1YIAA

Crystal structure of tryptophanyl trna synthetase ii from deinococcus radiodurans in complex with 5-hydroxy tryptophan.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
331
structure length
331
Chain Sequence
ARPRVLTGDRPTGALHLGHLAGSLQNRVRLQDEAELFVLLADVQALTDHFDRPEQVRENVLAVALDYLAAGLDPQKTTCVVQSAVPELAELTVYFLNLVTVSHLRQNPTVKAEIAQKGYGERVPAGFFVYPVSQAADIAAFGATLVPVGDDQLPMLEQTREIVRRFNALYAPVLAEPQAQLSRVPRLPGLDGQAKMSKSLGNAIALGDSADEVARKVMGMYTDPGHLRASDPGRVEGNPVFTFLDAFDPDPARVQALKDQYRAGGLGDVKVKKHLIDVLNGVLAPIRTRRAEYERDPDAVLRFVTEGTARGREVAAQTLGQVRRAMRLFGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and activity of an aminoacyl-tRNA synthetase that charges tRNA with nitro-tryptophan.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ligase
molecule keywords tryptophanyl-tRNA synthetase
total genus 104
structure length 331
sequence length 331
chains with identical sequence B, C
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1yiaA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1yiaA01
4MW6A 1KQPA 1VLHA 1CT9A 1Y42X 5FO1A 4HJRA 1OBCA 3SZGA 5F23A 4UZEA 2DERA 3CLRC 1KAMA 1MRZA 1Q15A 1VBKA 2XRYA 1OD6A 4DE5A 2DLCX 3VU8A 1K92A 1PFVA 1WY5A 2V0CA 4MWDA 1VL2A 1OWLA 1G8FA 2J08A 2GKSA 2TS1A 1TFUA 3SYTA 1O95D 2DR2A 3CLUD 4AS1A 1G8GA 4S1OA 4MUNA 1KQNA 5AHWA 1WQ3A 3BL5A 2E21A 1JILA 2A1TR 3FIUA 3H9CA 3L92A 4CT0A 1N2EA 1R6UA 4MUIA 1KH2A 4A91A 1WZ2A 1IRXA 1O5TA 4ZCRA 1K4MA 1EFVA 1TYDE 1Q19A 3RK1A 3X1KA 1J20A 1V47A 3H97A 1QQTA 1WXGA 4ZT6A 1EXDA 3N9IA 3SEZA 1XNGA 2A1UA 3IMCA 1ILEA 5TGTA 3KT6A 1KORA 3P0IA 3DPIA 1PFUA 1MBZA 3IUEA 1TYBE 2CV0A 3KT8A 2JAXA 3A4IA 5EKDA 4MW5A 4EG7A 5TEWA 3CLUC 4R2LA 4MUHA 1GLNA 1QRSA 1VBMA 2VXOA 1NUSA 3ILVA 1H3FA 4RUKA 1JHDA 3X1JA 4I6GA 5JBNA 3UMVA 3U1VA 1NUUA 3LOQA 4MWEA 4OJMX 5FNZA 1XNHA 3MUEA 3KT0A 3D6VA 1O97D 2JA2A 1H1TA 2CSXA 1O96B 2QUIA 2PFSA 1U7DA 4YBRA 4TS1A 3PXUA 3RJZA 4ZT5A 3DV2A 5KWVA 2RD2A 1O95C 2Z3VA 2A86A 1KH3A 1YIDA 1M8FA 5DASA 1EFPA 5KHAA 3K32A 3RFFA 1QRTA 3FOCA 2E18A 3N8HA 1J70A 1JEDA 1KQOA 4KPUB 2QTRA 3DLAA 5DB4A 5J5AA 1JZQA 3LE8A 2JANA 3FH0A 5LLTA 3QTBA 4AQ7A 4MUGA 1KP2A 5FO0A 1NUTA 1D2RA 1COZA 3G59A 2GOYA 3HL4A 3F3MA 3MLAA 4ND7A 2A7XA 3CLTC 3ND6A 4ZCTA 1U7XA 1N2IA 2X1MA 4GU5A 4KR6A 1BS2A 2IJGX 3Q12A 2PZAA 1GTRA 2EJCA 1EJ2A 4MUKA 4MQ6A 1K97A 2DEUA 1NSYA 1O94D 3P52A 4PBRA 1GPMA 3CVYA 2QTMA 4G6ZA 4EG1A 1U3CA 3MXTA 3IOCA 4ZT3A 4QREA 1PFWA 2J09A 1I2DA 1T6XA 1EFVB 3IOBA 4MW1A 3UOWA 1NP7A 5KCMA 1ZH6A 1M8KA 1R6XA 4DJAA 1ULHA 2HGZA 2CT8A 3QE4A 2DXIA 3JXEA 4HPWA 2A84A 2ZUFA 3P0JA 1ZH0A 3TS1A 3CVWA 1MB2A 4KR7A 1PG2A 3IMEA 3E27A 3SP1A 1O0BA 3NBAA 3CVVA 3HV0A 3LCJA 1O6BA 4F4HA 1N2GA 1J21A 3CVUA 4MULA 1JIKA 3GUZA 1JZSA 1KKUA 2QUKA 1Q77A 1IQUA 4MVYA 3K9WA 3NV7A 2YY5A 4MUFA 5H16A 4Q93A 3MMXA 1U3DA 2NZ2A 4MW0A 5K0SA 1N2BA 3VGJA 4NATA 4X0EA 3SEQA 3TQIA 4ZT2A 1X8XA 1EUYA 1WXEA 1TYAE 3IVCA 3COWA 1F7VA 1WQ4A 3ZUGA 3RK0A 4GRIA 4EFKA 1G59A 3L93A 1N2HA 1O0CA 4DLPA 1ZJWA 4ZCQA 1EUQA 1TEZA 2QJFA 4DDKA 4EF6A 1F9AA 1O94C 3UK2A 1S4MA 3VRHA 4RPIA 4JXZA 3OTWA 1KH1A 1K4KA 1XJQA 1OWPA 3M5WA 3PNBA 4UZFA 3MLBA 4YMIA 4ND6A 3TQOA 1UFVA 3NBKA 1IH8A 3ND5A 4KR9A 4NAHA 1IHOA 1VBNA 3IOEA 2J07A 4YP6A 2BTEA 1YUMA 2GM3A 4BWVA 4U7JA 2PZBA 4DDMA 1N2OA 1MAWA 3HFJA 3IDFA 3CA8A 2CUZA 3PNVA 2X0KA 3N05A 4ZT4A 4EG4A 1MJHA 3DO8A 4WNYA 1OWMA 3PNYA 4EG8A 2QUHA 4NAUA 3IH5A 3TNJA 1I6KA 3AIIA 4L2IB 4PY2A 4E1AA 2PZ8A 4ARIA 2HMAA 2CYBA 1TYCA 1LW7A 4Q16A 3PRHA 5HG0A 4CQNA 2OV4A 1WXHA 2J4DA 4K0RA 5IHXA 1IFXA 1A8HA 1IQRA 2ZUEA 1WJGA 3CVXA 1NUQA 4K03A 4L2IA 3HGMA 1G8HA 3CLRD 3IUBA 1QTQA 1M1ZA 2E89A 4HJXA 3FETA 1T9GS 2D54A 2YWCA 1N77A 3GLVA 4DNXA 1WKBA 4EG3A 2H29A 1GZUA 3P0HA 1H3NA 2DETA 4U63A 4JFAA 3ISJA 1J1ZA 1GN8A 2DUMA 1JGTA 4MWCA 2B7LA 1DNPA 3COVA 3OP1A 4NDAA 3CLSD 4NZPA 1OBHA 1YULA 2R5WA 1R6TA 3A05A 5H7XA 4JYZA 3CLSC 2PG3A 5J58A 2OQ2A 1IQ0A 2X1LA 2I1LA 4MW7A 1MC1A 3UC5A 1H3EA 4YP5A 1I6MA 4MW2A 3KT3A 2Z08A 1YI8A 1ZUNA 2D13A 4PBTA 3SDBA 4DDHA 3I05A 1O97C 3RHSA 4MAFA 3H9BA 2RE8A 2NSYA 1LI7A 3FHJA 3ZIUA 3FI0A 3N2YA 1JECA 5K0TA 2A1TS 1F4LA 2HZ7A 1N1DA 2H2AA 1PFYA 4JZYA 2D5BA 1MB9A 1N75A 1JIJA 2A4MA 4MUJA 3FDXA 4HK4A 2WB2A 3RBAA 4ARCA 1M8GA 3ND7A 4I6JA 1KP3A 1SURA 2J5BA 2WQ7A 1N2JA 2XRZA 3CR8A 1KR2A 1JMVA 4R2MA 4QBTA 1M8PA 4EG6A 1N3LA 1EE1A 3CLTD 4WSOA 4ZCSA 2ZP1A 5IJXA 1M8JA 2IELA 1J09A 4MVXA 3S3TA 2QUJA 1WXFA 1QU2A 1OWNA 3Q4GA 1QNFA 4ZT7A 4P2BA 4ZCPA 4PBSA 1NZJA 2AG6A 2VTBB 3AL0C 5HUJA 3IVXA 3AG5A 1TQ8A 2CYAA 5BNZA 2BYTA 3G6KA 5TEVA 3HMQA 1N78A 2QTNA 1FFYA 1F7UA 4MVWA 1I6LA 2O8VA 4NX2A 1B6TA 3FY4A 1NURA 1MOPA 2EL7A 2A88A 3H05A 1JEEA 2CV2A 2CYCA 2QJOA 1Q11A 5DK4A 3ZJVA 3ZXSA 3ELBA 1JIIA 3G5AA 1P7PA 1T9GR 4KPUA 3COYA 4XFJA 3ZXIA 4MUEA 3IMGA 4EG5A 4CDMA 1YUNA 3A04A 4QRDA 3FG9A 2X3FA 4OUDA 3FNRA 3SZ3A 1U0BB 3COZA 4H3SA 2IP1A 4R0NA 3A2KA 3H99A 1FYDA 1GAXA 4G5FA 3Q10A 3GMIA 4MWBA 2AKEA 5HUHA 2CFOA 5LM3A 1XNJA 3ZGZA 4MVCA 1GTSA 4XSVA 3HZRA 3AG6A 3UY4A 5LFAA 2QJTA 1IVSA 1V8FA 3AFHA 1QRUA 1WOYA 3C8ZA 2YXNA 1J1UA 4J75A 4MW9A 1O96A 1NI5A 3X1MA 2E0IA 1QU3A 3TZEA 4OUDB 2O5RA 4XFDA 2A1UB 3AKZA 4U8HA 1T6ZA 2CV1A 1YIAA 2YWBA 1QJCA 1T6YA 1MAUA 3INNA 1X6VA 3FWKA 2AZXA 1M83A 4G5YA 4JXXA 1LI5A 4EGAA 5J59A 4J76A 1WXIA 2WQ6A 1NYLA 3IVGA 2DPLA 1EFPB 1HYBA 4YP7A 5DEOA 2PIDA 2V0GA 3D6UA 1PG0A 2WSIA 4F3RA 3TZLA 4KKVA 5TS2A 2C5SA 4MW4A 3QTTA 2Z09A 3ZJUA 3KFLA 4CDNA 1OWOA 4FZJA 4I6EA 4MLPA 2PXHA 2VTBA 3IODA 3ZJTA 1KAQA 2G36A 1NUPA 1RQGA
chains in the Genus database with same CATH superfamily
1Z12A 4K87A 2X4LA 2WIFA 2ZZKA 2IOHA 5KCZA 4MR9B 2GYYA 4YQZA 1KJ8A 1MR3F 1FDUA 4JXKA 5JDCC 3GEHA 5DBHX 4DPMA 5KSPA 1KIMA 2V7TA 4KREA 2VHTA 5MN4A 5F3WB 2OP0A 3BD9A 2Q2NA 4X66B 2CVQA 3RU7A 5DGXA 1E5LA 2GZAA 2FSIA 3B9RA 1KETA 4IZIA 4DE5A 4I4TA 2X8LA 5EJMA 1Y8CA 2L2QA 3WP1B 1SCUA 5K9ZA 3D4NA 1L4LA 2J08A 1DBRA 1J42A 3GA7A 1ECGA 3S2ZA 4EM6A 3CCBA 3PL1A 1A88A 1XA3A 3K5IA 3MLEA 2NZUG 4ND1A 5EMJA 4KIJA 2DR2A 1PFGA 2D0OB 2X76A 3PXEA 3I2FA 4RIHA 5A1JA 3H3JA 4IVRA 1G3UA 3QIAA 5ICEA 4D6YA 3NEYA 4R3WA 1KQNA 4N5DA 4UHKA 3SJCA 1FY2A 2RB5A 5TT1A 4CMGA 1A9QA 2VUSA 3OHPA 4AY2A 4G67A 4J4TA 5KYUB 4PZUA 3WI7A 5CB4B 1LF0A 1QVRA 2J6CA 1DG1G 4YRBA 1JTVA 1Z6GA 3G8AA 1CV2A 1ULSA 13PKA 3LUPA 4LGVA 5H70A 4KXUA 4RHXA 4D25A 1N9GB 2J9ZB 1DJNA 3PA8A 3E3LA 1KSFX 3B5EA 1RJDA 4PX5A 2Y27A 1WCXA 3EDOA 1IHYA 3M2PA 4PLYA 1JHZA 1TKRA 4RGQA 5H1YA 4CHGA 5JAHA 1Z2OX 2EATA 3HB7A 4EGQA 1ILEA 5GJBA 4IDCA 1UOPA 3PWSA 3OJOA 3OO0A 5FTKA 5TR9A 3MWGA 4GI2A 1EGHA 3WGZA 4X5OA 2WVGA 3H4VA 2XJ9A 3UBMA 1HX7A 2JAXA 1OB2A 3ORSA 3I62A 4PLZA 5B4TA 2OYCA 5JU6A 3FWYA 4EJSB 3E8SA 1N6LA 4PSAA 2H2WA 3T7RA 2AZ4A 3PVCA 3RS9A 3H9UA 2MSKA 4LBYA 1BYIA 2IHNA 1E7WA 4J4HA 2C07A 2OZLB 5K7SA 3HLYA 3D02A 4BNGA 2XGJA 1JN0A 1U5BA 2CUNA 4FEYA 1V45E 1U8ZA 1ST3A 2CSXA 1D6NA 1HT2E 3FRIA 4YRKA 3DFZA 1MQSA 4FMPA 3PXUA 5IT5A 4DIKA 1NNEA 2UXBB 1NVBA 3FSGD 3Q7PA 4CN8A 1NGSA 1O95C 3WB1A 4K88A 2AI3A 4COKA 4IPTA 3KKZA 5FV4A 2DGDA 1XZEA 1XFDA 2FJUA 3CSSA 1NXXA 4RKRA 1J70A 3WQQA 4M8KA 1OXSC 3DZJA 5DB4A 2V5UA 1E9DA 2EGHA 1ZCBA 2QRGA 5AW4A 1S2LA 2WWFA 2O8EA 5LLTA 2ZT5A 4MGEA 1A7KA 2AYYA 4FFMA 3AJRA 4NV3A 5KYUA 2DWOA 4D2IA 5KTSA 5K20A 3MILA 3PCTA 1XTBA 4NH0A 1N33B 1DC3A 3F3MA 4KP7A 3LLMA 1EUDB 2RHMA 3DTVD 5GGYA 1MMFB 3P26A 1PNQA 4NZMA 3UMSA 2PL5A 4DDTA 1WDTA 4YP1A 2YBEA 3L1IA 1M2JA 2O8CB 2H4ZA 2ZR0A 4NYIQ 3Q12A 1BTOA 4G2NA 1JEQA 2IYZA 3HYSA 3REGA 3TSOA 4DV6B 4MIEA 1E5TA 2EJCA 4K6CA 1IEQA 1G3RA 2V4ZA 4GNKA 3GEIA 4DMFA 2DUWA 4HDRB 2FXVA 3S2FA 2P2ZA 4G6ZA 3O8BA 3LK6A 3NUZA 1W4AA 4FBMA 1E20A 1Z35A 2AQHA 2VHEA 3QNWA 1SKAA 5LLDA 4ZO6A 4F46A 1WPXA 2XCSB 1ZRSA 2C4MA 1TF7A 4NR0A 2DFTA 4MW1A 4NVRA 1TMYA 4TX1A 4TTSA 3TW6A 3MAGA 3GLGE 2JIMA 4HVAA 4M7RA 5JY6A 5LQNA 3I09A 3ANMA 1ATIA 2V03A 3BQMB 5KCMA 3ZWOA 1D7OA 4KN9S 1EI9A 3V8VA 5FB3A 4WOPA 3NHZA 5G3ZA 2A84A 2PMWB 4IDQA 3IOMA 4KO8A 1W25A 2YXDA 3L7YA 1JPJA 1MVLA 1YT5A 2WVHA 3CH6A 3I6QA 4MA4A 4WECA 3MGKA 5C5EA 2GCOA 5CD1A 2H0QA 5KAMA 2D1FA 2K87A 3IMEA 4N3CA 5AHXA 4FOPA 1I80A 1YHZA 2C1XA 2Q07A 2Z95A 4JLJA 3I2YX 4KLCA 5JH7B 3HV0A 2B37A 2RK3A 1I5RA 5AUQA 3FTDA 1IM2A 2VSXA 1KDVA 2ORED 2ZBUA 3SS8A 4BP8A 3SVZA 1W88B 4OK6A 3KEGA 5DLQC 1JZSA 3L7IA 1A5AB 4A8JA 2W6PA 3BFJA 3O03A 4N7JA 1J23A 1HK7A 5FRDA 4OL0A 2CE2X 3MJDA 3TIXB 4KOAA 3VH2A 4FYWA 4CJXA 4DANA 5A71A 3EFEA 5L51A 3EPPA 4AXXA 3FB4A 2CMGA 2RCYA 3IPCA 1YVEI 4WWHA 5I3CA 5EWMA 2SICE 3GOHA 3AV3A 2PRZA 5IJWA 3HKEB 3UGJA 4V3CA 3I6MA 1L5FA 5J4HA 4KK4A 1WD5A 5TMDA 4YRJA 3UK0A 2IH4A 4DJJA 1E94E 3DTTA 3JD4A 3L93A 1QYVA 2D0IA 1P18A 1C3XA 2YYAA 4XW2A 3PC3A 1XAHA 4TXNA 3K6SB 2WSLA 3FGOA 1GRQA 1QYXA 3OQIA 3QENA 2H9AA 2I4NA 4P4SA 3F3YA 1ZYUA 3WC4A 1XNRB 2WHPB 5JEDA 1P6UA 5JALA 4I1PA 1E3SA 2A6PA 1D2HA 2PMCA 4M2LA 3VH1A 3T5DA 1XJQA 2QN3A 4RKYA 4EHNA 1Q0ZA 2EVWX 3I9KA 1DX6A 3FYUC 4Y7DA 2R8PA 4ZA2A 5BR8B 4TZTA 4L0CA 1FE8A 1LVGA 2PMFA 3QEJA 4AKGA 1PZHA 1Y37A 1U8TA 3EZLA 1J07A 3FYUB 4PQFA 1Y0BA 1QS0B 4YP6A 1ZINA 4LOAA 3UYLA 4KGXA 4MVJI 1T3TA 5BVHA 4Q1DA 3C5EA 1GSOA 3BWDD 4HB3A 1G6OA 4R01A 3PR2B 4LF5B 3H17A 1NBME 1TK9A 3JV7A 4HEQA 4B9AA 4D8VA 3PNVA 2FV8A 1C0EA 3VYSB 5E9QA 2ADOA 4OXRA 4DM7A 4DRXB 5AD1A 3DO8A 3CTMA 1PQWA 2WTAA 2ZVQX 4WERA 4Q48A 4YJGB 1Z38A 3FNEA 3PU6A 3QOYA 4NZOA 1UMBB 4CF5A 4I4TF 3W9YA 5BW4A 3HB9A 2RIPA 1WV0A 3FRJA 5EIFA 2WPNA 3L0ZA 1MGOA 5BN4B 3U3JA 5FPKA 4TT3D 4RLQA 5IT9A 1UK8A 3L05A 1V96A 4HN4B 5M2QA 1ZW1A 4L2IB 2WHXA 4LDRA 1U0FA 3E0XA 4XEUA 5LSAA 2BELA 4AMUA 1LW7A 4Q16A 2AR9A 5SZJA 1K2VN 3PRHA 1E89A 2K2WA 4Z9FA 2GEBA 1F2TB 2G63A 5I7FA 3SVTA 2GVNA 1RM3A 3VC1A 2QN2A 3HUEA 4FHDA 4B35A 1YAHA 3ROPA 3WKAA 3QVJA 2EERA 4MKZA 2WZQA 2TYSB 4MV7A 1DAOA 3TIVA 2HNAA 4G1BA 4I4NA 4UNPA 1KFBB 3RYHB 4BNIA 4CKEA 2QX9A 3W5HA 1FZTA 4RKWA 1GR1A 3LM8A 1TKCA 4L22A 3WK9A 1YDGA 3P9CA 1FBNA 5CJJA 3N0WA 4YRLA 3VU1A 3PC8C 4CHTA 4PC3A 4AT1A 3LYUA 4J29A 1MOZA 1Z4IA 4XGQA 3EVAA 2W2LA 2OG1A 4Q7KA 4W9NC 4JFAA 4HATA 2PWYA 5BN5A 1E6CA 1UPFA 1T26A 1ZHFA 2AWOA 3HCWA 4HF7A 4HHEA 3KEOA 1JGTA 2VDMB 4PONA 3WE7A 5JAIA 1NNUA 3TKYA 1L4KA 1Z75A 2I80A 3T8YA 1T1JA 1YULA 3DPUA 4PNPA 4RDCA 1NSTA 3K9LA 2P9ZA 4CM1A 2BGMA 1ESMA 5KJCA 3LA8A 5SYAA 3WMRA 2GBCA 4TKVB 4X8HA 4EARA 1LLFA 1FDOA 4G3XA 4M1TA 5F3RA 3K30A 4B46A 4INJA 4QG7A 4ZDJA 3K2QA 1WUJS 2MSWA 3E22B 5CJ2A 2H3EA 4LJ6A 2VBCA 1BE0A 2DJIA 1KNXA 1JHXA 2PJDA 1MW9X 1LKZA 1SA0B 1QBKC 4FEGA 4RZUA 3I05A 1DBPA 1O97C 3B7PA 4NMMA 1YR7A 2JGNA 2QX4A 4BC1A 1TAHA 1RXSA 3VHXA 1E2PA 5DDIP 4UW9A 3RYCB 1UF9A 1GUYA 1LCIA 1QZUA 4KMRA 5ADUS 2RGGA 3Q7SA 5E2AA 1I3OA 3S1AA 2QW0X 2JLRA 2I2WA 1QZTA 5IAGA 1VHJA 1XFAA 1YMUA 3NC0C 2Z83A 1OH6A 2OZVA 4M76B 3I04M 5IBQA 4IIHA 3FDXA 1ACJA 2EKDA 1QQ5A 2WB2A 3ADDA 1FXSA 5CA1F 3V32A 5KNBH 4MDEA 3I1FA 3U81A 3QUTA 3VSDA 2Z1NA 1FDVA 5JSKA 3ZZUA 3TK1A 1MRNA 4EG6A 3SYKA 5K3EA 3EUAA 4CEIA 2ZP1A 4A27A 3WKCA 6YASA 1NR5A 3G2KA 2A0XA 2AJCA 4M1SA 3E7PA 3VPHA 3LLSA 4ZCPA 2P6MA 1OGJA 5BQPA 2YDYA 3I23A 2E55A 1ZMRA 1JR6A 1SR8A 1RPNA 2P30A 3RAFC 2XSZD 4RIGA 1RMQA 1Z9BA 2GCPA 2XA2A 1RZ3A 5BNZA 2P11A 3VR6H 4RESA 4EAAA 1AHHA 4AM8A 5DN6A 4DZTA 1R64A 4R9VA 4RQUA 4AG3A 4B71A 7ABPA 5JH7F 1S4QA 1TM2A 2G1AA 4IUYA 2C7QA 2YIDA 4YLGA 4CIXA 2VP6A 5IKEA 2DBZA 3I3SR 4LZWA 5K0FA 1FFYA 4TV9B 2XITA 2P2DA 3S29A 2UUCB 1E98A 4TXHA 4LY0A 4PLGA 3H04A 2X2EA 2O9JA 3DP9A 2GK6A 1XZKA 2NTYC 2Q28A 1JG4A 3PK0A 1E96A 4PLPA 1G2PA 3A36A 4RXTA 3W5DA 1YZGA 5DP2A 3VV3A 5C1PA 1QM5A 5A06A 3DS8A 1U2EA 2Q50A 3LL7A 5AQEA 3VZBA 3W5SA 1T2AA 4ACBA 2ES4A 5K3CA 1RKQA 2PLRA 3EASA 2P0EA 2Y1FA 3PFCA 4HQ0A 5JI2E 1YUNA 2C94A 1CEXA 4GWGA 4AKHA 4YQEA 3R76A 1OXVA 1QQ7A 3FNRA 5J2TA 4DNFA 2ZIWB 3DL2A 3SX2A 2YFKA 1TKAA 2D3WA 3IQIX 5LZ8A 3WBJA 5CVTA 1EGVB 1UQRA 1Z0AA 2XUHA 1F9EA 5EJ4A 3RO7A 1NVVR 1UOEA 3Q2KA 3DVSX 4F9FA 1A96A 1Q74A 5LYJA 4QLBA 1K7EB 2K7FA 1QCYA 2LRHA 2PKEA 1RQRA 2VQSA 3OU7A 3TVYA 4QUHA 2VHXA 3ICVA 1JXMA 4U2BA 2GAOA 2HTFA 4MVCA 5DMHA 1I3CA 5AI4A 3QXCA 3UJ6A 1GTSA 1YVPA 5AM3A 3KQUA 4NNOA 1K8XB 3IO3A 1GCGA 1JZTA 1X7WA 3MRXA 3GZTB 2WP8J 2I6XA 4BVBA 3AO0B 3WIVA 3BWVA 1T8UA 2POQX 4IO0A 5GJCA 3DOFA 3RUPA 1ISHA 4ZFNA 1SCBA 3E05A 3A4VA 4NBWA 3R9XB 4H27A 5L45A 1WMBA 1C30B 4I66A 4IIVA 4PSKA 1MX3A 3AM4A 5FTWA 2IXFA 4OY3A 1FNMA 3B3QA 1IJEA 4I19A 4YAEA 5GZ1A 1Y1SA 1PWHA 2JCXA 3AM3A 3EWAA 2GN6A 3PFWO 1RWNA 1A97A 2EW2A 1Z18A 4BNNA 4YJ2F 1EEHA 2CLLB 3RVJA 4JAVC 4V0OA 1E3QA 3O9MA 1NXOA 4A6DA 2Z2ZA 3TNLA 4DCNA 4ZHSA 1L8QA 4ZYLA 5BQXA 1K8RA 4WUTA 1RWOA 1GGNA 2G88A 4M3NA 4JODA 1XZCA 2QAGB 3VTKA 2OO5A 1P91A 2DG2A 3F8TA 5I7OA 5I6DA 1FFGA 3ACBA 3B9PA 2I8CA 4R05A 1II9A 1YS7A 2NYUA 4F6RB 1GXSA 3KVNA 5J4YA 1P2BA 4B2LA 2DLDA 1KFCB 1G7SA 2Z6UA 3SBOA 3F5FA 4K9QA 5GPBA 1I3LA 1P0IA 1ZN9A 5GIPE 3ZDDA 4L8FA 4M8IA 1RT9A 1C81A 1CYDA 1ZOOA 1NBIA 1R0XA 2WSIA 3O31A 4PFQA 4BE7B 5HVNA 5FYDA 1FSZA 2PQ0A 3CCFA 2X2FA 2V59A 1CZOA 2DX7A 2C29D 1ZZEA 1RM4A 2G76A 2PVCA 2ZRMA 3HXPA 4NL4H 4O8ZA 2E5FA 3NG1A 3DKKA 3PWZA 1W5AA 4IX1A 5F7ZA 1Y4DE 4Q34A 3GVPA 3SJUA 3WNZA 4DSTA 1VG1A 3RTDA 2G8LA 3CUVA 1U0HC 5EZYF 1KK2A 2WKRA 3WAGA 2JLXA 2O8BA 5EP2A 1ML3A 1I9CA 1CR0A 2VP0A 2FP4A 1WF3A 2FX3A 2X58A 3EW9A 3GLHA 1L4FA 4FIDA 5A9SA 1EK5A 1SU4A 2P6NA 5M5BA 2FEKA 1CJCA 1JFRA 1SCJA 1E9VA 1T5OA 2BFMA 2HA0A 3C3EA 4TUYB 2IV2X 4F5WA 8LDHA 2IW1A 4NCHA 1V9LA 4FC7A 2PL9A 2OOSA 2HA4A 1U28C 5EWLA 2RJNA 3KKEA 1T9HA 2XBUA 3B6EA 2ON6A 1J25A 4GG1A 2YL2A 3VJLA 4HEA6 4LY3A 4ZOAA 4I08A 1HG1A 5E0OA 2GD1O 2YXBA 3G1UA 4A0GA 1QCDA 1C29B 3O8OA 5IVIA 2V0CA 1Y8RA 4DSZA 2O0HA 3K2BA 5F1PA 2XOEA 1PLJA 3GT7A 4N0DA 1VJGA 3HV2A 5T6BA 1TM7E 2G0TA 3I5AA 3TTXA 4A6PA 1NRIA 2W43A 4RVHA 5EWLB 4WCFB 3D2CA 1RYZA 5F5LA 5JE8A 1VIMA 5A3JA 1NIPA 2ID8A 2PJRA 5K4AA 1BFDA 3UK6A 5JTUA 4UNQA 4FILA 3V7FA 1JXAA 3FMPB 4FLMA 2HLPA 3HNOA 4TLCA 5JD3A 2ZIZA 1I8TA 3HUTA 1TUIA 3G7UA 3K73O 4GXRA 4OI4A 3D2AA 4Y6LA 4YJKA 2QV7A 4GXQA 2GZSA 3CHYA 1DQZA 1SG9A 4NEQA 3WO0A 4HRVA 4NMHA 1D5CA 3IUSA 4OB7A 1EESA 2DBYA 2NTEA 1SHLA 1RMYA 1USKA 2YYSA 4J4BA 4L7VA 1BC5A 5C8YF 3IC5A 1IRXA 1IWOA 1DO2A 3NTLA 1EM8B 2ENUA 3P9XA 1YIOA 2X8BA 4N6GA 1RW4A 2BIFA 2ZKIA 1NR1A 3JQAB 3H97A 2LKDA 3NWEA 3O1HB 3QFCA 4HDCA 5DX0A 1PAUA 4JCCA 3QVUA 1FZQA 4DM4A 3JQGB 3O3OB 5K8TA 1Z25A 4QUAA 3KT6A 1VHDA 1DIBA 3PHJA 5HW0A 3F67A 3EGWA 1BKDR 3H2JA 4FFWA 2CXTA 4W5HA 2YWHA 1TYBE 2C88A 1YO6A 5FF9A 3HKBA 1TUBB 1C0PA 1U94A 1V2HE 2P90A 3UENA 1V1MB 3IERA 4FOLA 4I0WB 5KS2A 2YKGA 4P3XA 1A2BA 3SJ7A 1ABEA 3IIJA 4OJYA 3CY6A 3HMKA 2VXCA 2AW5A 1Y4UA 3SHQA 4BFXA 1ZK4A 1NLFA 5HBRA 1UKEA 3IHWA 1U3WA 4X85A 2VJQA 3H86A 2WD7B 4MVJH 4RZSA 3UMVA 4MWEA 3N7UA 1GRVA 4WRRA 4MYTA 1Y4ZA 1P2TA 2H1FA 4J16C 4YAGA 1QK3A 3EDCA 1DBIA 4MV4A 4DR2B 4QEZA 2QTHA 2AUNA 3PE3A 3CEHA 3UG6A 5LYYA 2AMLA 2UZAA 1SVMA 5IJ9B 3LBFA 1KMHB 3FNBA 3R6LA 1QAQA 4F3YA 5BN4A 3L4KA 4EYGA 3MF4A 5I47A 1ZFNA 1GQYA 2NLOA 1CS0A 2N75A 3KUXA 3DVRX 4JJIA 2Y4OA 5JOQA 4B2YA 1NVVQ 2ZRAA 1TRKA 5J4KA 1PWZA 4TKUB 3VR3D 2BGWA 1JEDA 2HY7A 3UA3A 5E8RA 2ZSAA 1CJKC 1JZQA 1ZMTA 1YS6A 2FPRA 4JUBA 5ITVA 3FCOA 1FTGA 4LHEA 3F73A 4MUGA 1SUEA 2OP1A 2NIPA 1IZ8A 1J8QA 2D7JA 4UVEA 2ACEA 3BBPA 1E92A 3TW8B 3C0KA 4WLNA 1NBEA 1P2DA 1UDWA 3JWGA 3V2HA 2VT6A 1VXOA 1N2IA 3IBGA 5CNKA 3OFSA 5HF9A 3RAPR 1O6ZA 1Q21A 1T0HB 4LHXA 3IR7A 4YUWA 4Q7JB 5TJ9A 2GKOA 2EGGA 3JQ8B 1FC0A 2R5NA 2ZUDA 1NULA 4Y9UA 4XUEA 1U8EA 2FEMA 5FA6A 1GNQA 3RRMA 2LNDA 4BMPB 2EDAA 2ZS9A 1JALA 4FMDB 4PRZA 4Q7MB 4JC5A 2NV0A 3CVYA 2PH7A 1L5NA 2HF7A 3ZWDA 2A7QA 1U3CA 4BE4A 3PTZA 4ABTA 2O1WA 4OQPA 4OPMA 3U31A 1H6AA 1CUCA 1HL3A 2W5UA 3GPIA 1VZ2A 1PFWA 3ZV7A 5A04A 1EFVB 3H84A 2OYSA 4IV8A 4BFYA 2AR7A 1VCNA 4UUAA 1WIWA 1EP3B 1BKYA 1ZH6A 2CT8A 3WYEA 1A9ZA 3WZMA 2YZNA 4ZZ1A 1DRVA 3EQ7A 1PL0A 2XT0A 3IP6A 3M9LA 3JQFC 3W7BA 4A0SA 3OWHA 3V4OA 4K81B 3MJVA 1J5XA 2GPYA 3HH8A 1TU3A 4G26A 3MB5A 4NU0A 4TOIA 4C89A 4DREA 1K86A 4XSHA 4BKPA 1FFSA 2PS9A 2XUGA 4UU1A 4YRNA 1DQRA 1XD8A 5KU1A 1T2UA 4AWAA 2I2FA 4MULA 5ECYA 2P9BA 4IG4A 1Y7IA 5G4KA 3T61A 3QHQA 1Z29A 3S2YA 1SBYA 4A5OA 1OLUA 1HDRA 1E1QD 1L1QA 2IIBA 3PITA 3R5JA 3Q8LA 4BB5A 1JJFA 2CJFA 4JOBA 3UHPA 3EK2A 5COBA 4EYKA 3ITDA 1AKMA 4POAA 5F2EA 2RHJA 4KIGA 1A9XA 1FYWA 3SEQA 3WRWA 3PHIA 3NANA 1AB6A 1A82A 1WXEA 3WOHA 3OJFA 1I3MA 3ZUGA 2YIMA 5FBWB 4QYWA 1BMDA 1YJBA 3AY6A 3IA2A 4MIYA 2H5JA 1E2IA 3S8EA 1CS0B 1DJPA 3LQYA 3EOZA 3NM4A 4PYLA 5EE9A 4DNPA 4Z5XA 5JWOA 1O0CA 1JEJA 1OV6A 4TGLA 4NFYA 1T10A 4FFDA 5JJCA 4MKHA 3IEIA 4ZCQA 1PJLA 3ZDRA 4B0PA 1IQPA 4FOTA 2GJSA 3QFRA 4PAWA 3KV1A 1CEEA 1O94C 1H93A 4BQSA 4D82A 1U2DC 3SE7A 3OIDA 3U61B 5IZCA 7ADHA 2PX8A 2XUIA 4LNHA 2H00A 2M6KA 3G0DA 2WD7A 3PNBA 4JT4A 3UJHA 5A0TA 4HXGA 4TRRA 3ND5A 3P9IA 7REQA 1GGKA 4WZAA 5CFZA 1DWQA 1JG6A 4HLCA 5TQ2A 2NVWA 2GGSA 4RY9A 2DVMA 2FWNA 2PRJA 4HNHA 3ZHVA 1ZVKA 2CLHB 4BWVA 1NYQA 1UDXA 5BWNA 3VNRA 1K8ZB 4PTZA 4W82A 2P3SA 5F2OA 2GZ1A 3L4BA 1BXGA 2RHBA 1LZLA 3AHGA 3QPWA 4RVNA 1KZHA 3PFNA 4KO1S 1JFTA 3AJAA 4OFXA 2AN1A 4EGJA 1IEVA 3I12A 2QVCA 4NBSA 4P38A 3V80A 5KJ1A 4EG8A 1X9HA 5DVZA 2Q5FA 2N47A 4MQBA 2JBAB 3UHJA 4A0HA 1ZOIA 3JZIA 2H5EA 5EZSA 2OBLA 4PN3A 1GRCA 1MF7A 3TRKA 4RPKA 2JRLA 1WEHA 4RETA 1OFIA 2ZYDA 2IZZA 1ZP6A 2BCJQ 2Y2VA 3AIIA 4I36A 4Q4HB 2ZT6A 4E1AA 5KQLA 1NN0A 4S1NA 4KMMA 1T0PA 1VP3A 2NXJA 1GGVA 2Q9UA 3BN3A 3ED1A 4PCLA 4YP0A 4YJFB 1MU0A 3DFKA 3BTVA 4OXXA 5EIBD 1VCMA 4YFVA 3BIFA 4X20A 3VKFA 1PKXA 1YHYA 2V74B 4OF4A 4X8MA 2B9EA 1JHVA 4IXDA 4MKRA 2FJ0A 4NV0A 1HNNA 5KKNB 2IU4A 2J9XB 5BQFA 3T1OA 3C8HA 2R6JA 1DX9A 3C8MA 4Q9AA 2EWMA 3K6JA 4Y9DA 1FK8A 2V7GA 1Q1ZA 1LTQA 2H4FA 2XXJA 2XUOA 2EZ4A 3AEKB 1P19A 5EIWA 1T9ZA 3L4SO 5LB2A 4CMEA 1X1CA 1M6EX 4WY8A 2J85A 1KO1A 1QANA 2JFFA 1JE1A 3OSZA 4IYJA 1P74A 3A1DA 3GLFE 1GOTA 4PF1A 5K2OA 3DBIA 2WVJA 3O8QB 1NVDA 4RCZA 1IM8A 1W5FA 2BEJA 4BE9A 4U63A 3BKWA 3SWWA 1QFYA 4HLUC 4ZO7A 1GL7A 3T1TA 2XMDA 1TZBA 4MWCA 4R1NA 4AY3A 5BV2P 4JVMA 3COVA 1J9EA 4Y7CA 4LDNA 1SU7A 1JBEA 2WHYA 3K0BA 4LZOA 5T57A 3Q8KA 2Y9PB 3DDZX 5GONF 4FDMA 4EI7A 4YWHA 2PKRA 3J7TA 1AA9A 1OA0A 2ANCA 2C5EA 2CHEA 3N8IA 4KGVA 2AK3A 2E9SA 1P4AA 2LV8A 2ZS7A 4LYEA 5J58A 4Q0MA 5G40A 4H3KB 3GLHB 3Q9UA 5CB4A 1MC1A 4EUNA 5AJXA 5LBTA 3OURA 1SHUX 3AESA 1GA4A 5KNCD 1YZYA 5AK4A 2WT9A 4WEOA 3ESQA 1Z6TA 1GZHB 2PNFA 1C4XA 3W6UA 2BMVA 2RSLA 2J9RA 4MX8A 2D3TA 4H60A 4L6CA 4QJIA 5E1BA 2VZ9A 2EKLA 3AR8A 1ENOA 2NSYA 3ZY2A 4U3JA 3UJ9A 2GHTA 4K6HA 3VR2D 3I1IA 2ZYGA 3ENQA 1PVDA 2VT7A 3KR9A 3SR4A 2WPDA 4A36A 4EABA 2IYTA 3KOWA 1CE8B 2QY6A 3DZGA 1P7CA 2ZSIA 3MK31 2YHBA 1ZCFA 4IICA 1WHTA 1YDFA 2QD2A 3U7IA 5G0VA 3VNBA 4CM7A 3LBYA 3EZGA 4XR9A 1TE2A 5K2MA 3RBAA 2A0UA 3PNLA 2AB0A 3SC3A 1H5QA 2IUEA 3ICQB 1SURA 3WMFA 4BO7A 4E14A 4JB8A 5CU7A 2FUCA 2XVMA 3WGMA 3A28A 521PA 1K9VF 3AHHA 4HQOA 3PLAE 4ID3A 4D5GA 4ZO9A 4ZCSA 5AOCA 1RYHA 3V55A 5ULLA 1DWPA 2Q5IA 4ED9A 4KWCA 3THSA 2X6TA 3WGJA 1QNFA 1TJNA 1SD5A 2H4YA 2XTJA 2Q5LA 3JQPA 5JNRA 5JXJA 2X4IA 1I0IA 1SZDA 4IFTA 1ZXXA 5F77A 1XCPA 3G9QA 1AQIA 3MTBA 1UC4B 2KE5A 2XNDD 4PR3A 5FI1B 2RIRA 2CXHA 2BYTA 2NQ8A 3ZHYA 1HLGA 2PAFA 4F5YA 1YD7A 2HWWA 5EFZA 1PR4A 1ND5A 4P7BA 4ECAA 4K6MA 3MWKA 4BWFB 3PFBA 3MMZA 1C0KA 2NSDA 1MV8A 2RC6A 4RL4A 1G60A 2CBGA 4D9IA 1TM5E 4HWOA 4JJAA 3LUDA 3V8MA 1GU1A 1XB2A 4MQMA 4QEKA 3U7QB 2EL7A 1M1YE 2UVDA 3NBXX 4CZ2A 4W5QA 1AQUA 2OAQ1 4CE6A 2Z0MA 3E3OA 2H7XA 2FF5A 421PA 2R8EA 2DC1A 5FPTA 2FSFA 1UKVY 2YWJA 1N0HA 3VQTA 3FCYA 4IDHA 1V39A 2JJ2D 3VH4A 3DLTA 2GK7A 2FHPA 3W1WA 1JEQB 1I0LA 1CQIA 2Y6UA 3AT1A 2YMQA 2CHQA 3Q8XB 4NMXB 4EPWA 4B3FX 4YHHB 4DLUA 2X3FA 1JDVA 2BMFA 2I1WA 3PD0A 3SZ3A 4LJYA 3BC1A 1CJVC 1LFAA 2DWPA 2J3LA 1AK2A 4HI0E 2O50A 3S8MA 3ENVA 1MEOA 3V3KA 4ZU1X 1WXWA 4U6QA 2HF8A 2QGNA 5EZ5A 3UUGA 1VL6A 4QXQA 5LXTA 2ET6A 4DARA 3HVHA 5AUNB 1CTQA 3MGGA 4M53A 5BRNA 2OLEA 2M6RA 1J2RA 3MJ4A 1ULZA 2PH5A 3C14C 3LO8A 5ELMA 2OORC 2XT9A 4OI0A 1LGYA 4BCDA 5A4FS 2WICA 1GUAA 1ZL0A 1VKJA 2DCMA 2UZ1A 1EVLA 2XW6A 3R4VA 5ICFA 4KBYA 5TQ0A 1VCHA 1YU9A 1VMEA 2OOKA 2VP3A 3UJCA 3TTSA 3ZI0A 3X43A 3ZVRA 1WABA 1UBJS 1QRUA 1A8SA 2JATA 1JDTA 4DQ0A 3NDPA 4GPD1 2MYNA 1J1UA 3MFQA 2ZSKA 5FBVB 2P77A 2H6EA 3FUCA 3PICA 1T1EA 2GBGA 3CNEA 3SC2B 2PWPA 3C39A 3W5BA 3PT5A 2EP5A 4OUDB 3OJCA 2JD1A 3JASA 2HU8A 3QE3A 3PDHA 4EQ6A 3LQ4A 1FF9A 2J8ZA 1G4HA 1DKUA 2AMYA 3OZEA 3UV7A 5HRUA 1TO2E 4LSGA 4RFLA 4D1YA 1U2TA 2PT7A 2Q3FA 4ZHQA 2OHHA 1XRRA 1EE9A 1YJAA 4YRZA 1RLMA 3PC7A 3EVDA 1Y3HA 2PD3A 4U7WA 3V4LA 1K8QA 4JH0A 2JC3A 2ZLBA 2AZXA 1M2WA 1JQJC 2DHRA 4EGAA 4BRWA 1QHNA 2HC9A 1H0SA 3NI2A 4D6XA 2CD7A 5DM70 5KOYA 3F9RA 1BCRA 1WE2A 1ZONA 3KAKA 2AD1A 1MV5A 5IBPA 1EFPB 3RSHA 4A5SA 3PR3A 5B2EA 3CIOA 3M4YA 1ZUD1 3DAFA 1HF3A 2PIDA 3MTDA 4KN6A 3LBHA 4XCVA 1D9XA 3VHXB 2ZWOA 3VVLA 4IV0A 5BW5A 2C2MA 3GXOA 2A92A 4JS0A 1KJZA 3EZ9A 5D3KA 3K3PA 5TY0A 4DCSA 2C31A 3OF5A 3NIGB 2ZAMA 2ZRNA 3WNDA 3MNFA 4DQDA 2B8WA 3F6BX 1CRWG 3TZHA 1LDYA 3IB3A 4N01A 2JG3A 1VI2A 1BH6A 2ZR7A 1SA0A 4B33A 2VTBA 2G7ZA 1K27A 1NU6A 1GARA 2YR0A 4C4TA 3W34A 4LYGA 3HCOA 3OP4A 3LY7A 3JAKB 4XE5A 1Y6GA 1KDYA 4IW3B 4HJRA 3MCVA 2R2GA 1W1IA 4Q4LA 2H4JA 4EGCB 4YUAA 5JHHB 2D59A 3U3KA 5AH0A 3G2JA 2G9ZA 3STHA 4DCUA 4FHZA 4AS2A 4KIFA 2CZGA 3IRUA 4BZPA 3KD2A 1QGDA 2F1JA 1CFJA 2X23A 3WISA 2FQWA 1EZZA 1WAMA 4O4JA 4AN4A 3AJEA 3ITNA 3O4GA 4U7DA 1FRZA 5CT9A 1WXXA 2VRBA 3FR7A 1M5UA 3DOUA 2JPDA 4DSOA 4MV9A 4WL0A 4KWHA 5AM4A 3T34A 3OTQA 1RVV1 5I4CA 3TFWA 4J7CA 4WLUA 1T25A 4ZMBA 2H59A 4HDSA 1W36D 1O87A 2OCIA 4JK3A 5AHWA 4OSEA 1SKQA 4Q9JA 4TLDA 3QE9Y 4MTLA 1V4NA 2GHRA 3FIUA 1DAHA 5DLPA 3T54A 4GQBA 4IDDA 4O0LA 3UGQA 3UVEA 1WBJB 4C0BA 2N0SA 3IPAA 3PQFA 4D3XA 1TF5A 3OE5A 2ISSD 3QMWA 3PEYA 3KVVA 2PKQO 4LGMA 3DC7A 3RG2A 3SQWA 1OU4A 3MWDB 1DAPA 1V9CA 4R2LA 4RKFA 2IS4A 5CVUA 4J0EA 2PGJA 4N8EA 1WBBA 4G5HA 1Z0ZA 1E5QA 4GAEA 4I1SA 3USCS 1EXDA 1UXOA 4MVJP 3S55A 3WXBA 4C76A 1XNGA 2F59A 2GJAA 2VRCA 4HDMB 2QUBA 1J8VA 5LUAA 2AC2A 3ZKWB 4PAGA 3TD9A 2OSVA 2CL5A 4R31A 1ELOA 2FCRA 5KTNA 1PZGA 1X7ZB 1OFUX 5DW3A 4EHIA 3TUZC 3WSVA 3KEFA 2NO4A 1X1QA 2XWBF 3HQ4O 2IHTA 3A1EA 3DAHA 5K3SA 2L82A 3QKUA 4ISBA 3QITA 3K5WA 1FA9A 2VR1A 2VCHA 1WWKA 3CVOA 3NH6A 1JHDA 2VHCA 2YUTA 5DK6A 4GI5A 3O26A 4C0KA 3CX4A 5A6VA 4XVQA 1QF6A 1YVUA 3GD5A 1GNPA 2P4SA 3IVAA 2CB0A 2ZEJA 1T13A 2JKZA 2QPOA 2NU7B 3ZLTA 1IY0A 1WEKA 2VNJA 2HRQA 3FWPA 4DLKA 4BV3A 4DWOA 2X3YA 2RD2A 3WNCA 4CNBA 4Q00A 3B53X 3WNQA 1MJFA 2ZFUA 1N1EA 4LWQA 5AKXA 3QW4B 4CIBA 3LV8A 1QRTA 1TAQA 4KAJA 5B1DA 5I9TA 1IZZA 3EXG2 3ID6C 4BFTA 1JQAA 1P4RA 5EJAA 1EWYA 1C0LA 3QPVA 5JHGB 4L50A 4H35A 4N5MA 4IIEA 2FP3A 5AR1A 4OHYA 4LWOA 2V6BA 5ERXA 1FJ2A 3CWCA 5EWMB 1J39A 4WA7A 4YJ3F 1NW5A 3HKEA 3I42A 3HVKA 5AOBA 4CGYA 3HL4A 4O59O 1P2UA 2R8YA 4NMWA 1QVAA 3IRVA 4G2TA 4XVUA 4F04A 3TR0A 2ZI6A 5F98A 5JADA 3L7DA 4NYIR 4B76A 1XPOA 3CX7A 1LRKA 2R65A 5ALJA 4MGIR 3PGLA 4FKMA 2PXCA 1KARA 2PZAA 2ZBDA 3ND9A 1GEEA 4PQYA 4UUBA 2GXAA 4MQ6A 2J3DA 3JQ7A 2DEUA 5HR5A 3JAMA 4OUKX 1T4BA 1P80A 1I24A 1PUJA 1WHSA 4GM0A 4NCIA 2ZI7A 4KBGA 5HCUA 2C92A 1C9KA 1CIPA 1OX5A 4UVHA 2DUJA 1E5XA 2A58A 1NAIA 2OZLA 3MXTA 4AZ0A 3IAFA 4NE9A 2MR6A 2N1MA 3L8EA 3LUBA 4QREA 3M0EA 1E8MA 1I2DA 4KIWA 5JJKA 2JIZD 3HDVA 3B5IA 1JSZA 1V5GA 1Z5NA 2O2DA 3A1WA 3JYQA 1LPNA 4Q3LA 5DYGA 1T3SA 2AK2A 2QZZA 1RAAA 3C6ZA 4QU0A 5F64A 3JXEA 4B3CA 4EGFA 4CEHA 5TC4A 4QG3A 1FRFS 1H2XA 4AQDA 4RJTA 1SQ0A 3AI2A 4ZQIA 3P2MA 2UUAB 3FZGA 3T3MB 1N5JA 4OLHA 2QNBA 4M0UA 3LAWA 3TCKA 3SP1A 4DXAA 5AVYA 1O08A 3KTAA 4XPZA 3WGYA 1NBAA 2FW6A 2E1PA 2QP4A 2W2TA 3UWDA 3BAFA 4WJZA 1HFKA 3V8QA 4R69A 3GYGA 2C4NA 4OQFA 4JB3A 4B84A 2D2EA 1U7HA 1RYMA 1BSVA 1DRKA 3K0CA 4EQ6B 1EM8A 4MVJE 2BHSA 3NV7A 1YL5A 1H0HA 1FPQA 3AWIA 2JCVA 1J8YF 3EG9B 4J6FA 5DCWA 1Z37A 2J41A 1GQQA 4QOSA 3GLQA 2E4UA 1B00A 3WLAA 3QEAZ 3CEPB 3A2LA 4EECA 3AOGA 1WTCA 3PLNA 2B4AA 4WXPA 3TVTA 3WLFA 1RHKA 4ZT2A 4RF2A 5B3JA 2ERYA 2QT1A 1T9KA 2Q21A 5CIYA 3L1VA 1GZ4A 2JJ2A 4HGNA 4AKEA 4DLLA 3L0DA 3WL5A 4GRIA 1F0NA 3GEPA 5JQWA 5AIBA 3HEBA 2IEZA 4F1KA 2ZUSA 1WNFA 3ZHXA 1F0PA 3QJ5A 2D6FA 3UXMA 1M2EA 3UJNA 2GN8A 2MSDB 4OYRA 1L4NA 3URKA 3NTOA 3IKTA 2ZJ3A 3UBTA 2QI9C 5H80A 5BV1A 3HVRA 3C3MA 3RTEA 1IUKA 2OBXA 3UWSA 4DDKA 3BWYA 1WB4A 1F9AA 3RSGA 4EUKA 4KQ2A 3PIRA 2LUOA 2FW8A 4FU0A 4GBED 4NMLA 2ONJA 3LU1A 3UAYA 5HF5A 1SD1A 2H1VA 4NJOA 4QDJA 4DF3A 3OFND 4UZFA 4YRTA 4OQNA 4UM7A 2VP4A 2Z1DA 1CUFA 2D7CA 4NAHA 4DJTA 3LX4A 1QRDA 2GBLA 1VJ5A 2QIOA 3QX8A 2BTEA 1CQXA 4QSHA 5D84A 2UYQA 2OQIA 3EHDA 4KZPA 1XAIA 4OU4A 1QB8A 4CM8B 3MJHA 1H2HA 3PUHA 5ALYA 2GD0A 3EZNA 3HFJA 1S01A 3DEZA 4RV9A 4C2AA 3MS7A 3FSRA 3SX0A 1HNXB 1E58A 3I1JA 3EXEA 5AVZA 4AP6A 4GX0A 3NWBA 4OQMA 4ESOA 4IOLA 5C32A 2QUHA 1NV8A 2R8ZA 2TMYA 4XWYA 1SIOA 4F4UA 1Y1PA 3DV0B 1OT5A 3EXHA 1NPTO 3BXZA 4FD3A 4HRAA 4JI0B 2ZWVA 4RD4A 2CL7X 2DHQA 1UM9A 2I4LA 2GEUA 4L5JA 1P1CA 9GPBA 2QIPA 1FMCA 1GPBA 4JOCA 4CKWB 4S2EA 4S12A 1EJBA 4PFSA 4PO9A 1TO6A 3WNVA 1N3BA 3IAHA 4MR8B 4GEGA 5HBGA 821PA 3HB4X 1T8TA 2YN4A 2EFGA 4CM5A 4YONB 2GD6A 4GC5A 1A7AA 2HPHA 4L9AA 2OECA 3RVMA 3SIPA 1LPPA 3ZE1B 3C6YA 1PDOA 2AKAB 3OX2A 4QPCA 3M5CA 4Z7OB 2GVZC 1N2SA 3FVRA 1L5GB 3ZJ4A 3TG8A 4M1WA 1ARZA 4D97A 1GKKA 1G8JA 2VLIA 4M9ZA 3Q3EA 3NU1A 1ODFA 1UIMA 4JI1B 1M54A 3WV5A 1K1EA 5B7QA 1JLMA 3L1UA 2CFCA 2ID7A 1P4GA 3H4TA 4QHTA 5HE8A 4DR3B 4OA8A 3CX3A 3K1ZA 3O8OB 4I50F 5JYEA 2OGUA 3BGSA 4QGSA 3DTNA 5DRTA 4FXPA 2WT8A 3URMA 1C3OB 1YS1X 2DUMA 1A2KC 3QUBA 3CZRA 2VYFA 3QY9A 1M74A 1MW8X 3DOJA 4CEHB 1B0PA 2GZHA 4NZPA 3EGVA 5DNEA 2HMSA 3L7OA 3L02A 3HCNA 4PGGA 1P8AA 1YRAA 2OVFA 2V6MA 3HU1A 2EQ5A 4FCVA 2X9VA 3U39A 4UDNA 1WUHS 1C8LA 4B34A 1VPDA 2J6IA 1T5TA 1I0ZA 3LHKA 4X63A 1UBTS 4C5BA 4AIRA 1JU9A 5BSGA 4UTOA 4ZGBA 5FUWA 2F8SA 2FI1A 2CLKB 3UGKA 3ZDEA 5CH8A 5BSFA 1YACA 2O3QA 1XEXA 4RD3A 1I6MA 1W2GA 3RT7A 3G1TA 4CPDA 5KOJB 2E49A 4TQUS 2P3QA 2C7RA 1P0PA 3DL4A 3IMFA 3UPDA 4S05A 1QHSA 1RQ2A 2JIQA 4ZXPA 1GITA 1V5FA 5U9CA 1RKVA 3F98A 1ORRA 4MKIA 4OSOA 3U3OA 2AH5A 3ZEAA 3R6GA 3JPWA 5JVDA 2H4XA 1F4LA 4Q18A 2FH5B 1NW3A 2HZ7A 4NK5A 1XZDA 3HJRA 4G1VA 3NQ41 4KXLA 1HT1E 3ZDXB 1KMMA 3UMCA 2BGGA 2F4VB 5ARCA 4IINA 1P31A 1QONA 4TTTS 4WCVA 1XMVA 3NJ4A 4KXQA 4O63O 3KQKA 2F00A 1GPNA 2APJA 4K2HA 4OXNA 4D57A 3WYGA 2JVIA 5IKMA 2AHRA 1IXZA 4D42A 3GG2A 9LDTA 4QBIA 2J5RA 5IDWA 1IATA 3RG8A 3FTNA 2WQ7A 1QQBA 4G89A 3A31A 1SG6A 2DR0A 1J5PA 1H5UA 3FFWA 3NAMA 1NXWA 4PG4A 3BH0A 4MRSA 5DF1A 1QTNA 3BILA 4F8JA 2VH5R 1X13A 2VRCD 2QUJA 3CH7A 3KJFA 4Z0HO 3TLKA 1SVWA 4GDFA 1UMDA 4JLOA 4PBSA 1QIJA 3C70A 4R98A 4DIEA 3O2QB 4P92A 2X77A 4DV3B 3AVOA 2JLVA 1EM6A 2C2BA 3BZBA 3A1CA 2R1VB 5ENVA 4B4OA 3L41A 1DO8A 3KQHA 1GEGA 3O5AA 3AESB 2EEZA 2J3QA 1P5RA 2PZLA 3KWJA 3WOVA 1Z2DA 4GNRA 1RLOA 4AKIA 2Y0BA 4Q05A 3KQNA 1HDGO 3PNSA 2WA2A 4MGKR 3IP7A 4KH1A 2JLQA 2XUKA 2OFXA 5C35A 3QLVA 4KGZA 5FOTA 4EKNB 3U4DA 4QECA 2O8DA 3EVBA 4D3YA 3SKXA 3L1JA 5CT5A 2RI6A 2B25A 1K08A 3K0HA 1WRBA 1NJGA 1K6IA 1DQPA 3B51X 3LZDA 1IUNA 3S1LA 5HRCA 5CX1B 3U16A 2BF7A 2QJOA 3GPCA 3H1GA 5H4HA 3ZYZA 1EDBA 1P0QA 4DUZB 4HNSA 2DSNA 1U2GA 1RRCA 2YHUA 3PX3A 1E79D 3N2GB 1ONOA 3BMQA 3X1WA 2IK8A 1LBHA 4WZAE 1GAJA 1K98A 4TMVA 4G09A 2NPIA 5IMSA 1J9ZA 2V7PA 1VYTA 5HK9A 1DBSA 4GVLA 3Q40A 2ZG6A 4QRDA 1LPAB 4GHWA 1SVSA 4A9AA 3W2GA 3BD6A 2JHAA 2H1SA 4RV5A 5BO5A 4AROA 4GGOA 1RWXA 3WYBA 3FROA 3LC7O 4OHVA 3I3OA 4GH5A 4H1VA 2AN4A 3P9SA 5LU8A 2IH2A 3QV2A 1FW8A 1FYDA 3IOYA 5DCUA 1UP4A 3N28A 3LX8A 4LXYA 4U9HS 4R1OA 2P3OA 5IBRA 3ZWYA 3L9XA 2V0GA 4RPJA 3Q72A 1M2NA 1PGQA 4M0FA 2IXAA 1GA6A 3IP5A 3BGVA 1HE3A 1IY2A 2BBWA 2O7QA 4YHBA 5E6UB 5CFQA 1HFWA 4UASA 4FW8A 2UV8A 3N0VA 5AVVA 3D0KA 1CUAA 3QYPA 1P45A 4EFMA 1I1HA 1Q1GA 3GCGA 1Z5PA 3N6XA 1EH5A 1YZFA 3U4IA 4G1EB 3A3KA 5SICE 1QPZA 4NQRA 4EF4A 4V02A 3IAS6 4RPGA 7MDHA 2H7VA 3JQGA 3DF7A 2JGLA 5ER6A 3IELA 4U8HA 2C3UA 1ECPA 4A92A 4IYRA 3E7XA 3RUIA 2KB0A 4LZNA 2JAWA 3PRJA 1A1VA 1RYYA 4JLBA 1I14A 1SNYA 3H1FA 3ZI4A 2FEXA 3A1VA 1T6YA 1EVKA 3DWGA 2FEAA 4JNKA 3NVKI 4MCIA 1DIGA 1E1CB 1N6NA 2BGLA 3DKPA 5JXIA 5J43A 4EEXA 4E70A 2NW6A 4FGJA 1IBCA 3VAYA 4FYHA 4OLFA 2FSGA 3A2MA 4E88A 2CY0A 2ZJAA 3AVWA 4ZQEA 4GM4A 3UJ7A 2VA9A 5LQRA 4NABA 2BFBB 1D1TA 2B1IA 4BNDA 4C4AA 5IK2D 4G0MA 3KQSA 3FCSB 2HTEA 1PG0A 4HFJA 1M2OA 3R20A 2OBMA 2PZGA 3QEMB 5CYGA 3KYBA 4MINA 1X1TA 1I5OA 4ADSG 4FB4A 1YZ3A 1U1CA 1OTHA 4JEHA 3JAWB 3SYNA 2HHLA 2Y8EA 4LE0A 2PUHA 2COKA 4FZRA 2HZBA 1OWOA 4Q21A 5C7LO 3PDUA 4BJ5A 1MZVA 5JMPA 2HHAA 3PXCX 2VT2A 4IUDS 4Q03A 1RQPA 2H06A 3TTYA 3QEMA 5A5EA 1FU4A 4W1SA 4OQYA 4XASA 2AG1A 3HDJA 3QVMA 1VRCA 1ZD8A 3GW8A 4OYHA 5JZOA 3PXDA 1T5LA 2D2FA 4HN9A 1Z4MA 3HC7A 1G1AA 3CWZA 1JJIA 5H59A 4NZ9A 3BXXA 3MSXA 3DE7X 1R12A 3PFIA 2EU8A 1H1LA 1EFUA 1ZUWA 2BCGY 2P4QA 3R0XA 3KPWA 3Q8WA 2OB2A 2QN6A 1J8DA 3H75A 4EPVA 4AW9A 1ICIA 2QE7D 1Z6ZA 3EX7C 1W7AA 3NTXA 3AYZB 4H7IA 3I72A 3KOXA 3JZFA 4E4RA 4NBKA 5G4KB 1IBKB 2AI2A 2P2NA 4CT5A 4A82A 2WTEA 5J4VA 4CL8A 4F9EA 3I83A 3IV6A 3VNVA 3IQDB 2OCPA 3LVFO 3LECA 2ODAA 3OCCA 1A0OA 2OV3A 3BL6A 3OT4A 4II7A 1KI2A 3PF8A 4MOWA 5AO9A 3PUXA 5UKDA 3SC2A 3FOWA 3HRIA 4Q19A 3N53A 2WJGA 3LLUA 4LJ7A 3FCXA 5GVRA 3I5XA 3GBSA 2AG0A 1WTAA 5ALGA 1XMJA 4UAUA 2OAEA 4CT0A 1BNCA 1OV4A 1QG4A 3IAM6 3HXOA 2KBEA 3N2ZB 4BMVA 2PV0A 4X00A 4M46A 2IGTA 1DCKA 2YHIB 4OG2A 1OYVA 4HUJA 4JR1A 1BVRA 3YASA 2P2CA 1MC8A 3CFYA 1M2OB 3PHCA 4L08A 3WBKA 2XLCA 3CXUA 3RTCA 1KQGA 1J56A 4P82A 1REQB 2Z98A 2MSEB 2FZCA 5H81A 5HOEA 3NHRA 5E7IA 1PYGA 7AT1A 4HTFB 1T6BY 2PYIA 1JFFA 4FK8A 1FMJA 3RU2A 3IQFA 4RHCA 3THRA 1NFRA 1NNI1 3KFVA 2AGVA 3KJIA 3RHFA 3R0QA 4YQYA 4YROA 3TIFA 3S44A 1OH8A 1FBTA 5BVHB 1JAHA 3GARA 4HY3A 2BI4A 1B3RA 4LVUA 4CV1A 1SKBA 3VUEA 1X3LA 1P3Y1 2GZ2A 2XB8A 3OCUA 3P45A 1A4UA 1P2FA 4WBXC 4ER6A 3ZGLA 2J3JA 2ZRIA 4LVCA 4CXMA 3Q41A 4IDOA 5JBNA 3OPYB 1RQ7A 5JI3E 4CV2A 1EE2A 1EYZA 5B36A 1A8QA 1LNZA 4H59A 3T5AA 1U6KA 1TB4A 2P2SA 1K2WA 4P7GA 2VQFB 4DLSA 5I45A 3W5JA 1X74A 3GUHA 4NOKA 5CM9C 1R5JA 1SQ6A 4Y0AA 5AKHA 5KWVA 2D5IA 3JQDA 3RRNA 4Y6QA 3BYZA 4XXHA 4B79A 3GT0A 5BVGA 1AUPA 3GK3A 1USIA 1Z2NX 1Z33A 1S0UA 2GPAA 1IZ7A 1XMXA 5DASA 1NY6A 3RFFA 2QW1A 3F74A 4JU8A 2OAP1 1KQOA 2OHJA 5EUCA 3NTUA 4MQEB 1T8PA 1OR8A 1EUZA 1PR2A 1W9HA 3EXFA 4QXMA 1ZWKA 1N7GA 2NOAA 3CS3A 3V1LA 3QTBA 4D8YA 1QYRA 3PI7A 4FDAA 2ODWA 4FGSA 1KRHA 2Q7XA 1X8LA 4R84A 1DRWA 2DRIA 1YE3A 1P4HA 3KWFA 2HH9A 4UPEA 5DSXA 2H0AA 2X1MA 4U4AA 3F5DA 2AOUB 1OT3A 1BS2A 3QNUA 2RHWA 3CZPA 4F7WA 3IIEA 4Y67A 4OHCA 3BIWA 2YINC 1US8A 3NFRA 1KI6B 4BCBA 3REQA 3HKBB 3UXEA 1GTRA 1EJ2A 3LQ2A 4MIOA 3VO9A 3TXXA 4G23A 4JEIA 5EQTA 3M6XA 5AW7A 1OUMA 1U4SA 1DAEA 3OJXA 4XQEA 1S2OA 2BEUB 3I9MA 5IN5A 1U04A 3AIOA 1U5BB 5B12A 2JD2A 4NLLA 5F4ZA 4CTNA 4BMYA 4GOND 4I5GA 1UJ5A 1DWOA 3BD7A 1N8TA 1Z56C 1V5IA 1ZRNA 1PX0A 4NF2A 5DBGA 5LC1A 3T38A 1KVSA 1I7SB 1W36C 5BUSA 3K94A 4PX3A 3I2GA 3RC2A 1M75A 3QF4A 4QPNA 2BGTA 2R60A 3F8WA 2VHQA 5KTMA 4JA2A 3AONB 1R6XA 1RXWA 2HGZA 3VAAA 2Z2YA 5E2IA 3OIUA 2CNWA 2IIQA 4EMTA 2AYZA 1PRYA 4OMUA 3BMNA 1JR3D 3SYMA 1JFFB 3I2HA 4O4HA 1QHGA 3ML1A 4OJKA 4Q82A 1W46A 3EHEA 3E27A 2VJCA 2YY6A 3PEUA 3UH1A 1UDBA 4KW7A 3WWCA 4GI1A 1Q0QA 5JNVA 1R5OA 3FHCB 3FCUB 4JJKA 5AM5A 3H19A 5IF3A 4IQGA 1IQUA 4UBIA 4OB6A 1YQUA 4M0DA 3H5WA 1KFEB 5FPPA 2FZWA 5L7WA 2OZEA 1LFDB 4KQKA 4AVYA 3PWTA 5HM6A 4FM9A 1H9BA 1F2UB 1RZVA 1TQ2A 2PX3A 2Q1WA 2H08A 2ZYRA 3MMXA 4MWGA 4E1BA 1IB0A 2WJIA 1T34A 2Q9AA 4Y30A 2O20A 4ZOEA 4XQ9A 3OETA 3AW9A 2VJOA 4HRYA 2Z2KA 3L40A 1U5CA 4OGKA 1SXHA 2QL6A 5HX7A 1H4SA 1KY3A 1AJEA 3DLIA 3OIGA 5FCDA 3OZCA 2BH9A 3HNRA 2D0PB 3RH0A 2X14A 3G3EA 1UEJA 2VHWA 3AB3A 4HAZA 4IIFA 4UFPA 4JUIA 5FFNA 7GPBA 2IBSA 5I7SA 4D3FA 4K9SA 1U0EA 1JHRA 1TMOA 2ECPA 2TMKA 3ED5A 3L07A 4X7BA 1JTFA 4EKDA 4OLBA 3W2TA 1T5IA 3DMYA 3TLMA 4A03A 3L4BC 4WXMA 2V3VA 1PO7A 3KU1A 3QOXA 5CEJA 3PUKA 2A5DA 1PZMA 1OBVA 3OPYA 1QR2A 4PRYA 2R8XA 5SY6A 4AJ1A 4Z51A 2WKQA 1QZ3A 1UBNA 2WSSA 2ZUCA 1DOAA 3TQOA 3T6KA 4CCYA 4D9NA 3KKOA 1PNOA 3LDUA 4L8YA 2J07A 3VHRA 4BMOB 4IS3A 1KJWA 2PUGA 2RK4A 3LPAA 3NASA 4NBRA 3TEJA 4U2CA 4UXHA 4K3VA 1R8QA 2FEOA 3RT1A 4DGSA 4X84A 4F96A 3CW9A 5HPYB 2O3RA 4Q7QA 4CQLA 1N0VC 2CBZA 1A72A 2NN3C 4HQKA 4C7OA 3G0GA 3N8NA 4ARZA 2M98A 2FG6C 2W2LD 2J6BA 5EQJB 5A3VA 2HJHA 2H1RA 2IKQA 2QTZA 2PUVA 3I9V6 2ZYIA 3OUZA 5LQCA 2G25A 4GR4A 3TM4A 5D5QA 2PBZA 3SIWA 4YAUA 1Y9DA 5IABA 4J8PA 4UOZA 1DU4A 2YDXA 4KNVA 5KPDA 3CBGA 2LIVA 4M0MA 5J63A 3RIMA 3WNBA 4KE6A 2Q9BA 1S9HA 1BVUA 2CKMA 2R1TB 2VDRB 2OY0A 1DIRA 2DZDA 2RH4A 3NRCA 3OKPA 2QRPA 5FEMA 3ZBPA 4B45A 4CMKA 2GM4A 1DJMA 1UKZA 5DTMA 4ID9A 1XP5A 2XKJE 3GT4A 9ATCA 5AM0A 3AB8A 3PQDA 3ZDQA 5FOWA 4NS4A 2O19A 1UBOS 2MTBA 3GIDA 4IHJF 1NBWB 1MB3A 2HCFA 3QTLA 2JHFA 2L18A 3ABIA 4W7HA 2P91A 5P21A 4C6TB 2SCUB 5F78A 3EZYA 1M1ZA 4PG7A 4RVOA 4WBNF 1YR2A 3HDYA 3QY0A 1QSGA 1D1PA 4LCBA 2QU8A 4AFNA 4OIMA 1M6WA 2XDAA 1MC5A 5EEGA 1AG9A 3QFHA 1NWCA 1KWKA 2D4AA 1H0KA 2MMGA 2P9JA 3C15C 3SHWA 3JQFA 1PNVA 4M86A 2X5KO 4CN9A 4KO3S 4US0R 5HWSA 4Z1OA 2OBNA 3OCZA 4J0HA 5KBYA 1GN8A 3FYHA 1RTKA 5A5FA 4PFKA 3K4HA 4EI9A 2NO7A 3U4AA 3MQ2A 1B26A 3CRQA 3UZUA 4CL2A 1KZ1A 2BGNA 4MA0A 4LYYA 5HOQA 2P5TB 2OFOA 4BLTA 2I76A 3OI7A 4XJXA 2FR8C 4M0KA 1KK3A 1XWIA 1FFXA 4X1IA 1C8BA 4TV9A 2QG6A 1SWWA 2IU0A 1JHOA 2QT0A 1YB5A 1D4AA 5C1OA 2OQ2A 1JR4A 2BJHA 4WUVA 2AXQA 1XKXA 5F1OA 1XZLA 1B6SA 2R6FA 4FMBB 4MW7A 4ZAXA 3RFUA 1L5YA 1P1IA 2DTEA 3GLTA 3DZKA 3GFFA 3O7MA 1NDHA 3VMFA 1K6MA 1X3SA 4ZC1A 4TYNA 1U0OC 1MB0A 3EQZA 5K99A 2CW5A 2RG1A 3N5KA 3ETEA 3KCNA 4OP3A 1WVIA 3FB1A 2XKAA 2ZU0C 5IKOA 1RLUA 3DD1A 5AYVA 3EXIA 3GLHE 5CXUA 1MORA 1U31A 3JQ7B 1FW6A 3SJAA 3LCUA 3O8DA 2O05A 4GLBA 3H3XA 4S0ZA 2HDNB 1OLSB 2I29A 3PGXA 1P0FA 1TZMA 3LHFA 2BONA 3TECE 2JD0A 3FCEA 5AKZA 5A0VA 4GDMA 5H9VA 4C0AC 1UPXA 1F0YA 2J87A 2RG7A 1WMAA 3VZCA 1WDMA 2VDOB 3ZY4A 1EA7A 1IUPA 5KYXB 1DBWA 3DUFA 2OM6A 2RGXA 2XE7A 3BERA 4ARCA 5AT1A 2FEWB 2PCJA 2AE2A 4BHTA 4COOA 2XMZA 1AX9A 4II2A 2O59A 2AMVA 2V4UA 4QUIA 4F12A 3PDWA 3QKRA 4R2XA 5G1OA 1S3IA 4UUNA 1XDSA 3G6WA 1APBA 1Y98A 1ZC3A 2FPUA 1KNQA 1V16B 3A3PA 1M8JA 1TD1A 3I0ZA 3JR7A 3KEQA 3MCTA 2VNAA 1H9AA 3ZW7A 1YZLA 1WXFA 4G0ZA 5DYTA 3N0RA 5FA5A 3WGHA 2IZ5A 2ORVA 3HCFA 4YPVA 1E2GA 3QWFA 3NP7A 4MMYB 2YJ4A 5I9NA 1UJBA 1VTKA 2C2KA 2V4MA 3HDQA 2ZJBA 2UYCA 2QD1A 3R3JA 4QOHA 3BWBA 8GPBA 2Z30A 2ODQA 4I8DA 1ZNQO 1LQTA 1P3DA 2AFVA 2BKUA 3V97A 4YCDA 3A1FA 3STYA 3IIMA 1KGDA 1ECCA 4C87A 1W75A 1ISMA 4URHA 2NMVA 2Y2UA 2IS1A 2ZB8A 3SQLA 5LDHA 3G1WA 4Y9RA 5HQ3B 2MSNA 3KOMA 1U2PA 1VIYA 5EHNA 4MVWA 4CDNA 4BMNA 1NMQA 3OKCA 1XQ9A 1XGKA 1GP2A 5AI5A 3F6EX 5IMBA 1KXJA 3MBKA 4OFZA 4NP6A 1AQ6A 4YC7A 5K8JB 1GYPA 4B6RA 2REBA 4M7WA 4C0QC 5BNWA 1QX4A 5B57C 1GYRA 2RGEA 3A8TA 4IQ8A 1OOEA 1FDSA 4FKBA 5EXEA 2O2IA 4XGKA 3B89A 3TZCA 3BHJA 1KEEB 3CPSA 4EFDA 3JYOA 3IBYA 5LMCA 1JJ7A 1L7NA 1NF8A 4YRAA 5L9AA 1FFXB 4X1IB 1PDWA 5DZSA 3UJDA 1J5EB 1RR6A 4QOFA 1VMDA 3WGVA 4BNUA 5TVKA 2WLSA 3GAZA 3PHLA 3N87A 3SE0A 4CKBA 3AOEC 4MYUA 2AVNA 4P3PA 4DG5A 2W58A 4BVLA 3GOQA 1AUQA 1XLVA 3EIQA 5CVCA 1TIBA 3ASZA 4OGGA 2VG8A 4D0LB 4ALJA 3GNQA 4W8GA 2JGIA 3CUSA 1XZIA 3EDMA 3GX1A 4DXDA 4E09A 4L72A 1TTPB 3D4IA 4IEEA 4P9NA 3L43A 2PUDA 1U3GA 3QBDA 1BMTA 4CUJA 5AVTA 3I37X 5B55A 2WIDA 4LY6A 3OUUA 1QH1B 4M0CA 3UMJA 1A9SA 2VP2A 3BICA 4US1R 1NPDA 2FEPA 5J1TB 1VQ1A 3L6CA 2YZKA 1E69A 4ZGGA 2YXNA 1I2ZA 1ZSYA 3FLEA 4UKDA 3TN7A 4GBMA 3UT0A 4I5EA 2Q0XA 4I1YA 3S5JA 1UT6A 3FAKA 3O4FA 5FQOA 4HH1A 3UK7A 5BT8A 5C31A 3LRPA 1B14A 3OIVA 2PPLA 3MBOA 1WSBA 3VKUA 5H9WA 1PSWA 1WZIA 4U00A 4MP3A 4PZLA 3TXYA 1OCEA 4GQIA 4HDQB 1E1YA 4NARA 4Q4AA 2HB6A 4PPQA 4M0EA 1KZ7B 1Q20A 2B4TO 3G68A 4O1MA 3TUIC 2DY0A 1TD9A 3ZZTA 3N6VA 3WHLA 4TRJA 1J6UA 3H2KA 4RIFA 4UMFA 1OFTA 1JLHA 1PL8A 2EBUA 2QPAA 3FGZA 5J59A 3L8YA 3LW8A 2X8JA 1XCOA 1K7YA 2A5GA 1I7LA 4IF4A 1EFDN 1PJCA 5L6MB 1QC5B 5AHRA 2OKCA 3V8NA 1RE0A 1UKYA 3QVSA 4QFCA 4PYMA 5JW6A 4N8DA 3VI4B 1OBOA 2I4IA 5KHOC 1KE2A 3OOHA 3A2NA 1ZU4A 1OA1A 2R85A 1U9IA 1A4XA 3M6VA 4M37A 1FNSA 3H7AA 5CK4A 4DKJA 3QTTA 1U3FA 2OILA 1PV4A 3PDCA 4FHGA 4CVNA 4UEWA 5CB8A 1U98A 3NFYA 4H7FA 4HVTA 1U7TA 4MS1B 1Q57A 4MV8A 3LF1A 2XWPA 4TYWA 1YJCA 1YJ5A 3EBOA 4W9RA 2G9QA 3NXKA 4MW6A 4BNTA 1KQPA 1VLHA 2AJTA 3K6SA 5J23A 4EJSA 5BQ5A 1P5FA 4K9NA 4OHXA 4TZKA 3DEKA 3EY4A 3P2IA 1NT4A 5H83A 2QI9F 1F20A 3ZH9B 1IYZA 1MP0A 3NT4A 1V7ZA 4KX3A 1P9OA 3ZIDA 4F6RA 3OZVA 5EJ5A 2HLNA 1C1DB 4HQFA 2C98A 3A9RA 5ESRA 1QHXA 3TBHA 3KWLA 1W85A 1V11B 3SU8A 1DIOB 2IE8A 1Y3IA 5BMOA 1VSVA 5J5CA 3RBXA 4YXWD 1QMPA 3W06A 4ACAA 5FAKA 3S8YA 2ESRA 5KVCA 1X7XA 2F64A 2FQ1A 5L95A 3AVVA 3P2JA 3ICPA 4I7EA 2GKSA 1U2QA 4HGOA 3P0FA 3GEEA 3BXPA 4CWAA 4FBLA 3M82A 1XMPA 1BXKA 4J0KA 4DV4B 1I3KA 1PYDA 1Q22A 5KTPA 1L5OA 4E0BA 1AC5A 3A3YA 2VTKA 3BMQB 3PQ6A 3LVRE 1G8GA 3C1OA 3K16A 4G36A 2AV6A 4IY1A 1ZRMA 4ZJUA 5CFOA 1EIZA 4QICA 3R9XA 2O52A 3LDFA 3BJIC 2DBVO 3COSA 3CUKA 1ZQ1A 3FBWA 4M1OA 5ILOA 3BL5A 3E58A 2V6FA 3E7FA 3ETLA 1BJRE 1XMQB 1QGYA 4GQAA 1PWXA 3OCJA 4JGGA 4R6XA 2X5NA 5HIMA 1N2EA 1R6UA 2FSUA 3CONA 2WSMA 3GWGA 3UJ3X 3W8FA 3S2EA 4CMIB 2NO9A 2V45A 5TPWA 2BBOA 2GERA 1JSCA 2VRWA 3QLUC 1XA4A 4UQPA 4HH0A 1ISJA 2P9QA 3BCUA 2FX5A 4C30A 3B12A 4NHEA 3RYIA 4B32A 3AM1A 2ENWA 3FD8A 4ZT6A 4BRSA 4ZPJA 2O7NA 3BJMA 2W9XA 4NZZA 1WCIA 3K1YA 4G9BA 4HMQA 4IH1A 1BOFA 4KXVA 4NOJA 1E2MA 3SBDA 1L6IA 3H0CA 2NGRA 3PLRA 1OHHA 1WMDA 4QGAA 5EGSA 5LA6F 3BXOA 4N5LA 3C3PA 3DQQA 4L8WB 3D81A 4JENA 3GVIA 4K1LA 4UQOA 2OXTA 5KVAA 3KZOA 2Q45A 1W93A 2Q6OA 2Y1LA 3NHFA 1Z74A 4XZ3A 3UW3A 4Z7QB 1R4AA 1FVXA 3BFKA 4OBWA 3WWEA 3ZEIA 1QGUA 4D56A 1XZFA 1YCDA 4MR9A 4RD2A 4D99A 3T9BA 3U3XA 3PJRA 1NUSA 1DOHA 2BN4A 5ALSA 4PO1A 3PQ8A 1M10A 4RUKA 2IDKA 2GPJA 3AUAA 1QQAA 1RS0A 1YR1A 3GL9A 1YF3A 3OKFA 3E2IA 4OHUA 1TCAA 2GFHA 3MG9A 3GP8A 2GETA 1NWHA 1JAXA 4Z86A 4F6LA 4ZYZA 1OAOA 3KLNA 5EE5B 5K3FA 3TKLA 4HB2A 2BUAA 3E3MA 3VVBA 2W7TA 5FUVA 3AEQB 5EXTA 1ILWA 1DKRA 3QVGA 1KJQA 3S5UA 4DIFA 1CUEA 2DOKA 4V0KA 4YCMA 3I6ZA 3BL8A 1KO4A 1UXHA 1W36B 3JQBA 1IPFA 1PNTA 2W2VA 3UJAA 4LUCA 2Q5QA 4UEOA 1ZR2A 4P8RA 1M8FA 1NVKA 4RMIA 2YQ5A 3QUQA 3R75A 2BJVA 3T9EA 1JL3A 3DLAA 3B9QA 5LZ5A 1TA9A 3BMOB 2VF2A 2YYYA 5J5AA 4P4NA 6LDHA 3SFVA 1B43A 2X0JA 1MG0A 3NRBA 2UYYA 2V0NA 1PLLA 3UICA 2QRJA 2GOYA 3GDWA 3G2NA 3FOFC 1PQUA 3EIHA 2I33A 1OKKD 3RUCA 5TJHA 3I61A 4ZCTA 1F4PA 1X7GA 2CFTA 4LOJA 3T5PA 3VPCA 3FLMA 2OC4A 4PYIA 3HZHA 2BFAA 4PHHA 2A9JA 4P7JA 4MWZA 6REQB 4NCKA 4TL8A 4QU8A 3HBNA 5L3SA 2QRQA 5CBPB 1GZ6A 2GS9A 1ZLXA 1W30A 1T1IA 2XF8A 1K9SA 2YTZA 4LV6A 3WIOA 4JUFA 3L8FA 1R37A 3Q0IA 4GFDA 3WSTA 3BUSA 2MHCA 3LY9A 3TLCA 2OXRA 1J2TA 4PNZA 4OP1A 4EHFA 1ZHOA 3JALA 3ETHA 4G9GA 4MJ3A 4Q1BA 1JG1A 3OQNA 4I55F 4ZAZA 1AKQA 5LQSA 3RLFA 4BN4A 4JJGA 2H1WA 2DFNA 2B30A 2H54A 4OOEA 4U0JA 2QQ0A 2OHOA 3C3CA 3QVKA 3CUEF 4EO9A 2FSHA 1IBLB 4DMMA 3QE4A 1GLVA 3E03A 1SIWA 2NVUB 1W5BA 2C2GA 1TADA 1XEAA 3KR0A 4LRWA 2PT6A 1XRNA 2R8BA 3C3JA 4FI3F 1T9AA 1YBVA 4LF6B 2QB5A 4UM9D 3KNZA 3BF7A 4EVQA 1JI3A 3PJEA 3MHTA 2UYGA 1MT3A 5BV0A 2QXYA 5BYJA 3OWOA 4HZUA 3LCJA 2WAMA 2CXPA 3HCCA 4CLOA 3L4EA 4JX9A 3GAAA 3MINB 3X44A 2PGLA 1ZIDA 5DOVA 4U6NA 2FOXA 4YBZA 3UJPA 1M33A 1Q77A 2VHYA 2C1ZA 3W3AH 1J0CA 1K8YB 1YJXA 3FNGA 4JGBA 4EHHA 2YZ7A 3I64A 2WUDA 5HFAA 4E94A 3P9RA 1LDMA 2WU0A 1XV5A 4Z8XA 1H5NA 1KZYC 2X13A 3JW8A 2OFPA 5K4HA 4BLPA 5GV7A 4ZI7A 3KKKA 2O06A 3EB9A 2JDIA 2D8MA 1XTTA 3Q87B 4FDUA 3COWA 1YBMA 3EJ6A 3QFTA 4GECA 3NJ8A 4J9UE 2W2NA 1WL8A 2H65A 1POXA 3U4CA 1DRUA 3C7KA 4DCCA 1EDDA 1X1RA 1R18A 4RENA 4YFYA 5D86A 2G8NA 3ZWXA 1SRRA 5AI9A 4BKMA 1Z4OA 4PXSA 5KX5F 2GUWA 5IG2A 3U09A 1AB5A 1LA2A 5KYTA 1F5NA 5CA0B 1YXMA 3TAXA 2OXEA 4YUZA 5FTMA 2CHUA 3V34A 3V7YA 3N59A 2CDCA 4HGRA 1S4MA 3UOAB 3T06B 4MYHA 5LQKA 1Z8DA 2R3SA 3ZCVA 3DXZA 1KI3A 5ALMA 3M4ZA 2GYVA 1B0ZA 4NI5A 1TM1E 3ISTA 5HA5A 3RAGA 5EJEA 5T4FA 1IH8A 4KR9A 2ISQA 1UBCA 5A6SB 4FNAA 3WHIA 3D6FA 1XL0A 2C5HA 2XZPA 1I3NA 1NT2A 2XYHA 3VYWA 2XGSA 4FIZA 3C6MA 4B9EA 5F33A 2OK8A 3QVVA 5TIIA 2QQFA 4IHAA 5FBRB 4IIJB 4IX9A 1LQUA 4K9KA 4Y18A 1KMIY 3RTBA 2BFFA 2JGFA 3O1LA 4B6EA 3IDFA 2HRBA 2CUZA 2F55A 1E63A 4O5OA 4DR1B 1BXGB 1B7GO 2ZITA 1X15A 1U65A 2YMLA 3FKSD 2I2CA 4WNYA 3V2GA 2YJ6A 4EK9A 3RIGA 2DU8A 5A3SA 3A4NA 3KYIB 4FEEA 3F6CA 1HKHA 2GF0A 4JN6B 4XYGA 3ZWQA 4ZVUA 4E12A 4Z53A 2O4UX 4RQBA 1E2LA 4Z9AA 4DQUA 3GCWA 1IOVA 4JKYA 2QYOA 1HNZB 4RWZA 3ZTTA 1AV7A 1EVZA 2FRXA 1XTQA 3JWPA 3R1IA 1ORDA 1E6LA 3EMKA 1TYCA 3FUUA 5HKAA 2AQ8A 1R6BX 3S2UA 4NJMB 4GL4A 5E7JA 2GA8A 4BBPA 2ZDQA 1E0DA 4KRXA 2OLJA 1S2IA 5CW1A 5IHXA 3HG7A 3ZHQA 2C4UA 2YFHA 4W7IA 5KYVA 3ZK8A 4UBLA 3T0IA 2IXBA 2DKNA 1LPOA 1SBZA 1M1UA 1KI7A 4EUEA 5FR2A 1KYWA 3TPFA 2PGDA 4MGZR 3VR2A 3FETA 4FGWA 5CTAA 3F49S 3KZ1E 2ZTSA 5AMXA 2R5FA 1SEVA 2JBAA 4L8GA 1A9XB 3N2GA 4C3ZA 5JH7A 2AN9A 3K1JA 1VPVA 4IRUB 1XMSA 5A4JA 4OHOA 2ZIXA 5AFSA 2B2NA 1VJ0A 2ZU6A 2ZULA 1EJ6A 2ZOSA 3AUKA 3MTEA 1UC9A 3Q7IA 3SR3A 2BFFB 4JXJA 4PYNA 4PG8A 3G9UA 2YFYA 4D44A 2JA1A 3LC2O 2ZANA 1HO3A 1QAMA 1ADCA 4ENTA 2X42A 3WB9A 4KSBA 1NVXQ 2ZPUA 2QRHA 3AFNA 4ROSA 4KXWA 2ZJFA 3KPJA 4C06A 5E4FA 5KOHA 2DAPA 2F62A 2BKXA 4U7GA 4MPDA 3VV2A 2WOOA 3FTPA 1P2GA 1TPYA 3P5BA 1KPIA 4XOIA 2QYSA 1SXIA 1CYEA 2VPTA 2JKVA 1E9FA 4R0VA 2C5GA 1Y1TA 1DT3A 1TDJA 3KUDA 4P4SB 2IZ7A 3OFKA 4PLTA 3UKJA 4EYEA 4B47A 5GINE 1BVHA 5F3DA 4F97A 4O2AF 5D6OA 3SBXA 2CB9A 3G5MA 3ZIUA 1JF8A 4XIFA 3IE2A 4DV5B 2P69A 1FFAA 1TCBA 4ZO4A 4DBLC 1G7RA 3FWHA 3K4PA 1UWLA 2ID9A 1JWAB 3JWJA 1F0KA 1UL1X 4ZEMA 5ITZB 4MAMA 4JLAA 1YC5A 1U8XX 1RQNA 1XSEA 2ZCJA 4BQIA 1OROA 1MN6A 4R3NA 3LPMA 4HR7A 3TR6A 1HV8A 4GI7A 3U62A 2EZUA 4FDLA 3F8SA 2ZZNA 2C4KA 2VFAA 2V65A 4GI3A 1RU3A 4KQEA 1OVMA 1BDBA 1HQCA 5BMVB 5JCOA 1JQ5A 4FR2A 4B17A 5JD5A