7A 2XAQA 3RGBA 2UXBB 4BIOA 4O2BA 3RFRA 1HNZB 4PI2A 2FL4A 3G6BA 3N2KA 2QWOB 5KA6A 1KKDA 4MVZA 1M5IA 3G80A 1HDJA 2E5LO 4BIZA 1R3KC 3RBZA 1XEQA 2HG5C 5AG2A 3B4SA 2W0FC 2ODMA 1B6QA 3UT5B 3VQXA 4JTCB 1N34B 2ILMA 1Y66A 4WBNA 5LMNO 1R3LC 4GX2A 3RW0A 4K8ZA 2Q68A 1D5NA 1F4NA 2FMLA 2OCCC 3W7WA 1WB7A 3CMEV
chains in the Genus database with same CATH topology
4QE9A 3ABKC 3GWOA 1KQSU 3ZRSA 4RQEA 3AG2B 2EIJB 4X8AA 1I5XA 4X88A 1W0KG 4JAUA 4X89A 1M56B 1SETA 3CD6V 1YITV 2ITCC 3G71V 5B1BB 3ZRWA 4JF3A 3K06A 3VBBA 1F23A 3ASOC 2F43G 1M1KW 4MVRA 4MTOA 4ZBMA 4P2ZA 3FKSG 1KD1W 2XOKG 3FYEB 3GB7C 1GK9A 2IH3C 2DWEC 1NVPB 1PD3A 2FTKA 4KP4A 4QE7A 3WG7C 3E8GA 1R6KA 4ZKIA 3SYCA 1DF5A 2B1IA 5C93A 3LDCA 1QVGU 2AHYA 3MHHC 1S77D 1WLEA 3CC4V 1GM7A 1M9NA 1ROPA 3SYQA 4WFBV 2EBOA 1MSWD 3JD1A 3CCQV 1K9MW 1OCOC 2EZOA 1YIJV 3K04A 1FXKB 1TUEB 3LSSA 1EFRG 2GSMB 3EHBB 3AG4C 3OUSA 4R6ZA 1K33A 1OCRB 2JIZG 2EIMB 2WPDG 5L3CA 1GM8A 2YSUB 1JQ0A 1QR8A 4JAVA 3ZN0A 4UUJC 5KUKA 2OTJV 3E83A 2NLJC 2ZXWC 1DLBA 1K5QA 4L87A 1V54B 4F4LA 2ATKC 2DW4A 1ENVA 1NH2D 4MW3A 1NQTA 3HB3B 4MT8A 1M90W 1SERA 1E1QG 1QLEC 3ZRVA 5LGUA 3STLC 1VQPV 1VQ8V 5BZBA 4QPKA 4TWKA 3ABTA 4JTAB 1M57B 3B77A 4UVAA 5DM6V 2IJJA 2KB1A 5J9PC 4PDVA 4UVCA 1BHAA 2ZQMA 1THZA 2QKSA 1MABG 3E89A 3IGAC 4JYCA 1RM1B 1BHBA 2V7QG 4WF9V 1G4YB 2H94A 4LP8A 2WSSG 3DTUB 3CC7V 2X6BA 1KP3A 2DYRC 4WFGA 1K4DC 3ABLB 4PA3A 1UJWB 3W7TA 2V1DA 1KECA 3OR6C 1V55C 2WLLA 3FB6C 3JYCA 4RO2A 1OCZC 2EILC 1OZ0A 3EFFK 3OGCC 4RUFA 1OHHG 3LDDA 5L3FA 2JJ1G 1AI7A 4KFMA 1NVPD 1S76D 5IY5C 4RQFA 3JD4A 4PDMA 2WLIA 2QM8A 2YEVB 2P6JA 3OW2U 1YTFB 1JOYA 1DTOA 2WLNA 5HFMA 4DXWA 1VQ9V 1VQKV 4JASA 4N23A 4BIUA 3CXCU 1QVFU 3E2EA 3ABMB 3AEIA 2P7TC 4FIPC 3OM3B 2XAGA 4RUEA 4I9WA 1AR1B 1AJNA 2Y69B 1AI6A 3CMAV 1RPOA 5CBGA 2WAMA 2XAJA 4PA7A 3E86A 4J9YB 1RPRA 1K5SA 1VQMV 3B8MA 5E1AC 5DN6G 4BAYA 1DF4A 2OCCB 2ZR3A 3K79A 4MW8A 4MTFA 4MVMA 5LHHA 1VQNV 2P90A 2Q6AA 1PL0A 2QEXV 1SZTA 2EIKC 4MVOA 1YSCA 2XAFA 3SYAA 3E8BA 1W0JG 4JTDB 3JD3A 1GKFA 4Z1MG 1COWG 2R9IA 5LGTA 1W2BU 3MHSC 3D3IA 3JD0A 3OUFA 4KUMA 1ORQC 1CPYA 4MVQA 3ZJZA 2A79B 3ETGA 2JK5C 4YXWG 3STZC 1JCHA 4OXSA 1S5HC 4TT3G 1FXVA 2X6CA 1QLNA 4GX5A 4UV8A 1NKDA 3ZN1A 4LBEC 3QO5A 3SYPA 2BOCC 2QM7A 2ZD9A 2H8PC 3ASNC 1BMFG 3CYOA 4PELA 3TCUA 4JPRA 2DQ3A 3K3WA 1PNMA 1K34A 3T1CA 3R65A 3FYIB 4FPPA 4RAIA 1EZJA 2PI5A 2XASA 3CP1A 1P7BA 3ML0A 3A0RA 5IYCO 3SPIA 2IJIA 3FB8C 4P9PA 3CCLV 1SESA 2D3OW 1NR1A 3OEEG 2EIMC 3K0GA 2JDIG 4WCEV 3DGEA 5L3GA 3PJSK 4BW5A 5IYDO 3LSQA 3P32A 3CCVV 5CMUA 1YTFD 1GMGA 1V54C 2IJHA 2ZXWB 1OCCC 5HFLA 3W7XA 5H9CA 1WPXA 3I55V 2B5UA 3ZIAG 1NBMG 5B1AC 4U7NA 3K9AA 2DYSC 2R9RB 4MS2A 4WFAV 2EINB 2A0LA 1J95A 1QLEB 2P67A 1K97A 3CC2V 2HVJC 1LNQA 3T2MA 1AI5A 4PA6A 3LUTB 3G4SV 1VQLV 1F51A 3OFNG 4XDKA 2M7WA 5L3BA 3ZRWB 2Z3YA 3QO7A 3BY6A 1YHQV 1JJ2U 2Q67A 4MSWC 4XDJA 1K3EA 1FFTB 1H8HG 1S3JA 1XL4A 3LNMB 1RM1C 4CZZA 3UKMA 3AG1C 3FB7C 5LBQA 2X7RB 5EK0A 3T4ZA 2DWDC 3G6EV 2JJ2G 4N21A 3SPCA 3BEHA 1Q86W 4P30A 1H8EG 3X2QB 3ABLC 2Q69A 3QO8A 2BOBC 3K08A 3IC7A 1PKXA 2DQ0A 5B1OA 3E8FA 1EBOA 5EBWC 3W7SA 5CBHA 2OTLV 3ZMTA 1FS0G 4QJFB 3E8HA 1FXKA 4WFHA 4ASUG 3D36A 5B3SC 2NNUA 2ITDC 5IY5B 4PA4A 5EC2C 5KA5A 1F4MA 4EKWA 5CA3A 4PDLA 5CN0A 3ZMUA 3NXSA 2A9HA 2Y69C 3JD2A 2Y48A 5GW7A 1YJWV 3TETA 4MVUA 3SJQC 3AG3C 2UXNA 4TSFG 2W6IG 5LHGA 2X0LA 3B8NA 2HVKC 1AJPA 3RVZA 3WFVA 1AJQA 1VQ7V 3AG2C 2EIJC 3ABKB 3CCMV 1P4RA 3ZCCA 3ZMZA 5L3DA 1NJIW 3QNEA 1BL8A 4U7OA 1M56C 4JYBA 3CCEV 4MVSA 2XNDG 3MD0A 4P9OA 5B1BC 5B1NA 3CCJV 1NR7A 2LFSA 3JCZA 3H01A 4UVBA 2EIKB 1FXHA 4DO2A 1QR9A 4G27B 2WLJA 2QE7G 2WLHA 4PDRA 4MTGA 3ASOB 1YJ9V 5EBMC 2JEUA 1K73W 1Q82W 2ZDIA 1PNLA 2HR3A 2AHZA 2EZPA 3OMIB 3WG7B 3M99B 4HYOA 1MG1A 1R3JC 1KC8W 2CK3G 4G2KA 3K0DA 1JVMA 1K7DA 4XBFA 3OEHG 2HKOA 3W7UA 5IYBO 1H38A 2WLLB 3F5WC 4FJCC 2IU0A 1IXMA 1KP2A 1L1FA 1FXKC 1OCOB 1JX9A 2HJFC 2LP7A 2OT5A 3F7YC 1OCRC 2YEVA 3ASNB 3HPLC 3UM7A 3ZRXA 5CBFA 1PNKA 1H2GA 2JEXA 2WLIB 3AG4B 3FB5C 3OMNB 4UV9A 2UXXA 4I5SA 1G8MA 3OR7C 2LFRA 1QCEA 2X6AA 4H37A 5H6QA 2IH1C 4GX0A 4XDLA 5EC1C 4QIWF 3T4DA 1S72V 1Y4MA 3ZMSA 3ETEA 3IFXA 4HZ3A 3ETDA 1HWYA 2QA4V 1R3IC 4R8CA 1YJNV 2B1GA 3OMAB 4CBCA 1OCCB 3SPHA 3I56V 1M57C 1R73A 5FL7G 5L3EA 3ABUA 4PA9A 3K03A 3CCUV 2EINC 2IW5A 2XAHA 5B1AB 1K8AW 1CP9A 2Z5UA 5EBLC 2DYSB 3SPJA 4WFFA 3P30A 4E2LA 1YI2V 1CEZA 4R50A 2WLMA 5IDJA 4J9ZB 1XL6A 1K4CC 1VQ6V 4QNHB 5LGNA 4MTXA 2PI4A 4LCUC 3TK1A 1E1RG 2ZDIC 1N8RW 1QBZA 2QTOA 4H33A 1SRYA 4FMTA 1E79G 2XAQA 3ZMVA 4QPJA 1VQ5V 4GT1A 1ZWIC 1MOFA 5H6RA 2DYRB 4FK5C 5KUMA 1GO3F 3AG1B 2HFEC 4LC1A 1R6NA 1V55B 2MK3A 4G28B 4GCZA 5LHIA 3X2QC 3SPGA 3CCRV 4JGSA 1OCZB 2EILB 5KA6A 1KKDA 4Q20A 4MVZA 4HAMA 2K1EA 2WWWA 2GHYA 1GTOA 2HLDG 3KG2A 1JPXA 1K92A 3F7VC 4BIZA 1R3KC 3RBZA 3CPWU 3VOUA 2HG5C 3ABMC 1GM9A 4GX1A 1VQOV 1NH2B 4R7CA 2W0FC 5B3SB 2C2AA 3RVYA 1Q7YW 3LDEA 4WFEA 1B6QA 3E35A 3CCSV 4JTCB 1VQ4V 1Y66A 4UXNA 1Q81W 1R3LC 4GX2A 3RW0A 3SYOA 1S0VA 1AROP 2Q68A 2W6JG 1I5YA 2IJKA 3OAAG 1F4NA 2EJRA 2OCCC 2ZR2A 3OE7G 3W7WA 3CMEV 2WLKA 2IU3A 3AG3B 1AI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R W;  5DM6 V;  3G6E V;  1Q86 W;  1KQS U;  4WFA V;  2QA4 V;  1VQM V;  1QVG U;  1VQ5 V;  1VQO V;  2OTJ V;  1VQN V;  3CCL V;  1YJN V;  1YJW V;  1YJ9 V;  2D3O W;  3CC2 V;  3CC4 V;  3OW2 U;  3CD6 V;  4WCE V;  3G4S V;  1YIT V;  1Q7Y W;  1VQ9 V;  1K73 W;  3I56 V;  4WFB V;  1R73 A;  3G71 V;  3CCS V;  1VQL V;  1Q82 W;  1VQK V;  1VQ7 V;  2QEX V;  1VQ4 V;  3CCQ V;  3CCU V;  1Q81 W;  1K9M W;  4WF9 V;  2OTL V;  3CCV V;  3CCR V;  1K8A W;  1M90 W;  1YIJ V;  3CXC U;  1QVF U;  3CCM V;  3CC7 V;  1M1K W;  1YI2 V;  1YHQ V;  1KC8 W;  1JJ2 U;  1VQP V;  1NJI W;  1VQ8 V;  3CMA V;  3CCE V;  1KD1 W;  3CME V;  1VQ6 V;  1W2B U;  3CCJ V;  1S72 V;  3I55 V;  3CPW U; 
#chains in the Genus database with same CATH topology
 1DGS A;  3AK1 A;  1Q6U A;  2E3C A;  5F2V O;  3ZRS A;  4RQE A;  3AG2 B;  2EIJ B;  3BPZ A;  3Q4H A;  4X8A A;  1VAR A;  3K59 A;  4I9Q A;  3CD6 V;  4JI5 O;  2PY5 A;  5DED A;  4I7Z B;  5J2T B;  4EB6 B;  1Q8I A;  3N2G B;  4L8J A;  1B06 A;  4ZBM A;  1JFF B;  1KD1 W;  4DR5 O;  2DWE C;  3H1J H;  2ZE7 A;  4YIP A;  3SJA C;  1R6K A;  3SYC A;  3LDC A;  4JI8 O;  4CC5 A;  4K0K O;  1S77 D;  5EIB D;  1Q6I A;  1NTM H;  5BR8 B;  2W0X A;  5LA6 B;  5K1X A;  4WFB V;  1ROP A;  1D5A A;  3CCQ V;  1EFR G;  4D7T A;  4DR4 B;  2D2C B;  5EYP B;  2YSU B;  1JQ0 A;  3ZHT A;  2OTJ V;  3E83 A;  1Z5W A;  1NS1 A;  4L87 A;  4F4L A;  4X9Q A;  1GRJ A;  4X20 B;  3TXQ A;  1NH2 D;  1H2K A;  1SER A;  1DK1 A;  2E76 B;  1TUB B;  2KG7 A;  5LGU A;  3CHX A;  1VQ8 V;  4I50 B;  1IVS A;  4AHC A;  4UB6 Z;  4DV7 O;  5KLV H;  4JI2 B;  4J11 A;  2IJJ A;  2KB1 A;  2QGN A;  4LF5 B;  1B3Q A;  1BHA A;  1NTK H;  2A3Q A;  1THZ A;  1XIL A;  4NR1 A;  5ITZ B;  1MAB G;  2YI9 A;  4BWA A;  4WF9 V;  2H94 A;  4DV1 O;  1AIL A;  2X6B A;  1MA1 A;  3W7T A;  2V1D A;  1KEC A;  2ZM6 B;  3APQ A;  2EIL C;  3EFF K;  4QGP A;  1OHH G;  2AGA A;  5LYJ B;  2F93 B;  4DW1 A;  5L3F A;  2JJ1 G;  1AI7 A;  4F6E A;  3ZED A;  5LA6 A;  5BXZ A;  4O2A A;  5BY1 A;  2QWP B;  2VWJ A;  4JI4 O;  1QVF U;  4RUE A;  4I9W A;  1AJN A;  1AI6 A;  2VS0 A;  3H9V A;  3R66 A;  2P22 C;  1QNM A;  3E86 A;  1RPR A;  5E1A C;  4IYI A;  1DF4 A;  3K79 A;  5K1P A;  1SKV A;  4O4L B;  1VQN V;  1PL0 A;  2AZ0 A;  1TUB A;  3SYA A;  4DR1 O;  1IDS A;  4FLY A;  4JZ2 A;  2CE4 A;  4O4I A;  1COW G;  5LGT A;  3D3I A;  1U97 A;  4O4J B;  5JQG B;  5JJE B;  3JAK B;  2JS3 A;  4DW0 A;  1BS3 A;  4X1Y B;  2X6C A;  1M93 A;  4X64 B;  5LP6 A;  1QLN A;  3ZN1 A;  3SYP A;  1FFX B;  2ZE5 A;  1XMO O;  1PPJ H;  1ZX3 A;  2DOS A;  3CYO A;  4ZOL A;  4JPR A;  4NTW A;  2DN9 A;  1K34 A;  3T1C A;  3UCS C;  1WNS A;  5LYJ A;  5CB4 A;  2LGQ A;  4CH5 A;  3D36 C;  3ML0 A;  4LR3 A;  2IJI A;  1SES A;  2XUM A;  4ZI7 B;  4WCE V;  2UU9 B;  1BGY H;  3HKE B;  1XUQ A;  3PJS K;  3HKB B;  5CMU A;  1YTF D;  1SQP H;  1OCC C;  4DUZ B;  1JA8 A;  3BHP A;  3ETQ A;  4KHP B;  1WPX A;  3K9S A;  3I55 V;  4LF6 B;  3ZIA G;  1NBM G;  5B1A C;  5LXT B;  4U7N A;  4MS2 A;  2R9R B;  1JJO A;  4WFA V;  3BAB A;  3H1K H;  4K3A A;  1QLE B;  1FAF A;  1LNQ A;  1VQL V;  2HHH O;  3OFN G;  4XDK A;  5L3B A;  3ZRW B;  5KHG A;  3UO2 A;  3BFR A;  4AI8 A;  1YHQ V;  2Q67 A;  4MSW C;  4XDJ A;  2OYQ A;  1FFT B;  1XL4 A;  1RM1 C;  3UKM A;  2X7R B;  5EK0 A;  1SF9 A;  1N33 O;  4N21 A;  1GN2 A;  4U3J B;  5B1O A;  1T5E A;  1FFX A;  1KB9 F;  4H44 B;  5EBW C;  5CBH A;  3ZMT A;  2E5L B;  2EX3 A;  4ASU G;  2NNU A;  1XDC A;  2ITD C;  3ZHS A;  5IY5 B;  4PA4 A;  3C3S A;  4PDL A;  5A9G A;  4HNA A;  3NXS A;  2A9H A;  5E79 Z;  2Y48 A;  2F1M A;  4I4T A;  4K35 A;  3JCU Z;  3SJQ C;  5LMN B;  1WP8 A;  2N04 A;  3M8A A;  3B40 A;  4TV8 B;  3B8N A;  1VQ7 V;  1AJP A;  1EN4 A;  3CEI A;  3AG2 C;  2EIJ C;  3OTO O;  2PYJ A;  4U7O A;  4B7K A;  1ZL8 A;  1VP7 A;  4MVS A;  4P9O A;  3CCJ V;  4X1I B;  1GH6 A;  4UVB A;  2YDE A;  4JI5 B;  2QE7 G;  4JI6 O;  3D3Q A;  2P4K A;  1LR1 A;  1TA8 A;  2L6L A;  5KX5 B;  5LL6 Y;  4DR5 B;  1FJG O;  2ZIM A;  2CK3 G;  1KC8 W;  5CA0 B;  1JVM A;  2HKO A;  1FD9 A;  4JI1 B;  3W7U A;  4JI8 B;  4ABM A;  4K0K B;  2WLL B;  1GN3 A;  1IXM A;  4I0X A;  2QTS A;  4U3J A;  2LP7 A;  3HPL C;  3F7Y C;  3UM7 A;  3TGU H;  1LUV A;  2JRI A;  3QTC A;  2WLI B;  3M7M X;  1HNW O;  4DUY O;  4I5S A;  3OR7 C;  2LFR A;  3L73 H;  2BCC H;  4TV9 B;  4GX0 A;  3KCY A;  3T4D A;  2RQ6 A;  1IBK O;  1IBL O;  1OV9 A;  2GBO A;  4CH6 A;  4FFB A;  5TIS Z;  2B1G A;  4CBC A;  3BA8 A;  4J10 A;  4TV8 A;  3I56 V;  5FL7 G;  5L3E A;  3P3N A;  3ABU A;  2IW5 A;  4X66 O;  4J7J A;  5EBL C;  4DV7 B;  4E2L A;  4LH7 A;  1VF6 C;  4X1I A;  4LCU C;  2ZDI C;  4ZHQ A;  1ZSP A;  4H33 A;  4FM1 A;  3OTF A;  1ZWI C;  1IUR A;  1NTZ H;  3RN4 A;  4DV1 B;  4FK5 C;  4LFC O;  1GO3 F;  5KX5 A;  1PP9 H;  4G28 B;  5LHI A;  3SPG A;  4JGS A;  2EIL B;  4Q20 A;  1I08 A;  2WWW A;  2GHY A;  2A7W A;  1QQC A;  1GTO A;  2BTO A;  1JPX A;  2OIE A;  5D5P A;  3KCX A;  3ZHR A;  3VOU A;  5JWP A;  4DRX A;  1GM9 A;  1ZUQ A;  4LWS A;  5JJJ B;  1VQO V;  1XRE A;  3RVY A;  1Q7Y W;  4JI4 B;  3CCS V;  2ZKO A;  3TJT A;  1S0V A;  1ZLZ A;  1EN6 A;  2W6J G;  2IJK A;  4JV5 O;  3OAA G;  2ZR2 A;  1B04 A;  4X62 O;  2IU3 A;  1E79 G;  5IT9 N;  4IL6 Z;  4FVM A;  1WJZ A;  2EUL A;  3RYH A;  4B3M O;  3CRM A;  1XMQ O;  1KQS U;  5DEC A;  1O9G A;  1I5X A;  2VQF O;  2DJV A;  1W0K G;  4JAU A;  4PD4 F;  5BMV B;  3HR0 A;  4X89 A;  1SET A;  1YIT V;  1L8D A;  4DR1 B;  2ITC C;  4ZIB A;  3HKC A;  4DV6 O;  4FLT A;  5B1B B;  4OX9 O;  4JF3 A;  1EN5 A;  3ASO C;  2Q7G A;  1TVK A;  3JAR B;  4P2Z A;  3FKS G;  4TUY B;  5FPO A;  3K5N A;  2IH3 C;  1NVP B;  2CGO A;  5C93 A;  1Y76 B;  2YIB A;  2Q7H A;  3KZI Z;  2QJ1 A;  2AHY A;  4AQY O;  1QVG U;  1BCC H;  2PGG A;  4PHZ A;  2CDY A;  1WLE A;  1VF5 B;  1GM7 A;  1IXB A;  4LNU A;  4NXN O;  1XMO B;  4NKG B;  5KMG B;  3FD9 A;  4NXM O;  1FXK B;  3OUS A;  4R6Z A;  3GVM A;  1K33 A;  1H2S B;  2WPD G;  2UXC O;  5KUK A;  2NLJ C;  1DLB A;  4IGG A;  2ATK C;  2HP8 A;  2LW1 A;  4GLX A;  4MW3 A;  3DSQ A;  1QLE C;  3ZRV A;  1SA0 A;  3DXR B;  4JTA B;  1TGO A;  3O9O A;  4X1K B;  3CXH F;  2HHH B;  3AK3 A;  4PDV A;  2PUS A;  5H2F Z;  4FLX A;  4UVC A;  5EZY B;  5EIB C;  4LF8 O;  1I94 O;  1JMK C;  4DV4 O;  3IGA C;  1RM1 B;  1U96 A;  5LMU O;  2AW9 A;  3DTU B;  4TUY A;  3OT7 A;  2JGD B;  3CWB H;  4WFG A;  3CSX A;  4YJ3 B;  1NU1 H;  1K4D C;  4C7U A;  1N33 B;  1YXB A;  3OR6 C;  3JYC A;  1OCZ C;  1Y76 A;  3OGC C;  2RN9 A;  2R9A A;  5IY5 C;  2YEV B;  3OW2 U;  1DTO A;  5KMG A;  1VQ9 V;  3T1Y O;  4JAS A;  3EVK A;  3CXC U;  1PL4 A;  3B09 A;  4FIP C;  3OM3 B;  2JGU A;  1AR1 B;  4GZR B;  4J7K A;  2Z0A A;  5CBG A;  1P84 F;  2FB5 A;  2XT9 A;  2ETN A;  4J9Y B;  5IWA O;  1H2L A;  3B8M A;  5DN6 G;  4LF7 O;  1N32 O;  2IBZ H;  4BAY A;  4LFA O;  3CRA A;  2P90 A;  2Q6A A;  3OTO B;  4NVP A;  4YJ2 A;  1YCI A;  2Q73 A;  3S3W A;  3JAS B;  2XAF A;  2GTA A;  1FKA O;  4JTD B;  4J42 A;  2R9I A;  3MHS C;  3JD0 A;  3OUF A;  4KUM A;  2GUZ B;  4X65 O;  4JI6 B;  2E74 B;  3CRQ A;  3ZJZ A;  2VQE O;  2A79 B;  5EZY A;  1JCH A;  4OXS A;  4GUN A;  1FXV A;  1SQG A;  1FJG B;  4TOI A;  2CUG A;  2H8P C;  4PEL A;  1BQZ A;  4B08 A;  1UPG A;  1PNM A;  4BR6 A;  3CS5 A;  3R65 A;  4H13 B;  2PI5 A;  3CP1 A;  3A0R A;  1HNW B;  4P9P A;  4DUY B;  2D3O W;  5IYZ B;  1NR1 A;  2YXH A;  2EIM C;  3K0G A;  2JDI G;  3UT5 A;  4GKJ O;  5L3G A;  3L70 H;  3SJB C;  5IYD O;  2CTW A;  2PF4 E;  3LSQ A;  2DE0 X;  4B3S O;  1BZK A;  1IBK B;  1Q6H A;  1IBL B;  5H9C A;  1X59 A;  4J7Z A;  1YDX A;  3K9A A;  1YEW A;  3ZHQ A;  2V4D A;  2A0L A;  1RFY A;  1J5E O;  1L0L H;  1K97 A;  4X66 B;  3T2M A;  4PA6 A;  5J2T A;  4EB6 A;  2Z3Y A;  3QO7 A;  3N2G A;  1JFF A;  3SR2 C;  4DYL A;  1H8H G;  1S3J A;  3FB7 C;  5C8Y B;  2CTQ A;  2JJ2 G;  3BAA A;  3G6E V;  1PV0 A;  4LFC B;  4LF9 O;  2F95 B;  2Q69 A;  1VF7 A;  3K08 A;  1SQV H;  3IC7 A;  1PKX A;  2UXD O;  2CTR A;  2UUC O;  4CS3 A;  3J80 N;  3RT3 C;  3E8H A;  3ZS8 C;  4WFH A;  3A0H Z;  2QWR B;  5EC2 C;  1N36 O;  4JYY A;  5GTI Z;  3ZMU A;  5EYP A;  4J80 A;  3DC5 A;  2Y69 C;  1YJW V;  3TET A;  4PV1 B;  2Y4U A;  2LQT A;  4X20 A;  4JV5 B;  1P49 A;  5LHG A;  2HVK C;  2BTQ B;  2BE3 A;  1X4T A;  1MNG A;  4X62 B;  3CCM V;  2YIC A;  1UFI A;  4PJ0 Z;  3ZCC A;  5L3D A;  4I50 A;  1SC5 B;  1SQX H;  1BL8 A;  2OIG A;  4DK1 A;  3C90 A;  4JYB A;  4B3M B;  2F4V O;  1W59 A;  5B1B C;  5B1N A;  2XTA A;  2VQF B;  5CA1 B;  2EIK B;  1QR9 A;  5GON B;  2WLJ A;  2P06 A;  2WLH A;  4DV6 B;  4OX9 B;  3ASO B;  1YJ9 V;  1VF6 A;  5ITZ A;  1K73 W;  3D8C A;  4CH4 A;  2ZDI A;  3FFQ A;  1NI8 A;  1PNL A;  3FAV B;  2EZP A;  3RYI B;  3ZX6 A;  4G2K A;  1K7D A;  4XBF A;  1P7G A;  5IYB O;  4DV0 O;  5C8Y A;  4AQY B;  3F5W C;  4NXN B;  1FXK C;  2ZNI A;  4ICG A;  3ASN B;  5CBF A;  2YIB D;  4NXM B;  2UXX A;  2YC0 A;  1G8M A;  4B7E A;  2QWN B;  4LFB O;  1AP6 A;  3VQW A;  2X6A A;  5H6Q A;  4XDL A;  1EZV H;  5EC1 C;  2Y4T A;  1Y4M A;  2UXC B;  3ETE A;  3JAL B;  4HZ3 A;  2MW2 B;  1HWY A;  5KAF Z;  1R3I C;  3HKD B;  4O4L A;  1R73 A;  3CE2 A;  2EIN C;  4BW9 A;  1R1B A;  4WFF A;  4CS2 A;  3P30 A;  4R50 A;  1N8R W;  2QTO A;  4O4J A;  5JQG A;  4LF8 B;  1I94 B;  4DV4 B;  3JAK A;  3ZMV A;  1VQ5 V;  3L71 H;  4X1Y A;  5LMU B;  1V9P A;  2BSK B;  3FAV A;  4W4L A;  3AG1 B;  3RYI A;  1R6N A;  4GCZ A;  2RJZ A;  3CCR V;  1OCZ B;  2QR4 A;  2K1E A;  4H0L B;  3KG2 A;  2HLD G;  1K92 A;  3F7V C;  3CPW U;  3CJH B;  2WA3 A;  1NH2 B;  4R7C A;  3CRC A;  3T1Y B;  3P3P A;  2C2A A;  4ZI7 A;  1A32 A;  2YXL A;  1XHX A;  4WFE A;  3E35 A;  3HKE A;  3H1H H;  4UXN A;  3HKB A;  3SYO A;  1HR0 O;  1JR9 A;  2RCV A;  1I5Y A;  1TAE A;  4I55 B;  2EJR A;  3OE7 G;  3AG3 B;  5IWA B;  3E2E A;  4LF7 B;  4DR7 O;  2PTM A;  5LXT A;  1N32 B;  1XNQ O;  4LFA B;  5KHI A;  3HKD A;  1N0N A;  3EXA A;  3G71 V;  3L9D A;  2E75 B;  3ZRW A;  3OGI B;  1QU7 A;  3VBB A;  4EFE A;  1N0J A;  3L74 H;  1M1K W;  4MTO A;  2RMK B;  4X65 B;  1AR5 A;  2XOK G;  3FYE B;  2VQE B;  2FTK A;  3E8G A;  3A8T A;  4ZKI A;  1H2N A;  3VQV A;  1ZTE A;  3SYQ A;  1MSW D;  2EBO A;  2LJ2 A;  2EZO A;  1YIJ V;  3RYF B;  3K04 A;  4KL1 A;  1TUE B;  1AVM A;  1YVW A;  3EHB B;  2DMX A;  3AG4 C;  4E4E A;  4GKK O;  3A2F A;  4IIJ B;  2IM9 A;  3CJH A;  2EIM B;  5L3C A;  1GM8 A;  4UCR A;  4JAV A;  3ZN0 A;  4UUJ C;  4FLV A;  2UUA O;  4GKJ B;  4K8X A;  1K5Q A;  3UQ8 A;  4B3S B;  2DW4 A;  1HNX O;  1NQT A;  4IHJ B;  4MT8 A;  4I55 A;  1BE3 H;  4O4H B;  1E1Q G;  1YF2 A;  2RDC A;  4QPK A;  4TWK A;  5KHJ A;  1M57 B;  1J5E B;  4UVA A;  5JVD B;  4D6T H;  4JI3 O;  5J9P C;  3CX5 F;  2ZQM A;  3E22 B;  2QKS A;  4CC6 A;  2GV9 A;  3E89 A;  1BHB A;  2V7Q G;  3CB2 A;  4LP8 A;  2LO1 A;  3MDS A;  2WSS G;  5JJN B;  5CA0 A;  2DYR C;  4PA3 A;  1UJW B;  1V55 C;  2WLL A;  2ADP A;  4U3F H;  4LF9 B;  1OZ0 A;  4RUF A;  2Q0O C;  2ZM6 O;  2R70 A;  3LDD A;  1S76 D;  1AB3 A;  2UUC B;  3JD4 A;  1OJH A;  2WLI A;  4TQF A;  2QM8 A;  4JI7 O;  2P6J A;  1YTF B;  1NZ6 A;  2ZNJ A;  2WLN A;  5HFM A;  1WA8 B;  4UCU A;  4CS4 A;  2ZE6 A;  4N23 A;  4BIU A;  5JCO C;  1N36 B;  3ABM B;  3AEI A;  4TV9 A;  2XAG A;  2Y69 B;  2P4V A;  2WAM A;  2XAJ A;  1H2M A;  3O65 A;  4PA7 A;  1KBH A;  4TQD A;  1K5S A;  1VQM V;  1GAX A;  2ZR3 A;  4MW8 A;  5LHH A;  2QEX V;  2EIK C;  3JAT B;  3J81 N;  3QVN A;  3TXS A;  2L35 A;  4B3R O;  2F4V B;  2AZ2 A;  1GKF A;  1W2B U;  4UFZ A;  5JVD A;  2JS5 A;  1ORQ C;  2Q4P A;  1CPY A;  4MVQ A;  1IZ3 A;  4EFB A;  2JK5 C;  4YXW G;  2PZS A;  1WP7 A;  3STZ C;  4GX5 A;  4UV8 A;  4YY3 O;  3QO5 A;  4UCO A;  2BOC C;  3N2K B;  1G1X B;  2QM7 A;  2XHB A;  4DV0 B;  3ASN C;  1F7Y A;  1MSD A;  2DQ3 A;  3K3W A;  4RAI A;  1EZJ A;  5KHK A;  2XAS A;  2YID A;  1P7B A;  3SPI A;  3CCL V;  5IE9 A;  3U11 A;  4LFB B;  1XBL A;  3DGE A;  4D7S A;  4WBN B;  3CCV V;  4AIL C;  1GMG A;  1KU9 A;  1RSO B;  1V54 C;  2IJH A;  2ARH A;  3WU2 Z;  2ZXW B;  3W7X A;  3K5M A;  3KKY A;  1XHZ A;  2B5U A;  1US6 A;  2EIN B;  2Y0I A;  5KAI Z;  5B5E Z;  3Q4H B;  5BMV A;  3CC2 V;  2HVJ C;  2YS8 A;  5IJ0 B;  1AI5 A;  3LUT B;  2G38 A;  1URF A;  3JAT A;  1F51 A;  1D2D A;  3LSU A;  4OPH A;  1IX9 A;  3JAR A;  2HEP A;  1IBM O;  5H5N A;  3LNM B;  2QSA A;  3AG1 C;  2OWO A;  3BEH A;  5LOV B;  4P30 A;  1G6U A;  3ABL C;  2BOB C;  2CTP A;  2DQ0 A;  4RWU A;  3G67 A;  1EBO A;  4DR6 O;  4IT5 A;  1FXK A;  3D36 A;  2N05 A;  1M4U A;  3WB2 A;  4A5U B;  1O9H A;  1Q90 D;  1F4M A;  4EKW A;  3WB0 A;  5CN0 A;  3S3X A;  3JD2 A;  5GW7 A;  3AG3 C;  1HR0 B;  2UXN A;  1I7F A;  3RVZ A;  3WFV A;  2QKC A;  4LF4 O;  1RSO A;  3ZHU A;  3ZMZ A;  2WA4 A;  1FPO A;  2KG7 B;  3QNE A;  4DR7 B;  4Q6G A;  3DXR A;  1XNQ B;  4F6R B;  2XND G;  1NR7 A;  2LFS A;  3SDL A;  4DR2 O;  3PN1 A;  4X1K A;  1FXH A;  5KHH A;  1KYO F;  5IJ0 A;  3DC6 A;  5EBM C;  5FNV B;  1Q82 W;  2HR3 A;  3M99 B;  2FYU H;  2JGD A;  4YJ3 A;  3H1L H;  3OEH G;  5J2U B;  4JI1 O;  5LOV A;  2IU0 A;  4DV3 O;  3T1H O;  2HJF C;  4O2A B;  2OT5 A;  2YEV A;  1PNK A;  3FB5 C;  2JEX A;  3AG4 B;  4YHH O;  3OMN B;  4GKK B;  2YUA A;  4FZ0 A;  2CH7 B;  2ZIO A;  2IH1 C;  3H1I H;  4QIW F;  2UUA B;  3IFX A;  3ETD A;  1QHT A;  4JYA O;  4NTY A;  4OPA A;  1HNX B;  1M57 C;  4PA9 A;  3K03 A;  3CCU V;  3JAS A;  4B3T O;  1S5J A;  2XAH A;  1Q43 A;  1K8A W;  1CP9 A;  2Z5U A;  2DYS B;  1YI2 V;  4F6R A;  2WLM A;  4O4I B;  3RYC B;  1XL6 A;  1K4C C;  4QNH B;  5LGN A;  4JI3 B;  3K57 A;  2GUZ A;  2Q8V A;  1QBZ A;  1XOU A;  4FLU A;  1SRY A;  4FMT A;  2F66 C;  4QPJ A;  4GT1 A;  1MOF A;  5H6R A;  4FM2 A;  1KKC A;  5FNV A;  2DYR B;  5LP6 B;  5KUM A;  2HFE C;  4LC1 A;  1V55 B;  2MK3 A;  3F5T A;  3X2Q C;  3VQY A;  1AR4 A;  4HAM A;  4JAA A;  4ZOL B;  5J2U A;  2UUB O;  2F23 A;  2YI8 A;  5CB4 B;  3ABM C;  4JI7 B;  1YZB A;  4GX1 A;  1PM9 A;  5B3S B;  5IJ9 B;  5IYZ A;  4DK0 A;  2ADQ B;  3L72 H;  3LDE A;  1KUQ A;  1WB8 A;  1VQ4 V;  1Q81 W;  2CH7 A;  2ZE8 A;  1ARO P;  3K5O A;  1S5L Z;  5B66 Z;  2WLK A;  1XMQ B;  1AI4 A;  1ZAU A;  4QE9 A;  5GTH Z;  3ABK C;  3GWO A;  4Z2W A;  3K5L A;  4X88 A;  1EM1 A;  4UCV A;  1M56 B;  4B3R B;  2JVD A;  1SQB H;  3K06 A;  1N4C A;  1F23 A;  3L75 H;  1SZX A;  1LUW A;  2F43 G;  4MVR A;  3RYC A;  1Q3E A;  2KSD A;  1Z5V A;  3GB7 C;  1GK9 A;  1PD3 A;  4KP4 A;  2RNB A;  4QE7 A;  3WG7 C;  2N74 A;  1DF5 A;  2B1I A;  3MHH C;  2B9Z A;  4YY3 B;  3CC4 V;  4EEQ A;  2O57 A;  1M9N A;  3JAM N;  4DV5 O;  3JD1 A;  1K9M W;  2YXY A;  1OCO C;  2VRZ A;  1XNR O;  3LSS A;  2GSM B;  3THO A;  1OCR B;  2JIZ G;  4NTX A;  1BT8 A;  1HP8 A;  5JCO A;  1QR8 A;  2HJD A;  1Q5O A;  4DR3 O;  1Y74 B;  4HNA B;  5IJ9 A;  2ZXW C;  4DV2 O;  4I4T B;  1V54 B;  3ICX A;  1CXZ B;  1ENV A;  2BTQ A;  2H3O A;  3HB3 B;  1M90 W;  4KXR A;  3STL C;  1VQP V;  5BZB A;  4JI0 O;  5A2Q N;  3U0Z A;  1ZL8 B;  3ABT A;  3B77 A;  5CA1 A;  5DM6 V;  5GON A;  1XI1 A;  2QDO A;  3J7A U;  1WPB A;  3I5D A;  4J41 A;  2UXB O;  4JYC A;  1G4Y B;  2ZT9 B;  1HNZ O;  1IBM B;  3CC7 V;  1KP3 A;  3ABL B;  3CRR A;  4FZ1 A;  3FB6 C;  4RO2 A;  4FLW A;  3JAW B;  4I0X B;  4KFM A;  1NVP D;  4CH3 A;  4RQF A;  4PDM A;  4DR6 B;  1JOY A;  4DXW A;  1VQK V;  3IC9 A;  5JH7 B;  2P7T C;  1N34 O;  4FLZ A;  3CMA V;  1RPO A;  4UCT A;  3JAL A;  3JSL A;  1Y74 A;  4FFB B;  2KQX A;  2OCC B;  4LF4 B;  4MVM A;  4MTF A;  1VIB A;  2VWK A;  3U10 A;  1SZT A;  4MVO A;  2CGN A;  1YSC A;  2KKW A;  3E8B A;  1W0J G;  3AK2 A;  4UB8 Z;  3JD3 A;  4Z1V A;  4Z1M G;  4DR2 B;  2GTS A;  4GYC B;  4ZHQ B;  2CAZ C;  2M6Y A;  3ETG A;  4UCS A;  1RP3 B;  1S5H C;  4TT3 G;  4NB5 A;  2BSK A;  5FPR A;  1NKD A;  5BR8 O;  4LBE C;  3RWR D;  3IJ4 A;  2ZD9 A;  4IYH A;  1BMF G;  3TCU A;  1VEW A;  4DV3 B;  3BCC H;  3T1H B;  3FYI B;  4FPP A;  3JAW A;  4DRX B;  4YHH B;  4DR4 O;  4LWS B;  5IYC O;  4NYK A;  1SQF A;  3FB8 C;  3OEE G;  2ZIN A;  3MAQ A;  1FYJ A;  1XQ8 A;  4BW5 A;  2OCH A;  3P32 A;  5JH7 A;  1Y67 A;  3B2E E;  3C3T A;  2Y0P A;  3IAY A;  5HFL A;  4JYA B;  4FFK A;  1BSM A;  4FM0 A;  5D5Q A;  2DYS C;  3RYH B;  1MZF A;  4JI2 O;  1J95 A;  1WN7 A;  2QWQ B;  2P67 A;  4B3T B;  1MMM A;  4OGQ B;  3JSN A;  3G4S V;  4LF5 O;  3APO A;  2M7W A;  3HKC B;  2GDS A;  3BY6 A;  1SQQ H;  2PYL A;  1JJ2 U;  3NR7 A;  1TVK B;  1GN4 A;  1Z2G A;  1K3E A;  5LP6 C;  4CZZ A;  2FKX A;  5LBQ A;  3T4Z A;  2A06 H;  2DWD C;  3OD4 A;  1Q86 W;  3SPC A;  1H8E G;  3X2Q B;  2Q9L A;  2UXD B;  3QO8 A;  4LNU B;  1HW7 A;  3E8F A;  2OTL V;  3W7S A;  1FS0 G;  4QJF B;  3RYF A;  2P5O A;  5B3S C;  2UUB B;  2YIA A;  5KA5 A;  2Q5Z A;  2LW7 A;  4IIJ A;  5CA3 A;  2Q0A A;  2QKA A;  3WB1 A;  3ZBH A;  4MVU A;  1L0N H;  4TSF G;  2Q7E A;  2W6I G;  3K58 A;  2X0L A;  3BRC A;  1AJQ A;  4IHJ A;  1NT2 B;  3ABK B;  4O4H A;  1WAZ A;  1SS3 A;  1P4R A;  1NJI W;  1SA0 B;  1Y6X A;  1M56 C;  3CCE V;  3MD0 A;  3JCZ A;  3H01 A;  2AXT Z;  3ZHV A;  4DO2 A;  2EJ7 A;  4G27 B;  3GWK C;  4W4K A;  4PDR A;  4MTG A;  4YIO A;  1MZE A;  1I0H A;  3E22 A;  4LH6 A;  3A0B Z;  2JEU A;  4O2B B;  2AHZ A;  3QF7 A;  3OMI B;  3BA9 A;  3WG7 B;  4X64 O;  4HYO A;  1MG1 A;  1R3J C;  3K0D A;  3UO3 A;  2NR5 A;  1H38 A;  2ZCE A;  4FJC C;  1BQ0 A;  1KP2 A;  1L1F A;  1OCO B;  1JX9 A;  2NN4 A;  3QG5 A;  1OCR C;  3ZRX A;  4DV5 B;  4JZG A;  1H2G A;  3BVO A;  1WA8 A;  4UV9 A;  1XNR B;  2UU9 O;  1QCE A;  3SJC C;  4H37 A;  2LGW A;  1VMG A;  3AG7 A;  1S72 V;  4DR3 B;  3ZMS A;  1GN6 A;  4DUZ O;  4DV2 B;  4KHP O;  2QA4 V;  1AP5 A;  4R8C A;  4LF6 O;  3SGI A;  1YJN V;  3N27 A;  2QM4 A;  3OMA B;  1R6T A;  1OCC B;  1KMI Z;  3SPH A;  2R72 A;  4YJ2 B;  2K9P A;  4JI0 B;  5B1A B;  3SPJ A;  1CEZ A;  5FLX N;  5IDJ A;  4J9Z B;  1VQ6 V;  2PI4 A;  4MTX A;  3TK1 A;  1E1R G;  3LNN A;  4HBN A;  4PI0 A;  3FX7 A;  2XAQ A;  3RGB A;  2UXB B;  4BIO A;  4O2B A;  3RFR A;  1HNZ B;  4PI2 A;  2FL4 A;  3G6B A;  3N2K A;  2QWO B;  5KA6 A;  1KKD A;  4MVZ A;  1M5I A;  3G80 A;  1HDJ A;  2E5L O;  4BIZ A;  1R3K C;  3RBZ A;  1XEQ A;  2HG5 C;  5AG2 A;  3B4S A;  2W0F C;  2ODM A;  1B6Q A;  3UT5 B;  3VQX A;  4JTC B;  1N34 B;  2ILM A;  1Y66 A;  4WBN A;  5LMN O;  1R3L C;  4GX2 A;  3RW0 A;  4K8Z A;  2Q68 A;  1D5N A;  1F4N A;  2FML A;  2OCC C;  3W7W A;  1WB7 A;  3CME V; 
#chains in the Genus database with same CATH homology
 4QE9 A;  3ABK C;  3GWO A;  1KQS U;  3ZRS A;  4RQE A;  3AG2 B;  2EIJ B;  4X8A A;  1I5X A;  4X88 A;  1W0K G;  4JAU A;  4X89 A;  1M56 B;  1SET A;  3CD6 V;  1YIT V;  2ITC C;  3G71 V;  5B1B B;  3ZRW A;  4JF3 A;  3K06 A;  3VBB A;  1F23 A;  3ASO C;  2F43 G;  1M1K W;  4MVR A;  4MTO A;  4ZBM A;  4P2Z A;  3FKS G;  1KD1 W;  2XOK G;  3FYE B;  3GB7 C;  1GK9 A;  2IH3 C;  2DWE C;  1NVP B;  1PD3 A;  2FTK A;  4KP4 A;  4QE7 A;  3WG7 C;  3E8G A;  1R6K A;  4ZKI A;  3SYC A;  1DF5 A;  2B1I A;  5C93 A;  3LDC A;  1QVG U;  2AHY A;  3MHH C;  1S77 D;  1WLE A;  3CC4 V;  1GM7 A;  1M9N A;  1ROP A;  3SYQ A;  4WFB V;  2EBO A;  1MSW D;  3JD1 A;  3CCQ V;  1K9M W;  1OCO C;  2EZO A;  1YIJ V;  3K04 A;  1FXK B;  1TUE B;  3LSS A;  1EFR G;  2GSM B;  3EHB B;  3AG4 C;  3OUS A;  4R6Z A;  1K33 A;  1OCR B;  2JIZ G;  2EIM B;  2WPD G;  5L3C A;  1GM8 A;  2YSU B;  1JQ0 A;  1QR8 A;  4JAV A;  3ZN0 A;  4UUJ C;  5KUK A;  2OTJ V;  3E83 A;  2NLJ C;  2ZXW C;  1DLB A;  1K5Q A;  4L87 A;  1V54 B;  4F4L A;  2ATK C;  2DW4 A;  1ENV A;  1NH2 D;  4MW3 A;  1NQT A;  3HB3 B;  4MT8 A;  1M90 W;  1SER A;  1E1Q G;  1QLE C;  3ZRV A;  5LGU A;  3STL C;  1VQP V;  1VQ8 V;  5BZB A;  4QPK A;  4TWK A;  3ABT A;  4JTA B;  1M57 B;  3B77 A;  4UVA A;  5DM6 V;  2IJJ A;  2KB1 A;  5J9P C;  4PDV A;  4UVC A;  1BHA A;  2ZQM A;  1THZ A;  2QKS A;  1MAB G;  3E89 A;  3IGA C;  4JYC A;  1RM1 B;  1BHB A;  2V7Q G;  4WF9 V;  1G4Y B;  2H94 A;  4LP8 A;  2WSS G;  3DTU B;  3CC7 V;  2X6B A;  1KP3 A;  2DYR C;  4WFG A;  1K4D C;  3ABL B;  4PA3 A;  1UJW B;  3W7T A;  2V1D A;  1KEC A;  3OR6 C;  1V55 C;  2WLL A;  3FB6 C;  3JYC A;  4RO2 A;  1OCZ C;  2EIL C;  1OZ0 A;  3EFF K;  3OGC C;  4RUF A;  1OHH G;  3LDD A;  5L3F A;  2JJ1 G;  1AI7 A;  4KFM A;  1NVP D;  1S76 D;  5IY5 C;  4RQF A;  3JD4 A;  4PDM A;  2WLI A;  2QM8 A;  2YEV B;  2P6J A;  3OW2 U;  1YTF B;  1JOY A;  1DTO A;  2WLN A;  5HFM A;  4DXW A;  1VQ9 V;  1VQK V;  4JAS A;  4N23 A;  4BIU A;  3CXC U;  1QVF U;  3E2E A;  3ABM B;  3AEI A;  2P7T C;  4FIP C;  3OM3 B;  2XAG A;  4RUE A;  4I9W A;  1AR1 B;  1AJN A;  2Y69 B;  1AI6 A;  3CMA V;  1RPO A;  5CBG A;  2WAM A;  2XAJ A;  4PA7 A;  3E86 A;  4J9Y B;  1RPR A;  1K5S A;  1VQM V;  3B8M A;  5E1A C;  5DN6 G;  4BAY A;  1DF4 A;  2OCC B;  2ZR3 A;  3K79 A;  4MW8 A;  4MTF A;  4MVM A;  5LHH A;  1VQN V;  2P90 A;  2Q6A A;  1PL0 A;  2QEX V;  1SZT A;  2EIK C;  4MVO A;  1YSC A;  2XAF A;  3SYA A;  3E8B A;  1W0J G;  4JTD B;  3JD3 A;  1GKF A;  4Z1M G;  1COW G;  2R9I A;  5LGT A;  1W2B U;  3MHS C;  3D3I A;  3JD0 A;  3OUF A;  4KUM A;  1ORQ C;  1CPY A;  4MVQ A;  3ZJZ A;  2A79 B;  3ETG A;  2JK5 C;  4YXW G;  3STZ C;  1JCH A;  4OXS A;  1S5H C;  4TT3 G;  1FXV A;  2X6C A;  1QLN A;  4GX5 A;  4UV8 A;  1NKD A;  3ZN1 A;  4LBE C;  3QO5 A;  3SYP A;  2BOC C;  2QM7 A;  2ZD9 A;  2H8P C;  3ASN C;  1BMF G;  3CYO A;  4PEL A;  3TCU A;  4JPR A;  2DQ3 A;  3K3W A;  1PNM A;  1K34 A;  3T1C A;  3R65 A;  3FYI B;  4FPP A;  4RAI A;  1EZJ A;  2PI5 A;  2XAS A;  3CP1 A;  1P7B A;  3ML0 A;  3A0R A;  5IYC O;  3SPI A;  2IJI A;  3FB8 C;  4P9P A;  3CCL V;  1SES A;  2D3O W;  1NR1 A;  3OEE G;  2EIM C;  3K0G A;  2JDI G;  4WCE V;  3DGE A;  5L3G A;  3PJS K;  4BW5 A;  5IYD O;  3LSQ A;  3P32 A;  3CCV V;  5CMU A;  1YTF D;  1GMG A;  1V54 C;  2IJH A;  2ZXW B;  1OCC C;  5HFL A;  3W7X A;  5H9C A;  1WPX A;  3I55 V;  2B5U A;  3ZIA G;  1NBM G;  5B1A C;  4U7N A;  3K9A A;  2DYS C;  2R9R B;  4MS2 A;  4WFA V;  2EIN B;  2A0L A;  1J95 A;  1QLE B;  2P67 A;  1K97 A;  3CC2 V;  2HVJ C;  1LNQ A;  3T2M A;  1AI5 A;  4PA6 A;  3LUT B;  3G4S V;  1VQL V;  1F51 A;  3OFN G;  4XDK A;  2M7W A;  5L3B A;  3ZRW B;  2Z3Y A;  3QO7 A;  3BY6 A;  1YHQ V;  1JJ2 U;  2Q67 A;  4MSW C;  4XDJ A;  1K3E A;  1FFT B;  1H8H G;  1S3J A;  1XL4 A;  3LNM B;  1RM1 C;  4CZZ A;  3UKM A;  3AG1 C;  3FB7 C;  5LBQ A;  2X7R B;  5EK0 A;  3T4Z A;  2DWD C;  3G6E V;  2JJ2 G;  4N21 A;  3SPC A;  3BEH A;  1Q86 W;  4P30 A;  1H8E G;  3X2Q B;  3ABL C;  2Q69 A;  3QO8 A;  2BOB C;  3K08 A;  3IC7 A;  1PKX A;  2DQ0 A;  5B1O A;  3E8F A;  1EBO A;  5EBW C;  3W7S A;  5CBH A;  2OTL V;  3ZMT A;  1FS0 G;  4QJF B;  3E8H A;  1FXK A;  4WFH A;  4ASU G;  3D36 A;  5B3S C;  2NNU A;  2ITD C;  5IY5 B;  4PA4 A;  5EC2 C;  5KA5 A;  1F4M A;  4EKW A;  5CA3 A;  4PDL A;  5CN0 A;  3ZMU A;  3NXS A;  2A9H A;  2Y69 C;  3JD2 A;  2Y48 A;  5GW7 A;  1YJW V;  3TET A;  4MVU A;  3SJQ C;  3AG3 C;  2UXN A;  4TSF G;  2W6I G;  5LHG A;  2X0L A;  3B8N A;  2HVK C;  1AJP A;  3RVZ A;  3WFV A;  1AJQ A;  1VQ7 V;  3AG2 C;  2EIJ C;  3ABK B;  3CCM V;  1P4R A;  3ZCC A;  3ZMZ A;  5L3D A;  1NJI W;  3QNE A;  1BL8 A;  4U7O A;  1M56 C;  4JYB A;  3CCE V;  4MVS A;  2XND G;  3MD0 A;  4P9O A;  5B1B C;  5B1N A;  3CCJ V;  1NR7 A;  2LFS A;  3JCZ A;  3H01 A;  4UVB A;  2EIK B;  1FXH A;  4DO2 A;  1QR9 A;  4G27 B;  2WLJ A;  2QE7 G;  2WLH A;  4PDR A;  4MTG A;  3ASO B;  1YJ9 V;  5EBM C;  2JEU A;  1K73 W;  1Q82 W;  2ZDI A;  1PNL A;  2HR3 A;  2AHZ A;  2EZP A;  3OMI B;  3WG7 B;  3M99 B;  4HYO A;  1MG1 A;  1R3J C;  1KC8 W;  2CK3 G;  4G2K A;  3K0D A;  1JVM A;  1K7D A;  4XBF A;  3OEH G;  2HKO A;  3W7U A;  5IYB O;  1H38 A;  2WLL B;  3F5W C;  4FJC C;  2IU0 A;  1IXM A;  1KP2 A;  1L1F A;  1FXK C;  1OCO B;  1JX9 A;  2HJF C;  2LP7 A;  2OT5 A;  3F7Y C;  1OCR C;  2YEV A;  3ASN B;  3HPL C;  3UM7 A;  3ZRX A;  5CBF A;  1PNK A;  1H2G A;  2JEX A;  2WLI B;  3AG4 B;  3FB5 C;  3OMN B;  4UV9 A;  2UXX A;  4I5S A;  1G8M A;  3OR7 C;  2LFR A;  1QCE A;  2X6A A;  4H37 A;  5H6Q A;  2IH1 C;  4GX0 A;  4XDL A;  5EC1 C;  4QIW F;  3T4D A;  1S72 V;  1Y4M A;  3ZMS A;  3ETE A;  3IFX A;  4HZ3 A;  3ETD A;  1HWY A;  2QA4 V;  1R3I C;  4R8C A;  1YJN V;  2B1G A;  3OMA B;  4CBC A;  1OCC B;  3SPH A;  3I56 V;  1M57 C;  1R73 A;  5FL7 G;  5L3E A;  3ABU A;  4PA9 A;  3K03 A;  3CCU V;  2EIN C;  2IW5 A;  2XAH A;  5B1A B;  1K8A W;  1CP9 A;  2Z5U A;  5EBL C;  2DYS B;  3SPJ A;  4WFF A;  3P30 A;  4E2L A;  1YI2 V;  1CEZ A;  4R50 A;  2WLM A;  5IDJ A;  4J9Z B;  1XL6 A;  1K4C C;  1VQ6 V;  4QNH B;  5LGN A;  4MTX A;  2PI4 A;  4LCU C;  3TK1 A;  1E1R G;  2ZDI C;  1N8R W;  1QBZ A;  2QTO A;  4H33 A;  1SRY A;  4FMT A;  1E79 G;  2XAQ A;  3ZMV A;  4QPJ A;  1VQ5 V;  4GT1 A;  1ZWI C;  1MOF A;  5H6R A;  2DYR B;  4FK5 C;  5KUM A;  1GO3 F;  3AG1 B;  2HFE C;  4LC1 A;  1R6N A;  1V55 B;  2MK3 A;  4G28 B;  4GCZ A;  5LHI A;  3X2Q C;  3SPG A;  3CCR V;  4JGS A;  1OCZ B;  2EIL B;  5KA6 A;  1KKD A;  4Q20 A;  4MVZ A;  4HAM A;  2K1E A;  2WWW A;  2GHY A;  1GTO A;  2HLD G;  3KG2 A;  1JPX A;  1K92 A;  3F7V C;  4BIZ A;  1R3K C;  3RBZ A;  3CPW U;  3VOU A;  2HG5 C;  3ABM C;  1GM9 A;  4GX1 A;  1VQO V;  1NH2 B;  4R7C A;  2W0F C;  5B3S B;  2C2A A;  3RVY A;  1Q7Y W;  3LDE A;  4WFE A;  1B6Q A;  3E35 A;  3CCS V;  4JTC B;  1VQ4 V;  1Y66 A;  4UXN A;  1Q81 W;  1R3L C;  4GX2 A;  3RW0 A;  3SYO A;  1S0V A;  1ARO P;  2Q68 A;  2W6J G;  1I5Y A;  2IJK A;  3OAA G;  1F4N A;  2EJR A;  2OCC C;  2ZR2 A;  3OE7 G;  3W7W A;  3CME V;  2WLK A;  2IU3 A;  3AG3 B;  1AI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...