1YI9A

Crystal structure analysis of the oxidized form of the m314i mutant of peptidylglycine alpha-hydroxylating monooxygenase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
309
structure length
295
Chain Sequence
CLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEEICNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic copper of Peptidylglycine alpha-Hydroxylating Monooxygenase also plays a critical structural role.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
total genus 57
structure length 295
sequence length 309
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yi9A02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 1yi9A01
3PHMA 3MLJA 1PHMA 3MIHA 3MICA 1PNGA 1YI9A 1YIPA 4QHBA 1YJKA 3MLLA 3MIBA 3MIDA 4R4ZA 1PGSA 3MLKA 1SDWA 3PMSA 1PNFA 1YJLA 4R4XA 3MIFA 4E4ZA 1OPMA 3KS7A 3MIEA 3MIGA
chains in the Genus database with same CATH superfamily
4WZCA 1Z7S3 3H3UA 1DF0A 2W94A 3DCQA 4FFGA 4YYOA 2X05A 3VDAA 4KQ7A 5FOJB 2HWC1 1DQ5A 3OGGA 4C8DA 4K20A 4HVRA 3MFAA 1EP0A 3VZJA 5T52A 5EPAA 2W1QA 4MUVA 4M3CB 2E26A 5IAXA 1IKPA 5IATA 3KQRA 1QF3A 1VBB3 3PJYA 1NXMA 1TMF3 3NKTA 4HLTA 3ZR6A 1DZTA 4BQWA 2WAAA 2GC2A 1RUJ3 1VRH1 1HDKA 3POEA 2Y64A 3NNMA 4JQRA 4CE8A 5FYUA 1LECA 4OI1A 5HCAA 2YZ4A 3VV1A 1N1VA 3I54A 4M00A 4TLGA 1NT0A 1ZZ8A 2ARXA 1NQDA 4L8QA 4UFKA 1X8EA 4W50A 5J98B 5J3UA 1UOGA 4CEYC 4AW7A 5ABJA 4UF0B 1JZ4A 2KXLA 3RZJA 4B7EA 1W2UA 4JHZA 2D3SA 5F5AA 3MPPG 5D8AB 4BK4A 4YW4A 1WBLA 3B02A 3ZN5A 3DKQA 4YGEA 4AK3A 3RSJA 5T5LA 5IVEA 2EICA 2J1SA 2WO2A 3DPRC 1PVC2 4COYA 2HYXA 4ZPIA 2DCTA 3JQWA 5LATA 5E1RA 2MPFA 2PLV3 4LKDA 1G9FA 1RVF1 3V56A 2J1RA 5KXDA 5L9RA 1SBDA 5JXHA 4QGMA 1FT9A 1JU3A 2BGCA 3M4FA 4CPBA 3NNGA 2JD4A 4Z82A 1V0AA 2PHXA 2ZHLA 5CKMA 1R091 3WNLA 1ST8A 2QQOA 1GFF2 5J1XA 3B93A 3H8UA 3HD8B 4NAMA 3AP5A 2EA7A 5LB6A 4V2VA 1D0HA 2H6BA 4LR4A 1LOFC 2YC4A 3GM8A 1YHFA 1FNYA 4NHXA 3MW4A 5KC5A 4N43C 2CSGA 2WA3A 5EQUA 1BMV2 1AYM3 1FI2A 3BTAA 1XC6A 4RHV3 5FY9A 3KVBA 3VBRB 4QM8A 2UY9A 4PJYA 4QXHA 1ND3A 3NV4A 3WINE 1XYOA 1DYOA 3HMYA 3KGZA 2A73B 5FZOA 1C57A 2JE9A 2WQ8A 4Y20A 2N7GA 2Z42A 3DEMA 3PUAA 2WC2A 4CU8A 2JENA 5FPXA 5J09A 2ES3A 1XNTA 4LIVA 3RDIA 4EJRA 5B2GB 1OPMA 3WG4A 3PVOA 4ZZ5A 2XXZA 2B4KA 1OH3A 2OS2A 1WLTA 1WW6A 2Q1MA 1PZ9A 3WQ0A 2WZEA 3LEKA 1A78A 3GBGA 3NV1A 4KWLA 4N53A 3CU7A 1A3KA 4CCOA 2E7TA 4PIXA 3IN9A 4E8CA 1OOPB 3DPRB 4OCTA 3O1RA 3KV5A 4AEDA 3T4VA 2JX9A 4EV0A 3O1OA 1UCXA 2VAUA 2UYAA 2K9ZA 3UGHA 3WF3A 2PMWB 2FMYA 1HRV3 1DZQA 4EN0A 3VHRA 4NRPA 1COV1 3WUCA 4HK9A 4QXCA 1VMFA 4N53C 1DBNA 4UF0A 3O14A 1IG0A 5GJ6A 3TNQA 5CFCA 3AL5A 1CZSA 5LA9A 1WZXA 1F9KA 4DPNA 4AFCA 3HNBM 5KWRA 3OSDA 2W92A 2DVDA 3J8F1 3MLJA 2WBKA 1CPMA 4YW6A 1CAXA 4N43B 3MICA 4JX0A 4PBPA 2BTVC 1MQTC 1DCSA 1REEA 4YG6A 1RUC3 3MW2A 1VBE1 1Y4WA 3VL9A 3UNPA 3ECQA 3S5AA 2YU1A 4A42A 2WAOA 1CAXB 4N43A 2WNVA 2WLPA 2ZZJA 2SBAA 1R083 2PYTA 1QOTA 3H50A 5AFBA 5DZFA 4GXLA 1F4HA 2WZR3 4JGYA 4PI0A 4QGLA 2HLEA 2AUYA 4CXWA 2C1FA 3L9JT 2ENRA 5I0RA 1OVPA 4XDQA 1VIWB 4IEXA 4PDWA 4E9KA 4R9CA 5C8CC 4CP2A 1E5SA 5EXOA 1JZ5A 3ZFFB 4I3GA 1OOPC 2QZ3A 3AYDA 3QBQA 2UURA 1VJ2A 3IDAA 2E33A 3DXUA 3LDKA 4MGYE 1ZREA 3WQ1A 2JDUA 2JDAA 2OW4A 3KV9A 1NE4A 5FZ9A 3WNPA 1VBC3 4LUMA 1OLMA 1TME2 2K2SA 3N7LA 4FPFA 5A1AA 3PIGA 3H3LA 1TMF1 1RMU2 2JDNA 3O0WA 4QQOA 2XJVA 3RS6A 1N47A 3TWIA 3ZFGA 5LW9A 2ZTNA 4Y5TA 1AR71 2YGMA 4B7KA 4D7SA 4JKMA 5KHKA 1CAVB 1GU3A 4GJYA 1HXS1 4NWWA 1JW6A 2ZABA 5FWJA 3APBA 2ZPXA 4Q1PA 1NZIA 3FUQA 1ASJ2 1C3HA 4LO8A 1MACA 1W2OA 1IS6A 3KWVA 1WD4A 4D7YA 3IBMA 5HPOA 5FY7A 4QKBA 1U5YA 3V0AA 1MQTB 2IXCA 1D0GA 3BOWA 1WMXA 1LHVA 1JZ2A 2X5IA 2VUJA 1IS5A 2HBUA 2W9XA 3KT1A 3D82A 5FMOS 2LS6A 2ZGTA 4Z2AA 1MS3A 1QNWA 2R1BA 3I3BA 3VBFA 5AC92 3S0MA 4FTEA 5F2WA 5DQ0A 2VR4A 5B4NA 5BV6A 1OT5A 4XTMA 1DDLA 3B94A 3H0OA 1PVC3 2XL7A 3WQ7A 2ETEA 5FYYA 5KHIA 4HPKB 5JMOA 1SLAA 2NN8A 5F8PA 1W9TA 5C8CB 4L92A 2WJSA 2LW8A 1STMA 5CB7A 4B4QA 2OT7A 2A6VA 2VZSA 3IDCB 4XJAA 3AJYA 2ET7A 2DCZA 1MS5A 2GDFA 1KJRA 1HIXA 4LOTA 3C7GA 4NPLA 4PF1A 4Q26A 4ZS2A 2WWJA 3UKVA 4CCKA 1XE8A 3UKNA 4DY3A 4MHUA 1GP6A 2WFF2 2H0BA 2P34A 3JU9A 2E6VA 4FBFA 2X8KA 5LBFA 2YFZA 5ACA1 4J25A 4S2HA 1AL23 4IGQA 5FLHA 1XE7A 3QOPA 2ZHNA 3JD71 5DDJ3 4FPLA 4UWDA 1MS0A 4ZS3A 2W1WA 3LEIA 3LSEA 5EFUA 4R52A 2GMMA 5GZDA 1LU1A 3PLQA 5LBBA 1X36A 1UY4A 3KF5A 2ZOEB 4QT6A 1R092 1DYPA 4FPCA 4LBQA 5FZ8A 1I1EA 2P2KA 1MVEA 1P8JA 1GQGA 1VMJA 2GSYA 2ZKLA 3OGSA 3QH7A 1F35A 5GLZA 1R081 1VBC2 5CIRA 1UPSA 3FLTA 3ROUA 1XU2A 1PNGA 4RGGA 1LESA 1O6UA 2HWF1 2R7EB 4QHOA 1OD3A 5IK7A 3U0ZA 4Y4YA 2CAVA 1CIWA 4K40A 5GLTA 5EJZB 4AVBA 4KWKA 5CZKA 2Q1FA 1UPIA 1TG7A 2BU9A 3W5NA 1VBD3 2AGSA 2JEMA 3JBG3 4Q4W1 2WZR2 4D94A 4LK7A 1PNFA 4Z1VA 2BW8A 2PXJA 5LK7B 3POYA 1V6MA 1X9PA 2XVGA 3MYXA 4Y1XA 1OUXA 1GMMA 1IG3A 2WSVA 5JLVA 5C3OA 4OUMA 4EQVA 2RMU1 3SCHA 2RHPA 2IC1A 4Q0PA 3T0BA 3VDBA 1MEC3 1QJU1 1KRIA 5G05L 1SFYA 4DRRA 1POV1 4S2DA 5FP4A 4IV1A 4GWIA 4WM8C 4CUBA 4EROA 2GNMA 2YV8A 1R1A1 3DXTA 3U78A 4OHYA 3EBRA 4QU1A 3K77A 4BLIA 1HLCA 1UZYA 3IPVB 4YWAA 5A33B 4TN7A 5I0SA 2VTFA 3USSA 5F5IA 2FZ1A 1D7PM 4E8DA 5FYHA 1FMD1 1SPPA 3HN1A 3NJXA 4XUNA 4IDZA 5FY5A 4ATFA 2ZGUA 2WIIB 1HV1A 5GKAC 2ZX1A 3T30A 1VLNA 1BBT2 1VBD1 2EAKA 2ZX3A 4W6XA 1JYVA 1ODNA 4GA9A 5KHHA 2R49A 5I8TA 2B5HA 2WNVC 3WHTA 4XUTA 3SCGA 5E89A 1AL21 2VE1A 1BLZA 1G9AA 1Y9QA 3POWA 3TOJA 3MF6A 4HBNA 5APAA 3RJRA 3ZFEC 2A70A 5FYZA 4XIKA 2VCMA 1S0IA 1IOAA 3A4UA 3IAPA 2QTWB 2O8QA 4IQPA 1GNHA 3H7YA 2RS11 2W08A 3MIBA 1NA1A 1HRV2 1YFXA 5K0UB 3T1MA 4RR3A 4YVWC 4TTGA 4BQ3A 1HQWA 4RQPA 2W1SA 5T5JA 4HETA 2QQVA 4EZHA 4LA2A 3PIJA 4YW2A 2XONA 2DV9A 5FZMA 3ZXKA 3NJYA 5FY1A 2NYYA 3LDBA 4XFAA 1BK1A 5I8SA 1UXXX 1WCSA 3B69A 1W8TA 4XW3A 1SDDB 3BODA 4FOYA 5A1FA 2J22A 2Y6LA 2VBPA 3AYAA 1T2XA 4D0QA 4KGQA 5FV3A 1TQ5A 3HPNA 1HRI2 2W91A 5FXXA 2R061 4F8AA 3EB7A 1Q8VA 3POIA 5A3TA 1ZZ6A 1C8M3 3I8TA 1BQPA 4XZPA 5D21A 2ZGRA 3ZLIA 3O5SA 2YHJA 2CDPA 5AVAA 1QQP3 1EAH3 3PMSA 5FUPA 1GR3A 4Q4X1 1RGSA 3EJKA 4RL7A 1CD3G 5FYBA 4KWJA 3M2MA 4LBLA 4IE4A 1GANA 3M70A 4I0AA 4QKDA 3ES1A 3MIHA 4WVZA 5F5CA 3VDDC 2UWAA 5FZEA 2FCTA 4NIIA 3O1MA 1O3QA 2VBBA 4BYYA 3ZFEB 2Y6JA 4UXAA 4JRLA 2PHUA 3SH5A 3ETPA 1ZZ9A 4QGNA 1U12A 3VGIA 3AB0A 4B1MA 4CDWC 3AMPA 3M3QA 3I2DA 1XYNA 4AI2A 2JDKA 1QMJA 1QXJA 5C4WA 2A3XA 5FZBA 1QOOA 3Q8BA 5K0UC 4YVWB 3A0NA 2W3JA 3KT4A 2Y6KA 2Y38A 3KGLA 3IIAA 1BBT3 4UFHA 5E88A 3LCPA 5C5TA 4XEZA 2YPDA 4XF3A 3KLSA 2IVJA 1U5XA 1YUDA 4JDOA 4OI4A 4DUWA 1VBB2 3CJIA 3CMGA 3OB8A 2VZ3A 4BJ0A 3MIGA 1PK6C 2XQXA 4MO3M 3K4ZA 3K4AA 3I7DA 1PIV3 3RZGA 5FYIA 4I2OA 3IPVA 3PU8A 1W8FA 1QNYA 2DCJA 2WS91 4WZFA 3INAA 1IS3A 1QDCA 3A7QA 2VMGA 4R8HA 1UZVA 2IXIA 3LEGA 4RFRB 3ZSKA 3WQBA 1QH6A 4ZKTB 1K3IA 1QU0A 3F2ZA 3SKJE 1LTEA 4MXWB 4JGZA 3SXWA 1UXZA 1YNAA 5A7SA 4AEJA 3AL6A 3VKLA 2D3PA 4BIOA 2VW2A 1POQA 1ZYBA 3ASIA 1SLCA 4LBQD 3VHNA 2AEZA 1WLWA 5ABJC 2A75A 3KT7A 1LKNA 4F3JA 5BNOC 5EJ3A 2TBVA 3I3DA 4FAGA 4EWAA 1DQ1A 4EWDA 2QFEA 1SMVA 1BJQA 3OG2A 1ULCA 2C6SA 3USUB 3AXEA 3L2HA 4JAAA 3VBRA 4CDWB 4PQQA 1MZEA 1RJ7A 3H8RA 2BJSA 3CZJA 2XDVA 4RYDA 4BDVB 1B09A 3BB6A 1KD7A 4YRDA 1RITA 5C3PA 2ZKNA 2Y6FA 1Q8SA 2JKBA 4ET7A 1EAH2 2VD7A 4RFT0 4NIGA 3OCPA 1OMIA 4GB33 3LE0A 1S2EA 3OBZA 5A6XA 1CGPA 1YJLA 3E6CC 2W2IA 2QUOA 3KV4A 2EIEA 4HMZA 1PK6B 2FCUA 3BIWE 4WBBA 4JZRA 1W6MA 4C1XA 3AZYA 1ZBE2 2E51A 1O4YA 3TEXA 3JD73 3KCCA 2VNVA 1QH7A 2ZHMA 1QOSA 2Y6HA 1G9DA 4Y1VA 2ADDA 4K3UA 1EAH1 1W6OB 4BHPA 1BEV2 1JUHA 2GMPA 1VAMA 2GH8A 2UWCA 1D4M2 2AR6A 1ACCA 3FN9A 3ACGA 1PO13 2YROA 5HCFA 5C3RA 5C70A 3BIEA 2JB4A 4COUA 1C8M2 2CTVA 3BU0A 3RZHA 2MEV2 1WCDJ 3WP4A 2ZACA 1VRBA 1S0CA 3WF1A 4NRQA 5C3QA 2BDRA 1OC1A 1RC6A 4QDSA 3OUIA 2OVUA 5BNOB 3MEPA 5FXZA 1UX7A 1CX4A 5DAPA 1A34A 4BZ4A 3VZMA 5EP9A 2VQUA 2VW0A 3H42B 4K1YA 4QXBA 5C8CA 2RR12 3IWZA 4FOVA 3ZDSA 5FPZA 4NJ4A 3VBOC 1ZRRA 3N9QA 3PL0A 4UT5A 3WDXA 1H9PA 4IEYA 1D2QA 4AL9A 4WVWA 3FL7A 3T1LA 4JGYC 1TMF2 4Y3OA 5JSPA 3VD7A 1O8PA 1ND2A 1PMHX 1X50A 3U4XA 4FPGA 5FYTA 4GQ7A 1G86A 4H7MA 4JDMA 4LT5A 5K7PA 2P3KA 5CISA 2OYZA 3O1SA 1H8TC 1WBFA 3KB5A 3ZXAC 2VZPA 3EYPA 3ZYBA 3I3QA 1J3PA 3R4SA 4JC1A 4LUKA 5FZHA 5IUQA 2QQPA 4LBMA 3NW4A 2RJLA 4LMFA 5FJHA 1UMIA 1JH5A 5BNOA 1EPZA 4KU7A 1AYM2 3LA2A 1ODMA 4QQ2A 4TWTA 5CFCC 1AZDA 2TUNA 5CU1A 3N9OA 1FMD3 3GZAA 5AVPA 4O65A 1UX6A 2XLGA 1CJDA 2EAAA 3GGLA 3IIIA 4FT8A 4OLLA 4CP1A 4HL0A 3RYKA 2VVEA 1RUE2 1UOJA 4CU7A 3BKZA 1DLCA 4CDQA 4FPKA 1K5JA 5DDJ1 2EF6A 5E8AA 1W6QB 2CGNA 3BTYA 3UL2A 3O1UA 2XH6A 2FDHA 4EZ4A 3AMQA 2D40A 2YY1A 3I59A 1PK6A 1VBE3 5EJ1B 4YFZA 2D3RA 3AM2A 2ARCA 2BNMA 3TRSB 5I0DA 3VBOB 5E16A 1W28A 1CZTA 4LKEA 2QDRA 1UYZA 3ZN6B 1RUOA 2WYFA 4JGYB 4DY5A 1KQRA 3P3PA 5JR7B 3NV2A 1OUSA 2KR2A 2ZA9A 4MVTA 2XUEA 4Q1RA 4ZU5A 1IQDC 1BK0A 2C0ZA 2XLFA 4XF0A 3OOXA 2XL9A 3JBG2 5FKCA 5C4WC 1XJAA 4L99A 3S5QA 4OMCA 3HT2A 4XBNA 4OULA 4ES9A 1C8M1 2GC3A 2UWBA 3RNSA 3T2TA 3THPA 5DPNA 5ANQA 1NLQA 3WDTA 1Y9MA 4B1LA 2BQPA 2IZWA 4FPJA 1O91A 2BFUS 5LRRA 5LA1A 1AR93 1WLDA 4HOOA 4PIYA 3A23A 2VZTA 4NE9A 3WW3A 1O3SA 4EN8B 4FTBA 1NCQC 2CDOA 4LJHA 3K75B 2PLV1 1RVF3 2NMNA 2RMU3 1BMV1 4P08A 4OI0A 2XGXA 1PIV2 2BBAA 2D6KA 1YYNA 2D97A 2VOXA 3FWEA 3J7NA 4XQ4A 3ZYGA 5L9VA 1S1AA 4P9GA 4CCMA 2H6CA 3Q8FA 3NKGA 4OQ9A 3DL3A 1G9CA 4TZDA 2WN2A 2OKXA 3SITA 2JG8C 2JICA 2P37A 3B7MA 1F2NA 4CDUA 2EXKA 1J1LA 2VVDA 4GH4A 3WV6A 4BLJA 4G9SB 4D6RA 4DMIA 3QH6A 2G9FA 4BB3A 1JYNA 3LB9A 4W6YA 4UOJA 3S57A 1YCIA 2HWF3 4ZU4A 1JYCA 1QKQA 5EHDA 2Y6GA 3OPWA 4IE0A 3D5OA 2J42A 1XBFA 1T6BX 1FV3A 4M4PA 3H1YA 1PVC1 4AXOA 3MF9A 1ULPA 5C4WB 1QGLA 4RHV2 2J1UA 3HIFA 2P3IA 5BNQA 3VB9A 4LHNA 3ON7A 4M3CF 4COWA 3I2IA 4ZU7A 5FRAA 1KFXL 1O4TA 5HXMA 4CUCA 1W0NA 2WFF1 1IS4A 2G9ZA 5FZ6A 4YZ5A 3RZKA 1OLME 3FBYA 2V5YA 2JECA 1G8WA 2Z5WA 3AVSA 1HB2A 2BRTA 2Q8OA 5ACA3 5KHJA 2DVAA 1NCQB 4K8FA 3VD4A 4MGTA 1W99A 2XKOA 3M1HA 4R4XA 3WOGA 5JMCA 4OHZA 4FQZA 3SQOA 1YFWA 1DHKB 1Q43A 2B45X 1SFPA 2XMLA 4Z8BA 2BPA2 3ZSLA 2RV9A 3E5XA 2DFBA 4XFIA 5H9RA 5LEJA 2JG9A 1RUF1 1HB3A 2WDBA 1EV11 2KM2A 1YQCA 3T3YA 3UT0A 4CP9A 1L7RA 1ULDA 1AUYA 3HBZA 4LBQB 1QY4A 2ZEYA 3FHIB 4I01A 5JIUA 1AL22 2JG8B 1LNSA 2OPWA 4AFBA 5GZCA 5FY8A 5IK5A 2VY0A 2ZX0A 4QPIC 4FTSA 2WNOA 4Y1ZA 1YI7A 2XJQA 3K4DA 2MHFA 4KG8A 5IK8A 1CAUB 3J26N 2W52A 3VZOA 1R082 1VBC1 4YGBA 2IUWA 4R4ZA 2BGPA 3T4HB 3I2OA 2BV4A 3EXUA 1S55A 4DIQA 3FLPA 1W3XA 4HN1A 5IT6A 1V9U1 3I3EA 1VBA3 3OD4A 2TEPA 5K8SA 3BTXA 1W6NA 1LGBA 5FZ0A 1DIWA 1W2AX 1WCUA 1XNKA 2CV6A 3CJIB 4E2QA 4YSFA 1SCRA 4DFSA 4JHTA 3ME2A 4IGPA 3ZXGA 1RUG1 2VULA 1K45A 3I3MA 4URTA 4B29A 1Q5OA 2WT0A 2VMHA 3FX3A 1URXA 3AP9A 4M3CA 1Y3TA 4KH9A 3HQUA 4TSVA 4CUAA 1PO22 1GOGA 4RA0A 1BCXA 1RVF2 2G9GA 3DYPA 3VBFC 2JD9A 4C90A 5I0UA 1UYPA 5C33A 4YM0A 5A7QA 2E31A 2F4LA 4IEZA 5FJKA 1B35B 1C5IA 1WCKA 2WO3A 1PM7A 4B8EA 3LFIA 3HOBA 3HJRA 1ASJ3 3LA7A 4FOWA 4NRMA 4CCDA 4O61A 2JJ6A 3X29B 4BQ5A 4A4AA 4BH9A 1TEIA 4AEKA 1PGW1 3DUIA 5FPLA 3WZ1A 5H9SA 3TBDA 2DDUA 1ZBA2 3TNPB 3ZO0B 2HWE1 4X6RB 1SCSA 2ZXQA 3J7HA 3CF6E 1RUE3 1LULA 1DQ6A 2WT2A 5A7WB 1N3OA 4RD7A 2VNGA 1FNZA 3LPGA 4OI2A 1G6NA 4A44A 2YPJA 3PURA 1W3VA 4DUVA 1PGSA 4DS0A 2XG3A 2PFWA 4RGKA 3ZXDA 1UZWA 4UW3A 1QJX1 5FZOB 4IUGA 3U1XA 2DURA 5FYVA 3K2OA 2VJXA 3CJIC 3D0SA 5HV0A 2HYKA 1JZ6A 2X53S 1W6MB 2HJIA 1COV2 1KS4A 2PHDA 1AR72 2YXSA 1V6JA 4LITA 4XFGA 3N9PA 1GZCA 5FWEA 4XOGA 3N7MA 2UU8A 2JXAA 3VL8A 5L36A 2GC1A 1OQEA 3N7JA 3MV11 3F95A 2QKDA 2BVVA 3NJZA 1W6PB 2D44A 2VNRA 2ZGMA 3N36A 3ZSEA 3B9IA 2Q4SA 1RUF2 2HWE3 2JDPA 4PIZA 2XKPA 5FK8A 4MV2A 4DUXA 2VQTA 1S0DA 4M01A 4RS5A 3EHKA 2I74A 5BXXA 2F6BA 2YFUA 4XMIA 1CR7A 1I5PA 1QJU2 4IE7A 5JOXA 1PGL2 5A80A 1XU1A 3POBA 4AZZA 1RHI2 4P02B 3HEIA 3U4SA 4BIFA 5AC91 3PUHA 1J59A 1AR83 3OTFA 4ASLA 4CCEA 2BBVA 2QE3A 3BVCA 1YC61 4Q4W2 1RUD3 4LLFA 1YI9A 4QX7A 1ZX5A 5C6CA 1RUH1 3D3AA 5FPAA 3R4DB 3AZZA 3DYOA 4FFFA 4EWEA 4E2GA 1LOBA 1W8HA 4QX3A 4WVVA 4QX0A 1RUC1 1MS4A 3ZXEA 3NNFA 3RVHA 3ATGA 1LGNA 4QX2A 1VE0A 4XIOA 3ZSMA 4AFAA 1X7NA 1JYTA 1ZBE3 2R041 4HPKA 1BVVA 4JTNA 4QDQA 4X8PA 1UYXA 2X10A 5FZLA 1H1IA 3WW2A 4RHV1 3N35A 4Q0UA 1Q8OA 3I2KA 2ZEXA 1SLLA 3GYDA 2WR9A 4HKWA 3H8OA 1NA1B 2L9LA 1PMJX 3LAGA 4Y20B 1PO11 2PHWA 2VMCA 2ZGNA 3QACA 2RVAA 3JD72 1ZZCA 2ARAA 2DUQA 1VBB1 2WRAA 4IW3A 3BGAA 4Q4Y1 4HT1T 1POV3 2CYFA 1DGLA 4O7XA 2RG4A 1S0BA 5F5QA 3URFA 4BQXA 2XVLA 5SV5A 4D6QA 2C5DA 3U11A 5K9YA 1PX3A 4LO7A 3IDEA 1JXNA 3T0AA 3VN4A 2ZGKA 4DOUA 2LUWA 3KMHA 4CPBD 4FPYA 1IPJA 1GLHA 4XDOA 2JDMA 2D43A 2IWGB 4E2SA 2A3WA 1XPWA 2IXLA 1RYYA 5L9BA 1OKQA 2K0GA 1RUD2 1AJKA 3GALA 3RJ2X 3GNEA 1NCRA 1SZBA 4HVQA 4ISQA 2ERFA 4LO6B 1LR5A 1SACA 4LA3A 3VBUC 2GU9A 4GULA 4R9BA 5KR7A 2WZ8A 4IE6A 1ZBA3 1AYN3 4CCLA 5C9AA 5EZWA 2C26A 3FLRA 1QWRA 2P6CA 3N9LA 1I5ZA 1AXYA 1FATA 2KA3A 2WNVB 1LOAA 1ZRFA 2CU5A 3VKNA 4AAPA 4LXLA 4LTAA 4ZY9A 2VMIA 4L0PA 5FOBB 1LJ7A 1UNBA 3SEEA 3A0KA 1UOFA 2FCVA 5EV7A 2OZJA 2HWD1 3GZEA 1JOBA 3LOBA 2NP0A 2VUDA 2DVBA 3WR0A 1EV13 1AYM1 2AH2A 4KBBA 2DTWA 1DGRA 1X9TA 4XE9A 4DNYA 5BNNA 1ZVFA 3AKQA 3NL1A 5KXCA 5CEHA 2EIGA 2OIIA 2RDSA 4AFMA 1K5MB 1N3QA 1OSGA 1R1ZA 1ZZBA 1CAUA 5FO7B 3RGBA 1DFQA 1D2SA 2P3JA 1NKGA 2J1AA 4K1ZA 5SV8A 1RHI1 1C1LA 4HSLA 2DUPA 3DPRA 1PGL1 1W8UA 2DF7A 3U37A 4IEQA 4C1WA 2WNUA 2LRPA 3O1VA 5BYNA 4QPYA 1O3TA 4Z07A 3VBUB 1HRV1 1SBFA 1RXFA 4WM8A 4D8MA 5K4LA 3BI3A 3BU7A 3R4UA 4IV1B 2VO5A 1UY3A 4YM3A 1BEV3 1W0PA 5CYYA 2R042 3HAGA 1F5FA 3RZMA 1NCQA 2ORZA 4BU2A 2ZMKA 3J8F2 4FO9A 5JXGA 4URAA 3KV6A 1JU4A 2BFUL 4D3WA 3ZKYA 2GH2A 4B4RA 2D6LX 1RUNA 1K5MA 2JDHA 4GZ9A 2H0VA 4E4SA 5FMOL 1WLCA 4N7UA 4YPJA 1DQ0A 1LEMA 1QJX2 4S2GA 2YBSA 3B3QE 4YGDA 4CCNA 5I91A 1N1SA 3HNMA 1OLRA 4LHSA 2ZGPA 2RS51 4NMIA 1LODA 3MLLA 1O7FA 1KFUL 3THDA 3NVCA 4GD4A 1RINA 2CHHA 5DDJ2 1W9WA 2I2SA 3PDQA 2X5IB 5HI0A 5ISLA 1RUE1 3SHRA 1KEXA 4FI9A 5LY1A 3P1IA 2YU2A 1BEV1 2XPJA 3M3OA 2QQLA 4YM2A 1V6IA 4Y1UA 1PX4A 1ENRA 5FBJA 4COVA 1Q8PA 4LHLA 4UFIA 3OGRA 5FLJA 2OQ6A 3OBRA 3EQEA 2VL4A 5D8AA 1W90A 5FPVA 5JVVA 4CDQC 5FREA 1HN1A 3BYWA 3AKTA 1GQPA 1UQXA 1W05A 5DZEA 3KHBA 5FUNA 4OVEA 2ARBA 2R073 2ZMNA 3POFA 2YDEA 4P00B 4UFJA 1MEC2 2VUCA 4XYXA 5F2SA 3IM0A 5IFPA 5A6ZA 4Y24A 3WF0A 1KITA 1ZZ7A 1UMZA 1KDKA 1RB8G 4INDA 4K8RB 3VLBB 5IJRA 5IVFA 4EYUA 4QWNA 3ZXLA 2BWCA 1NX9A 4DXTA 3VDCA 1AR91 1CESA 3NNJA 3GJAA 3R05A 1NOVA 1CPNA 4CU9A 4MG2A 4K6BA 5JOZA 3OJBA 1GICA 3H1MA 5CNAA 1UU6A 2D5FA 1RUJ2 2D6OX 1FV2A 4Q4V3 5A70A 1YQ2A 4O9EA 4YFWA 1J83A 1F5JA 5AC93 1MEC1 1GZ9A 3ACFA 2ZEZA 4KG0A 1HV0A 2O14A 2Y0OA 3ACLA 4UI9L 4EN9B 5C8WA 5FCCA 3SC7X 2C9KA 1AYN1 4HK8A 4IV3A 5A7NA 1GSLA 3VBSC 5J7MA 2FDFA 4KL1A 5C5UA 3OY8B 4JV4A 2BUKA 4QX8A 2A1XA 2ZAHA 3AMHA 5DUWA 3LD8A 3P5BA 3LSDA 2Q8DA 4MGSA 4CDQB 2WO1A 1AX2A 1PO21 1UW8A 2G19A 4UYBA 4YNIA 3C7OA 3DECA 5CVRA 4LPLA 4AFDA 1ZBE1 2R043 3HT1A 1CAVA 2XUMA 2FDGA 1QXPA 1YQ5A 1RJ8A 4GH4C 4Q27A 5FKBA 3RRDA 4BE3A 3W20A 3U10A 3PVEA 1GZWA 4NHYA 2ZGOA 1JYWA 4YZ4A 1JZ7A 1XYPA 2BYVE 4UW6A 4XJWA 1W9YA 3AZWA 5CKQA 4LBNA 3TN91 3K46A 4L97A 4A6SA 5FUIA 3KF3A 4OQ8A 1WWYA 5CAZA 4Q4V2 3W9AA 4E4ZA 5T50A 1SFNA 5JSOA 3AZVA 3WW4A 1JYIA 1N1YA 2GNTA 1I9RA 1M4WA 2GN7A 5DUXA 2VOKA 1LHUA 4RR3B 2NMOA 4MH0E 1HXS2 5K0UA 5F32A 1XRUA 1C4RA 3OYWB 1H8TB 2YC2A 3K3OA 3SH4A 2JDYA 2NZ9A 3VZNA 4FFIA 4W65A 1FOD2 3VBHA 5CADA 3WDUA 4CP0A 4QM9A 3W59A 3H9AA 4D6SA 1JODA 2IXJA 1VB2A 2QCSB 4XILA 1HQNA 1TNRA 3I2GA 1H8VA 2YGLA 3NAPC 1AF9A 1NLSA 2VW1A 4L2NA 4Q4Y2 1HQLA 1GWKA 2JB8A 2DYCA 1WW5A 1APNA 4XMAA 1YRZA 1ULFA 3CO2A 4QKNA 3UETA 3ZN6A 4DB5A 4AQSA 4GH4B 2CAUA 3VHOA 2XWBB 1AXKA 4Q8LA 4XBLA 1VRH3 1S4CA 4I09A 4YW5A 1YFUA 1ZRCA 1RUG3 1COV3 3J4UH 1Q3EA 2BNNA 4P9XA 2MEV3 4KNCA 4YVSA 1VBD2 3AKPA 2E32A 3MW3A 3OGJA 3O0XA 4XACA 5JR2A 3ITQA 3ALQA 1OOPA 1FOD1 1US3A 2A6WA 4AVSA 4RN5A 4D7TA 5FQ0A 3ZYRA 1RIRA 3CNAA 5DG2A 4JDNA 3V64A 1Z7S1 3OUJA 4Q2FA 4CEYA 2RE9A 4E27A 2QQJA 5A6QA 5B4XA 1F31A 4N9IA 3ZVXA 4RR3C 2HH9A 4CYDA 1IPKA 1UOBA 3NNLA 3NV3A 5DAXA 3JB8A 4YVWA 2E7AA 2NLRA 5DUVA 2AREA 3QCWA 4N7IA 4EN6B 2PHTA 4F83A 2DFCA 3KD4A 1YIPA 4I02A 4Y5SA 1MPXA 3WP3A 3T0DA 3VKOA 1V6LA 2HWB1 2XBO2 1DLLA 1NYWA 3GBWA 4MXVA 2BERA 4Q4Y3 5LA2A 1O8SA 2R071 1BZWA 2V72A 1HB4A 4MOAA 4YARA 3UK9A 5I93A 4I30A 3NAPB 1AJOA 1RUD1 4GALA 5FBZA 1Q8QA 3LA3A 2VQ0A 3VBOA 3E6BA 1EV12 1W8ZA 4FQ4A 4C91A 2WZR1 3BUCA 1RTVA 5L7OA 3IB3A 4NR1A 3ZXFA 4ORFA 3SISA 4AGVA 4YM1A 3M3CA 2HWF2 4AI0A 2WKKA 5KXBA 1MS9A 1NCRC 4HKOA 3J9SA 5FZFA 5H9QA 5EYYA 5A7OA 3WD5A 4QQLA 2OX0A 4AHYA 2OXBA 3CQOA 4N9HA 1F15A 1OH4A 4LO5B 3WDYA 5CKNA 5IWFA 3NJVA 4Y1YA 3HBKA 1O5LA 1WD3A 4Q5OA 4E4HA 1N3PA 1UL9A 4NIHA 1BVP1 5H9PA 4CVUA 1Q56A 3GXUA 1LEDA 2J1TA 2Y26A 1ZRIA 2QDNA 4Q4X3 2QQMA 1JI6A 3WSOA 1W8OA 1UY2A 4QX1A 3ZKUA 4XDPA 2VM9A 4QX5A 2G4IA 4AOCA 5ERLA 3VKMA 4Q0VA 1JN2P 1H6YA 2WT1A 1AR92 1DP0A 4YW7A 4AR2A 2WN3A 5IFTA 4HZFA 2D5HA 1QJY2 2IFRA 4CCCA 1E57A 2Q5TA 4AQTA 1IQAA 1LOGA 2E7QA 4QD2A 5LWBA 3QLQA 1ULEA 3LIGA 2VMDA 1JOPA 3CLPA 1ULGA 1WA6X 3JXSA 2LTNA 2FQPA 1L7LA 3OEBA 1TZOA 5LBEA 2R32A 1TME3 1RUH2 2ID4A 4OHWA 4AE2A 4GMP3 1WKYA 3LEMA 4FP2A 3WNXA 5JSRA 4PF5A 4QQHA 2EVXA 2PQSA 5FZDA 2GALA 2R0HA 4BMEA 3ZYJB 5J37A 1PZ7A 4QPIB 4XUQA 5FZCA 1SG3A 2YMZA 3B00A 3D6EA 4HANA 5C9AB 2WS93 5FZIA 5D1IA 3ZFGB 3WNMA 4P9IA 5FP9A 4V2WA 3WDVA 4QHZA 3VD3A 1HRI3 3AP4A 5FY4A 3PUSA 2BOIA 2F4PA 3MO4A 4JGZB 2HEWF 3E6DA 2FBEA 3NWKA 2BZDA 4HN0A 3THCA 5IVCA 3WCSA 5J96B 5JIAA 1CAWB 1QJY3 1OVSA 1XXNA 3JQXA 1RUI1 2ADEA 4LULA 4HONA 4XXPA 1XE0A 3I2JA 4JKKA 3KHCA 2P1BA 1W6PA 4AI8A 2WFF3 4TXWA 3LKJA 5G04L 5BNNC 4XAEA 3VBFB 3ZPYA 1S0FA 3GZTB 4BQYA 2R0FA 4LORA 1ND2C 5LA0A 1OD5A 3Q8CA 4MADA 2VOWA 3DF0A 1FAYA 1JHJA 2YC0A 1B35C 3WX5A 1PO23 3FJSA 1KDMA 4UFLA 4HVOA 2BP6A 2WFPA 4XCAA 1HJFA 4UW4A 2VVFA 1QHDA 2D98A 2HWC3 2BWAA 3ABZA 3KCXA 1QIQA 2CY6A 3ILFA 3WG1A 1E5HA 3SNMA 4P9YA 4Q4W3 5DABA 3S6PA 3DKWA 4AVVA 3M3IA 1XNAA 4BWOA 3IDBB 5C9AC 1LOCA 1QJX3 2YBKA 4BCUA 2SLIA 2FDIA 3ZFGC 3NMBA 4MXWA 1R1A3 5DAQA 5L73A 1IZ3A 1LU2A 2VG9A 4XQDA 3Q8AA 4YG3A 2WQZC 4MHRA 3SH3A 4AEDB 2HWD3 3HVDA 1EY2A 1H1AA 1UZ0A 3ZFFA 1VBA1 2OZ6A 5J36A 5FYMA 2EIBA 3VUOA 2Q8CA 3B5LB 5JPNB 4CRQA 5FIXA 5FMBA 2RM23 2W68A 3MIFA 4YZ2A 3M8LA 3NQHA 5BY5A 3BPSA 4XBQA 2AYHA 3CJXA 2VXJA 2WUHA 1W0OA 1V00A 4CEWC 2VMEA 2QQKA 4MLOA 4WM7A 3G7DA 4W4ZA 4N90A 4QB1A 1ND2B 1R1A2 1ND3B 1ZNPA 2YUEA 3N9MA 4YW1A 3B9CA 2FD8A 1D4VB 4JQTA 1EUTA 1ENXA 1AHSA 4ZXEA 3TEWA 4GWJA 4UAPA 2V4VA 1PIV1 4KU8A 5A3NA 2JE7A 3DV8A 2PLV2 3N4MA 4ONUA 1QDOA 2ZX4A 3MIDA 4DINB 2R062 4LHKA 1H2MA 4YW3A 3BN6A 4H55A 2RR13 3ZR5A 4CDXA 3WLUA 1HN0A 2P17A 1S2BA 1VALA 5GZEA 1LHWA 1WA4A 1H2KA 1L7QA 4YZ1A 1MR5A 1AXZA 3J7MA 3OF1A 1OI6A 4FPHA 4YZ3A 1GWMA 1S0GA 1U5IA 1H9WA 3WHUA 1ENQA 4J1WA 4IETA 4KMQA 4AAXA 1NZCA 3GZUC 3QD6A 4A2UA 3RFRA 1VMHA 4AEDC 1CJPA 3OEAA 1RUJ1 2WNUC 4IEWA 3ST7A 5LRSA 1HX6A 1D4M3 1OQDA 1BKZA 1JMUB 4NVPA 2P3YA 3VD5A 1AX1A 5LK5A 1GZTA 1OA2A 4OHXA 3LPFA 1AL0G 4KBZA 1SBEA 1W6QA 4XXAA 4META 1Y9GA 5A7WA 3SKVA 3ZN4A 5IK4A 2GZWA 3LOIA 2O1QA 3FE5A 4CEWB 2NPIA 3KS7A 1QQP1 1BYHA 1U0AA 3E1F1 2V73A 4LEJA 4AGRA 4OZXA 2LROA 3RI9A 4BQ1A 1K12A 1ND3C 2BNOA 2RS31 4HG6B 5A3MA 1NA1C 1Z7S2 1ASJ1 2PA7A 3M3EA 4P5HA 3ZPOA 1PHMA 4LKFA 4XFHA 4Z2WA 5CG9A 5FAXA 4RS5B 2B9VA 2VC9A 4ISRA 4NROA 3O12A 2ET1A 4AQ6A 5JPMB 5F3GA 5T5OA 3TEYA 3HQXA 5JI9A 1O4ZA 4NIAA 2A7AA 4BM8A 4X8NA 2Z4FA 4ITCA 2ZEWA 3T09A 4FVVA 4AI9A 2B8MA 1AX0A 4M0HA 4GWNA 4NUBA 4P9WA 3WDWA 5JAXA 4MGKE 1NY71 1AR81 4NAOA 3WT3A 3PNAA 3BTZA 4X6QB 3RQ0A 2VZQA 3MUY1 4AQ2A 4BISA 1F4AA 5GZFA 4OUEA 3CL1A 3RG0A 1DQ4A 2C4XA 5FP8A 2QZ2A 4LIUA 4Q8KA 4B4PA 1HW5A 4OFGA 1A6CA 1S2KA 3FBMA 1J84A 4GMP0 4JCKA 1XQNA 2VZOA 1XSQA 4GB31 1YJKA 3WF4A 1UN1A 4IERA 2PAMA 4QAWA 1REDA 3IZOA 3ZIXA 4FFHA 2OA2A 5DN2A 3VHPA 3RYPA 4XJ8A 3MBWA 1ONAA 1FMD2 3JUUA 1SQ4A 3V0BA 4JTOA 1WMDA 5DAVA 1XNDA 5FPBA 5J48A 2P5BA 2HWC2 2HBTA 1BBT1 1WMFA 1UAIA 4XF4A 2VCCA 2F17A 3ZXJA 1GOHA 5IVYA 2R6QA 4YGCA 3GBFA 1B35A 4IEPA 1YFYA 1JTZX 4JKLA 4NN0A 1OF4A 1VP6A 2VTXJ 3IT8A 3ZFEA 2ILMA 2E53A 1IPSA 2R16A 4NOTA 3GCWA 2CWSA 1YIFA 3HN3A 1HRI1 4XAAA 4L9BA 1W9SA 2YB7A 2GNDA 2ZGQA 4CEWA 2A6XA 2DBNA 1CVNA 5T3NA 1K5MC 4XPVA 1UMHA 3RZLA 1LHOA 4CZSA 2R1DA 2FMDA 1JHNA 2O8OA 1RUF3 2HWE2 2JKXA 3RZZA 3NO8A 1V6NA 4XJZA 1PGW2 2AC1A 4ARXA 5A3PA 1WW7A 5F39A 2I07B 4ASMB 2ZAAA 3KCYA 4IESA 5FLIA 4Z92B 1VR3A 5BPXA 1UO9A 1RXGA 1F8VA 1REFA 1C5HA 2D6NA 2WWUA 2W46A 2ZS6B 4IV1C 2QQWA 2B46X 4MGQA 4U36A 5E6HA 5F3CA 4F7ZA 1MVQA 1MZ6A 2WABA 4AHZA 1GP4A 1PO12 5HV4A 1XNBA 4XCBA 2JE8A 4AVCA 4LQRA 1QQP2 1W03A 2AEYA 2DCKA 4K21A 2WYSA 3PUQA 4LO4B 5FFOC 5GLVA 5GM0A 3R6SA 5TSWA 4CXXA 1ZM1A 3CZUA 3FHAA 2WZPP 3T2PA 1R64A 4FCAA 2VZUA 2D6PA 5FXVA 3D0JA 3AP6A 4HXCA 5JXJA 5FO9B 2PAEA 4LE4A 1LB2A 1VB4A 2XLAA 2IXKA 1RUI2 1QJZA 4PLNA 1E5IA 1WUVA 3H7JA 4LBKA 4PT6A 5ANNA 4EN7B 1RUC2 1U5ZA 5LEKA 4DRVA 2LALA 1QXRA 4QB2A 2X5IC 5LBCA 3ZYPA 1W2TA 4ES8A 2E63A 5DG1A 3FFQA 1D4M1 4J1XA 5FTTC 3ZDVA 4HSJA 2XJTA 1CAWA 4UFMA 1TME1 2OPKA 3VBRC 3POSA 4KGGA 3VKFC 2D93A 1NY72 2PELA 3AMMA 4DXSA 4UBGA 1I3HA 1FOD3 2QBXA 1CN1A 3VD9A 4WM7B 2FZ2A 5JI7A 1GKBA 5FYSA 5A33A 3AVRA 2ZGSA 2VQAA 5FMDA 3OD0A 4DEVA 3E5QA 4EE2A 5GLUA 1SPPB 1CZVA 1NQJA 1TE1B 4IEOA 4XF9A 4CDUB 2QQIA 3UGFA 1MS8A 3BOPA 2G1MA 3TEZA 4A3XA 3D4KA 1C1FA 3N7KA 1IKQA 5FZKA 4WVMA 5JWPA 2C24A 4J6GA 1QJY1 4FOQA 3FZ3A 1I6XA 1W2NA 5JZGB 1KXGA 3KQ4B 4LOSA 3SCFA 4XHBA 4N53B 2WWSA 3DN7A 1K42A 4DXRA 4XFCA 1HXS3 4AHWA 4CUGA 1VAKA 3UKTA 4CCJA 4B3NA 1PVXA 2PQQA 4BA6A 1YXWA 1T6GC 2PHFA 5LZ6A 1QJEA 4NHKA 2XBO3 1PZ8A 2RDNA 1KS5A 2RDQA 4QPGA 5FP7A 3H8XA 1FXZA 3AP7A 3LQCA 3T2QA 4ZONA 3USUA 3WCRA 3V0AB 3EMRA 4XVHA 4FPEA 4XF1A 3SLIA 2XR4A 2YG0A 2VXRA 4GKYA 4QPGB 3VBSB 3K48A 2FHRA 4LBJA 1C28A 3VDDA 1OA3A 1ENSA 4AVAA 1H6XA 3NRUA 4MZUA 5LY2A 3WF2A 3THTA 1ZBA1 4XABA 4WM7C 1YWKA 4ZZ8A 3K3NA 3CKHA 4G4FA 2Q0AA 4G3YC 4CSWA 4AF9A 4XHXA 3ZYHA 5F7UA 4UW5A 3TN93 5BUVA 5FQ0B 1SHWB 2PHRA 1S0JA 3GCXA 2HWD2 4OYUA 4QQPA 3MZHA 2VECA 2CNAA 4XQWA 4CDUC 4I3PA 3AK0A 3ZFFC 1RL3A 1GOFA 3O7OA 1L3JA 1EUUA 1RUH3 3IMNA 5IYYA 1BXHA 3RI8A 5FMCA 4Y4RA 2GMEA 2RS33 3UJQA 3DGTA 1UD1A 5JZGC 1GZWB 4NWVA 1WW4A 5FZAA 5A32B 1UZZA 1O5UA 5A3OA 4PDWC 2ORXA 4DEQA 4XURA 2OUJA 4IE5A 1ULOA 2DU1A 2QJVA 3LFMA 3MFCA 1DGWX 3UV9A 4RQPC 4FPOB 1Y43B 4IL7A 5BNPC 5KXEA 5IW0A 3WW1A 1C8NA 2IVIB 3GF6A 5HXVA 3ELNA 4E4DX 5EIYB 5JOYA 3PVNA 1CWPA 5DXDA 2EXHA 3JB4C 5C7GA 4QKFA 5FZ1A 2UY8A 2QVSB 2QQUA 4Q4X2 4RGAA 5F9TA 4QPGC 4XUPA 1LOFA 2RMU2 3Q8EA 5FYCA 2Y0IA 4PHZA 4WV8A 3LF7A 4TLFA 1WMEA 3TB0A 3C2UA 1JYXA 3I2HA 2VGDA 4W8JA 3E97A 1V6OA 2AACA 2CL2A 2DVGA 3HR9A 5F3IA 3TAYA 2VZ1A 3I49A 1TVGA 2XVKA 1OKOA 3G6JB 4AWDA 1J3QA 1MZ5A 3B01A 4DXZA 1GBGA 3VBUA 1AR82 4BPZA 4BXSV 4D69A 1UWWA 2DCYA 4NO4A 1RMU3 3PU3A 3LIHA 5F6LB 3MHZA 3I59B 4YVSC 3ORJA 1OF3A 1UU5A 2Z79A 5IAVA 3WNNA 2RS12 3KM5A 1AR73 4BK5A 5L19A 3ILNA 2DBIA 2P4EA 4CTEA 5FXWA 4NIDA 1OFSA 4Q0SA 1LAJA 2R063 2XJSA 1CX1A 5CG8A 2RDRA 1XOYA 4PDWB 2BEOA 1W9FA 2D7FA 4YG0A 4O9GA 3OBTA 3EO6A 2CGPA 2Z2SB 4RQPB 1SDWA 5D2AA 5BNPB 2GP3A 1WCQA 2XWJB 4IEVA 3NAPA 4I0BA 2Y34A 2A6ZA 3AKSA 3UJOA 3WUDA 4ZHNA 3H1WA 3MIEA 4XUOA 4FSJA 3OPZA 3FC0A 4GKXA 3LZZA 3POGA 4LKSA 4KWUA 1UYYA 3AXDA 3FUOA 3MV01 4TYSA 5L7OB 2RR11 2VMFA 5DUUA 5HCHA 1YQ6A 5CFDC 1NLRA 4CXYA 4GB32 3RWKX 4C0BA 2D6MA 2RM22 2DVFA 3OUHA 4MX3A 4GJZA 3TN92 2VPVA 3MPBA 1SLTA 2B9UA 5T5PA 3UGGA 5CBLA 3WNKA 5FR3A 2W0XA 1KGYA 3AYCA 4XJUA 1FYUA 1XB9A 3ENRA 2Q30A 4R9AA 1NUKA 3ZOIA 2V5DA 5T55A 2I45A 1JS9A 3RWNA 4H7LA 2A6YA 3O1TA 1FPN2 4AYUA 1BHGA 4OMDA 3ZYFA 2GP5A 3MGUA 4DQAA 1R093 2HEVF 1NCRB 5FZ7A 4LK6A 4YVSB 1LGCA 4AI1A 2RM21 1UKGA 2R072 2WLQA 3L2YA 4Y22B 4PBOA 3ZM8A 5IHRA 5LASA 2HWB2 2ZHKA 3BALA 1S0EA 2XQRA 5IVBA 1H30A 4BXFA 4A7KA 3WEZA 4PLMA 4Y22A 1AR63 3UYJA 3CDZB 3M7AA 3AX4A 5EWSA 4WM8B 1W8WA 1N1TA 4S2FA 2EALA 4CU6A 2YBPA 5FK7A 1W6OA 2A71A 3I97A 1TNFA 2CWMA 2VOVA 4GWMA 5FPUA 3PTRB 4LLOA 5LCWL 2W5FA 4OHVA 4SBVA 1O3RA 1US2A 1YO8A 5F6KA 1QJU3 4XETA 4HFSA 2WINB 4A7YA 5L7OC 3VZKA 4M3CE 5KBFA 2XJRA 5CFDB 1OBNA 3C7FA 2VZVA 1NXD1 1ALYA 1MZFA 1GWLA 2HWB3 3FHQA 4GMP1 1DQ2A 4XJ9A 3ACHA 2AENA 3A21A 3T08A 1OXCA 3RMXA 3V65A 4QHBA 4Y26A 2WNEA 3LWCA 2MNGA 4FAHA 1OLQA 1SLIA 2AZ5A 4FP3A 4JRAA 1NE6A 2RJ2A 4W6WA 1CIYA 2NM1A 5CFDA 3AFGA 4DZGA 1W6NB 4AHXA 4Q0QA 4SLIA 3AJZA 1PM4A 3ZYIB 4AI3A 3Q9OA 1JOJA 1OPOA 2WS92 4XFFA 3GJBA 3WXPA 3DYMA 3IKWA 3JCIA 2WL1A 4AG4A 4UBHA 2ZBJA 3AKRA 2PAKA 2EIDA 3A22A 2DU0A 1W06A 2W47A 2OQ7A 3WG3A 2VH9A 3WP6A 4ASKA 5IVJA 1RUI3 1DYKA 1UIJA 1MS1A 2A3YA 4RSUA 1RUG2 3O1PA 1G7YA 4QPIA 2RS13 4JGZC 2RS32 1UIKA 2IXHA 5A3LA 2JG8A 2YYOA 1IGOA 4Y33A 1J58A 2VTXA 1DG6A 1DGWA 2WO7A 3CHXA 4BMBA 5JXIA 2B39A 5I0TA 3H3ZA 1GUIA 1V9U2 1UKRA 1VAVA 3MDPA 3OBAA 2Y60A 2XBO1 4IXLA 1GV9A 1JBCA 3WY6A 4IGOA 4ARYA 3GHMA 3FMGA 5A3UA 1PMIA 3RPQA 2V4AA 5AFEA 3S7IA 1QJFA 1ZA7A 5BNNB 5A1LA 1JZ8A 2WA4A 3TYJA 1G9BA 2BGOA 3LGRA 2XOMA 1J3RA 4KI5M 3ILRA 3ES4A 4QMAA 4CDXB 2GAUA 3U75A 3C8XA 3E5UA 2VNOA 3OY8A 3ZMOA 1DZRA 2VU9A 3VDDB 5I8YA 1FX5A 1UF2C 4P9JA 5GALA 2QNKA 4A3ZA 5C3SA 2XHKA 1MQTA 1VPHA 4N8MA 1RHI3 1RMU1 2MEV1 2WSUA 5JDBA 5FZ3A 4CDWA 2ZZQA 1M06G 3C7HA 2XJUA 2OUHA 1JUIA 1LENA 4NHLA 4I0WB 4C0HA 3OYWA 2B7YA 2V09A 1QEXA 5A3WA 4OUSA 3IAQA 1AYN2 2QQNA 5DMYA 3WVJA 2DTYA 1X33A 2J1EA 1FPN1 3MI8A 4QB6A 1EPWA 3P3NA 2XB6C 5JZGA 2VCBA 2C9AA 1OURA 3WNOA 5GLWA 1XSRA 3PJQA 2X29A 1OFNA 2JIGA 1SLBA 2XJPA 3KSCA 1WGPA 2ATFA 1AR62 2DUOA 2GC0A 3R0RA 1Z78A 4ATEA 4BOWA 3P6BA 3T2OA 4PLOA 2ZX2A 4A45A 2R30A 5F37A 3PTYA 2JG9C 1VBE2 5F1RA 1HKDA 1V9U3 4XC9A 4H14A 2A5ZA 1O59A 4CDXC 3HNYM 5ABJB 3GHNA 1CONA 2K46A 4HKLA 3ZX7A 4QU2A 2GN3A 1AVBA 4ZXKA 5A6YA 1POV0 2Q8EA 2TNFA 3ACIA 1ZRDA 2W39A 4H2AA 3KVAA 4FXKB 4P9LA 2UYBA 3VBHB 2WQ4A 4A6OA 2O0OA 2Z69A 4A7ZA 5FO8B 3HWJA 5FY0A 5DAWA 1NG0A 2ZJCA 5F3EA 4MGIE 4AVTA 1X8MA 1H0BA 1V6KA 3SMHA 1JZ3A 1SEFA 3D8CA 3MUZ1 3OPTA 5BNPA 1X82A 4PI2A 4GIQA 1VRH2 3AC0A 1HJGA 1UY1A 2Q1ZB 3GDBA 3JZVA 3AYEA 1UU4A 3N9NA 3W5MA 3S30A 3J8F3 4MGZE 4NHMA 1EYBA 4Q29A 1A8MA 3I2FA 3PHMA 4P5YA 2BOJA 3ZIWA 5A32A 1Z0HA 2WNUB 5DZGA 3JBG1 4NPRA 2RS52 4BQ2A 4COZA 2VOTA 4M4RA 1H1MA 2ZGLA 4QXKA 5HCBA 5JOWA 4P14A 4YLZA 5KC6A 2EXJA 3BPZA 3WP5A 2PTMA 1H2LA 1OQ1A 4CP9B 1V70A 4JVAA 1KJLA 2JG9B 2X09A 3C7EA 2Y8KA 4K7JA 1H4GA 4XTPA 2HKXA 1A8DA 3FFZA 4OZOA 4Q4V1 3K51A 4MYEA 4CA9A 1ZA4A 4AGGA 3PUIA 2HEYF 1GYKA 1W39A 2KD7A 1YLLA 2VUAA 3CBNA 4GAZA 4XFBA 5M0TA 1LHNA 4IEUA 5JUVA 3HQRA 4MSVA 3AZXA 4QPWA 4RS5C 2W1UA 2J1VA 1H4HA 2VCAA 4IV3B 4LNVA 4L11A 5EYXA 1GNZA 1H8TA 2RS53 3RYRA 2BVBA 4AEMA 3WG2A 3VBHC 3PVBB 1XNCA 2VBDA 3KZ4C 1VBA2 1GP5A 2ZMLA 3VZLA 5FZGA 4NPMA 2DWRA 2FDJA 1HB1A 3AMNA 5HBAA 4Y5Z0 2CGOA 1AR61 1FPN3 2JDZA 4LE3A 1LCLA 1YQ8A 3W21A 3IMMA 3W58A 5C71A 3CEWA 5JCTA 4QDRA 2RJKA 3U14A 1W8NA 2PHLA 3AFKA 5FDBA 5ACA2 2B42B 1CQ9A 3SEPA 2ZCWA 4BQ4A 1LRHA 1LOEA 3J7LA 3PMEA 4DO0A 1UY0A 5CA6A 1NAEA 4WVMB 2E9QA 2JIJA 3O0VA 1Y7BA 1E5RA 2GNBA 5A7PA 3V0BB 4K9SA 2P6HA 2Y33A 4A41A 4U2AA 4H3WA 3UESA 1IHMA 3ETQA 4LBOA 3S7EA 4CEYB 2IFWA 3CIHA 5CFCB 4R9DA 2NQYA 4PCRA 5T54A 3U07A 1GQHA 2LM3A 3ZMNA 5FP3A 1DU3D 1H2NA 5D8AC 4XZUG 5GZGA 2W87A 5FZ4A 1OHFA 1J1TA 1DGRN 1GNYA 1OA4A 3OGVA 2XHNA 2JWPA 3MLKA 2EXIA 4M0NA 4FXGB 3N3HA 1W04A 3NSTA 4PQ9A 3RMYA 4V1PA 3I4IA 2J7MA 5IVVA 2W95A 2VZRA 3BCWA 3ZSJA 3LDRA 4IV3C 3VBSA 3C3VA 5KHGA 2FDKA 1YEWA 2PN5A 3POJA
chains in the Genus database with same CATH topology
4WZCA 1Z7S3 3H3UA 1DF0A 5FOJB 4YYOA 4KQ7A 2HWC1 1DQ5A 3OGGA 4K20A 4HVRA 3MFAA 1EP0A 3VZJA 5T52A 4MUVA 4M3CB 1IKPA 3KQRA 1QF3A 1VBB3 3PJYA 1NXMA 1TMF3 3NKTA 4HLTA 1DZTA 2GC2A 1RUJ3 1VRH1 1HDKA 4JQRA 1LECA 4OI1A 5HCAA 2YZ4A 3VV1A 1N1VA 3I54A 4M00A 1ZZ8A 2ARXA 1NQDA 4L8QA 5J3UA 1X8EA 5J98B 4CEYC 4AW7A 5ABJA 2KXLA 4B7EA 1W2UA 2D3SA 3MPPG 5D8AB 4YW4A 1WBLA 3B02A 3ZN5A 4YGEA 4AK3A 3RSJA 5T5LA 3DPRC 1PVC2 4COYA 2DCTA 3JQWA 5E1RA 2MPFA 2PLV3 1G9FA 1RVF1 3V56A 5KXDA 1SBDA 4QGMA 1FT9A 2BGCA 3M4FA 2JD4A 4Z82A 2ZHLA 2PHXA 1R091 1GFF2 3B93A 3H8UA 3HD8B 3AP5A 2EA7A 1D0HA 2H6BA 4LR4A 1LOFC 5KC5A 3MZHA 1YHFA 1FNYA 3MW4A 4N43C 2WA3A 1BMV2 1AYM3 1FI2A 3BTAA 4RHV3 3VBRB 4QM8A 2UY9A 4PJYA 1ND3A 3NV4A 3WINE 1XYOA 3HMYA 3KGZA 2A73B 1C57A 2JE9A 4Y20A 2N7GA 2Z42A 2WC2A 5FPXA 2JENA 5J09A 2ES3A 3RDIA 4EJRA 5B2GB 1OPMA 3WG4A 3PVOA 1WLTA 1WW6A 2Q1MA 1PZ9A 3WQ0A 1A78A 3GBGA 3NV1A 4KWLA 4N53A 3CU7A 1A3KA 2E7TA 4PIXA 3IN9A 1OOPB 3DPRB 4AEDA 2JX9A 4EV0A 1UCXA 2UYAA 2K9ZA 2FMYA 1HRV3 1DZQA 4EN0A 3VHRA 1COV1 3WUCA 4HK9A 4N53C 1DBNA 3O14A 5GJ6A 3TNQA 5CFCA 1F9KA 4DPNA 4AFCA 5KWRA 2DVDA 3J8F1 3MLJA 1CPMA 1CAXA 4N43B 3MICA 4PBPA 2BTVC 1MQTC 4YG6A 1REEA 1RUC3 3MW2A 1VBE1 3VL9A 3ECQA 1CAXB 4N43A 2WNVA 2WLPA 2ZZJA 2SBAA 1R083 2PYTA 1QOTA 3H50A 5AFBA 5DZFA 4GXLA 4JGYA 2WZR3 4QGLA 2AUYA 2C1FA 3L9JT 2ENRA 5I0RA 4XDQA 1VIWB 4IEXA 4PDWA 4E9KA 4R9CA 5C8CC 4CP2A 5EXOA 3ZFFB 4I3GA 1OOPC 2QZ3A 3AYDA 3QBQA 2UURA 1VJ2A 4MGYE 1ZREA 3WQ1A 2OW4A 1NE4A 1VBC3 4LUMA 1TME2 3N7LA 2K2SA 4FPFA 1TMF1 1RMU2 3O0WA 4QQOA 2XJVA 3RS6A 1N47A 3TWIA 3ZFGA 2ZTNA 1AR71 2YGMA 4B7KA 4D7SA 5KHKA 1CAVB 1HXS1 4NWWA 1JW6A 2ZABA 3APBA 2ZPXA 4Q1PA 3FUQA 1ASJ2 1C3HA 4LO8A 1MACA 1IS6A 1WD4A 4D7YA 3IBMA 1U5YA 3V0AA 1MQTB 2IXCA 1D0GA 3BOWA 1LHVA 2X5IA 2VUJA 1IS5A 3KT1A 5FMOS 3D82A 2ZGTA 1MS3A 1QNWA 2R1BA 3VBFA 5AC92 3S0MA 4FTEA 5BV6A 4XTMA 1DDLA 3B94A 3H0OA 1PVC3 2XL7A 3WQ7A 2ETEA 5KHIA 4HPKB 1SLAA 2NN8A 5C8CB 4L92A 2WJSA 5CB7A 4B4QA 2A6VA 3IDCB 4XJAA 3AJYA 2ET7A 2DCZA 1MS5A 2GDFA 1KJRA 1HIXA 4Q26A 3UKVA 1XE8A 3UKNA 4DY3A 2WFF2 3JU9A 2H0BA 2P34A 2E6VA 4FBFA 2X8KA 5ACA1 4S2HA 1AL23 5FLHA 1XE7A 3QOPA 2ZHNA 3JD71 5DDJ3 4FPLA 1MS0A 3LSEA 5EFUA 4R52A 2GMMA 5GZDA 1LU1A 3PLQA 1X36A 2ZOEB 4QT6A 1R092 1DYPA 4FPCA 4LBQA 1I1EA 2P2KA 1MVEA 1GQGA 2GSYA 2ZKLA 3QH7A 5GLZA 1R081 1VBC2 5CIRA 1UPSA 3FLTA 3ROUA 1XU2A 1PNGA 4RGGA 1LESA 2HWF1 5IK7A 4Y4YA 2CAVA 1CIWA 4K40A 5GLTA 4AVBA 4KWKA 1UPIA 1VBD3 2AGSA 2JEMA 3JBG3 4Q4W1 2WZR2 4D94A 1PNFA 4Z1VA 2BW8A 5LK7B 3POYA 1V6MA 3MYXA 2XVGA 4Y1XA 2WSVA 5JLVA 4OUMA 2RMU1 3SCHA 2RHPA 2IC1A 4Q0PA 1MEC3 1QJU1 1KRIA 1SFYA 4DRRA 1POV1 4S2DA 4IV1A 4WM8C 4EROA 2GNMA 2YV8A 1R1A1 4OHYA 3EBRA 4BLIA 5A33B 1HLCA 1UZYA 3IPVB 5I0SA 3USSA 2FZ1A 1FMD1 3HN1A 4ATFA 2ZGUA 2WIIB 1HV1A 5GKAC 2ZX1A 1VLNA 1BBT2 1VBD1 2EAKA 2ZX3A 4GA9A 5KHHA 2R49A 5I8TA 2B5HA 2WNVC 3WHTA 3SCGA 5E89A 1AL21 1G9AA 1Y9QA 3POWA 3TOJA 3MF6A 4HBNA 3RJRA 3ZFEC 2A70A 4XIKA 1S0IA 1IOAA 3A4UA 2O8QA 4IQPA 1GNHA 3H7YA 2RS11 2W08A 3MIBA 1NA1A 1HRV2 1YFXA 5K0UB 3T1MA 4RR3A 4YVWC 1HQWA 4RQPA 5T5JA 4HETA 4LA2A 4YW2A 2DV9A 3ZXKA 2NYYA 4XFAA 1BK1A 5I8SA 1WCSA 3B69A 4XW3A 4FOYA 3BODA 3AYAA 4KGQA 1TQ5A 1HRI2 2R061 4F8AA 1Q8VA 1ZZ6A 1C8M3 3I8TA 1BQPA 4XZPA 2ZGRA 3O5SA 2YHJA 5AVAA 1QQP3 1EAH3 3PMSA 1GR3A 4Q4X1 1RGSA 3EJKA 4RL7A 1CD3G 4KWJA 3M2MA 4LBLA 1GANA 3M70A 4I0AA 3ES1A 3MIHA 4WVZA 3VDDC 2UWAA 1O3QA 4BYYA 3ZFEB 4UXAA 4JRLA 2PHUA 3SH5A 1ZZ9A 4QGNA 1U12A 3VGIA 3AB0A 4CDWC 3AMPA 3M3QA 3I2DA 1XYNA 4AI2A 1QMJA 1QXJA 5C4WA 2A3XA 5K0UC 1QOOA 4YVWB 3A0NA 3KT4A 2Y38A 3KGLA 3IIAA 1BBT3 5E88A 3LCPA 4XEZA 4XF3A 3KLSA 1U5XA 1YUDA 4JDOA 4OI4A 1VBB2 3CJIA 3MIGA 1PK6C 3I7DA 1PIV3 4I2OA 3IPVA 1QNYA 2DCJA 2WS91 4WZFA 3INAA 1IS3A 1QDCA 2VMGA 4R8HA 2IXIA 3ZSKA 1QH6A 4ZKTB 1QU0A 1LTEA 4MXWB 4JGZA 3SXWA 4AEJA 1YNAA 3VKLA 2D3PA 4BIOA 2VW2A 1ZYBA 3ASIA 4LBQD 1SLCA 3VHNA 1WLWA 5ABJC 2A75A 3KT7A 1LKNA 4F3JA 5BNOC 5EJ3A 2TBVA 4FAGA 4EWAA 1DQ1A 4EWDA 2QFEA 1SMVA 1BJQA 1ULCA 3USUB 3AXEA 3L2HA 4JAAA 3VBRA 4CDWB 1MZEA 1RJ7A 1B09A 3BB6A 1KD7A 4YRDA 1RITA 2ZKNA 1Q8SA 2JKBA 1EAH2 4RFT0 3OCPA 1OMIA 4GB33 1CGPA 1YJLA 3E6CC 2QUOA 4HMZA 1PK6B 3BIWE 4WBBA 4C1XA 1W6MA 3AZYA 1ZBE2 2E51A 1O4YA 3JD73 3KCCA 1QH7A 2ZHMA 1QOSA 1G9DA 4Y1VA 4K3UA 1EAH1 1W6OB 4BHPA 2UWCA 1BEV2 1JUHA 1VAMA 2GH8A 2GMPA 1D4M2 2AR6A 3W58A 5HCFA 1PO13 2YROA 4COUA 1C8M2 2CTVA 2MEV2 1WCDJ 3WP4A 2ZACA 1S0CA 1RC6A 2OVUA 5BNOB 3MEPA 1CX4A 4BZ4A 3VZMA 2VW0A 4K1YA 5C8CA 2RR12 3IWZA 4FOVA 3ZDSA 5FPZA 3VBOC 1ZRRA 3WDXA 1H9PA 4IEYA 1D2QA 4WVWA 3T1LA 4JGYC 1TMF2 5JSPA 1ND2A 1X50A 4FPGA 4GQ7A 1G86A 4H7MA 4JDMA 4LT5A 5K7PA 2P3KA 2OYZA 1H8TC 1WBFA 3KB5A 3ZXAC 1J3PA 3R4SA 4JC1A 4LUKA 5IUQA 2QQPA 4LBMA 3NW4A 2RJLA 1JH5A 5BNOA 1EPZA 4KU7A 1AYM2 3LA2A 4QQ2A 4TWTA 5CFCC 1AZDA 2TUNA 5CU1A 5AVPA 1FMD3 3GZAA 1UX6A 2XLGA 1CJDA 2EAAA 4FT8A 4OLLA 4CP1A 4HL0A 3RYKA 2VVEA 1RUE2 4CDQA 4FPKA 5E8AA 5DDJ1 2EF6A 1W6QB 2CGNA 3UL2A 2XH6A 3AMQA 2D40A 2YY1A 3I59A 1PK6A 1VBE3 4YFZA 2D3RA 3AM2A 2BNMA 3TRSB 3VBOB 5E16A 2QDRA 3ZN6B 1RUOA 4JGYB 4DY5A 1KQRA 3P3PA 5JR7B 3NV2A 2ZA9A 4MVTA 4ZU5A 4Q1RA 2XLFA 2C0ZA 4XF0A 2XL9A 3JBG2 5C4WC 4L99A 3HT2A 4XBNA 4OULA 4ES9A 1C8M1 2GC3A 2UWBA 3RNSA 3T2TA 3THPA 3WDTA 2BQPA 2IZWA 4FPJA 1O91A 2BFUS 5LRRA 1AR93 1WLDA 4PIYA 3WW3A 1O3SA 4EN8B 4FTBA 1NCQC 2PLV1 1RVF3 2NMNA 2RMU3 1BMV1 4OI0A 2XGXA 1PIV2 2D6KA 2VOXA 1YYNA 2D97A 3FWEA 4XQ4A 3ZYGA 1S1AA 4P9GA 2H6CA 3NKGA 3DL3A 1G9CA 4TZDA 3SITA 2JG8C 2JICA 2P37A 3B7MA 1F2NA 4CDUA 2EXKA 1J1LA 2VVDA 4GH4A 3WV6A 4BLJA 4G9SB 4DMIA 3QH6A 2G9FA 3LB9A 4W6YA 1YCIA 2HWF3 4ZU4A 1JYCA 1QKQA 3D5OA 4AXOA 1FV3A 3H1YA 1PVC1 3MF9A 5C4WB 1QGLA 4RHV2 3HIFA 2P3IA 5BNQA 4LHNA 4M3CF 4COWA 4ZU7A 5FRAA 1KFXL 1O4TA 2WFF1 1IS4A 4YZ5A 3FBYA 2V5YA 2JECA 1G8WA 2Z5WA 5KHJA 2Q8OA 5ACA3 2DVAA 1NCQB 4K8FA 2XKOA 3M1HA 4R4XA 3WOGA 5JMCA 4OHZA 4FQZA 1YFWA 1DHKB 1Q43A 2B45X 4Z8BA 2BPA2 3ZSLA 3E5XA 2DFBA 4XFIA 5H9RA 5LEJA 2JG9A 1RUF1 1EV11 2KM2A 1ULDA 1AUYA 3HBZA 4LBQB 1QY4A 3FHIB 4I01A 5JIUA 1AL22 2JG8B 4AFBA 5GZCA 5IK5A 2VY0A 2ZX0A 4QPIC 4FTSA 4Y1ZA 1YI7A 2XJQA 2MHFA 4KG8A 5IK8A 1CAUB 3J26N 2W52A 3VZOA 1R082 1VBC1 4YGBA 4R4ZA 3EXUA 1S55A 3FLPA 4HN1A 5IT6A 1V9U1 1VBA3 3OD4A 2TEPA 5K8SA 1W6NA 1LGBA 1DIWA 2CV6A 4E2QA 1XNKA 3CJIB 4YSFA 1SCRA 4DFSA 3ME2A 3ZXGA 1RUG1 2VULA 4URTA 4B29A 1Q5OA 2WT0A 2VMHA 3FX3A 1URXA 3AP9A 4M3CA 1Y3TA 4KH9A 4TSVA 1PO22 4RA0A 1BCXA 1RVF2 2G9GA 3VBFC 4C90A 5I0UA 5C33A 4YM0A 4IEZA 1B35B 1C5IA 1WCKA 1PM7A 4B8EA 1ASJ3 3LA7A 4FOWA 2JJ6A 3X29B 4BH9A 1TEIA 4AEKA 1PGW1 3DUIA 3WZ1A 5H9SA 3TBDA 3ZO0B 1ZBA2 3TNPB 2HWE1 4X6RB 1SCSA 3CF6E 1RUE3 1LULA 1DQ6A 2WT2A 1N3OA 4RD7A 2VNGA 1FNZA 4OI2A 1G6NA 2YPJA 1PGSA 4DS0A 2XG3A 2PFWA 3ZXDA 4UW3A 1QJX1 2DURA 3CJIC 3D0SA 2HYKA 2X53S 1W6MB 2HJIA 1COV2 1KS4A 2PHDA 1AR72 2YXSA 1V6JA 4XFGA 1GZCA 4XOGA 3N7MA 2UU8A 2JXAA 3VL8A 5L36A 2GC1A 1OQEA 3N7JA 2QKDA 2BVVA 3NJZA 1W6PB 2D44A 2VNRA 2ZGMA 3N36A 3ZSEA 3B9IA 2Q4SA 1RUF2 2HWE3 4PIZA 2XKPA 4MV2A 4M01A 1S0DA 4RS5A 3EHKA 2I74A 5BXXA 2F6BA 4XMIA 1CR7A 1QJU2 5JOXA 1PGL2 1XU1A 1RHI2 4BIFA 5AC91 1J59A 1AR83 3OTFA 4ASLA 2BBVA 2QE3A 4Q4W2 1RUD3 4LLFA 1YI9A 5C6CA 1ZX5A 1RUH1 3R4DB 3AZZA 4EWEA 4E2GA 1LOBA 4WVVA 1RUC1 1MS4A 3ZXEA 3ATGA 1LGNA 4XIOA 3ZSMA 4AFAA 1X7NA 1ZBE3 2R041 4HPKA 1BVVA 4JTNA 4X8PA 1H1IA 3WW2A 4RHV1 3N35A 4Q0UA 1Q8OA 1SLLA 3GYDA 4HKWA 1NA1B 3LAGA 4Y20B 1PO11 2PHWA 2ZGNA 3QACA 3JD72 1ZZCA 2DUQA 1VBB1 4Q4Y1 4HT1T 1POV3 2CYFA 1DGLA 1S0BA 5F5QA 3URFA 2XVLA 5SV5A 2C5DA 3U11A 5K9YA 4LO7A 3IDEA 1JXNA 3VN4A 2ZGKA 4DOUA 2LUWA 3KMHA 4FPYA 1IPJA 1GLHA 2D43A 2IWGB 4E2SA 2A3WA 2IXLA 1OKQA 2K0GA 1RUD2 1AJKA 3GALA 3RJ2X 3GNEA 1NCRA 4HVQA 4ISQA 2ERFA 4LO6B 1LR5A 1SACA 4LA3A 3VBUC 2GU9A 4GULA 4R9BA 1ZBA3 1AYN3 5C9AA 5EZWA 3FLRA 1QWRA 1I5ZA 1AXYA 1FATA 2KA3A 2WNVB 1LOAA 1ZRFA 3VKNA 4LTAA 2VMIA 5FOBB 1LJ7A 3A0KA 5EV7A 2OZJA 2HWD1 3LOBA 2NP0A 2DVBA 3WR0A 1EV13 1AYM1 2AH2A 4KBBA 2DTWA 1DGRA 4XE9A 4DNYA 5BNNA 1ZVFA 3AKQA 3NL1A 5KXCA 2EIGA 2OIIA 4AFMA 1K5MB 1N3QA 1OSGA 1R1ZA 1ZZBA 1CAUA 5FO7B 1DFQA 1D2SA 2P3JA 4K1ZA 5SV8A 1RHI1 1C1LA 4HSLA 3DPRA 2DUPA 1PGL1 2DF7A 4IEQA 4C1WA 2WNUA 5BYNA 4QPYA 1O3TA 4Z07A 3VBUB 1HRV1 1SBFA 4WM8A 3BU7A 3R4UA 4IV1B 4YM3A 1BEV3 1W0PA 2R042 3HAGA 1F5FA 1NCQA 2ZMKA 3J8F2 4FO9A 4D3WA 2BFUL 4B4RA 2GH2A 2D6LX 1RUNA 1K5MA 4E4SA 2H0VA 5FMOL 1WLCA 4N7UA 1DQ0A 1LEMA 1QJX2 4S2GA 3B3QE 4YGDA 5I91A 3U0ZA 3U4XA 1N1SA 1OLRA 2ZGPA 2RS51 1LODA 3MLLA 1O7FA 1KFUL 3NVCA 1RINA 5DDJ2 2I2SA 5HI0A 2X5IB 1RUE1 3SHRA 1BEV1 2XPJA 3M3OA 4YM2A 1V6IA 4Y1UA 1ENRA 4COVA 1Q8PA 4LHLA 5FLJA 3OBRA 3EQEA 5D8AA 5JVVA 4CDQC 5FREA 3AKTA 5DZEA 4OVEA 2ARBA 2R073 2ZMNA 2YDEA 4XYXA 1MEC2 3IM0A 4Y24A 1KITA 1ZZ7A 1UMZA 1KDKA 1RB8G 4INDA 3VLBB 3ZXLA 2BWCA 1AR91 1CESA 3R05A 1NOVA 1CPNA 4K6BA 5JOZA 3OJBA 1GICA 3H1MA 5CNAA 1UU6A 2D5FA 1RUJ2 2D6OX 1FV2A 4Q4V3 4O9EA 4YFWA 1F5JA 5AC93 1MEC1 1GZ9A 4KG0A 1HV0A 2Y0OA 3ACLA 4EN9B 5C8WA 5FCCA 4HK8A 1AYN1 5J7MA 4IV3A 3VBSC 1GSLA 4KL1A 3OY8B 4JV4A 2BUKA 2ZAHA 3AMHA 5DUWA 3LSDA 4CDQB 4YNIA 1AX2A 1PO21 1UW8A 5CVRA 4AFDA 1ZBE1 2R043 3HT1A 1CAVA 2XUMA 1QXPA 1RJ8A 4GH4C 4Q27A 3RRDA 4BE3A 3U10A 3PVEA 1GZWA 2ZGOA 4YZ4A 1XYPA 2BYVE 4UW6A 4XJWA 3AZWA 4LBNA 3TN91 4L97A 5CAZA 4Q4V2 3W9AA 4E4ZA 5T50A 1SFNA 5JSOA 3AZVA 3WW4A 1JYIA 1N1YA 2GNTA 1I9RA 1M4WA 2GN7A 5DUXA 2VOKA 1LHUA 4RR3B 2NMOA 4MH0E 1HXS2 5K0UA 1XRUA 1C4RA 3OYWB 1H8TB 3SH4A 2NZ9A 3VZNA 4W65A 3VBHA 1FOD2 5CADA 3WDUA 4CP0A 4QM9A 3W59A 3H9AA 2IXJA 2QCSB 1VB2A 4XILA 1HQNA 1TNRA 1H8VA 2YGLA 3NAPC 1AF9A 1NLSA 2VW1A 4L2NA 4Q4Y2 1HQLA 2DYCA 1WW5A 1APNA 4XMAA 1YRZA 1ULFA 3CO2A 3ZN6A 4DB5A 4AQSA 4GH4B 2CAUA 3VHOA 2XWBB 1AXKA 4Q8LA 4XBLA 1VRH3 4I09A 4YW5A 1YFUA 1ZRCA 1RUG3 1COV3 3J4UH 1Q3EA 2BNNA 4P9XA 2MEV3 4KNCA 4YVSA 1VBD2 3AKPA 3MW3A 3OGJA 3O0XA 3ALQA 1OOPA 1FOD1 4AVSA 2A6WA 4D7TA 5FQ0A 3ZYRA 1RIRA 3CNAA 5DG2A 4JDNA 3V64A 1Z7S1 4Q2FA 4CEYA 4E27A 2RE9A 1F31A 4N9IA 3ZVXA 4RR3C 4CYDA 1IPKA 3NV3A 3JB8A 4YVWA 2E7AA 2NLRA 5DUVA 2AREA 3QCWA 4N7IA 4EN6B 2PHTA 4F83A 2DFCA 3KD4A 1YIPA 4I02A 3WP3A 3VKOA 1V6LA 2HWB1 2XBO2 1DLLA 1NYWA 3GBWA 4MXVA 4Q4Y3 2R071 1BZWA 4YARA 3UK9A 5I93A 4I30A 3NAPB 1AJOA 1RUD1 4GALA 5FBZA 1Q8QA 3LA3A 2VQ0A 3VBOA 3E6BA 1EV12 4FQ4A 4C91A 2WZR1 1RTVA 5L7OA 4NR1A 3ZXFA 4ORFA 3SISA 4AGVA 4YM1A 3M3CA 2HWF2 4AI0A 2WKKA 5KXBA 1MS9A 1NCRC 4HKOA 3J9SA 5H9QA 5EYYA 3WD5A 4QQLA 4AHYA 4N9HA 3WDYA 4LO5B 4Y1YA 1O5LA 1WD3A 1N3PA 1UL9A 1BVP1 5H9PA 1Q56A 1LEDA 2Y26A 2QDNA 4Q4X3 4QX5A 2G4IA 3VKMA 4Q0VA 1JN2P 2WT1A 1AR92 4HZFA 2D5HA 1QJY2 2IFRA 1E57A 2Q5TA 4AQTA 1IQAA 1LOGA 2E7QA 4QD2A 3QLQA 1ULEA 3CLPA 1ULGA 2LTNA 2FQPA 2R32A 1TME3 1RUH2 4OHWA 4AE2A 4GMP3 4FP2A 3WNXA 5JSRA 4PF5A 4QQHA 2EVXA 2GALA 2R0HA 4BMEA 3ZYJB 5J37A 1PZ7A 4QPIB 2YMZA 3D6EA 3B00A 4HANA 5C9AB 2WS93 5D1IA 3ZFGB 4P9IA 3WDVA 1HRI3 3AP4A 2F4PA 4JGZB 2HEWF 3E6DA 2FBEA 3NWKA 4HN0A 3WCSA 5J96B 5JIAA 1CAWB 1QJY3 1XXNA 3JQXA 1RUI1 4LULA 4XXPA 1W6PA 4AI8A 2WFF3 3LKJA 5BNNC 3VBFB 3ZPYA 1S0FA 3GZTB 2R0FA 1ND2C 1OD5A 2VOWA 3DF0A 1FAYA 2YC0A 1B35C 3WX5A 1PO23 3FJSA 1KDMA 4HVOA 2WFPA 4UW4A 2VVFA 1QHDA 2D98A 2HWC3 2BWAA 3KCXA 3WG1A 2CY6A 3ILFA 3SNMA 4P9YA 4Q4W3 3S6PA 3DKWA 4AVVA 3M3IA 4BWOA 5C9AC 3IDBB 1LOCA 1QJX3 4BCUA 2SLIA 3ZFGC 4MXWA 1R1A3 5L73A 1IZ3A 1LU2A 2VG9A 4XQDA 4YG3A 2WQZC 3SH3A 4AEDB 2HWD3 1EY2A 1H1AA 3ZFFA 1VBA1 2OZ6A 5J36A 3VUOA 3B5LB 5JPNB 4CRQA 2RM23 2W68A 3MIFA 4YZ2A 3M8LA 5BY5A 4XBQA 2AYHA 3CJXA 1W0OA 1V00A 4CEWC 4MLOA 4WM7A 3G7DA 4N90A 1ND2B 1R1A2 1ND3B 1ZNPA 2YUEA 4YW1A 3B9CA 1D4VB 1ENXA 1AHSA 1PIV1 4KU8A 2JE7A 3DV8A 2PLV2 3N4MA 4ONUA 1QDOA 2ZX4A 3MIDA 4DINB 2R062 4LHKA 1H2MA 4YW3A 4H55A 2RR13 4CDXA 3WLUA 2P17A 1S2BA 1VALA 5GZEA 1LHWA 1WA4A 1H2KA 4YZ1A 1MR5A 1AXZA 4FPHA 3OF1A 1OI6A 4YZ3A 1S0GA 1U5IA 1H9WA 3WHUA 1ENQA 4J1WA 4IETA 1NZCA 3GZUC 3QD6A 4A2UA 4AEDC 1CJPA 1RUJ1 2WNUC 4IEWA 3ST7A 5LRSA 1HX6A 1D4M3 1OQDA 1BKZA 4NVPA 1AX1A 5LK5A 1OA2A 4OHXA 1AL0G 4XXAA 1SBEA 1W6QA 4META 3ZN4A 5IK4A 2GZWA 3LOIA 2O1QA 3FE5A 4CEWB 2NPIA 3KS7A 1QQP1 1BYHA 1U0AA 4LEJA 2V73A 4AGRA 4BQ1A 4OZXA 3RI9A 1ND3C 2BNOA 2RS31 5A3MA 1NA1C 1Z7S2 1ASJ1 2PA7A 3M3EA 4P5HA 1PHMA 4XFHA 4Z2WA 5CG9A 5FAXA 4RS5B 4ISRA 3O12A 2ET1A 4AQ6A 5JPMB 5T5OA 3HQXA 5JI9A 1O4ZA 2A7AA 4BM8A 4X8NA 4ITCA 4FVVA 2B8MA 1AX0A 4M0HA 4GWNA 4P9WA 3WDWA 5JAXA 4MGKE 1NY71 1AR81 3WT3A 3PNAA 4X6QB 3RQ0A 4AQ2A 5GZFA 3CL1A 3RG0A 1DQ4A 2QZ2A 4Q8KA 4B4PA 1HW5A 4OFGA 1A6CA 1S2KA 3FBMA 4GMP0 4JCKA 1XQNA 4GB31 1YJKA 1UN1A 4IERA 2PAMA 1REDA 3ZIXA 2OA2A 3VHPA 3RYPA 4XJ8A 1ONAA 1FMD2 3JUUA 1SQ4A 3V0BA 4JTOA 1WMDA 1XNDA 5J48A 2HWC2 1BBT1 1WMFA 1UAIA 4XF4A 3ZXJA 2R6QA 4YGCA 3GBFA 1B35A 4IEPA 1YFYA 1JTZX 4NN0A 3IT8A 1VP6A 3ZFEA 2ILMA 2E53A 2R16A 4NOTA 2CWSA 1YIFA 1HRI1 4L9BA 2GNDA 2ZGQA 4CEWA 2A6XA 1CVNA 5T3NA 1K5MC 4XPVA 1LHOA 4CZSA 2R1DA 2FMDA 1JHNA 2O8OA 1RUF3 2HWE2 3RZZA 3NO8A 1V6NA 4XJZA 1PGW2 1WW7A 2I07B 4ASMB 2ZAAA 3KCYA 4IESA 5FLIA 4Z92B 1VR3A 5BPXA 1F8VA 1REFA 1C5HA 2D6NA 4IV1C 2ZS6B 4U36A 4W6XA 3WW1A 2B46X 4F7ZA 1MVQA 1MZ6A 4AHZA 1PO12 1XNBA 4AVCA 1QQP2 2DCKA 4K21A 4LO4B 5FFOC 5GLVA 5GM0A 3R6SA 5TSWA 1ZM1A 2WZPP 4FCAA 2D6PA 3D0JA 3AP6A 5FO9B 2PAEA 4LE4A 1LB2A 1VB4A 2XLAA 2IXKA 1RUI2 1QJZA 4PLNA 1WUVA 3H7JA 4LBKA 4EN7B 1RUC2 1U5ZA 5LEKA 4DRVA 2LALA 1QXRA 3ZYPA 2X5IC 4ES8A 2E63A 5DG1A 3FFQA 1D4M1 4J1XA 5FTTC 4HSJA 2XJTA 1CAWA 1TME1 2OPKA 3VBRC 3POSA 4KGGA 3VKFC 2D93A 1NY72 2PELA 3AMMA 4UBGA 1I3HA 1FOD3 2FZ2A 1CN1A 4WM7B 5JI7A 1GKBA 5A33A 2ZGSA 2VQAA 3OD0A 3E5QA 5GLUA 1NQJA 1TE1B 4IEOA 4XF9A 4CDUB 1MS8A 3BOPA 4A3XA 3D4KA 1C1FA 3N7KA 1IKQA 4WVMA 5JWPA 4J6GA 1QJY1 4FOQA 3FZ3A 1I6XA 5JZGB 1KXGA 3SCFA 4XHBA 4N53B 2WWSA 3DN7