1YI8A

Crystal structure of tryptophanyl trrna synthetase ii from deinococcus radiodurans in complex with l-trp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
331
structure length
331
Chain Sequence
ARPRVLTGDRPTGALHLGHLAGSLQNRVRLQDEAELFVLLADVQALTDHFDRPEQVRENVLAVALDYLAAGLDPQKTTCVVQSAVPELAELTVYFLNLVTVSHLRQNPTVKAEIAQKGYGERVPAGFFVYPVSQAADIAAFGATLVPVGDDQLPMLEQTREIVRRFNALYAPVLAEPQAQLSRVPRLPGLDGQAKMSKSLGNAIALGDSADEVARKVMGMYTDPGHLRASDPGRVEGNPVFTFLDAFDPDPARVQALKDQYRAGGLGDVKVKKHLIDVLNGVLAPIRTRRAEYERDPDAVLRFVTEGTARGREVAAQTLGQVRRAMRLFGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and activity of an aminoacyl-tRNA synthetase that charges tRNA with nitro-tryptophan.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ligase
molecule keywords tryptophanyl-tRNA synthetase
total genus 106
structure length 331
sequence length 331
chains with identical sequence B, C
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1yi8A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1yi8A01
1KH3A 1KORA 4DNXA 1KKUA 4EG7A 3ZGZA 3P0JA 1K92A 3RFFA 4ARCA 1O94D 2PZ8A 4JXXA 4I6JA 4MVWA 3TQOA 3D6UA 2DETA 1GN8A 1H1TA 2A84A 4ZCTA 1VBMA 1N3LA 1YIDA 1KAMA 2D13A 1XJQA 1O95D 3FHJA 1U3DA 4UZEA 2VTBA 4MULA 3A04A 1J1ZA 3IVXA 5JBNA 2J5BA 4CDNA 3I05A 1PG2A 3LCJA 1KP2A 3P0HA 1J1UA 4JFAA 4NATA 3SZGA 3K9WA 1J09A 3RK1A 4MQ6A 2RE8A 4MVYA 3A2KA 3HL4A 2YWCA 3CLRC 4YMIA 5F23A 1GTRA 4WSOA 2PFSA 3CR8A 4F3RA 4K0RA 3ND5A 4MUNA 4P2BA 5H16A 2J09A 3ZXIA 3MXTA 1QJCA 4EG6A 1EXDA 1O6BA 2VXOA 4YP5A 5J59A 4EG4A 2QUHA 4I6EA 1JIIA 1EFPB 1B6TA 2ZUFA 1N2IA 1VLHA 4AQ7A 1KQOA 1OBCA 4TS1A 4DLPA 3C8ZA 4CDMA 3A05A 2H2AA 1ULHA 3CVVA 3TNJA 3ILVA 3H99A 2CYCA 3COYA 3H9BA 1KH1A 1RQGA 3TZLA 1T6YA 4XSVA 3VU8A 2A1TS 2V0CA 4MUJA 4QREA 2CSXA 1QRTA 1OD6A 4YBRA 1Q19A 1MB2A 5KWVA 1EJ2A 1QNFA 1K4MA 1YI8A 4Q16A 2TS1A 2WB2A 5J5AA 1GPMA 3CLSD 1NSYA 4PBRA 1MAWA 4OUDB 3VGJA 2NZ2A 1MAUA 2C5SA 2YWBA 3IMEA 4DDMA 3COZA 1WJGA 1TYCA 3SZ3A 4X0EA 1TYDE 4HPWA 4KR7A 1G8HA 2AKEA 1NI5A 3IUEA 1WQ4A 1I6MA 4NDAA 1IQRA 1EE1A 5TEWA 1ZUNA 5FO0A 3F3MA 1IQUA 1OWLA 2YXNA 4GU5A 3SDBA 3UMVA 2A86A 1Q77A 2CYBA 3D6VA 1WXEA 1VL2A 4J76A 4MUHA 4U8HA 2E0IA 4ZCRA 3ZJVA 1NZJA 1T9GR 2J07A 3FY4A 2G36A 1ZH6A 4NAUA 1N2EA 1J70A 3L93A 1JMVA 3IOBA 4YP7A 1N2JA 2PG3A 4ZT7A 4JYZA 1IVSA 2X0KA 2QJFA 2D5BA 4MVCA 4MUKA 4MWDA 3NBKA 3HZRA 1TYAE 1VBKA 5HUHA 3ZJUA 2PZBA 3Q12A 2CV1A 1T6ZA 1JECA 3IOCA 2VTBB 1MBZA 4ARIA 5AHWA 4KR6A 1EUYA 3RHSA 3FI0A 1F7UA 4R0NA 3IH5A 3TZEA 4MW4A 2IP1A 2GOYA 4MWBA 3HMQA 1H3EA 1N2GA 2R5WA 5IJXA 1JEEA 1O96B 1A8HA 4EGAA 3CVXA 1PFYA 2A1UA 3COVA 4CT0A 1U3CA 2QTRA 1QRSA 3G5AA 3DLAA 4MUFA 1QU2A 5TGTA 3IDFA 3JXEA 3INNA 3MMXA 2XRZA 4OJMX 1G8FA 4CQNA 3SP1A 1KAQA 3IOEA 4H3SA 1ZJWA 2HMAA 4MVXA 2ZP1A 3FH0A 3VRHA 2WQ6A 1QU3A 2QUJA 3SYTA 3P0IA 3CLUC 1COZA 1MJHA 3CLUD 2AG6A 1Q15A 1M83A 5DASA 5KCMA 2X1LA 1WXFA 2NSYA 2EJCA 3E27A 3RK0A 1TFUA 4WNYA 3IMGA 2DR2A 2CYAA 1PFVA 1OBHA 2J4DA 4RUKA 1IRXA 4NX2A 1KQNA 1J20A 2EL7A 2GKSA 1X6VA 1ZH0A 1IHOA 1N1DA 4MW0A 3P52A 2O8VA 3CLRD 2CT8A 4MW1A 4R2LA 4S1OA 3Q4GA 1OWPA 1O97D 1PFUA 1O97C 3CLTD 2CFOA 4L2IA 1M8PA 1XNJA 1T9GS 3IVCA 3MUEA 1GTSA 4BWVA 2DERA 4XFDA 2B7LA 1YIAA 1P7PA 2DPLA 1N2OA 3H9CA 3RJZA 1O96A 2XRYA 2PIDA 3M5WA 1TEZA 4ND6A 2HZ7A 2QJOA 2IELA 3PNYA 4U7JA 4ZT5A 4L2IB 4ZCPA 2A1TR 3AIIA 1KQPA 1M1ZA 3UK2A 1JZSA 3CVYA 3A4IA 4MWCA 2X1MA 1HYBA 4MUEA 1GZUA 4EF6A 1QTQA 4EG3A 3NV7A 1QRUA 2OQ2A 1OWNA 4I6GA 4K03A 3AL0C 1U0BB 2BYTA 3FOCA 4ZCQA 4HJXA 3X1MA 2H29A 4MW9A 1J21A 4G5FA 1IFXA 3ND7A 1M8JA 3CLSC 1FYDA 1N2HA 5TS2A 3QTBA 5FNZA 4DDKA 2Z09A 2CUZA 1CT9A 4MLPA 1NYLA 3ZIUA 1KP3A 2Z3VA 1VBNA 2QJTA 2DLCX 2DXIA 4MW6A 1JHDA 3KT8A 1KH2A 3GMIA 4MUIA 1YUMA 1JIJA 2PXHA 2A7XA 1WKBA 3K32A 2E18A 2DEUA 1EFVA 3Q10A 2A1UB 5EKDA 4DDHA 3GUZA 2IJGX 4ZCSA 1TYBE 4KPUA 3S3TA 1K97A 1F4LA 5DB4A 1N77A 5FO1A 1N75A 4MWEA 1UFVA 3PNVA 3ISJA 4NAHA 3RBAA 4EG1A 5BNZA 4ZT4A 3SEQA 4ZT2A 3KT6A 1G8GA 4AS1A 3TS1A 3BL5A 3PRHA 4JXZA 3KT3A 2I1LA 1EUQA 4DJAA 2X3FA 4YP6A 2QTNA 1XNHA 3IMCA 1JIKA 2OV4A 1WXGA 3PNBA 3QE4A 4MW7A 1M8KA 4U63A 2YY5A 5LLTA 4FZJA 3HGMA 2PZAA 4G6ZA 3N05A 3TQIA 1WZ2A 1R6TA 3U1VA 5DEOA 2V0GA 1NUPA 5K0SA 1SURA 4KR9A 2GM3A 2HGZA 3UY4A 3ELBA 1NUUA 1NUTA 1XNGA 3OTWA 5K0TA 3AKZA 1MRZA 1H3FA 4MW5A 1NUSA 1JILA 1YULA 1EFVB 4QRDA 3UC5A 3HV0A 1N78A 3FDXA 4PBTA 3OP1A 3PXUA 4EG5A 1Q11A 3NBAA 4F4HA 3LE8A 2RD2A 1N2BA 4ND7A 2JAXA 1S4MA 1U7XA 1TQ8A 3H05A 1D2RA 5J58A 1T6XA 2AZXA 4DE5A 1G59A 5TEVA 2E21A 1NURA 3CVUA 1O0BA 2D54A 2E89A 1LI5A 4QBTA 4JZYA 2A88A 1NUQA 3G59A 4MUGA 2O5RA 5IHXA 4ZT6A 4EG8A 4A91A 4EFKA 2JA2A 3IVGA 1IQ0A 2QUKA 2CV2A 4HK4A 2JANA 4MW2A 4KKVA 3ZJTA 4MAFA 3LOQA 3L92A 3H97A 1I6KA 1MB9A 2ZUEA 4J75A 3AFHA 3SEZA 5HUJA 2BTEA 1O5TA 3CLTC 5LM3A 1MOPA 1Y42X 5LFAA 2A4MA 1FFYA 4UZFA 1JZQA 1R6UA 2DUMA 1EFPA 1PFWA 1OWMA 3ZUGA 1F7VA 1H3NA 1O94C 3MLAA 1R6XA 3AG5A 3IODA 1QQTA 5H7XA 4NZPA 4E1AA 1IH8A 3HFJA 3DO8A 1OWOA 3N8HA 3ND6A 2CV0A 4HJRA 1O95C 1I6LA 1WXIA 3N9IA 3FG9A 1PG0A 1JGTA 3AG6A 1YUNA 3N2YA 2J08A 1NP7A 1DNPA 3COWA 3CVWA 5DK4A 4PBSA 3KT0A 3DV2A 1M8FA 4OUDA 1WXHA 1WOYA 3X1JA 1WQ3A 4R2MA 2WQ7A 3MLBA 1LI7A 4PY2A 4Q93A 1KR2A 1O0CA 1I2DA 4XFJA 1F9AA 1V47A 2QUIA 3G6KA 3QTTA 1GLNA 1JEDA 1K4KA 1GAXA 5KHAA 1LW7A 4ZT3A 2QTMA 1BS2A 3GLVA 3ZXSA 3DPIA 3FIUA 1V8FA 3FETA 3IUBA 2Z08A 3FNRA 1X8XA 4KPUB 3UOWA 1MC1A 4RPIA 1ILEA 4GRIA 3CA8A 3FWKA 5HG0A 1WY5A 1M8GA 3X1KA 1U7DA 3KFLA 4G5YA 2WSIA
chains in the Genus database with same CATH superfamily
1F0PA 2ADFA 1L3IA 4DNXA 5KDDA 3NKLA 5C8XA 1Y34E 5ARDA 1XRSB 1DEOA 1J9EA 2XMSA 3A6ZA 4O33A 4HAWA 2C4WA 2D62A 1KZ6A 3EWIA 4LZLA 4PGHA 3NKFA 3S5JA 1QCCA 3L7AA 5D87A 3TOVA 4D8TA 2QTLA 4RK1A 5DCLA 3LSTA 1XTRA 4FK8A 4UEWA 3P0RA 3K0KA 1A0OA 4C4XA 1J1ZA 2BFMA 2HCRA 2OK8A 1GAQA 2WJZB 4PHGA 3RS8A 2DBVO 4I2VA 4HAIA 4WA7A 2YRFA 4KNWA 2PKWA 3C15C 1MJNA 2Z9BA 2BFEB 4I1YA 1CY6A 5HJ2A 3RIXA 3WB0A 3K6SA 2FYTA 2EL9A 4YCLA 2O7VA 1BA2A 2X41A 3K9WA 4QPJC 4GKKB 5COQA 3ID6C 3SF0A 4JLSA 2RE8A 4MVYA 2OTCA 1WS6A 1ZM2A 2ZBGA 1M2FA 3SHFA 1CNEA 4BPBA 5LSAA 3PFWO 1IXSB 2AKAB 4IP0A 1BMQA 1ML3A 2H5IA 3ENQA 3HHEA 4KO1S 4K6HA 2XTNA 5HVNA 2J09A 3MN1A 2I62A 3EISA 5IN4A 2V1UA 5LDGA 3V4LA 3TLAA 2OOKA 1Z9BA 4EJSA 3V4OA 5IEJA 4JJZA 5H8WA 5C35A 1J8MF 1NM5C 1Q0HA 3G0OA 3QEKA 1WKVA 2DHRA 1KJQA 4HQRA 4NWIA 5AKLA 1T3LA 4CMJA 1R0RE 4HAUA 2Y68A 3SZRA 3GN1A 3QKUA 1P1JA 3IPAA 4F12A 3BMCB 1SUAA 1IDN1 4KREA 2CHGA 4MPJA 1KYXA 4Q21A 4EGSA 1F20A 2IDKA 3SE0A 3DKIA 4EP1A 5LD2C 1MHPA 1T34A 3C41J 3T3PB 3UW3A 4OFZA 2QRJA 5DM60 3KSAC 2YOFA 3C87A 2QEQA 4O2RA 5IJAA 3K0FA 4LK3A 1U2DA 2BBWA 2VHZA 2XWJI 4P4TA 3HJUA 2BSXA 1CJKC 2EV9A 3HXLA 1ZCZA 1F6BA 2R4QA 2RKOA 3AIOA 2I87A 3EMKA 3MTJA 4KO3S 4I4TA 4N0MA 1G0NA 3BH6A 3EG9B 3R0XA 2ECPA 2ASVA 3QX8A 5DTRA 4AJNA 3TRJA 2NUPB 4IO1A 5JALA 1ZITA 1H69A 3AYZB 2FTKE 5HCUA 2Q3FA 4UD6A 2VJPA 3BEDA 3ZWVA 1RI2A 4Q9KA 5C1OA 2IHJA 5AM5A 3V4VB 4F7WA 2QD1A 4PINA 4J0GA 4F2HA 3JW8A 2J5XA 5M2QA 3DMDA 2O8DB 2O1EA 3JWGA 2NZ2A 5TARA 2H3HA 3PVCA 4C08A 4XX1A 4CCYB 3S2GA 4YAKA 2D06A 4KQJA 4YUYA 3OZUA 3DEYX 1B8NA 3NZEA 3H1PA 1WJGA 2E6UX 4IQ4A 4JIGA 4YA6A 5CH5A 2PQ2A 1NU6A 3ZWCA 1JDBC 4F8YA 4KR7A 2VJKA 5H1YA 1IOLA 4E13A 4WTOA 5JD6A 1R10A 1U11A 4NDAA 4XWGA 3W1EA 5LCXA 1SIOA 4QC2A 5H83A 4H1HA 1GADO 1K1EA 2ZVJA 5DHSA 5AKZA 5A3RA 3TTWA 2QAGB 4B6SA 4I1RA 4JAVC 4P53A 1ONPA 4D4MA 4Z1MA 2V6IA 1CK4A 2C2YA 1WXEA 1D2EA 4MZDA 4O4JA 3WR5A 1LK7A 1ZGJA 5EFZA 4ZMSA 3U7RA 1E4OA 3ZJVA 2HPZA 4DB2A 1NZJA 1SO8A 3BGVA 1RCFA 1JAHA 3MWJA 3MJVA 2GO1A 4QYMA 4R6XA 4ZK2A 4XCVA 4C03A 4J0DA 3L1IA 4ZVRA 3JZMA 1CUWA 1JMVA 2CLFB 3CPJB 2Q50A 3I12A 2OILA 3KKPA 3B2NA 4QJ4A 5I7AA 2PYIA 1CJSA 3TLYA 3REGA 1U0NA 3DD1A 5KX5B 1E79D 1H1LA 2PUCA 3C16C 1QGZA 1B93A 3HZRA 1WTCA 3TNFA 2IU6A 2RI1A 2NUAA 3DL4A 3FGNA 4DLYA 1HDCA 5CMLA 1TCBA 1EVQA 3B6JA 3NKVA 1EBFA 1AV7A 4LXTA 5E9JA 2PCLA 5EYPB 4HWPA 2WSLA 2R47A 2HW8A 1X87A 1U1IA 4FFDA 1R88A 2AOWA 2Z8YM 3AUAA 3NHWA 4LE0A 2Y1DA 2N9UA 4FFWA 4MYDA 5AI9A 3O8RA 3ETLA 2VI5A 4OXRA 1Z6XA 3TEFA 5HM8A 3WKDA 2WKQA 3VHQA 1KI3A 4L27A 1PZNA 4YECA 2PJUA 3QSGA 3PEWA 3W3ZB 4ERNA 3KEQA 2RAUA 1R0LA 2VAVA 1Y4UA 2E4WA 1REQB 2XJ9A 3SIXA 3ZDDA 1DE0A 1A3CA 1CCWA 4GYWA 3DBIA 2FZ5A 3PLNA 4CNQA 3ZWYA 3GFGA 1ULBA 1P1FA 1TTQB 2QTRA 3EXHB 3MTIA 3X1ZA 7YASA 1CDOA 4XXHA 4AJOA 1AZWA 1VSUA 3BL8A 4CODB 4KPEC 3D1JA 3JQ8B 4FFOA 3CO5A 2XRZA 3BIFA 5CXQA 3NNNA 4CMGA 1N2ZA 1Q7RA 1VL8A 3SP1A 1RKVA 1MV8A 2CMDA 3QUTA 5TMPA 2BJHA 5JYDA 1ZX1A 4OGKA 2YR0A 3RARA 1JPNA 2X77A 2I2AA 4IIJA 1VHTA 3MWFA 1UKYA 3L0BA 3VRHA 4C14A 3BRWD 4UHBA 1RKUA 3DTVD 2G0TA 3SS8A 4F85A 3A1NA 4TTPA 1E4EB 5AVRA 1AUXA 3LHIA 1WXDA 3SDZA 1GYRA 2YVAA 2EJCA 3PHCA 3UMGA 4EPTA 1CIJA 1XLWA 1VYUA 2XQIA 5DEIA 2ANBA 2CYAA 4QBIA 5ULLA 5KQGA 1HTBA 4JCOA 4K1LA 4MMYB 1YRLA 2ZRNA 1FYFA 5FWNA 1Z63A 1J20A 3NB0A 1FXWF 3VYWA 3KOYA 1XEAA 2C78A 2PUHA 3KO8A 3LI2A 3WNQA 4Z9XA 3M81A 4C4PA 4E94A 4H16A 4GOOD 5ANRB 1EBBA 2I1WA 4Y7CA 3KVRA 2O8VA 4KAAA 2GEDA 4BV8A 3HCRA 2WU0A 2R6CA 2IRWA 1TM2A 2FWIA 1NGSA 4RMJA 1C8BA 4UAUA 1OWPA 4D1YA 4FOLA 3OICA 4LV6A 1TQ4A 3ANYB 3MCZA 4MQEB 3SZUA 3KSBC 4RSMA 5ED0A 1DAIA 4EEZA 4RPCA 4EENA 1P91A 1GTSA 1BYUA 2C9OA 3AI3A 3FZEA 3IGFA 1TK9A 3OIUA 1G9XA 1W581 4MAAA 5EJIA 4DXDA 4ZDIA 4P3OA 3RROA 3TVYA 5D51S 4M1OA 3VOAA 3GVHA 3NLLA 3RGWS 4P4UA 3GLHA 3TR5A 3BS4A 1CYDA 4HFMA 2HQBA 1L8AA 3OA2A 3HI6A 5MGBA 2OLJA 2PL3A 1OW3B 2GUGA 1TU4A 4G0NA 3OBBA 4MS4A 1T2VA 3AIMA 1ABFA 1T5BA 1YR6A 4GOLD 1E6EA 4PX5A 5CLQA 2XNKA 5EVJA 3ZCQA 1Y1KE 1BW9A 1R4NB 3KKNA 3STYA 4DVGA 4ZGBA 2R8RA 2J7PA 4XYEA 2JFYA 5DYYA 1PGPA 2IYFA 2FI1A 4R1NA 5IBRA 3ZW9A 2DH6A 2ZJBA 4OBXA 3GEIA 1FTSA 2BGRA 3N2GB 4R0NA 3NG1A 3U3RA 4C0AC 2AQIA 4JELA 2NUPA 4FFVA 1M8JA 2AE2A 2HCBA 3AU9A 2PTGA 2I3DA 4YX9A 1RWWA 4IFTA 4I55A 4J7CA 1L8OA 2DCUA 3BZBA 4RCYA 5JHHB 1Y4SA 2Q5JA 4IIJB 4X71A 1Y4ZA 1XN4A 2LBPA 2RARA 4ZOLF 4YRIA 4QYXA 4TTVA 4BTLA 1A71A 3O0DA 3P7MA 3O7WA 1AQ6A 1RHRA 3GEPA 4I4IA 1KI6A 1M1XB 1L9XA 4J1QA 4M1MA 3TZKA 1FVXA 1S1CA 3Q10A 4X1OA 2PMFA 3LV8A 3EXHA 4L5JA 4MIEA 1JE1A 5DV9A 5DM70 1RYMA 1AC5A 5K8JB 5LP6B 2QN8A 3GUZA 3TSZA 5K2OA 4ENPA 4G5SA 2WP0A 5C2JB 3HSYA 1VOTA 1YA4A 1K97A 5PGMA 3ZU5A 5IJZA 3O91A 1ZL0A 4BC1A 4O4JF 1B0AA 1UFVA 2GTPA 1ZJYA 4NAVA 1AKYA 4EKYA 4TRJA 4H2DA 1S3IA 3MS4A 1EJ0A 3MJHA 3OMXA 5BW4A 3E70C 1EZ4A 4NESA 1MDBA 4ZTZB 3G0IA 4UASA 1OPRA 1P33A 2PL9A 4FGZA 4Z9BA 1TA4A 2ZTLA 3KT3A 1B76A 4JB2A 3G6WA 4GT1A 2WYOA 3PSHA 4ISCA 3CT4A 2RCNA 3K0CC 4IZIA 3CY6A 2VQFB 1W96A 1A77A 2ZDQA 4UBNA 3N07A 1NIJA 2ZRJA 3JVVA 3HPQA 2XUIA 1JIKA 2EIXA 3IUJA 4UEQA 5G4KA 3X1XA 4XDGA 1XAGA 5C5DA 5A2QA 1FFHA 3W6OA 4L1KA 4DJTA 1FB5A 3IA7A 4R6WA 3KETA 1ADYA 1PX2A 4LXHA 4F9EA 1HA3A 4EB6A 4QDOA 3MNFA 3DBVO 4FW8A 5HS4A 4MQFA 3PC2A 1JU3A 4PYLA 3C8HA 2J3HA 3UBMA 1BJTA 4NLLA 3H5LA 2Y9PB 3VOSA 1ZU5A 5AH0A 1U9IC 4W8GA 3LU1A 4UDYX 5K0SA 1L2TA 2AYZA 3TLXA 3W2EA 2NU7B 2MTBA 4DWVA 3V7FA 2P4QA 3T7SA 4QUHA 2IHKA 4HFRA 4EGJA 1YRYE 2HRBA 3IB6A 3RAGA 5A9SA 1OZHA 1Z2AA 2PRJA 4IH4A 4BXOB 3PQ7A 1EFVB 4RAOA 3KQLA 3KKZA 2P9ZA 1EGHA 1JFVA 4Q3NA 5HK9A 5EKTA 3ICVA 1MR3F 1Y9DA 4QUDA 5TNXA 4F91B 3PXUA 4ZFNA 1I3KA 2R1VA 3Q3CA 4MGEA 4TQUS 5A5DA 1AQJA 2AZ4A 4IDPA 4ND7A 1N33B 1ZZEA 1N57A 2FRXA 3ONNA 1G2OA 5TVKA 1J0AA 1JH9A 1SKYB 2DPYA 2C0CA 4GP7A 4U2EA 2GCNA 2M9MA 3S2ZA 1DKPA 3B1JA 1UC8A 4F96A 5BWLA 2NMVA 1RYBA 1W2WB 3CZ5A 4ZVOA 3O2JA 2OB2A 1R1DA 3P5BA 4ZVLA 1LI5A 1N34B 1EA7A 4KQKA 1QLWA 1E1LA 2YXDA 5F51A 4IGFA 4J16C 4E22A 1Q12A 2BLNA 4D5EA 3RKRA 4ZN6A 4HVAA 3P4XA 1SXJC 2GJAA 2UZ1B 2JA2A 2F90A 3QELA 3V8VA 2XTZA 2C2GA 2WV7A 1G8AA 1WDLA 1OT3A 3QFCA 4LZAA 3VJMA 4AF8A 5AVTA 1TUBB 4M4SA 4BC0A 4PHHA 3EW9A 2GA8A 1JF8A 3OCXA 5JFTA 4FX5A 5EP1A 1LPAB 3SKYA 1YKFA 5AXAA 4GP9A 3Q3GE 2H5JA 5DLQC 5TT0A 1JW9B 5A3VA 2ZUEA 4ADSG 1FUYB 3E48A 5IDWA 3TOZA 4DMLA 1CQIB 5L53A 4BNWA 4C0WA 4HXEB 1Y42X 5GZ3A 3FXAA 1PQPA 2VWQA 3KB6A 4Y6RA 4UAGA 4PG6A 3B6IA 4B47A 5K3DA 1HOTA 1QRDA 1JQAA 4ZYZA 3FROA 4QJIA 3PE6A 4W5OA 2O48X 3PHBE 1RQXA 4ZMRA 2GPBA 1P9RA 4NCJA 2AOVA 1UF9A 1BDIA 1NOIA 4EJSB 1NBMA 1DG9A 2C2HA 4L02A 1JWBB 3RIHA 1MAVA 3YASA 4C20A 4IUYA 2UUCB 1OVGA 1TLLA 1Q91A 2O52A 4NRDA 1K89A 3ND9A 5BN5A 1I9CA 2QVGA 1P9WA 1YUNA 3GHYA 3HB4X 1RXWA 5T4EA 4GO1A 1DLIA 1M0EA 3WGOA 2BKUA 2X0DA 3AUSA 3H42B 3OO0A 3IIIA 1DDIA 3LUJA 5EIAA 3ICWA 3I6ZA 3EVFA 3FAKA 4MV8A 1FJGB 5E8RA 4B6FA 4DCVA 4DRXB 1Z82A 2Q5OA 5EIEA 1D0IA 1XAIA 4WBNA 3MUFA 4UFOA 4BQIA 3B9QA 1L5MA 3DAGA 1GWNA 3CPSA 1Z33A 5CURA 2PS9A 4UUBA 2C3UA 4LFCB 5JZMA 2RFLA 1ORHA 1IUNA 1HOXA 3HYNA 4LPKA 5CLIA 1KRHA 4HNVA 5KTRA 4H18A 3ZD8A 3RVOA 4CF3A 2QTZA 4CMCA 3LC1O 1EGAA 1V95A 4QYSA 4BLWA 5ER6A 1X2EA 2B5OA 4MS1B 4QPDA 5C46F 1EFHA 1RRMA 5GM1A 4XKJA 3LY7A 3DPIA 2XVAA 4G63A 3JD3A 1QIGA 2A1IA 4IJVA 1IHDA 4JB8A 2P3SA 5BN1A 2R8YA 1KO7A 1DT5A 1BQEA 2PSHA 4QG3A 4UREA 5IUJC 2P9CA 4RPIA 4TS9A 3ZI7A 4IHAA 2XIJA 5DNEA 5FBHA 3S2YA 4FHCA 5CB4A 1U7WA 2XGOA 5AVYA 4WX2B 4WCFA 2BGJA 3KZKA 2OAP1 3HYSA 2NACA 4IZ6A 2AX3A 2NO5A 4O3FA 4ZOBA 1Q57A 4KH0A 5CA1A 2JI9A 4ALJA 2IPLA 1QWSA 3ADOA 1NL3A 1Z0UA 3MBIA 4M1KA 4EF5A 5L45A 3BFVA 1BE8A 3WYDA 4IF4A 1FQJA 3I6YA 1J22A 2NP6A 3TQOA 4R0MA 1UADA 2AR0A 4ECAA 1Q0TA 4LF6B 4K9LA 2AFIB 3WDKA 3T5MA 1BD4A 3JATA 4KQ2A 1YI0A 5JV5A 1C1DA 3ETJA 2HLDD 2RKWA 3D3WA 4FN4A 3TD2A 5FNVB 3GGJA 1C30B 3FLEA 3THXA 4Q0MA 2PSEA 1L5HB 4UTOA 2PEYA 2BTQB 2J87A 4Q4AB 2Q8NA 3GAAA 5AICA 2SCUA 1TMKA 4GH5A 4Q05A 4WAUA 3V8PA 5H5JA 3X44A 4CR8A 2REBA 1KP9A 1U7UA 1U2SA 3E23A 1G5IA 3A0UA 3EH2A 3PFNA 4JX8A 3T99A 1JJAA 5I7RA 4JJIA 3PC6A 4Q3DA 5H9VA 1P60A 2BGLA 1E1CB 2GPAA 5F9FA 1C1XB 2JLZA 2FMTA 4GS5A 1VL0A 3FFBA 4MUNA 1D7AA 4CUKA 2ZZMA 3CR7A 4IHKA 4NE7A 1V35A 3K5HA 3U37A 3QKRA 1AMOA 2XY4A 4YRBA 1H2EA 2BSAA 4LZNA 3T52A 1I30A 4UPVA 1JDZA 4ZVKA 2A78A 3UV3A 1FMTA 4WK6A 2VXOA 3JD2A 3L5OA 4IJWA 2QUHA 4KWCA 4EITA 1ZI9A 1UBLS 3DFUA 3L9WA 3DUWA 4Y2XA 5K09A 2BDUA 3UAWA 3WRYC 4YJFA 4F9TA 2YTZA 3RC8A 1RHJA 3NDIA 4FEGA 5GGXA 4D6XA 3M4NA 1MLDA 5G1PA 1FX0A 3BD7A 4EBBA 1GL3A 2NZYA 4PHCA 3QHQA 4EIWA 2O6HA 1K7SN 4O1MA 3TAXA 1GDDA 3QEMB 1N32B 4LGMA 2YZMA 3WP1B 3VI3B 1GSOA 4AJPA 4EY6A 3D81A 5BR4A 2QPTA 1Z56C 1AQLA 1ZNYA 3UF0A 1RQGA 4NU0A 1QQ5A 1YDGA 1JR3E 4P3KA 2PKYX 2D1SA 2ZAOA 2FR8A 4NCIA 4C04A 4EFLA 4NH0A 1VA4A 2CSXA 4N18A 3UAVA 3QBEA 4TV9A 5AW8A 2R86A 5KOIA 3PDCA 2BHRA 4L4RA 5J4KA 4BZWA 1NR7A 4NSNA 4DIEA 4TN5A 2WUWE 2IXBA 5DBHX 5CFQA 4JKIA 5D1HA 1O2DA 4CM4B 5FJIA 4GZLA 3KZCA 1PNRA 3GC6A 3IEIA 4OUDB 4HUQB 4LDQA 4ZAGA 4RA6B 1BW9B 2I7DA 1E9SA 1VYVA 1SXJB 2QXTA 4I4TB 4IILA 4IWNA 4KQFA 4M76B 4PQRA 1YHZA 1EQAA 2Y1FA 3SSAA 3RI3A 3WQBA 2WFAA 3U3OA 4DNFA 6ADHA 2QT1A 3EUEA 1P2SA 3UUFA 1NI5A 1XN1A 4AC9A 3IAM6 3VHRA 4CM6A 4C7XA 4J07A 3FVQA 5TE9A 4EHAA 3K9FC 3KTFA 3QUAA 3PIRA 4HXGA 1ADGA 1NC3A 3LYAA 4MIKA 3DHVA 4ND4A 4FGSA 3ZGNA 2JLVA 2BL4A 4BDSA 4MQ4A 1E0AA 2H59A 3EGCA 4CWAA 2VRCA 2I2WA 1OFHA 4U8HA 3PJRA 2FW9A 1IY2A 3P45A 5EPEA 1IUKA 4KQXA 4RVDA 1T9GR 4XVHA 1I36A 4F38A 1TNDA 2PV7A 2DPXA 3B13B 1KO8A 3R41A 5A4DA 2LZ0A 2C8KA 4ZDJA 2IYVA 2PBRA 2IPXA 3ORYA 4ENTA 5F2NA 3FLMA 3DE1X 4ZYLA 3TF5A 2DFPA 2B94A 3D0OA 5FOWA 4JYZA 5I9IA 4RLFA 4CM4A 1L4LA 1NJ1A 3AOEC 1KJIA 4MVCA 4HDOB 2O8FA 4X8OA 3KWMA 3RDPA 1FP1D 1U0GA 3UAGA 3NC4A 2H2IA 3OT1B 2WHPA 2BGNA 4GGOA 5ALUA 4CE6A 3UJ8A 4EHDA 5KOJA 3M70A 2RGUA 4N7RA 1UEXC 2H0AA 1MC5A 2W93A 1PGQA 1XMVA 2XGGA 3DE2X 3NPAA 3GJ0A 1W49A 4NDZA 2UVDA 1A9SA 1J00A 3MQ4A 4P08A 3EGWA 4TMZA 4AY5A 2OZVA 4TWRA 5DBIA 1PT7A 3WG9A 4BMVA 4E0BA 3KNZA 4FKZA 4RCVA 1TZKA 2E4VA 1QG6A 5CDFE 4JYCA 3PTLA 4IIFA 3LT0A 2Q29A 3NFYA 3ESZA 2Y76A 1QH0A 2DBQA 3K1YA 2ZAYA 1S9DA 1N5MA 3K2EA 3HCWA 1WD7A 3GQBB 3HZHA 1IG3A 1C14A 5D7NA 2HV9A 3MD0A 1FP7A 3PEUA 4YQZA 4PC1A 4AP6A 2VRWA 2RBEA 1ZEJA 3HJGA 4XWYA 2VBFA 2OCPA 4CQNA 2YWGA 1LPMA 3F8SA 2O0JA 4N3AA 3J80A 3BB1A 4UAJA 1OFUX 3AOGA 3OM0A 1G21E 4HLQB 5AOVA 3O3MB 2R1UA 5H3CA 3ZDQA 8AT1A 1L5QA 2BR3A 3NTUA 3OT5A 1BWQA 1OU4A 1S3SA 4GOJA 5TPZD 2JAUA 1YFLA 3Q5EA 1XRJA 3PL5A 5CTJA 2YRXA 1CR6A 1RYFA 3V8EA 1M83A 2NZXA 3V7WA 3GN2A 5LOVF 4Y6PA 2X4GA 4RTLA 2IYRA 2F62A 1QBKC 3OQJA 4IW3B 1KWKA 2OM6A 3FPEA 1BEUB 4N0EA 1CUYA 4LMBA 4RUKA 1YNOA 3EEFA 4FJ1A 4RDIA 4EA9A 2HC9A 2LW7A 4FDLA 4QKQA 4NX2A 1OROA 2IPOA 4FGWA 2HYIC 1C30A 3W90A 1Z4IA 1E3JA 1WB5A 4ZKDA 3STTA 1F4VA 3GVIA 4HWRA 1DAFA 4D0LB 1ODIA 2BN4A 3QV1A 4O2BA 4QD3A 1IHOA 2ZTMA 2C5AA 4DDTA 5L40A 5J1SB 5FNVF 2BR5A 4UUAA 4XDHA 2IUSA 4TKVB 3VU9A 4U4AA 3OOHA 4NBKA 1H9BA 4L07A 4OY3A 4KR3A 5CCEA 2JIDA 3AY3A 2D00A 1YBMA 4PG8A 4X90A 4CM1A 5JARA 5JNTA 3KBOA 4XUCA 2J45A 2I67A 3DDZX 3T1HB 2IUFA 1IZ7A 4HB2A 4LCEA 3GV0A 4EDFA 1KEKA 2QUAA 2ON6A 4EEXA 4GRDA 4LFAB 1GPH1 1P7PA 1T43A 1PGJA 4L8YA 4U7DA 4QOIA 3BBPA 5KO2A 1R8JA 2WK1A 2IHVA 3CX7A 3ONDA 1YQDA 5G0SA 4NR0A 4E5PA 4ITVA 4HDMA 1F8XA 1KYYA 1VI2A 2EBFX 3RSGA 4GL2A 1EFRD 4ZCPA 3DEJA 9MHTA 1GQOA 5CXXA 2AJDA 1I7PA 1BYIA 1USWA 1C41A 2OCAA 8GPBA 4PTYA 1UPFA 2I5PO 3NWJA 5DBOA 4C0KA 4CRWB 3CUYA 1OI4A 3RYCA 1PVOA 4ACAA 3K5IA 3WBJA 4CTNA 2J9FB 1Z35A 2NO4A 1YR1A 3Q0IA 1JIXA 1RAEA 3KSUA 3N2ZB 4MPRA 4TMWA 1XMQB 3Q9NA 4R71A 2O7RA 1P0CA 4KVGA 4DIFA 3PFCA 1PDOA 4ZCQA 1R9JA 1GU1A 1E7MA 4KXYA 3RT1A 4G0UA 4HFNA 5SYAA 4JEUA 1YMVA 2TYSB 2VDVE 4QUJA 4E1VA 4RD3A 2IOHA 3N76A 2CFSA 3BE8A 3LCVB 2C5EA 3OZCA 5CCXA 1N2HA 2VHUA 3MRSA 1IWBB 3G0GA 2W6QA 3TWOA 4F1JA 1J5EB 1PFGA 4F5YA 1ZFNA 4UVDA 5FNZA 1MX1A 3SIWA 1T2CA 3EWSA 4UUQA 2BEUA 2G4CA 4JUIA 4F3CA 4N7MA 4LRTB 1FUKA 1PJLA 1XA3A 1ACJA 3GLKA 2Z2IA 4QVKA 5IJWA 4AY3A 4CHGA 4H3HB 2DXIA 4LYEA 4IMIB 5CFRA 3GMIA 1D2CA 4OO3A 1IXKA 3GEGA 4N47A 1X19A 4P7GA 2E18A 5IMBA 3DDUA 4L4ZA 3Q7EA 1J1IA 2ZRIA 5AM3A 5EKDA 1XTJA 1JR3D 2CNBA 1LTHR 1RZUA 5F73A 1O4WA 1P7YA 2I4RA 1QZZA 3BE4A 4Y9RA 2F4VB 4U7GA 1Q7BA 1F4LA 2GD1O 1J0BA 3I01A 3Q15C 2A0FA 4ENQA 4RJTA 1W29A 1LV7A 2ODAA 2XYQA 3GIWA 4K1XA 5NLLA 4JI1B 1L6IA 1F51E 3RBAA 3WVNA 1YVUA 4EG1A 4PAWA 1KMMA 2I6GA 3LT4A 1WUYA 2JCYA 2ZG6A 3R6WA 3AHDA 1DPGA 5A4IS 2EU8A 3HFGA 4JKYA 1BDMA 3CJTA 3NETA 1X15A 1HI9A 3A4MA 2KWIA 3SI7A 4U3JA 2V55B 1FQWA 5IPFA 2H5LA 4LZPA 5C5CA 2MSWA 3GPBA 3IMCA 3OC0A 4YASA 5ICSA 2O54A 3HO1A 1G4UR 1HQCA 3WXMA 2HU2A 1WSAA 1HNZB 1PYGA 3QE4A 1TZ2A 1NXXA 3IPYA 3QVVA 3B3QA 1S9HA 1SBTA 3KOMA 4P84A 1HQKA 1WCV1 2ZBPA 1LXCA 5DRYA 3F2VA 1AK2A 3U7GA 4LQDA 4NKRA 1IRIA 2VT2A 1SZDA 4OQMA 3FOZA 2XCIA 3DQZA 3TD9A 4M7PA 4IIGA 4CN8A 2GM3A 2J6IA 3GY0A 1CLEA 3G5UA 2VZ0A 4OGLA 2PJZA 3W2GA 2WY2D 3SEAA 3LWNA 4Z2AA 1D9ZA 1ND5A 1XZHA 2M1XA 1YOVA 3SPXA 4BNKA 4DCCA 3T7EA 4CLRB 3MELA 3CW9A 4RTKA 3DXZA 2JVIA 4JP1A 1FMLA 1U2DC 2MYPA 1QMPA 3DVAB 1ODKA 4LEIA 2Q5FA 4JBYA 3P9YA 5DHAA 4G4JA 4EG5A 1K4YA 4MMZB 3TJZA 5B1EA 5EJ4A 3TUJC 1JDSA 4EOGA 2VG8A 1IE3A 3EDOA 2FWBA 4U39A 1U63A 1U7XA 2EG9A 2Z2ZA 3H05A 2QYOA 1N2SA 5J43A 3M2TA 1YK1A 1CF9A 1DVRA 1XDUA 3WGMA 4DE5A 1EGQA 1W47A 3L02A 5EMNA 1MHTA 1IK6A 4OK5A 4HUTA 2OM2A 1U2ZA 1G8MA 2W6MA 3D2CA 2ZTVA 1PP4A 1UBRS 3MTEA 4RIGA 2IYQA 1U8TA 4R8VA 1JAYA 3VZCA 4RGYA 4AJEA 5B4UA 3MGKA 1W7AA 1AGNA 3LHFA 1Y6JA 1HURA 5ARCA 2IHNA 2B69A 2PUAA 1R0YA 5AVOA 3WS7A 1IBLB 4UPDA 3BTUA 4MVJI 2Y0EA 3RWMB 2QV0A 3WNDA 4EFKA 5M04A 1ESCA 1RMYA 2J0UA 3O31A 2AGVA 2V6BA 2QMUA 3DNPA 3X2FA 2RGRA 4D3DA 1NMZA 1CY1A 3LUCA 1N1MA 3OCVA 4M0MA 4PE5B 4BX8A 4DCNA 1N0WA 1XD9A 3F96A 2J32A 3SN6A 1QM5A 2WKSA 2GBIA 4EDHA 3D7MA 2F8TA 3W78A 2JI7A 3I8XA 3WLOA 1KC3A 2VDQB 2OZLA 3H2HA 3NM6B 3RJTA 4OKSA 3I0ZA 5EFOA 2IUEA 2BTEA 4BBAA 2ZJZA 4PQEA 5KTSA 4RNDB 1NXPA 3ICOA 5D00A 2ZVPX 4HUJA 4IWXA 2A4MA 1GNLA 1Q92A 2XYVA 1WOMA 3G9ZA 1R6UA 4JKOA 4J3JA 4XOIA 2EKQA 1XP8A 1XZ8A 1ELOA 1H3NA 1PS8A 3BJMA 3IDQA 3MWEB 2B7CA 3NAMA 3OE5A 3AG5A 3TZ6A 3CONA 3OTQA 5IULC 4FHDA 1K8QA 5EN4A 2WF8A 2C9ZA 3C5VA 3EPPA 3VBCA 1Q50A 1R8SA 3OLWA 3L6OO 4RGBA 1P5FA 1T15A 4ZPJA 4TQGA 1NVVR 1NVBA 3R7LA 3RHFA 3LCUA 4QDXA 5K03A 1BVRA 1L5NA 4CG3A 1ZI6A 3R9WA 1U6KA 2QWXA 3E5RA 4D9IA 3E81A 5L3SB 2J0QA 4EHJA 2W4IA 3TMYA 3UJAA 3A06A 3GGOA 1QR6A 3IKJA 3T4XA 4PBSA 2AFRA 2HY7A 4KXXA 1F0YA 4EQ6B 4LSWA 3UH1A 1TAUA 2LXNA 4P4SA 2GF9A 3FIJA 2BGKA 1ZY2A 4TVBA 3W7AA 4LCBA 2QGFA 1OJ7A 3GUCA 3K1JA 4JLWA 4JR0A 2FG7C 2Z5FA 1P2TA 3AVPA 2G71A 1AXGA 3DMGA 3CZMA 4KXQA 3W8EA 1ESDA 4CQMA 1PK7A 3OIVA 2AD5A 1OH7A 1K4KA 3CF0A 2DWPA 1IXZA 4WBSA 2FPIB 2IH5A 1WCXA 3W5IA 3M4YA 2Q99A 1O6FA 4LBYA 4C4RA 5ELXA 2QRZA 1KZGB 1Z25A 1MZVA 3UVEA 2C7PA 1BS2A 3ILHA 4RDHA 3GLVA 3DDHA 4URHA 5FWAA 3NHLA 4W7SA 2F3RA 2NTJA 3CKYA 1V8FA 1F48A 2BHNA 2BMFA 2YZKA 4LXGA 3IUBA 2VNJA 1K9SA 3FYUB 1ZGZA 1X74A 3N6VA 4NMMA 3UAZA 3UNXA 3WAKA 2DFTA 1BXRB 4FDUA 1EQ2A 3Q8KA 1GPYA 3I0MA 2I3AA 2O8BB 1JSRA 4AZSA 1CJUC 2IIQA 1NFRA 4E2XA 4NV1A 4PGAA 4LNAA 1IHXA 1WDMA 2RGCA 3WZ2A 2PA3A 3IEKA 5FPHA 3MOSA 4Q1FA 1R0XA 4RXMA 5ESWA 5D3ZA 1JTFA 3O3NB 4ZI5A 2BISA 3ZGZA 2R8OA 5DZSA 4NMWA 4DSAA 3PHIA 1NOKA 3O4VA 3ZNOA 4ARCA 2PZ8A 3TLMA 1CY2A 4C22A 3ZQ6A 1J2EA 2I8AA 3RVJA 1IZYA 4GM4A 5CBKA 2ORVA 1ZEMA 4J3FA 5IK2D 2NN3C 5IJ0B 2WJAA 1CEXA 1N3LA 1O4VA 2XNHA 4HFJA 3MJCA 4C7VA 4LSMA 4FI3F 2XZPA 3FHJA 1E62A 2CMGA 3HP1A 4ARUA 1U3DA 4E46A 3HY3A 4F9FA 1GA1A 2O8EB 3IOYA 3N6XA 4CMKA 1K66A 2WKWA 1A04A 3EIQA 3RVDA 4KI0A 4B33A 4D8XA 3ZVLA 1RWOA 1OC4A 5EQDA 4OMFG 1LBEA 1LNQA 1HT0A 5K8CA 2YMQA 1QIEA 1JE0A 4CIYA 2QSJA 1NQTA 4JHLA 1BNCA 1D9XA 4RFSA 1M1NB 2JF0A 3BCSA 4WZAE 7MHTA 5MF6A 3I72A 2DR3A 5GAJA 5T6BA 1HK7A 3MWDA 3HL4A 4AMUA 2JLXA 1FDSA 3SG0A 1LVGA 2HWWA 4CMEA 3PFBA 5D86A 4W9RA 2PKXA 3TTSA 1Z6QA 5GINE 2CY0A 2RHJA 2ZCVA 4QDUA 2JLBA 3NIGB 1AG9A 1N6HA 1NLZA 3ROQA 1KDZA 1JEQB 4FC7A 4IJUA 1JHRA 1OX5A 4P83A 4IFEA 1ISIA 1VE9A 2PT6A 2QUZA 2QY6A 1FFDA 2FPGB 4H7PA 4NYIR 4OI2A 2HHHB 1GO2A 3D3NA 1KDRA 4L72A 4JH0A 1A96A 4QGBA 3I2HA 2A5DA 3KAJA 3BC1A 3AUYA 4P38A 5E1DA 3RG8A 2AQHA 5C8YF 5U4QA 4LJRA 2WE8A 2QR5A 1KQOA 1OBCA 1UKEA 3IKLA 2YMLA 4F5DA 1YVDA 3R4VA 2F8LA 4FD2A 5BSMA 2RGWA 3QPAA 2PYZA 4N82A 4PPQA 2H1LA 1WXXA 2W8ZA 4WERA 4Z54A 4TSFA 2JA1A 3HCFA 1IN5A 2Z3ZA 3RUIA 1SZPA 1XQ9A 1WA5A 3Q6NA 4GX1A 2GUWA 3VU8A 3RS3A 1YQWA 1D0VA 4L08A 2WJ3A 1UFRA 2DT8A 3L0PA 5D2CA 3W77A 4PFQA 3ZNNA 4IMJB 4EBFA 3FPSA 1V1RA 5AHKA 2XMCA 3E7DA 5LWQA 4Z53A 4CIVA 3K8YA 1QK3A 3FMGA 3GUUA 1B8PA 4I55F 4LYJA 5J5AA 1NSYA 4V0ME 3LQ4A 3R2JA 1JHMA 1GZ5A 4YAGA 3B1XA 2ZE8A 4Q6BA 2B8WA 3LS2A 4ND2A 5CYGA 2WJYA 4RSRA 4WFJA 3U7QA 3DLCA 4MKRA 3V9PA 3GLIE 1VL5A 1PT9A 1ZN2A 4YRNA 5CBPA 3HRHA 5K0CA 3ZE6A 1RU3A 4QUKA 2Q1SA 4R7GA 4PC6A 2GN6A 3IUEA 2ZRMA 3T3OA 4UDNA 2O3TA 5TX7A 5TEWA 1SZJG 3LUKA 1FDWA 4KU4A 3NNDA 2BJVA 4Z5XA 3CW8X 1UBEA 2A94A 1N92A 2ZPTX 3N59A 5F7XA 5IKXA 1E77A 1JDPA 5ECDA 3SJAA 1KRXA 1EDDA 3OI7A 1IZ9A 4P7JA 4TXJA 4ZIRA 2W8BA 3S5UA 1G60A 4LK2A 4YO8A 4AXXA 4QATA 2GEFA 3D8TA 4FFSA 4JR2A 2R8EA 3P0EA 3TXXA 1NPTO 1O95A 2X8AA 4P4LA 4Z4IA 2G76A 3VPGA 4PCAA 4QM7A 3HN2A 1Z5OA 5IBQA 1WM1A 5H81A 3M6LA 2QTAA 5FPTA 1IMJA 5HQJA 4EJ6A 3PUZA 3OFKA 4B3RB 3KJXA 4DCTA 3O4RA 1AKRA 4P33A 3WDSA 1CD5A 1L7VC 2OORA 4DIMA 3PDWA 4OIMA 2QJFA 3ABIA 1ZS9A 1IU9A 3CX4A 4P7FA 3DDNA 2F9LA 4WXYB 4MWDA 1WSWA 1KZ9A 4FE3A 1RE0A 1QUFA 3ROMA 4DR6B 5JRDS 4FBLA 4X1IB 1AE1A 1GG5A 1GSAA 1L7XA 1KJJA 2YN2A 5FA8A 4D42A 2NXJA 1QX4A 1YA8A 1TM7E 2G88A 2ZDGA 4EI7A 1VYHA 3OE7D 2OQRA 4LXXA 3V55A 1XTSA 3AERA 4Q15A 1H0HA 3OZGA 1U4OA 4GBED 4RVSA 1TQ2A 3TBHA 3DEAA 1FFBA 2VP9A 1GQRA 2IZ0A 2OPBA 3CPHA 3W4IA 5FWXA 2VRCD 5BNWA 3FTFA 4JI2B 4G5RA 1O96B 5FBVB 3IIJA 1ECJA 1KDPA 3COVA 3DZHA 3JD4A 3KVVA 1DP4A 1RP1A 2R2GA 3RW9A 4AK9A 4OV6B 1LQTA 3L41A 3RHTA 2XOEA 1EWTA 4L85A 3W7VA 1KPHA 2A9FA 1QU2A 1APBA 3NAGA 3O2QB 2VK2A 4BB0A 3EXIA 2YIVX 4U02A 2CUKA 1MFPA 3U16A 4YIHA 2CXTA 1VFNA 5DXAA 2BDTA 2DJ5A 3H2ZA 5FYDA 3T3DA 3G1UA 1LDMA 2IX3A 1ZOLA 3JQQA 3NIDB 2V7EA 2P2LA 4Q9NA 5DTJA 4ZVUA 1K5PA 3HB7A 4TV8B 3UFBA 4YT2A 2BMEA 3L7JA 3NTLA 3PDJA 3PX3A 3FTEA 3IEUA 3S0JA 5HKOA 3VHXA 2TMKA 1O6GA 2ZU6A 2JCSA 2Q4RA 2BEWA 3TCXB 1T6NA 1E6LA 1QAOA 3R7AA 3GAMA 2JH3A 1T2NA 2IYZA 2NXWA 5ENDA 5EMJA 3S40A 4X65B 3F2IA 2Q2QA 3JSXA 1WLSA 4NICA 2PMBA 1EWRA 2ACEA 2GFQA 2JC3A 3I37X 3QU5A 3LC0A 1COWD 1NQOA 2CE2X 1ISMA 2RG1A 3KKKA 4YJ2A 1KIMA 3JS5A 4EVRA 3FNGA 3VYUB 2I99A 4A5SA 1X6VA 3AKEA 2CW5A 2ZKLA 4WKBA 4Y1FA 3CLRD 4OHZA 4BO8A 2WTNA 4MR8A 1XLTA 3ZZ1A 4CIBA 3RBXA 2W2KA 3QVGA 3NANA 4KQWA 3TQTA 3BCUA 4OQXA 4PZZA 2HA7A 4K6OA 1ZO8A 3GK3A 1FX0B 2PWYA 1AO0A 3OMLA 4BWVA 4FNAA 3PZRA 4BNJA 5KYNA 1VMKA 2YMMA 3BFPA 3E4CA 2DPLA 1H8HA 2BFOA 3DWEX 2QDKA 3NT4A 4J1NA 4DBLC 3MWEA 2Q2VA 2HJGA 3DOJA 1DWOA 1O9GA 2B37A 2NW6A 3Q7IA 1SOWA 2PIDA 4UW9A 9ABPA 3ZLJA 1GVNB 1ORTA 1XDBA 3OTHA 4M3NA 1E6CA 4U7JA 5DMXA 2JK0A 1MXHA 2ZT5A 4MI1A 4UHCA 3QJGA 1VXOA 1OZGA 3CH5A 4OMCA 1EFCA 3I5YA 1RRGA 4FYXA 4WXHA 4B3FX 3ZV7A 4DW8A 1GEEA 5K4AA 3O3OB 1E9RA 1QDEA 2Q4BA 2X1MA 5AI4A 4ZALA 1HYBA 1VSTA 1YFZA 1QTQA 2XOKD 4H35A 4HCJA 1PR9A 1X7GA 1OWNA 2ORWA 2XBUA 3IOMA 4ONEA 3UAOA 4DA8A 4DC1A 1E3MA 4EB0A 2HDNB 4B6PA 1IYZA 2CNDA 2QVXX 4N5DA 3I6MA 2ERYA 4E08A 3TB6A 1JVSA 5A9RA 2ZVDA 1PYOA 3FWYA 2VJNA 2DBYA 1WUTA 3BRWA 1RWXA 2VPXA 4H0FA 3ZV3A 5KTKA 1XCGB 2YS7A 4XYGA 4MPTA 1FYDA 1PE0A 3JR3A 2ODPA 1GUBA 1ECPA 2QMHA 2DT5A 3CX6A 3GQVA 1SKBA 1L7OA 3O2SB 4H1UA 5JOQA 3W2HA 3IE0A 3HCOA 4J0QA 4XE5A 3F9IA 2MIIA 2ZEJA 4KIUA 1N7GA 1DXOA 1XUOA 3FCEA 2I8CA 3HM2A 5TV2A 2A59A 1Q0QA 4MW6A 3PGKA 4IXNA 1OI2A 1KH2A 2PXCA 3QQPA 3UUWA 2HR1A 4IGAA 1H0RA 4KRXA 4XVCA 1UFOA 2FG5A 4PNHA 4EF4A 2CFCA 1Y3BE 1JHPA 1AKQA 3ERCA 4X6XA 3U60B 1RAFA 5I51A 3R0QA 1VKJA 1PR5A 3KWFA 4J2OA 2RHBA 4NH4A 5HZMA 3M5CA 2VYVA 3TZCA 5CB8A 1DGQA 2Y92A 1UAGA 2BONA 4P5PA 2ERCA 3UA4A 4PLTA 4MR8B 4QSMA 4M0DA 1L8LA 2AI2A 2DKOA 3NBZC 5EWJB 1OA0A 2Q3CA 2DMRA 1BX0A 1LFAA 1RZVA 4GWLA 4LZOA 4CM9A 4X45A 2FEMA 1JLLA 3DT8A 1W87A 2EVWX 5T8KA 3VKVA 2PVPA 3K1AA 1EUQA 2Y1WA 4NBUA 3K4HA 4P3XA 3I45A 4YP6A 3BWEA 4Y9UA 2R68A 1BJKA 1XNHA 2UUOA 4IIUA 1NA5A 5AR1A 4D8WA 2XVXA 1NW4A 1X1AA 2C31A 2F1IA 3B1WA 1JS1X 4V1CB 2CLMB 3O4HA 3GCDA 4WJZA 1RXEA 2BTOA 1GKKA 2Z56A 3EGVA 3OCUA 4G6ZA 3H19A 1UFKA 4YFVA 2G5GX 2H17A 5F35A 2WB4A 4BMZA 3F3SA 3OZDA 1RCTE 1ILWA 3OZWA 4NBSA 4BLRA 3QVJA 1ZM4A 2V8OA 5B12A 4HN2A 1GGHA 2NUTB 2FDRA 2XX3A 2G9UA 3GFRA 3LPCA 4CFSA 4D0RA 5B57C 5A71A 3EXEB 4JT8A 3U9LA 1SVOA 1YAJA 4ZEWA 2ZUVA 1JFLA 4FBGA 1K3FA 5LDHA 3NS7A 2PT5A 3WSWA 1GL6A 3W6NA 3ZLTA 1T1EA 5AVZA 2F1RA 1Q11A 3T5TA 3LE8A 2X76A 5H68A 1A7AA 3B12A 3SMQA 2D4HA 1NZDA 2HU8A 3DE4X 5EKXA 2C5GA 4ZI7B 3CBGA 3EZLA 1N6RA 3LYLA 4N6OA 5LBUA 2BOVA 3B78A 4U2DA 3CSDA 3OHMA 4E2WA 4GI1A 2DTEA 2E7ZA 4XB2A 5F9HA 3C7AA 1TUBA 3U40A 1JP7A 1AS0A 1MB4A 3K7EA 5FR1A 4U6QA 1D07A 2JIPA 4LOIA 4MK4A 2B35A 1SM4A 4UTXA 4NJMB 1LNSA 4QU0A 3I73A 4A91A 4YYEA 2DE0X 5C1DA 4XIIA 4B0OA 3B7GA 4PYKA 1IN4A 1AVTA 1ZC3A 3K15A 3D3WB 1F9EA 4MW2A 4KDRA 2I3GA 1VJCA 3IERA 1USKA 4INPA 5COAA 2I55A 1IL0A 5ICMA 1W9MA 5K0GA 2AMVA 5HSGA 3OJ0A 2V7WA 2XNCA 2BV3A 1BCRB 2YN0A 3ENNA 3QKTA 3D7RA 4J0EA 4JBIA 4P86A 3QEAZ 1C7ZA 2FX5A 1U1GA 2QN7A 3LKDA 3O8CA 5IAOA 1QG2A 1Z36A 1ISPA 2O4CA 2XHEA 2ZR8A 2G72A 3LK6A 4H7HA 2X6QA 4IDNA 4BZXA 3ESBA 2HTEA 1L4GA 5BT8A 1P3DA 2XI4A 4K8RB 4OA8A 4MR7A 4LVCA 5E7MA 1WMSA 3C7KA 1VGVA 5F5XA 5KTPA 5LXTB 1HETA 2QLJA 2QXYA 2YOHA 3ZK9A 4FSXA 3AFNA 1Z6ZA 4C6HA 4PC3A 1NKSA 4BEWA 3IV6A 5AM2A 1PZFA 1P6UA 3FMIA 4MKHA 1OH5A 3AOEA 3NEAA 1E66A 1DIRA 3GT4A 4QXMA 4AKGA 1IK4A 5ALWA 4CCAA 3WL5A 3MCAA 3W6PA 2VA8A 2J3LA 3NHUA 3DA8A 4YMUA 2C4TA 2J30A 3HDYA 1FDIA 4XVQA 4AJ4A 1AH2A 5A9TA 1FFAA 1BE6A 3DWFA 5J47A 1ST3A 4KP7A 4XDYA 2ZBUA 3HBMA 2CVPA 3RVPA 4EW1A 1OASA 2IXFA 3B3FA 3DCYA 1YTLA 1IIBA 3H13A 1ZQ1A 5F4ZA 5JC1A 5HF9A 2PX5A 1D2NA 1CFZA 4YR7A 1UBOS 3ZH9B 1HYEA 3C43A 5ESXA 2WHRA 4NYMR 4C6TB 4ZI7A 4CEIA 4V3BA 2F48A 1QB7A 3EQ2A 3EQ6A 2Q21A 2A6PA 1CP2A 1L5ZA 4R31A 1BN7A 1M1YB 1E6UA 3DTVB 4AKHA 1VHWA 4ZO4A 5MFZA 4PZDA 1ECLA 1KIAA 1UXHA 2CJYA 4KR2A 3BFXA 4CTMA 4CLRA 4KRGA 2K6GA 1R5OA 3CEHA 3OFVA 3DULA 3TQQA 5F77A 4TROA 4DMMA 3GPCA 1E2LA 4Q1EA 1TCAA 2X9QA 2J46A 2V7UA 3DG9A 3RFFA 4F6RA 1ZMTA 1G6HA 2B9EA 5B1IA 4D4GA 4I6JA 4BO3A 2OP1A 2F43A 2D0DA 3BJEA 3NT2A 2A84A 2BEJA 4PLWA 1CJTC 2BFWA 3EYWA 5LOVA 3U44A 1QH8B 3EPKA 3ETHA 4N5MA 1K5GA 3G5MA 4C3UA 1N3YA 2CJPA 4CDRA 4A8JC 1ZMBA 2ZIWB 4ZTBA 5BV2P 1RM3A 2RB4A 3AR7A 4M1QA 3F4BA 1UOPA 3IVXA 5ILQA 1P2UA 1SQGA 2PSJA 3VH2A 4ZICA 2LNDA 4L9RA 2VJDA 5EZ6B 5LKRA 4N9QA 4RHUA 1J1UA 1DJQA 2ZBFA 4NATA 3QUSA 1OX4B 3K1AB 2KS6A 4X8MA 3FJYA 3DVQX 2C42A 5ESDA 5TMEA 4MQ6A 3VYRB 4DV4B 2SBTA 5FI0B 3LBAA 2WP8J 2YWCA 4P1ZA 2Y6VA 2XT6A 2WD7A 4ZHQA 3H4IA 1HDGO 1O9BA 4F3RA 3JQPA 4K0RA 4BMDA 3F46A 1DQRA 1MTOA 1N7JA 3IEXA 4OYYA 3TGPA 1BCSA 5HIJA 4RIEA 3SIPA 4B1FA 3UA3A 1LPPA 1YIOA 3ETEA 1BGXT 3KYDA 4RE5A 2IA5A 1W6UA 3I09A 1FQOA 1NSFA 3JQ6A 1EGVB 4GR4A 4KE9A 4UTRA 4KQ1A 1M75A 1DFHA 3DMTC 5E38A 1QV6A 1YRBA 1YACA 2B25A 2ODEA 2XXBA 4KGXA 4PNZA 2LCQA 1XU9A 2E55A 3NUZA 1E1NA 1E2QA 5DOVA 4QJ3A 4P4GA 2BFCA 1K7EB 1I1OA 2Q0HA 1NKTA 1VMEA 3TLEA 2IH4A 2ECQA 4I46A 1J9GA 3IR7A 1R6AA 2Q1XA 4QUIA 2AQKA 2BFBB 1NF8A 5DGIA 2VJAA 1ULHA 4LNHA 4PGFA 1Y4AE 1LWOA 1SKYE 1L6RA 2YJGA 3KELA 5HIKA 3ZHRA 3WK6A 1KH1A 3O5AA 1PEAA 1NJ8A 2WFMA 2C5HA 3DOFA 4G1VA 2NSHA 1U8XX 1EVKA 4HBZA 3DNFA 3EHDA 1Z06A 2P4HX 3DOEA 1TKRA 2P9EA 1N1EA 3FAZA 3NATA 4OLHA 5EE5B 4WZAB 2RJOA 3P94A 3K20A 1GPKA 5IJ9B 3NOOA 5HFNA 2ZIUB 5M3BA 1EJ2A 3SR3A 4CIWA 3P96A 3W5AA 1C29B 3IULA 3DHYA 3D31A 3JWHA 1SWWA 1GU0A 1X2BA 1UIMA 3KOXA 3H5NA 5E7QA 4P5EA 2JAQA 1IHYA 1XZMA 3PICA 3EFOA 4JUCA 2MSLA 5THXA 1A7JA 2R8BA 3GJSA 1N5IA 4MINA 4PO9A 4JN6B 3QPVA 3D0QA 5EXXA 1UQUA 4J91A 1TYCA 1FFEA 4MICA 4HPWA 1P4SA 5K3AA 3GJTA 4MR9A 3GMSA 3OQBA 4INAA 5ARBA 1OH8A 3PE3A 1TQDA 3EXFB 2COKA 1S3GA 3U48A 1ZUNA 1C0LA 1G9SA 1A9YA 3KJQA 3PFKA 2JEZA 2Q9BA 4MQBA 3S7ZA 3ANXA 3GG9A 3CNOA 4Q4HB 3ZKAA 1X80B 1K3UB 5AM0A 4ZV9A 4E32A 1E3IA 1BA3A 5ER9A 3U4HA 3KZOA 1M54A 4AN4A 4J76A 2FWMX 2QQGA 3IUYA 5C7OO 4HVTA 2NADA 1E5LA 2AJCA 5K6AC 4B3TB 2H9IA 4LSZA 3UJHA 1E3EA 2GN4A 3ABQB 3QVUA 2WAMA 2Z30A 3B6EA 2VR1A 1A8QA 3KHTA 1SWVA 1UJCA 2VPPA 3JQCA 1QH9A 4HDSB 4MARA 5BNIA 1UBGA 4L51A 1MVOA 3CUKA 1J70A 3LGAA 4NEHB 1RACA 4RZHA 5E6UB 5ADVA 1MORA 2GCPA 2H2GA 3F7NA 3KEOA 5C8YA 1W4RA 2FLWA 3IQIX 1EG2A 3BMQB 4MDEA 1HNWB 1DKQA 2I91A 4A8JB 4PLGA 5KTTA 4MUKA 3WNZA 1URPA 2OAQ1 3DVRX 4JB3A 4DAOA 1TYAE 3L40A 3OD1A 5K8LA 5ITWA 4EYSA 1T6ZA 3GFPA 1JX6A 1R00A 3JYQA 3U3DA 4CZ2A 4Z1OA 3K0SA 3OQ1A 3DHEA 3I6BA 5CHEA 4DLSA 2BSQA 4JXJA 1LC3A 4XYMA 5ETJA 3TIVA 5SYMA 2V7PA 5BWCA 3DW1X 1Y4DE 4NE9A 2W90A 2VHXA 4B3CA 3ZHXA 1P5RA 2Z95A 3ESXA 2NYRA 1T2AA 1E1KA 2NU8B 4OI0A 4RVHA 1Q7GA 4IDAA 4BX2A 1GCUA 3Q8XB 2V65A 2E3JA 3OF3A 1FE8A 3T0IA 1FMCA 1XRQA 3DCNA 4L7VA 2QMZA 4HX5A 4K3UA 2IYYA 1RJEA 4RD6A 3ZOKA 5DLPA 3JAMA 4XQEA 2PDAA 2E1RA 1P4RA 2PQ0A 3R5SA 4IG9A 3HCBA 1V3VA 2XWPA 3ZQJA 3WK8A 1TAHA 4HQFA 5C18A 4BX0A 3CVXA 4EZEA 4HQOA 4AECA 1L5YA 2AL7A 4NBVA 1O3YA 4DLZA 3G5AA 1MH1A 4KDFA 3ZCPA 1YOVB 4LRWA 2RAVA 2R60A 3IDFA 5EGNA 4RTNA 3ISTA 1AIPA 2D0OB 3T5DA 2XB6A 3IAHA 1B4DA 1E63A 2E4AA 5DU2A 1WNTA 5TIIA 3LX8A 2GGSA 1CRLA 2PX0A 3RASA 3TPCA 5I9NA 1DFIA 2BMDA 5T57A 1RPAA 4L3OA 2K4MA 2ZYTX 3TDNA 1F38A 4O4HB 3E9CA 3E9ZA 5FT9A 5LMZA 4Q1VA 5JEEA 3C24A 3EZYA 2EZUA 4ZJYA 1JXAA 1WX1A 4L8VA 4PIMA 2OKCA 4B2IA 1FUIA 1XU4A 3OT4A 1MO2A 1OYWA 5KOJB 1KI4A 3A1WA 3M6MD 4K81B 4LXYA 1UC4B 3FOEC 2VLBA 1PJAA 4EAAA 2XSZA 1FNCA 4TV9B 4G0MA 5KC8A 4BMCA 4NARA 2GKSA 1JPJA 1SC9A 2EHJA 2J0EA 1UDXA 2P9YA 3F4LA 4UCFA 4X93A 3R8CA 1MA3A 2ZULA 1Z5ZA 1MOQA 2AJ8A 3PB3A 3C3EA 3SNKA 4CJXA 3P52A 4FCWA 4RBNA 2DBZA 3JQAD 3Q4GA 4MUXA 3FNQA 3UK6A 2GSWA 2P2CA 5FKJA 1I9GA 4AMYA 3OLCX 2Y1XA 4RZIA 3QX9A 3WFJA 3DZJA 3OZXA 1GRCA 3QLEA 4MA0A 4RM3A 3WHKA 2P7HA 5T64A 3KD3A 2X2PA 4D44A 3VHLB 4GSLA 3RSQA 5AK0A 1NQWA 4RKEA 2XUJA 2YW9A 4LF9B 3GLRA 3V00A 1JFFA 1T4GA 3AFOA 3BZWA 2HA5A 3NGMA 3A36A 2BUBA 4BCCA 4ZP1A 3WC4A 1NU8A 2BZGA 5A03A 3LLVA 2OMEA 3QKRB 4L2IB 4JQZA 4IUBS 4RZQA 1C7FA 2PKRA 4BL5A 2OXEA 1QO0A 3LQRA 4KLAA 2VHEA 1S2IA 3IKVA 5AJWA 4QTXA 4GI7A 1QPBA 1ULSA 2HMTA 2VZLA 5BSVA 4ZANA 3E9RA 4P7BA 5DCUA 3HR4A 3R7WA 1YAHA 1GARA 1HLGA 2FJPA 1E9AA 3LO5A 4IM7A 4NZ9A 3C4QA 3WO1A 5IT9A 3KYJB 5HDBB 2G0AA 3RUCA 1Z4QA 5ENZA 5C31A 4CEJA 4W1QA 4ME6A 2J4CA 2NUBA 3M89A 2PGIA 2WJPA 4IIJF 2GPTA 5ESRA 1YOBA 2ZIXA 5HZGA 3T4PA 4ZRNA 2F8SA 5KX5A 4N65A 1GTJ1 3EGIA 3A3NA 2NO7A 2JCVA 2WTBA 2HRZA 5FR2A 1VCHA 2GH1A 5E4JA 4G4GA 4C4AA 1IZZA 2FSVA 3GAZA 4XJXA 5DGHA 1R16A 3QTBA 4I50F 4NOKA 1JEYB 1KI7A 2VWHA 5JQGF 2C3YA 2ISSD 1Q21A 1G0OA 3MIIA 2YXEA 4Z6KA 5LLDA 3IBFA 1XT6A 1T8TA 3JYPA 4GPAA 4WI1A 1CRQA 3O9VA 4OB8A 3ZCXA 4D3FA 2BE9A 1TC1A 1KMCA 1RYDA 2D2VA 3QVXA 4YJ2F 5CVTA 3ZWWA 4IKEA 1Z4MA 3EBLA 1Z62A 3HUTA 4QUBA 2AN4A 3R9XA 2CUTA 4IICA 4PVCA 2PMEA 3OC6A 4S0ZA 2H1OA 3OZAA 4L76A 4XYBA 1XF9A 5HIIA 1Y8CA 3R0ZA 1JEQA 2FPWA 4Q48A 4KGDA 1KZHA 3DMNA 2YWDA 1WZNA 4F4FA 2ZJ7A 2CDAA 4H15A 3ISJA 3NV9A 1E20A 3MQFA 5GJWC 2OG1A 3DZKA 3SEQA 4GL4A 3RU3A 3TLKA 3DC2A 2P62A 1OXSC 2L0XA 3MUNA 3OSUA 4D45A 2IKSA 4Q3OA 4PAQA 4GPZA 5LIRA 1JT9A 5KKCA 3OO1A 2OFWA 1C4KA 2NZJA 1EZ1A 3M6IA 4YCMA 2V03A 4K05A 2CNKA 3WWPA 1G66A 2IF0A 5KTOA 3FFAA 4LDPA 2V3VA 2IGTA 4C2TA 1WHSA 4GLBA 1RQPA 5LQRA 2NP7A 1KVQA 2OD9A 3PJDA 4YRQA 1LDEA 2YH2A 2VL7A 1RBQA 1NV9A 3IQEA 3H8WA 4QOEA 2WU4A 3GDOA 4PN3A 2WM9B 4WZAA 4IHQA 2FKAA 3RVRA 5LLTA 5G40A 2PU7A 1EYZA 2NNWB 3MJFA 3R44A 4U7HA 2SECE 4FFBA 5EJ2A 4HAZA 4TPKA 1EJBA 4PLYA 4LQLA 3SIRA 4E2YA 4EEKA 5BMVB 4OQZA 4H60A 3A70A 3HDHA 4HLUC 4RL4A 5IH3A 4EECA 4DNPA 3KPVA 4OKIA 5CX1A 2WWVD 3RD5A 3F47A 3ELBA 3EXIB 1GCAA 3OTWA 1QHNA 2W70A 1WZIA 2OHIA 4GBMA 4PS1A 3S68A 4XA8A 2LDXA 1B7GO 3FUCA 5FI1B 1BX3A 1R0ZA 1O94A 2R11A 1LZLA 2OG2A 3G7UA 3OEYA 4IFBA 3ZBTA 2W0MA 3Q3IA 5EZ5A 5AK6A 3ZIAD 5JJLA 1CU1A 1JG3A 2QD3A 1LX6A 4XD7A 1FP2A 2VQ3A 2I4NA 3NYWA 5FWXB 1QFSA 4BN0A 4JQOA 1DKLA 3BJRA 3LF1A 2I7VA 3IVMA 3ZHCA 4FXPA 2G1KA 4BWFB 4D4KA 1K06A 1JKIA 2P5UA 2PN1A 3PUKA 3IPRA 3SBXA 1M1UA 3N2IA 2GZRA 3O47A 3ORHA 4OA5A 4EUHA 4CFZA 2G0NA 2GETA 2HKIA 4U5XA 2XCTB 4N5NA 1NMQA 5H82A 4NQZA 1D2HA 2IHUA 2FPXA 2AFHB 1Z47A 4FR0A 1QGDA 1TJ4A 2B1RA 2YW2A 1UZMA 5A06A 2QN2A 2W6OA 5AJHA 5BOVA 4EHHA 4YVFA 3AY0A 2IITA 1EDBA 1Z26A 4HMOA 1W25A 4X7MA 3AZPA 2FWAA 4M38A 3P8ZA 3ZJTA 1I4WA 4K9SA 3FZNA 5PNTA 4AIIA 5C34B 5IVPA 4AJ1A 5KSZA 3DZ8A 3M6FA 1Q83A 1GQQA 5C1IA 6REQB 3DMYA 2ZZKA 3GRRA 4HGZA 1N3BA 3CLTC 4GYKA 4UEJA 2GBPA 1QKIA 3PIDA 1VE3A 3MJEA 1YBAA 4TMXA 3HH8A 4K46A 4DJJA 1WUIS 3GLHB 4BUJA 5LU9A 3JQ7A 3ZUGA 5KHOC 4JSTA 1DCTA 4HO1X 1K7YA 3EGDA 1Z0JA 1THTA 4TLEA 1FTWA 3EC7A 1WZEA 4YP9A 3UM9A 3OPYB 4TT3A 3KOWA 4R69A 4DIOA 2ZBQA 4KWIA 5IABA 2ZXEA 5SICE 2XWQA 5JXIA 5B1HA 1G38A 3DO8A 4YCSA 2RGYA 3I5AA 1B74A 3LOPA 1XPRA 1KSFX 3RYHB 3IAXA 3FYCA 1DKNA 2Y77A 4RTRA 2WDZA 4MI6A 2JJMA 2RMKA 2OZLB 4CF5A 4G0WA 2CUNA 1JJ7A 1ISHA 2QOEA 3LQYA 4XIJA 3U3KA 1LDGA 2FV8A 2JLCA 3Q0EA 5GY7A 1XTZA 5JCOA 2RGBA 3A4LA 1OQAA 3CCCA 5INTA 1HYHA 1TI7A 4AS2A 1ETUA 4Q47A 5K0JA 1ZUD1 5CPBA 1H22A 3GMDA 1P9NA 1QZ3A 3FKJA 4KXNA 3CRW1 4MA4A 2HCFA 2FEOA 2BAGA 1H6BA 3OFND 2FRVA 4BLQA 1QH1A 3OZIA 4EGQA 1TC2A 2CC2A 1DL5A 2A3NA 4GICA 1ZRMA 2PGDA 1KMHB 1BJRE 2P3OA 3E82A 3LPAA 3W9UA 4QFBA 1JEDA 2X9VA 3SOZA 5EUQB 3OTGA 3G2KA 1QIHA 4FNOA 4Z7JA 1AKVA 1MXFA 2PUWA 4BNDB 3VDRA 3DHNA 3AV0B 1AK1A 5JJCA 4GECA 1FW8A 2O57A 4ZODA 1G19A 1RJ9A 4BJ1A 3K16A 2I66A 2E4YA 1CQJB 4JLNA 5J2UF 4HV4A 1W8DA 2RAFA 4HMQA 4J1SA 4QULA 4X7PA 4C6SA 3LUBA 5CK5A 3A6KA 4ROTA 2CLLB 3GLSA 2I54A 5FFFA 4FLMA 4O08A 3I52A 4MWZA 2I80A 2ZATA 2YFHA 1ILEA 2C7GA 1DRKA 3QUCA 1BOOA 1QYCA 2C9CA 1ZVJA 3SCZA 3T7CA 1JAIA 5JW6A 2WTAA 3AR5A 1U7DA 3QF4B 5DX8A 3DVSX 4BBZA 4YP1A 1KH3A 4MRMA 4GMGA 1REQA 4PQFA 4JJ7A 2G9ZA 3AVOA 1J42A 5K45A 1MO5A 1IN6A 4L73A 5AUQA 2XMPA 3ANLA 3OIYA 1SVKA 1U7ZA 1PCXA 2D59A 3VNRA 2QKYA 2XB9A 2XSZD 4CL3A 4H59A 4TYPA 4BO9A 3GCZA 3RVNA 1N5JA 2AS0A 2VT6A 2Z1DA 4LTNA 3PQ6A 1D1PA 5LYYA 5JAOA 1QZXA 4OQNA 3T94A 3DJFA 1XVLA 4E7OA 2NVWA 1SEPA 3PQ5A 3C4VA 5B2EA 4FEAA 4KTTE 2PM8A 1IBKB 1NNLA 4EFMA 1K98A 5BYAA 3BXZA 5DM1A 4P0QB 3F6BX 1B43A 3HKEB 1HQDA 3KPYA 4Z99A 5DWVA 3U4CA 4D3XA 5IM4A 4Z8XA 1TMYA 3VMFA 2OBBA 4F8EA 4ICIA 4L6CA 2HQ1A 3PUXA 3SZGA 4UNIA 3RK1A 1VHLA 5EJMA 3V48A 1EUCB 2WE7A 1G2IA 2Q9CA 3EQ9A 3LAWA 4JNKA 5TJHA 4ETWA 1H6DA 1SY7A 3O82A 2C98A 3ROKA 4W5RA 4HPXB 1GTRA 4YT8A 1IATA 2WTXA 3AL3A 3QH4A 3AJEA 3V97A 4F5EA 5DWQA 1TJNA 1COWA 1WCIB 4ZC8A 1NN1A 4MGIR 4OK6A 1JB1A 1W94A 2BHLA 5JXHA 4N54A 1F1BA 4M0CA 1QJCA 4NBNA 4P35A 4M9CA 2JGJA 2D5CA 5GVRA 1JQEA 1B41A 5BRJA 1ZSVA 1BVUA 1NTOA 2RONA 3LP6A 4QOSA 4AUKA 4D9KA 2ZRDA 1ZD8A 3L7LA 4M1ZA 4YHHB 3NAZA 1BU5A 3BERA 1GOTA 3TJMA 4E5SA 3G17A 4MVJA 1DC5A 1MPXA 2IDZA 4PX2A 2FZEA 5CVVA 8ATCA 5F3RA 2CK3A 3NTQA 5HR5A 1FFGA 5BMVF 4EY7A 1J5PA 3I2JA 3VSBA 2HUPA 4URZR 1SKMA 3IUNA 3CLVA 1L5KA 3ROFA 4QWMA 4RACA 1DG1G 2GPNA 3MBKA 4YS6A 5E4YA 5C1PA 3U7FB 2I7TA 3UWKA 4IF6A 1EK2A 4PLVA 2MYNA 2E48A 4QHTA 4E31A 3KTOA 3M1IA 2YXPX 5HIMA 2AA3A 3WMEA 3QPBA 2UU9B 2G17A 1Y5IA 1LS1A 2FW1A 2QNBA 3AUUA 2B4KA 5JLJA 2JD0A 3UJCA 1V8OA 1Z6AA 3PL1A 2H31A 2ZBEA 5GJVC 4LF4B 4Q39A 4HSGA 1NR1A 4DCOA 1G8SA 2ZQ5A 3OCJA 1P18A 1N2CA 2P2NA 4DIBA 2IXDA 3EIUA 2QNIA 4P4SB 5GV7A 521PA 3PP8A 1FNDA 1JTVA 5JR3A 3TL2A 1YRAA 2X4IA 1SC3A 4LQCA 4F0JA 3VGJA 4G5QA 3UMRA 1FP4A 5FEUA 2CVHA 1SHTX 3FSRA 4C29A 4LFBB 4HQ0A 5EWJA 4CCWA 5JDCC 1QG4A 4A23A 1Q2XA 2A3RA 3BSWA 3OJFA 4AM8A 1GILA 1Y3HA 1Y7PA 2ZRHA 4CNBA 4W1RA 5JRZA 2O59A 1DJNA 1QO9A 1TK3A 3FBWA 4HLCA 2GYUA 4L57A 2AKEA 4DCSA 3OQMA 4DLLA 1R9NA 3KE9A 3HVRA 4KZPA 3LGSA 2BP7B 1II8B 3USES 3G9UA 4QGHA 3V80A 4Y2GA 4BU1A 1QORA 1FFWA 1OWLA 2OVBA 1TPYA 5BWMA 1FP6A 2YJ6A 2CHUA 3GA5A 1Z7YA 4JLPA 1NDUA 1XOIA 3STHA 4RDXA 2DTDA 1ZLXA 3VX4A 2WWWA 2N3ZA 2A9JA 5AKXA 3PIIA 1VFPA 5GADl 3ZHYA 1XX6A 1R4MA 3EBOA 1I80A 4I81A 5BSKA 4GMXA 1V8ZA 3T12A 1ZCFA 1GUAA 2O2XA 3NYRA 5BW8A 2BJWA 4C4OA 2IT1A 3IHKA 1RXVA 1NKVA 1N8KA 2G36A 2QAJA 4MCIA 5FHQA 4NAUA 4CLXA 4COKA 3K70D 2OB1A 3EAFA 1C9KA 2VF8A 1CFJA 1XKTA 4GW3A 5CUQA 2I4OA 1JQBA 1OLXA 2FZ4A 4RVOA 4OHXA 2ZIZA 4WOCA 1I7QB 5DM0A 3EEYA 3FLBA 3J81A 4QU8A 3QW2A 3C5HA 5CJ2A 1PYDA 3LCCA 3FVVA 1KYWA 1BKSB 1QH1B 3D5TA 3QVOA 5HQ3A 3VR3D 1G1AA 1P6XA 2PV0A 1DTEA 3UN1A 1SAYA 1WRBA 2CZCA 3ZU6A 2O0LA 4XEUA 1DOHA 2OO5A 2AC2A 1ADJA 3E05A 4BFVA 1KYVA 1UDCA 5KAMA 2IXEA 2XR1A 4GR9A 4WBXC 1Z2CA 3QM1A 4CV1A 3OJWA 4WNAA 2XJ4A 5BURA 4MV9A 5L9AA 2X8WA 5KS2A 5C52B 1ZR4A 1CP3A 4TV8F 1AUVA 1A76A 2IY9A 4L7QA 4WVFA 2DRIA 2WEKA 3USCS 5TQ2B 5ENVA 3ROZA 5BO5A 1WP9A 4OP2A 4FUQA 1BDBA 2HWYA 4YDSA 1TJ3A 2LWIA 3OM9A 1E3LA 1PLKA 4KAJA 2A7QA 4M0FA 4DSTA 5LUAA 1XVAA 1XXHA 1FA9A 2QTTA 3RSOA 1EVZA 2IFTA 3PDUA 4RV9A 3GFOA 4CT0A 2DB3A 1ODJA 2QAGA 4UM7A 2C4UA 4PAMA 1XRLA 2VP5A 2YVKA 1Y98A 2I6XA 3I2GA 3P4UA 3U7JA 4LRSB 4EKNB 4Z7OB 2W7TA 3OJXA 1ONBA 1Z5NA 1JSCA 1KMIY 2VJYA 4P3PA 4ZOQI 2WG2A 3RRZA 4L8WB 5D7BA 3I92A 1IZ0A 4Q9HA 2AG0A 4JU9A 2YRWA 4DUGA 1F6WA 1KOJA 2YVLA 4WUVA 3EY9A 4IV0A 3USZA 2NXEA 3KCQA 5EJ9A 1ZINA 3DBLA 1C9NA 3CNNA 2JFFA 3HYLA 1QHXA 2Y4OA 1HO3A 4JVMA 4YONB 3INRA 1ZHHA 1KXJA 3RJMA 4HKTA 4RD2A 4HNHA 3ZHSA 1W48A 1VIMA 4PF1A 1HDOA 1TFUA 4M46A 4D4LA 3GLGE 4TWAA 2WHPB 1R6BX 2J4DA 2VWGA 1KXZA 1VMAA 3NOXA 4ZDWA 3FX2A 2RK6A 2BFFA 1NHGA 3G8BA 4IV5A 3A6HA 4OAQA 2RGNA 5DCWA 2PNJA 4MMXB 4NCAA 4H77A 3O9ZA 2J0SA 2HDHA 2ID4A 3VVBA 1C1DB 1IPHA 3AJAA 4AD8A 1TAGA 3BPSA 4AMGA 1R3UA 5K3FA 4OD0A 1KYZA 5B3KA 4JLAA 1NVFA 3WLAA 1VG0B 1HYQA 2AOUB 3HN6A 1H66A 3A4YA 3MMZA 4QQNA 4BVFA 4F4IA 3L7CA 3DMRA 2PD6A 1KL7A 2IEGA 4L2IA 1QTIA 2GD6A 2GBLC 2BFCB 3MPOA 5JYCA 3FVRA 4GUDA 1XTBA 5U9CA 3GPIA 5JFOA 3GJZA 4Y7DA 1U9JA 3CH6A 4A7PA 4KN9S 2FN7A 3KLOA 4ZI3A 3H87A 1E2KA 3T1VA 1MT3A 2V9PA 2NXCA 3RJZA 5CB4B 1AO3A 2J4FA 3B52X 4KIWA 3S99A 1ULZA 2J3DA 5B2ZA 1SBCA 2GASA 1R66A 2IELA 3E7WA 3K2BA 5A0VA 3RWBA 2J31A 3VKWA 4D41A 4E5VA 1YS7A 4GVPA 1LPBB 4IIHA 4P92A 1YGYA 4BNHA 4EY3A 1IUPA 3UWMA 2IIPA 1OAOC 1JDJA 1I4TD 1MEEA 3ELYA 3PGMA 3JCZA 4G9BA 2HJVA 1UINA 1EHYA 2I65A 1P0PA 2NO1A 2ZUSA 1EDEA 3I32A 5C3UA 3PXCX 1AKTA 1J07A 4JUFA 2FH5B 1PJ2A 4QOGA 3S4YA 3TOXA 2IUYA 4KIFA 3U0BA 1CJVC 2GERA 4PFSA 4BGIA 1B3RA 1XPOA 4X44A 4W5NA 2OQ2A 1KSGA 1RMQA 4S12A 5CVJA 2WWYA 1RT9A 3I9JA 1YQUA 2GEJA 5ALVA 5HRCA 2WIJA 3O1HB 4LCJA 1QFJA 3WYFA 5J5CA 5C7YA 5FLEX 3PVSA 4C5CA 4RABA 4G5FA 1F14A 4KIGA 4FEEA 4QXAA 3P32A 4PSCA 3UJ7A 3AKDA 5GZ6A 4UFPA 5JWOA 4TOIA 3I83A 4E6PA 5TS2A 1JLLB 1U8UA 2H11A 2VTEA 3OF2A 4B73A 1T9KA 4EM6A 3T7DA 1W76A 3U44B 5AM4A 4PYMA 3CH7A 1B6GA 5L3SA 4KPGA 4NMXB 1X7HA 3BHIA 4ND8B 4HH0A 4RK6A 1FOEB 2CE7A 1DX9A 1YKGA 4QT0A 2W43A 4W1PA 2ZM6B 2IIBA 3AETB 2ZKIA 1HKHA 5D1NA 1Z0DA 1QK5A 2OZKA 3BAZA 4C01A 5BORA 3L0YA 3P9RA 2PRSA 2LCFA 5T67A 3UB4A 3M3HA 2PXHA 3GZTB 3K32A 1RW4A 3TDMA 4EA7A 3FHOA 4GC9A 3ASYA 1UM8A 4B9AA 1EXNA 1P7VA 1RM4A 2WWHA 2P41A 4ZCSA 1WCWA 3TYXA 5AUNB 1PT6A 2XB2A 2MSKA 5KI6A 4HQNA 5TGDA 1CQJA 1QFZA 2OV6A 2YX1A 4MKXA 4NAHA 5KQMA 4LDNA 3PNPA 1DDGA 5ITZA 5LBIA 3D7SA 1Z7GA 3A9SA 3SJZA 1V7QA 2G08A 4QGFA 5IASA 5I9TA 4C7MA 2CXNA 4RHCA 4L4YA 3KQWA 2GEVA 2G77B 5CVEA 3K9NA 3FHTA 3N8GA 3OLZA 1CR4A 8ABPA 1BMFD 1E5XA 2PH7A 2WFLB 1ZQ9A 4FGJA 4GOKA 4N40A 1HE8B 3R9KA 2V3WA 1R74A 4B6OA 2OV4A 4AZVA 3EARA 4JLVA 3PNBA 3CURA 4EUNA 1XTTA 2PPVA 1K86A 1M8KA 4PO1A 3C45A 3ZI4A 2FOXA 3Q3HA 3UCEA 4J6EA 4PIVA 3DL0A 3EEQA 2VP0A 2PA0A 5JSZA 4G2NA 2WYVA 5JNSA 4HH3C 2AZMA 1QDLB 3PZBA 2I3BA 1E7QA 1YUBA 3DMTA 3LUDA 4Q4JB 5IZCC 1I7SB 1UT8A 5TVGA 1OZ0A 4QG7A 3UG7A 1H42A 5LP6C 4DM7A 4BP8A 1U4SA 3X1WA 4MQLA 4AJ9A 6AT1A 4WZZA 3INYA 3GLFA 4TZ0A 1S01A