1YIAA

Crystal structure of tryptophanyl trna synthetase ii from deinococcus radiodurans in complex with 5-hydroxy tryptophan.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
331
structure length
331
Chain Sequence
ARPRVLTGDRPTGALHLGHLAGSLQNRVRLQDEAELFVLLADVQALTDHFDRPEQVRENVLAVALDYLAAGLDPQKTTCVVQSAVPELAELTVYFLNLVTVSHLRQNPTVKAEIAQKGYGERVPAGFFVYPVSQAADIAAFGATLVPVGDDQLPMLEQTREIVRRFNALYAPVLAEPQAQLSRVPRLPGLDGQAKMSKSLGNAIALGDSADEVARKVMGMYTDPGHLRASDPGRVEGNPVFTFLDAFDPDPARVQALKDQYRAGGLGDVKVKKHLIDVLNGVLAPIRTRRAEYERDPDAVLRFVTEGTARGREVAAQTLGQVRRAMRLFGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and activity of an aminoacyl-tRNA synthetase that charges tRNA with nitro-tryptophan.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ligase
molecule keywords tryptophanyl-tRNA synthetase
total genus 104
structure length 331
sequence length 331
chains with identical sequence B, C
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1yiaA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1yiaA01
4JFAA 1WXFA 2X1LA 3TQIA 1M8PA 4H3SA 5TEVA 4I6JA 3X1MA 1JIKA 3TS1A 3S3TA 2CV1A 4GRIA 4BWVA 1J20A 1F7VA 4HJRA 1MAUA 1K4MA 2DR2A 2XRZA 2IP1A 3UK2A 3ELBA 3K32A 4MUIA 5LFAA 4KPUA 1WKBA 1KQOA 5LLTA 3AFHA 4XFJA 3BL5A 4ZCTA 1U7DA 3AL0C 3COVA 4ZT4A 1O94C 5EKDA 2DUMA 3OTWA 4ZCSA 4DNXA 1T6YA 3A2KA 1MOPA 1D2RA 1N1DA 1NUPA 1JEEA 1GLNA 1N75A 4ZCPA 3QE4A 1NURA 3CLRC 1N78A 1XNHA 3IVCA 3RK1A 5K0SA 4EG6A 4EG5A 5JBNA 3SZ3A 2QUHA 5J5AA 3TNJA 3UOWA 3CVVA 3P0HA 1KP2A 1JMVA 1F4LA 3IOEA 4ZCQA 2QJOA 3RK0A 3CVUA 3N9IA 1SURA 2E89A 4UZFA 3ZGZA 1IRXA 3ISJA 1A8HA 4X0EA 1WQ3A 4MQ6A 1K4KA 1EFPB 1T9GR 4MW4A 4CDMA 2A1TR 2A86A 3IODA 5DB4A 2X1MA 3FWKA 3H05A 1IHOA 4EF6A 2NZ2A 1J1UA 3Q4GA 3D6VA 2DXIA 1KQNA 1PG2A 3PRHA 3TZEA 4JXXA 1O5TA 1X6VA 3DPIA 1U3CA 1M1ZA 4ARCA 1MJHA 1NUSA 2CV2A 3H97A 1MC1A 4MW2A 2V0GA 1J1ZA 4MW0A 2DPLA 4P2BA 3CLUD 1IVSA 5KWVA 1Y42X 1VBNA 4NX2A 1EE1A 4R2MA 2J4DA 1M83A 2CT8A 4YP7A 3PNVA 1QRSA 1MB2A 3CVWA 4MW1A 1T6XA 3FOCA 4OUDB 3PNBA 4YMIA 3VRHA 1R6TA 4DJAA 2YWBA 4U63A 1O95D 1O0CA 4YP5A 4PBRA 5BNZA 3CVXA 1J70A 1GPMA 4KKVA 1JIJA 3A04A 3ND6A 2BTEA 1NUUA 3GLVA 1I6KA 3FIUA 4S1OA 2H2AA 2WQ7A 3IH5A 3KT6A 1OBHA 3P52A 1PG0A 4MW7A 1PFVA 4I6GA 2DEUA 1V47A 1VBMA 4OUDA 4Q93A 3FNRA 5IJXA 3FY4A 2PZAA 3MLBA 1J21A 1S4MA 1QU3A 5DASA 2X3FA 1M8GA 4NAUA 2VTBB 3SEZA 4EGAA 4MWCA 2D5BA 1QQTA 1JIIA 5HUJA 2CSXA 3SEQA 4DDMA 2PZBA 4CDNA 4MUHA 2JANA 2OQ2A 4ND7A 3FETA 1F7UA 3CLTD 3N8HA 3CR8A 2PXHA 3AG6A 1JZSA 2NSYA 4HPWA 3RBAA 4PBTA 3ND7A 3G5AA 3H99A 3UY4A 2JA2A 3RFFA 2RD2A 2A1UA 1FYDA 3SDBA 1WJGA 3DV2A 5DEOA 3AKZA 1PFYA 4EG8A 1M8KA 1IQ0A 3IVXA 3CLUC 2E21A 3IDFA 4MWBA 1H3FA 4EFKA 4EG4A 1KQPA 3KT8A 3CA8A 4MWDA 2EJCA 2GOYA 3G59A 2YY5A 3E27A 1N2OA 4QRDA 1JHDA 4MVWA 1EFVB 1N77A 1JILA 3FHJA 3P0JA 4ND6A 3NBAA 3ND5A 4NZPA 5TGTA 3JXEA 2DETA 1GZUA 3HMQA 1T9GS 1ULHA 1YUNA 3QTTA 1OBCA 1X8XA 5HG0A 1N2JA 2A7XA 2AZXA 4MVYA 1N3LA 4TS1A 2CYCA 1F9AA 1R6XA 1O95C 1ZJWA 1XJQA 3H9BA 4ZT7A 1EXDA 3HV0A 1NZJA 1T6ZA 1EUYA 4E1AA 4NATA 4I6EA 5DK4A 3M5WA 1IQUA 1O6BA 3L92A 3LOQA 4ZT6A 5LM3A 4KR6A 3F3MA 1G59A 2X0KA 2IELA 1YUMA 3CLSD 2QUKA 2QTNA 4MUFA 2VTBA 5KHAA 1O97C 4Q16A 4ZT3A 3SP1A 2WB2A 2PG3A 1N2GA 1YIDA 4MW9A 1PFUA 4HK4A 1G8FA 1WOYA 1KKUA 4QBTA 3X1JA 2B7LA 3Q12A 4G5FA 1WZ2A 1KORA 2CYBA 3CLRD 4F4HA 4MUJA 3ZJVA 1J09A 2PIDA 4KR9A 1WQ4A 1H3EA 1U7XA 2AG6A 1ZH0A 3IOBA 3LE8A 4RUKA 2WQ6A 4WSOA 1GTSA 1OWNA 3NBKA 2AKEA 1JECA 3ZXSA 1FFYA 1Q15A 3ZUGA 5FNZA 2E18A 3QTBA 2PZ8A 4U8HA 1IFXA 2A1UB 4JYZA 1EJ2A 2JAXA 3UMVA 1NUTA 3PXUA 2YWCA 2CV0A 4FZJA 1TYAE 5J59A 1MAWA 3IOCA 1JGTA 1LW7A 1TYCA 5TEWA 1N2IA 4XSVA 1RQGA 3HZRA 3ZJTA 4G6ZA 2J08A 5H16A 1OWMA 4QREA 3U1VA 1EFPA 4RPIA 2HMAA 3G6KA 1VBKA 2J09A 5F23A 2YXNA 2D13A 1WXGA 4MVCA 3ZJUA 3H9CA 2DERA 2QJTA 3P0IA 1O96B 1MBZA 4MW6A 3TZLA 2CFOA 1WXHA 2IJGX 4MVXA 4F3RA 3COYA 2A1TS 1KAMA 3HGMA 1KH3A 1U0BB 4DDHA 1Q19A 2A84A 4GU5A 4WNYA 4XFDA 3AIIA 3N05A 3VU8A 4AS1A 4CT0A 4YP6A 2QJFA 3C8ZA 1TYDE 4AQ7A 1IQRA 4ZT5A 1H3NA 2QTMA 3SYTA 3IVGA 4OJMX 4MULA 3UC5A 2A88A 5KCMA 4MAFA 1TFUA 2J5BA 3N2YA 2V0CA 1VLHA 2ZP1A 4MLPA 4K0RA 4MUEA 4MUGA 1WY5A 2O5RA 2D54A 3IMEA 2A4MA 3X1KA 4KPUB 1K97A 1Q77A 2HGZA 2J07A 3IUBA 1N2EA 3COWA 3INNA 3FH0A 1EUQA 1Q11A 1K92A 3KT3A 1KH1A 1TQ8A 2GKSA 1PFWA 2QTRA 2Z3VA 2QUIA 1ZUNA 1V8FA 1YIAA 3K9WA 1IH8A 1QTQA 3MUEA 1QNFA 4NDAA 3MXTA 4MUNA 3DLAA 4R0NA 3IMGA 1KR2A 4MUKA 3NV7A 1QRUA 2I1LA 1XNJA 4DDKA 1B6TA 3AG5A 4J76A 1GN8A 2VXOA 4G5YA 4PY2A 4JZYA 5H7XA 3TQOA 1N2HA 1YULA 1VL2A 4CQNA 2ZUEA 1M8FA 2PFSA 2WSIA 1YI8A 1WXIA 3CLTC 4A91A 3VGJA 3DO8A 1G8HA 1H1TA 5K0TA 1XNGA 1G8GA 1JZQA 1OWLA 4K03A 3FDXA 2G36A 3OP1A 3RJZA 2QUJA 1HYBA 1KAQA 4ZT2A 2R5WA 1I6MA 3MMXA 3KT0A 1OD6A 4EG7A 1NSYA 3I05A 1ILEA 5IHXA 1EFVA 4U7JA 4ARIA 1M8JA 3IUEA 3Q10A 1NI5A 3CVYA 1P7PA 3RHSA 1R6UA 3A05A 1NYLA 3IMCA 1OWOA 3GMIA 5HUHA 4L2IB 4ZCRA 3FI0A 4R2LA 3ZIUA 2Z09A 1CT9A 2O8VA 1TEZA 1NUQA 3COZA 4DE5A 1BS2A 1DNPA 1I2DA 1O94D 5FO1A 4JXZA 4PBSA 5FO0A 1QU2A 2CYAA 4EG3A 1U3DA 2Z08A 5J58A 1GTRA 1UFVA 1O0BA 3LCJA 1COZA 3L93A 5AHWA 3CLSC 2C5SA 1I6LA 2EL7A 1ZH6A 1JEDA 4MWEA 4UZEA 3PNYA 1O97D 3KFLA 4HJXA 2OV4A 1QJCA 1LI7A 2DLCX 2E0IA 3SZGA 1LI5A 2RE8A 2BYTA 1WXEA 4KR7A 4L2IA 3FG9A 2TS1A 2HZ7A 1O96A 3MLAA 3ZXIA 1OWPA 2XRYA 1KP3A 2ZUFA 3ILVA 2CUZA 1MB9A 3GUZA 3HFJA 1N2BA 1QRTA 1NP7A 3D6UA 1KH2A 5TS2A 4EG1A 4J75A 1MRZA 3A4IA 4MW5A 2H29A 2GM3A 1GAXA 4NAHA 1TYBE 4YBRA 3HL4A 4DLPA
chains in the Genus database with same CATH superfamily
1HNXB 2Q5HA 1JA9A 1P1CA 3OZBA 4N9QA 3KKNA 3OECA 1ZGCA 2FDRA 3AR6A 3IHKA 3NG1A 3NRJA 5IANA 4GOMD 2QR3A 1BCRB 3QBTA 5BR8B 3MRVA 5F9MA 4R0VA 1WLYA 2X4LA 4BWVA 3PXXA 4XYMA 1C3LA 3LDGA 3KXLA 4DCSA 1UFOA 3DLPX 3JQPA 3JZDA 5JZBA 1Y3IA 1QHFA 1FVXA 2YHIB 1M9NA 4EJSB 3WYCA 2Y1LA 3D3EA 1XLTA 3K32A 3T3DA 5DYGA 4YO8A 4LRUA 4KPUA 1MG0A 3NM4A 1H69A 1KQOA 1R4AA 1TZJA 1YAHA 4P5PA 3ACBA 5CHYA 4YRCA 3S7TA 3I04M 3NCTA 1IE3A 1N9GB 4JJEA 4OHRA 5K3BA 3G0DA 1XTRA 1LRKA 1YDEA 3D8UA 3DOEA 4X6XA 2MIIA 4J29A 5AI8A 2HUPA 5A9TA 2BRUA 5A4JA 4BTVA 1ZN2A 3DPSA 4N3BA 1QAOA 3RWOA 4OLAA 2NU6B 1ZJ5A 4LYYA 4EB6A 4EOGA 1W36D 2Q21A 4CQJA 1OT3A 2QENA 3RK1A 3ZEIA 4AYTA 3QU2A 4INZA 4B3CA 4D4GA 3DTVA 1CXZA 1E2BA 3F6RA 3EH2A 4H4DA 1Z74A 3TNLA 5CA0F 4OHZA 2WIDA 3Q2IA 3ZE6A 4ZCLA 1AZTA 4EBBA 1EDZA 3SZ3A 1GU7A 1GG8A 3VOAA 1K0UA 1ZC3A 4HNHA 5DN6D 1GDHA 5JANA 5DCWA 2YICA 3OFNA 4C1BA 2QM8A 4HWOA 4TXNA 1YDHA 2HSGA 2FMFA 1TKRA 1U1GA 2ZI5A 3BMNA 3V3KA 3ZWOA 4EFDA 4ZCQA 2C95A 4DR6B 5JC1A 1W0JD 1OB5A 4JI8B 3EFOB 2AFHB 2FY8A 3PE4A 2EEZA 4LCBA 2I7XA 4P33A 3OSZA 2YWDA 2ZAYA 3P5BA 3LUDA 1IRXA 2IODA 3GA7A 4HMPA 5TF0A 2QSYA 4WZZA 4FE3A 3A4LA 4J2HA 4CN9A 5JISA 3DOHA 3QV2A 3O1LA 1EFRD 3TEMA 1WDKA 2PTHA 1KYYA 1T5DX 1E2IA 3FTPA 5DNEA 4AF8A 1T36B 3Q6NA 2O4CA 2X1MA 4IR7A 4PS0A 1AK1A 2DHRA 1ZVKA 3CC8A 1YKGA 2YYYA 1XFAA 2ZUDA 3WLOA 2HHLA 2A2ZA 2I1QA 1Z7BA 1YS9A 2DCUA 3ZDZB 4CKZA 4CLOB 4WY5A 5FAXA 2MR6A 4LDAA 3NIBA 3MQ4A 3RFCA 1RFGE 3B70A 1EQAA 2CB9A 1CS4C 1CIJA 5FI0B 2HWYA 1CE8A 1SC1A 3P9KA 2Q0XA 4G4SP 4UVHA 3BEOA 4OMCA 2NVWA 3EIOA 3FR8A 4KWTA 5EZQA 5LVAA 1S3SA 2JPDA 1M5RA 4IIYA 3E7XA 1YL6A 1BMTA 1NIJA 2WHPB 2R8ZA 3DAOA 1XXHE 4HRYA 1G5HA 4OQ4A 2OXIA 4L6CA 3T3NA 1XOIA 2CE7A 1R7RA 1YT5A 3CH4B 5CD1A 1NXSA 2PY6A 3CT6A 4MKHA 4EHLA 2P2SA 4MQ5A 1UBOS 3ZTWA 1QVAA 3ZYZA 1U63A 3TBHA 5FRDA 1TYZA 3RHFA 1DCMA 1VSTA 3H19A 2J6HA 5FPHA 3WKDA 4R2XA 2YJGA 2QTCA 3OO0A 4KR0A 1M72A 3NEJA 3EVTA 5K8VA 1YZLA 2CY0A 2GWHA 4OGLA 1YA6A 2IGTA 3U3XA 3TI9A 1OGIA 4M9QA 5BP7A 1S96A 2R1VA 2VJBA 3PCTA 4U63A 5HRUA 4RACA 1GT6A 4M9RA 3FUCA 2ZOSA 3Q85A 4XTRA 3WRXC 4MRPA 2P2DA 1B3RA 3V2GA 1PBTA 3KC2A 3VPFA 5AVTA 2GUGA 2WPDD 1SZPA 3AM3A 2QROA 2B0CA 5IH7A 1W0KA 5WRFA 3HCDA 3Q5EA 3P2MA 2XGJA 1GRQA 3BYZA 3P52A 3SDZA 5BORA 3NWPA 4H7HA 1GKYA 5DW3A 2DEUA 3BX1A 1T0JB 4XX1A 3W5CA 3ADDA 2H2FA 4NSNA 1C81A 4AG5A 4B6EA 2OV3A 1J21A 2IZOA 2ZRAA 4G4SO 5EMLA 1OFHA 4E15A 3SEAA 2AJ8A 2QNIA 3R6LA 4A03A 4N0PA 1M8GA 2VWPA 1UINA 3H2IA 2JNWA 1ECBA 2XCOA 4D6PA 3D5TA 1XAHA 3I6MA 1CJVC 4WUTA 3BQMB 4YAIA 3IT2A 2R86A 1AM4D 3GEHA 1GL3A 4ZI2A 1DWPA 5IUKC 3SEQA 3PC7A 2Y66A 3NHPA 4B43A 4CM3A 3RBXA 1SCUB 4IG4A 5DCUA 1VG8A 3FOWA 1QZTA 1V7PC 3CVJA 4JCOA 3N8HA 2FW8A 3NAQA 3LI2A 4XX0A 1P1JA 5HS4A 1VCNA 1VHQA 3B1KA 4IMJB 3T12A 1V25A 1QZ3A 4AJ4A 5KKCA 3AL0C 3U19A 3EK2A 1WXWA 5CEFA 1QLHA 4Z4EA 3AUKA 3CMMA 4HAVA 2HNAA 4YWHA 1JAXA 5JWHA 3JQAA 4HNUA 2J59A 2X15A 3ZUPA 3AI2A 4KQMA 3ZJUA 4YRRA 5BSGA 2JKYA 1QK5A 2XE7A 4FYPA 3VPDA 5IMSA 4GKBA 3WVNA 2ZQZA 4OH1A 2ZUUA 2PR7A 3IP9A 3ZXUB 1SCNE 5K0LA 2ZJOA 1LLFA 1IBKB 1USVA 2JZNA 3DOCA 3A0RB 2YV4A 3A11A 4FLFA 3AIKA 3PVSA 5ABPA 2ZM5A 1FFYA 3H6HA 4HADA 2QMQA 2YR0A 4N41A 3I2HA 2V6MA 1NW8A 4KODA 1MDBA 5LD2B 3W5HA 2QY9A 3EG5A 1CC1S 3HDGA 3B7PA 2FR8A 2RH9B 4M37A 5EKUA 2CKDA 4NONA 5TGTA 1EVIA 3KK0A 3OFJA 2REBA 4QJIA 2DGDA 4DEVA 1L5NA 3S8MA 2JGRA 2Z4TA 1Y4DE 2GYWA 4ND1A 3MELA 3HZZA 2IZ0A 3K9BA 3GV0A 4BFTA 4UFNA 3BIFA 4GT1A 1UPTA 4IDFA 4K87A 1O95C 5JNSA 5KYGA 3VAYA 1EXDA 1C0LA 1NI3A 1U81A 4O4JA 4NYMR 1XA0A 3D31A 3GWZA 2X0IA 3G2IA 3WLFA 4BGVA 2P9GA 4FGKA 4RVHA 2GDZA 4N6GA 3T4XA 1N25A 3T7JA 1XJ0A 1FZQA 3GRKA 4LTMA 3WBJA 4E14A 5L40A 4ND4A 4IRMA 1G21A 5IXSA 1E9RA 5KO2A 5C1BA 4KR6A 2B1JA 3TJZA 1G59A 1RHKA 3NX4A 4L51A 4R8KA 2R44A 2IVFA 3DHVA 1JQ5A 1VRVA 1QIFA 2RIRA 2FK7A 4MUFA 1R4MB 4NBNA 1FLAA 4IHQA 5EP3A 1FFWA 2W2MA 4G9BA 3MWDB 4A23A 3VHRA 4B7AA 1TJ3A 3DAPA 2C5HA 1A5ZA 2EJUA 3AP1A 5AJVB 3UUWA 1UBEA 3DWIA 1Y3BE 1SVSA 5JADA 4IHJA 2JCYA 1Z17A 2I4IA 4NMWA 3EZ6A 1G2QA 2EBHX 3KQPA 3FMPB 3T34A 4CQLA 4W5NA 3O93A 4F4HA 4L6IA 3BFVA 1S9DA 3RLIA 1SOMA 3PXBA 1S3GA 3CRMA 3HXLA 1U99A 4L0DA 4CL0A 2YV2A 2AG6A 3HCRA 4PIPA 1ZH0A 4BYMA 3OJCA 3QA9A 3FCSB 1XMSA 3R9WA 1UKVY 4LQCA 1UF9A 1ECJA 1NMEA 1TQ4A 1Z15A 3AH8A 2G8NA 2OZKA 3I52A 3IUSA 3L7CA 1YQUA 2PZ8A 3OPNA 3QLVA 5AJUA 4ZAFA 3WK6A 4AX4A 4CQMB 5FLXA 3OWHA 4Q00A 4OY3A 4XW2A 4AYWA 1DT5A 2JVKA 4F4JA 1VE1A 4QLBA 5AJXA 5TPWA 1N5RA 2BM1A 1EEXB 2E48A 2X4IA 4CQMD 5TEWA 3ESQA 9MHTA 3BWCA 3V55A 2XQVA 4HF7A 3SYMA 1C7EA 1P3JA 1SG9A 1RXEA 2B4AA 3Q72A 1LB1B 1MHPA 4QRIA 2CHVA 1E2HA 4CM4A 1RRVA 2OHFA 1OPXA 3AR8A 3NIDB 4S1VA 3SJCA 2BY4A 1L4FA 3O6VA 4U1RA 2HKIA 3K5HA 4LSMA 1Q1BA 8GPBA 2VO1A 3FPHA 2IXGA 2MOKA 4BMCA 1Y3FE 3JZAA 3PXGA 4FS3A 4DIBA 1KAMA 4S1TA 3T0FA 2O50A 2JAWA 1F38A 3R09A 4BV2A 5F7ZA 4NULA 3GJQA 4WVLA 3T1OA 5B3AA 3HADA 1T4BA 4Y7DA 3WGVA 3LLUA 2W6MA 1KPGA 2G1KA 2FHSA 1PAUA 2NTVA 5E9JA 4TYMA 4QNNA 2GGSA 3GDHA 2QPOA 3FNBA 3SC2B 1YJ8A 4ZV9A 2ZAIA 3NAMA 4AX8A 4JLWA 3K2QA 3RE1A 5EJ4A 4YASA 4GE3A 1QPZA 3IVGA 5K03A 2XB2A 4OLBA 5FPPA 3HV2A 3AI7A 4LUCA 1F06A 1ADCA 5AOBA 4I7EA 3TTYA 1XVVA 3QFHA 1L1QA 3RVLA 1N57A 5DBHX 1CVLA 1TIKA 4I4NA 2L42A 2ZYAA 3FF4A 3LY8A 4JVNA 1Q1AA 2E4ZA 3G5TA 3SSOA 2QX6A 2P2LA 4BZWA 3O7WA 2QN6A 3I72A 1RWVA 2HIMA 1TYEB 1WY5A 4IAOA 4OXRA 1SGWA 4DIOA 2QL5A 5HJEA 3TSYA 4C7VA 3IJPA 4L5JA 5FLYA 2QMOA 3JZIA 1V1MA 4EKGA 2QZPA 3DD1A 4FGLA 1KH1A 4MYRA 4PANA 4OHFA 1JG3A 3LVRE 3RU2A 3DWFA 3K4QA 4BX3A 4Q05A 4RV5A 5IT0A 2PIAA 2JGEA 4UFOA 1ISIA 1DEHA 1Y9JA 2W6IA 4M1YA 2FSUA 2CE2X 3K0SA 5HKKA 4KO4S 2FETA 4BKMA 2XXAA 4ZRDA 4E5NA 1WDMA 2Q3EA 4AZ0B 4QC2A 3V1UA 3FNHA 2XCRB 3W2IA 1BWPA 1U2DA 2PKEA 1DIRA 3QF4A 3HWWA 4K26A 5ALHA 3LYHA 2ZJZA 4AC9A 2ENWA 2FPPA 4F04A 1U9YA 5JVDB 3G2JA 3RU3A 2C7VA 3C39A 3IPRA 3W34A 1KIMA 5HSGA 3SVTA 3UK1A 4LXGA 4RLQA 3KYBA 1ECLA 3L6UA 3R9XB 5JDIC 1PNVA 2KBEA 3L84A 3ZV4A 4DIFA 5LP6A 1GN8A 2P62A 1E3WA 1L5HB 4KE9A 1H4TA 4G8DA 1OY1A 1DDGA 1L7VC 4QVKA 4QXRA 3ZD9A 4YUYA 4E7PA 2Q0HA 4G4IA 1JDVA 3CNLA 3ANNA 1BS1A 4KACA 4D0GA 2XZOA 2O52A 1IK4A 2Q49A 1GZ4A 2V1XA 3AEZA 4HLQB 4RFSB 2X4GA 4WRRA 1E2LA 5H9WA 1C7RA 4JR2A 3G2NA 3THRA 5MN4A 1GAJA 2Z43A 3MWEA 3V42A 1XD2B 3DMNA 2DSNA 3RF7A 1TMOA 4G1FA 3EZ7A 3SHTA 4E94A 2VDLB 2SNIE 2YMQA 4EHFA 1UIRA 4RWEA 1E4EB 1Y3HA 2XMDA 2HEIA 1OXMA 3VC7A 2F3QA 3Q5DA 2RHHA 1VSBA 2DY0A 3DMHA 1DSSG 1MIOB 2GXQA 2AK2A 3O82A 3ETLA 1I30A 3IUEA 3GNLA 4UBOA 5K8TA 1Z5UA 4RY2A 5AVYA 3FZGA 1JQJC 1NBOA 3FROA 5GONA 4WCFA 3EFEA 3HUUA 2XEDA 3K30A 1A9XB 1TF7A 1VLQA 1K6EA 1T2EA 2X2OA 1G38A 3V5NA 3GPIA 4Q4CA 1DCKA 2BM9A 3EZYA 5U1PA 4DGQA 4EFLA 3IAM1 5HUHA 3IHWA 5EIOA 1JG1A 3ZIUA 1ZXLA 4CEHA 1QIGA 5K3FB 5LU9A 2Z09A 1RJWA 2WSLA 3C1UA 3PTZA 1MXHA 1BS2A 1CK4A 2GQ0A 3TMAA 5ED4A 2GHIA 2WWFA 4N1AA 3EMVA 1N92A 4MS4A 4EO7A 4A8JB 1C4WA 3G2HA 1G3IA 3AUXA 3LT4A 5I4KA 3GA5A 1DG3A 2QVCA 4L57A 3OF2A 4QYSA 3BZUA 3H5WA 4BP1A 2Q5LA 3A6ZA 1B0UA 3MT7A 4GLOA 3U80A 1IN5A 1G5QA 3P96A 1OIVA 2GX6A 2WAYA 4M0KA 4NBSA 2D62A 4NJEA 4ZRMA 1R2QA 1YE3A 3VKFA 3TNFA 2ZRIA 1IDOA 4UZSA 1C4OA 3P9ZA 4JBGA 4WZBA 5TVGA 3HYCA 1RMQA 1HSOA 3DP7A 4IXDA 2NYRA 3R8FA 1CETA 2YINC 1PJBA 1C1XA 4F2DA 4DQDA 3JS5A 1UKEA 2BM8A 2WWHA 4WDRA 2ZQYA 3B6KA 4MQFB 5EC8A 4BPBA 5JJIA 3I9JA 4LMBA 2OV1A 1T25A 1XDWA 3R5SA 3DE3X 4IJQA 3NIWA 5FHRA 4MARA 1WABA 3W6NA 3E5HA 3GT7A 2IL1A 5IAGA 2C0CA 4Q3OA 1N6NA 4XB6B 3GHYA 5BW6B 1CP3A 2WUEA 4I66A 4OMFG 5G0VA 3W9BA 3HKEB 4DQXA 2WA2A 4G65A 2QDXA 3AIMA 1AQLA 2PD3A 3VVLA 4DNFA 3A9WA 3PXAA 4Y6OA 4MKZA 3P5SA 2GHTA 2EGUA 3B1VA 1XV5A 5DVZA 5EMHA 3U9SA 1PYGA 2CVHA 2QTGA 4DWWA 5LNK6 2IDMA 1OREA 4BDSA 3KOMA 2NNLD 2VH1A 3RSCA 2G1UA 2O8CB 4I9HA 2K87A 3BB1A 3QPVA 3QK7A 1KERA 2MINA 1M2JA 1UBKS 2Z95A 4IZIA 2IU6A 1SXJA 4RENA 4Y2PA 4J4TA 4AG6A 3C15C 4DCVA 5ES4B 2FQ1A 3L4KA 2QTHA 4Y1FA 3WMXA 3HGTA 2NYAA 4R8MA 4MCAA 2FMHA 5FBWB 5KYXA 5H4HA 1NVDA 3REOA 1RIFA 2HXGA 4J1QA 4UTVA 4YQEA 4DZTA 1MC5A 2DR2A 4JT4A 3ANYB 5LP6F 1O9BA 2XRZA 1BG6A 3WI7A 4O59O 2NU9A 2YC2C 1HM5A 1XQ6A 4O33A 1BE1A 2UUCB 1MLDA 1G98A 2PXAA 5ALGA 4MAMA 2VQDA 3UQYS 3MAGA 2I6SA 2G70A 5EXTA 4C6TA 3IQHX 2AOWA 3CJTA 3ZIAA 3OMWA 3WK5A 1OU4A 4Z6KA 2OFPA 1TMKA 5TJ9A 3A2KA 3VNUA 3DC7A 3UTCA 4E21A 3KPJA 4LDPA 3Q8XB 2VDWB 1MO6A 1OI3A 2PZFA 3EQ8A 4GF5A 4ACAA 2O8EB 4I3HA 3AVPA 5K01A 1KBZA 4RF5A 2ZUWA 4XWOA 2W48A 2XW6A 3E3OA 1L5QA 3B1WA 4ZN6A 3H5VA 4TPKA 4KITB 2BFFA 4QODA 4MRRA 4ARBA 4D9HA 5K20A 2FPSA 4GDMA 5J5AA 2JAOA 3CVVA 2Y1WA 5T5QA 1LPOA 1UZMA 3JQEA 1GUFA 2WIKA 4UE6A 4D4LA 4EEXA 1Y5RA 5L8VA 4LZAA 4K3VA 3IRVA 5JE8A 3SX0A 4J3JA 4I5DA 3ZEAA 4E7OA 2NP7A 1MEJA 2GPWA 1AURA 2QJOA 4OO3A 4M9XA 2F8TA 2ONZA 4H08A 4MWOA 2E89A 2HLDD 2M1ZA 2XR1A 1HEUA 3CZCA 1LPPA 2FKAA 3OOHA 2DC1A 5DGIA 1XRJA 3GLIE 4YO7A 4MP8A 1XIVA 1SU6A 2GZDA 2V6BA 2Y1EA 2BBTA 4X0EA 3V2IA 4BKPA 5DX8A 2R0QC 5F5NA 5HZGA 5EEHA 3EH1A 2G0TA 1M1YE 1II8B 3JAWB 6REQA 3QM1A 1IHOA 3RKSA 4LJAA 4W5RA 1AV6A 4L4RA 1I10A 1NXOA 4JLKA 3D6VA 1R50A 4K05A 3UFXA 5E6RB 2XBUA 1GRRA 2FJUA 2WMNB 3AEXA 4FYIA 5J63A 1GVNB 4PYLA 4Q47A 3ER6A 1WD7A 3BRQA 2JFYA 4UD6A 1XJCA 4MH0R 2WG0A 4Q12A 4AK9A 4LG1A 4ZDIA 3L2OB 1PQ4A 1VDZA 1NUSA 1CZLA 2XBLA 4LJKA 1L5GB 4C7MA 3GAFA 3KKKA 4CBVA 3L4JA 4RHCA 2V0GA 4IOMA 2VTDA 1HLDA 2H2IA 4G56A 2GEJA 1A9RA 1N5OX 2WYVA 1M6HA 2O3SA 3PDJA 1B2RA 1QH1B 3D3QA 1NMZA 4H3HB 4E33A 2O19A 2LW7A 4FC7A 2GPNA 1OE0A 2YFYA 2NUPB 4FN5A 4EZEA 1WU7A 4DUGA 1WMSA 3WAGA 1V8BA 1Z6XA 5EUQB 2RAFA 1GPKA 2CLDX 3NEYA 3RIXA 3JVDA 1SBYA 3VR6A 2QK4A 5JCJD 3GLSA 4YMIA 3UOGA 5A6VA 1RE1A 2V8BA 3A25A 5TY0A 5LYJF 3F3KA 2ANBA 5EZ6B 2EWMA 1N2CE 3H5TA 2QLNA 3KPYA 1MB3A 1PQPA 2OMEA 2YHAA 3PXDA 4B17A 3FSGD 1G8AA 4HWSA 1QTNA 4BKRA 1ZOLA 1P9OA 3RUHA 1K98A 1UJ6A 4KWHA 2C0PA 4CKCA 3AEQA 2GTIA 2VJOA 2YMPA 4JAVC 2BI8A 4ZFNA 1KDOA 1DWQA 1KKLA 1Y63A 1RLIA 3B1JA 4RANA 3T54A 3OY2A 1AE1A 2GBLA 2V98A 3DE0X 5EQDA 1VA4A 3OUUA 3WLAA 1HSZA 1N32B 3GCDA 2JH9A 2ZXUA 5JSQA 3S40A 2BH2A 4MR8B 4ALMA 3I09A 4IOJA 3PPVA 3BD6A 1WR8A 3PXEA 5TT0A 2UAGA 2VTBB 4WBNF 2JFWA 4X20A 1EM8A 2HK8A 3FYUC 3G7UA 3GFQA 3T7SA 1C3JA 3QX7A 4LRWA 3W8EA 4RXUA 4PSKA 1C50A 2YXDA 4H59A 2ZS7A 4LIPD 5CT8A 5DMXA 3WRWA 1X74A 2I2CA 2CJWA 4RVOA 4YCMA 1KO5A 3OT4A 1YS2X 3R75A 4CDNA 4IVQA 1E6MA 1GZ6A 2WU4A 4MX8A 1PVVA 1R8XA 3F6PA 1F7UA 3JRXA 3R5KA 4W9NA 3FCOA 1XRNA 1NE2A 1JWBB 3B3JA 3IBCA 5HYVA 3VU9B 2UYYA 3C0KA 1F8UA 2C99A 1OROA 3AUSA 5G4KB 4Y1EA 5YASA 3VNQA 2P35A 1VLVA 2ALJA 2O20A 3JR7A 4S2UA 3WNDA 1I0ZA 4EHAA 5CLLA 4WX2B 4QJ4A 4AN0A 3STYA 1A2BA 1E96A 3OX3A 1ISSA 4E5PA 2RD2A 1CHDA 5DEOA 1TCUA 13PKA 4Q9JA 2GETA 1JFTA 1I4TD 4I4LA 2VPXA 1ZRMA 3HKBA 5G1NA 2AX4A 3IDFA 1QCZA 2VUTA 3B3GA 3BJZA 4R5MA 4CF3A 4DLLA 2DPMA 5JFTA 1QHHA 1W76A 3NHBA 3CA8A 2W8BA 1A9OA 3NNDA 4D8XA 3SVLA 3CNQS 1UT8A 3E27A 4IIVA 3WTBA 2V03A 4HVTA 2VI5A 3UCFA 3WIOA 5I7WA 1P91A 3AI3A 4QG3A 5L9AA 4C4OA 3DXXA 4LDQA 3ND5A 2QRHA 4NPHA 1UFRA 4N39A 3KD3A 1U1EA 1KMCA 3GEIA 3I3SR 4DV7B 2JD0A 3KE9A 2JDID 3D9QX 1U6KA 3Q2OA 4HWKA 2PV7A 4PHTA 4DLNA 3KB6A 3CU5A 1T24A 2J3EA 1MTZA 4ZVSA 1VHWA 3RYIB 2XB9A 4BFXA 5EWMB 5LB4A 1II8A 5JLAA 4E1AA 1LW6E 1EBBA 4LWQA 4Q0MA 4UEOA 1UMCB 5JYEA 2SHKA 1XG5A 3D3WA 1OFTA 4FSDA 4RORA 1YNOA 3HR8A 3O8NA 3ZVRA 2WQZA 3ONWA 5LJLA 3EIUA 5EN4A 3K5WA 1ACMA 1JHXA 1PP4A 1Y6RA 2PBFA 3C3DA 3WZLA 2TRSB 5C51B 4EITA 2QUZA 1WHSB 4IWXA 3BRSA 1XD8A 3TUIC 4WDQA 2AYXA 4JGBA 1G64A 4QPNA 4B75A 2P0YA 2UXCB 3G5LA 3OZRA 1A0OA 1K88A 1TTHA 4TX1A 3MJVA 1ZOIA 1E4VA 3DV9A 3BMQA 4ARUA 4C03A 5C8VA 1F2UB 2C4VA 3V3TA 1YIDA 3GB9A 3H18A 2NUPA 2UYGA 4DJ5X 4JI2B 4LF4B 4ERNA 3TD2A 4QU0A 3LIIA 3NYIA 4S04A 4PRYA 2H7XA 4LV8B 5DLPA 1UAYA 2CLKB 4JC5A 1JHOA 2B21A 1DAOA 3MSXA 1UDRA 4HDMA 4QM7A 4NOJA 2G67A 5FV4A 3FMIA 4AZ3B 4K0KB 2WE7A 5FOSA 3PJEA 1BE0A 4L5YA 5AO9A 5HHTA 1LJUA 1ZFNA 1XDUA 3OEYA 4TVBA 4BTLA 5JWOA 4DCUA 5A3JA 1ZNWA 4LA4A 2XZDA 2EX1A 3LE8A 3Q11A 4HY3A 1XKQA 1NT2A 4JEHA 1GPJA 3GRAA 5KCZA 2HF8A 2VCEA 1OKKD 3GK3A 4XWAA 2XMCA 4FS8A 3RKRA 3BCUA 1GEEA 1AHPA 2O3RA 4MDEA 2G9ZA 3RVJA 3H2ZA 2CLHB 3B6ZA 2I03A 2XF2A 1RJFA 5DT9A 5EJ6A 4HOYA 2QMUA 1MAWA 4CMKA 3J7TA 4PLYA 1Q21A 1FFBA 2HK9A 1YZFA 2NSLA 4I46A 4BU0A 4P58A 2D3TA 4RXTA 1S02A 2X0RA 1E1QD 2R7MA 3G2OA 1WPRA 5B1DA 4ETIA 1N1EA 1FTSA 1E2JA 1ZUWA 2FPIB 4QREA 3F3SA 4JX8A 4KNVA 1B1AA 2CCKA 1W47A 5SY4A 1L8AA 1VBKA 2YXNA 2GO1A 2ODQA 2RONA 4MVCA 1XCLA 1IPEA 5CTAA 4LJ9A 1N6PA 2CXQA 4RZSA 4E09A 1L4LA 3GVXA 4IIJA 4P4SB 3CZ4A 1MJNA 3AUYA 1PR1A 3TZLA 3QWAA 1OBOA 2IJGX 4UUNA 3T7AA 3GEPA 3T94A 3ZHZA 4CVNA 1JFLA 4Q9NA 4GG1A 3GIWA 4H60A 4DDHA 3BVPA 1MDFA 1Q0UA 4XFDA 2BEWB 1BKSB 1OZAA 3QSYA 2ABWA 1BDIA 4HWRA 3BGSA 3RDPA 3NC4A 5CXUA 5JAPA 4P7KA 1FBTA 4RM3A 1TJ5A 1QYDA 6PFKA 1OFUX 2XQFA 3PI6A 2P3SA 3H1BA 2TECE 2B6NA 2Q5EA 2FKNA 3QWBA 4KBGA 3FN4A 4CTMA 3TQQA 4EGFA 3RAJA 3QEBZ 1R4ZA 1L7MA 2QVZX 2WFZA 3DAFA 3BS4A 4MZXA 4NCJA 1GITA 1K27A 3CNHA 1X3SA 1J7JA 3U3OA 4C29A 3I8SA 2EAUA 1RWBA 3LPAA 2W2XA 3KHSA 4BC0A 2H1HA 2OXTA 3TD9A 2ODBA 4EHBA 2AFIA 3HJRA 2ZLBA 4QHTA 2GDJA 3K1JA 2HW8A 3A1TA 5EZSA 5GGYA 3UHAA 1RABA 2LIVA 3O2JA 3V34A 4LE0A 1P45A 1W1WA 4KC0A 3TLJA 3FH0A 4GL4A 2D7JA 3RT9A 5IM4F 3AJDA 5B1SA 2M6KA 4IZOA 3W2TA 2QEQA 2CC2A 2QVYX 4JL8A 1IM8A 3IDAA 5KREA 3IA2A 1WF3A 3VUFA 3K9WA 4FIDA 3U40A 4GLLA 1RHQA 1TF2A 1VPEA 2H8GA 3N8GA 3VR5A 4YRAA 5IJWA 3LXUX 1PQUA 3R3XA 5DNVA 4JSTA 1DQPA 1JA1A 4F93B 1XNRB 1DVRA 3ZJYA 2UZ1A 5JG7A 1QG0A 4HZIA 1KDRA 5E0KB 4LFAB 1EWRA 1NNUA 3TZBA 5L3QB 3NAGA 2C2WA 4Y67A 4OLHA 4DA6A 1F2TB 3AERB 4FGJA 5EPEA 4FEAA 2JBAA 5DX0A 2AOUB 3NWBA 2DUWA 4M86A 4N5MA 5UKDA 4B6RA 2NWQA 4UUOA 2HQ1A 4DCTA 2ZITA 5EZYF 5SV2A 2VHQA 3OPMA 4MV9A 1SVWA 1G3QA 2OTCA 3UMCA 1HT1E 2A57A 4TUYB 3VZBA 1JIQA 1C1DB 2AIRA 2V7BA 2WLSA 2ZYWX 4N0MA 3NRCA 1KE1A 4WGGA 3RQSA 4BBAA 1IWBB 1COWA 4CMIA 3U7QB 4EJ6A 2YRWA 3WWCA 4LVCA 3I1JA 1NXQA 5EI5A 1R0KA 4MPJA 2PFKA 3I2JA 1KQFA 1T34A 4FONA 2Q7XA 2VPWA 1X7DA 4LVUA 3KT0A 1NQUA 4IW3B 5JCOA 3WMWA 3ID6C 3B9BA 4WNAB 4IHJF 2OL4A 1WW2A 5EMJA 4CIAA 5JNVA 2VQSA 1H42A 3IOYA 2WI8A 2W4MA 3C74A 3BWDD 4AKEA 4FVTA 4WWHA 1C7JA 5CDGA 3VAZA 4W9MC 4ZVPA 5IHXA 3TO5A 3KQNA 2B36A 4ROSA 5HR5A 5DI3B 2HO4A 4OOFA 4N6NA 2QU7A 4LSGA 3I34X 4JIMA 4MI1A 2BIFA 2QNBA 3EB9A 5T4HA 1KEKA 2GYUA 1XZBA 3RIEA 1W8DA 4EVRA 3DCIA 4F8JA 1VPTA 1AO0A 1USUA 2R00C 4KYIB 3VKUA 1ADJA 3ETGA 3MXOA 3TMYA 3HMKA 4H27A 1AQUA 2OCLA 1IWOA 4MR9B 1H1LB 1PKXA 2Q45A 1DLJA 2DWQA 2I7VA 2XMSA 3RLFA 1QYIA 4HUTA 5BUZA 4GMGA 2MHCA 5A7FA 3COZA 2K4MA 1SVMA 4MV0A 3T9DA 2ZPUA 2X86A 4YHBA 5AOCA 2BHNA 3ESCA 3BZBA 3HB4X 1NG9A 1ATZA 1BC5A 1GG5A 2O8NA 4R81A 2HSEA 5GONB 3PJFA 1A71A 2J0SA 3BIWA 4IIXA 4CR7A 1WUHS 4Q21A 4YYEA 3G3EA 4PSUA 1A96A 1VE5A 5HQ3A 2QMZA 3DLBA 5KSWB 1OX5A 3C16C 2NU7A 2WLTA 5AHWA 5DBEX 2Y9MB 4FMCF 5D00A 3HBLA 1N2XA 1NP6A 1ZH6A 4BHTA 4C4ZA 4UZEA 1DDIA 2OT3B 4XQCA 2QXYA 1HEYA 1O97D 3KCQA 3ROGA 3QFTA 1CDZA 4RSHA 5KX5B 4HJXA 1WBJB 5T57A 1QJCA 2ID8A 2PSHA 3QKIA 2VJMB 1OVMA 1ZKMA 2DLCX 3FFXA 1YDFA 5AJYA 5BURA 2B6HA 3H7IA 3AZQA 3KALA 1I1NA 5FBVB 3DF7A 3PKZA 3RUCA 1WZNA 2BP7A 4CGYA 4ARZA 2TS1A 1QH8A 3CF6R 3U5ZB 4RZUA 3IB3A 4S24A 1AF4A 4TGLA 2JJ8A 2C57A 1LUAA 4UPVA 4V3BA 4AJHA 1CY2A 1P62B 2G5GX 3LHIA 1GCOA 4OXQA 5EE3A 1XEXB 5JTTA 3ONEA 1CUZA 1FDRA 1TU3A 1IULA 3GUUA 1U28C 3CS3A 4ALJA 5EIEA 4UVDA 4F12A 2F43B 3DBVO 1UCFA 3FHTA 2GM3A 2HSZA 1D1QA 2E3JA 1CB0A 2QP3A 3OKFA 2BISA 4MUBA 5EJMA 4KI7A 2ZUTA 5IVPA 3GPCA 4DANA 4ESVA 4RETA 4JBLA 3ETJA 4V2IA 2HSWA 3TRIA 3EPRA 2FRDC 4URHA 1S2MA 4YQZA 4PF1A 4MKRA 3F8TA 4CW7A 5A5DA 3ESRA 2VDWA 3KCNA 4TVOA 4CFYA 3OKPA 3PRJA 2CFTA 4DT1A 5HIJA 3TS1A 3TJRA 2A5DA 4GZ3A 1AOXA 3ICOA 5BOSA 1BEUB 3ZWVA 1XPRA 4RVDA 1E9DA 1INLA 3P94A 1KI4A 5KOHA 1V1MB 3U4IA 4CI9A 1E60A 2J31A 2JATA 3ZLUA 3FWYA 3KHUA 1K9SA 4HDSA 2GJAA 4D4JA 3BHJA 1KR5A 4RKRA 3ZVNA 2GN0A 4P53A 2XAAA 5J3JA 3TLKA 1A1SA 3CURA 4L4UA 4MV7A 1T9KA 1VJRA 4PSVA 4BEVA 1ULBA 2VSOA 2X42A 2XLCA 4NMXB 2R47A 1P6XA 2F1KA 4QDOA 3IXMA 1GNLA 5F1PA 1O94C 3RG8A 3ZCQA 3BMOB 4KDFA 4D42A 4EHNA 3LTEA 1FSPA 1UAGA 3EW7A 4X1YA 1GR1A 1J5XA 3IKJA 3BA1A 4WFQA 4PLTA 5A1JA 5TVKA 3U81A 1N1DA 3DOOA 4X41A 3QU5A 3ANTA 4FFBB 1SCBA 4TQGA 4UEKA 1ENZA 2HCRA 1U5BA 2B78A 3HB5X 3O3MB 2P8JA 1FDTA 3O4FA 4Q9AA 3O31A 3PR3A 1BYUA 3R0ZA 1X1BA 4FFWA 4ZXPA 3VNBA 3NATA 4C01A 5MFPA 3IVAA 2TMGA 1N9KA 4NCBA 2KLHA 1RRMA 3C1TA 4UUPA 2MYPA 4D41A 2QTZA 3IXQA 3B8EA 3SF0A 3FPFA 1EVZA 3KEMA 4RK6A 3CUEF 2IVZA 3LC1O 3UT5B 1ZVVA 5I7SA 1ZEMA 2ZZKA 4DUPA 2XHZA 1U8CB 3BSFA 1A4UA 1F4LA 1VJDA 3DYVA 1QG4A 4I55B 3DE4X 1AXRA 4M9SA 4J7XA 3B53X 2EP8A 3TLGB 3H2KA 1X70A 1C8KA 2Y76A 1SKAA 2AXQA 3AY0A 4OHOA 5CBKA 1KFEB 3H0KA 1QOPB 2F64A 3IDSA 4MUXA 5CGZA 3PC2A 4PGFA 1EFPB 4MP3A 2QN8A 3KJQA 4P5DA 2YRXA 3TOVA 3IP1A 3QVJA 4OJYA 2V9ZA 2JI8A 4M1OA 4XD7D 1V26A 2R8EA 5HMMA 1KMHA 4QGAA 3T9CA 1FYFA 2JHCA 1GRVA 3MCVA 3D4NA 4KBFA 2HIAA 1L7OA 5ICEA 4JUBA 4RQTA 1YFLA 2JFPA 3R7WA 4V1CA 1XCOA 2C58A 1I13A 4OQDA 4Z0NA 5IM5A 5AXBA 3S70A 1R8JA 1EFCA 2OECA 5EAIA 4DV5B 1EFDN 1MEEA 1UWVA 4WBXC 4AKSA 1JJFA 3B3QA 4C4PA 3F9IA 4JYPA 3JQFC 3SSMA 4ARCA 3A1DA 3FHOA 1LNZA 1M74A 1AHIA 4I1RA 3OQMA 3PGA1 2JFZA 3SBXA 3D43A 1SWVA 4WXMA 1CEEA 1R0RE 4C4RA 4EMUA 4YJFB 3GY0A 2PH7A 3U2QA 5JQGF 5JTUA 5D5QA 4KGXA 2FRDA 3C4QA 2PV0A 4AY6A 1RJ9B 4D79A 4BATA 4A8JA 2P8SA 4FXOA 3MJ4A 3IDQA 4KV9A 2AYYA 1V7QA 5JSKA 4IDNA 1B8NA 3STUA 3VH4A 3ADBA 2JAHA 1QXSA 1QZUA 3A27A 1J7KA 3SU8A 5ADWA 1U9CA 1VE9A 3B51X 4O2AB 2TMDA 3DCNA 4KQCA 4H7DA 4QBGB 4FB4A 3EX7C 4EYQA 3RT7A 1RYMA 1LNSA 4OKSA 4P0PB 3SX4A 3WLEA 3WSVA 1TF5A 2FCRA 2I62A 3OIWA 4G01B 1ODFA 4R51A 4Y18A 5F35A 3MD0A 5I8ZA 4HX5A 2X0FA 1ISRA 1BJTA 2IDZA 3D0KA 1CJMA 4MS1B 5FH9A 4JL5A 3PDUA 2CVZA 2OWDA 3PFNA 4KB5A 4A36A 4CGZA 4DMHA 1QM5A 3L07A 1LBEA 2IY7A 4B48A 1MIHA 1S2NA 2A9OA 2W7TA 3ROTA 3DHYA 3OPVA 4D96A 5CEEA 1FQKA 2ZBRA 1DWUA 4FMDF 3QVKA 4HLUC 3WMEA 3BCSA 4EHDA 1G55A 2NUBA 2OPHA 4JN6B 3AY6A 1GAEO 1XWIA 1V47A 4EABA 3M3HA 4LFCB 2XZPA 3MLBA 5DGHA 3I58A 5DEIA 2HMTA 1BNCA 3UT5A 4P3PA 3UXEA 3QOYA 4JLDA 2IX3A 2AZDA 3NBXX 2OZPA 3X2FA 1Z16A 2E4WA 1U8XX 4IICA 2D5BA 4INPA 3ZCTA 4BVGA 5B64A 1NY5A 4ADSG 5DSZA 1QIMA 1Y9ZA 3FWHA 3PPXA 3ZE7A 1KDPA 3C85A 3QBJA 4JR0A 1WZCA 2GZAA 1TQDA 3LMKA 4D46A 1W48A 1RLMA 2X5XA 4Q6BA 3UHOA 2OQ2A 3ZDFA 4N5LA 4B4DA 2OYCA 5BPHA 1Y4AE 2XOKA 2WPDA 1L7XA 4O6VA 1MO5A 3TLZA 3ERCA 2DAPA 4X1YB 2VF7A 1WBBA 1KI1A 2PBLA 3PX3A 3RBAA 2YVLA 5DTQA 1T43A 1Q0LA 4NBVA 2H48A 2NTNA 4M60A 2XUGA 3RFTA 4QGSA 2GJ4A 3CX4A 3F46A 3OA0A 4YLGA 4HP8A 2IWHA 3WKEA 4OHYA 1KJYA 4ZARA 5I9SA 5I4CA 1KMHB 1QOQB 2B82A 4J43A 3LSYA 1KZHA 2XYRA 3KKMA 4E30A 6ABPA 3SHQA 2HQBA 1Y81A 3ZJ5A 5LLSA 1FJHA 1Q7CA 5IYZF 3C6YA 3SIRA 1PUIA 5BYJA 4RIIA 3KXKA 4DT1B 4GI7A 2XUJA 4LNUA 3CXUA 2XSZA 2ZYSA 2I3AA 4QOIA 4L3WA 2JGNA 3MUFA 5DDIP 3WLLA 4CFZA 3KOOA 1T3LA 2I5PO 3CNNA 3DDWA 3IPCA 4LDZA 4ND5A 2WJYA 4WZBE 2DETA 1FTWA 3RSOA 2VYCA 1YUNA 3L0ZA 4PHGA 4CKBB 4CR6A 3FPCA 4WAUA 4CMAA 1N2JA 1XDZA 5CJJA 3CNBA 2YFHA 3AVQA 4KMOA 1HE3A 1R6XA 2RJNA 1XJQA 5DF1A 3RREA 3TLXA 4CUKA 4EQZA 2UUAB 1NJ6A 4FMCB 5BV7A 1CR2A 3M89A 5I9MA 1EFAA 3OQJA 4G09A 1O6BA 3PEEA 5JARA 5B2ZA 4JLMA 1PJLA 5KB3A 2KYRA 5L3SB 1ENYA 3OA2A 5JO9A 5LM3A 2VS1A 4ZO9A 3OOEA 3AEYA 4F9FA 2AR0A 5HJ5A 1SHTX 4ZREA 1R5JA 2O3UA 5JAIA 3EGWA 2M6RA 2NNWB 1DC8A 4PXYA 4L15A 4FKZA 2ZU0C 1O97C 1QIJA 4O4HF 5K0NA 4QTUB 1MZVA 1WB5A 2QN1A 2HA5A 2RBKA 3GXBA 1NZDA 1TA4A 3NO4A 3DSRA 3AEKA 2Q6LA 2Y6VA 1MB0A 1ZR2A 5BQ5A 3LWDA 1UMKA 2RH8A 2I76A 2M32A 3H5LA 2YFQA 3HFGA 3I45A 3OU6A 1DQNA 5DHQA 5AOVA 1UMDA 4H1VA 1TMGE 2QLLA 3WYDA 2FTKE 3DTVB 1SEPA 3OMLA 4EDHA 1AGYA 2XSZD 5HQ3B 5HKAA 3A3KA 2ODWA 1W46A 3GVHA 2WQ6A 1TRKA 2YWJA 1JN0A 1ND6A 3P45A 1QVWA 1OJLA 3HZHA 4NCIA 4BAZA 5HZKA 2MT9A 3HCWA 3W04A 3T1VA 1KWGA 1OCEA 2RGNA 1QLWA 1GVHA 5C52B 5EA2A 3PXUA 3KQWA 4J1NA 2GZMA 3O03A 4F21A 4NWIA 5AIBA 3LAWA 4XPIA 4B2PA 1I94B 2O0JA 3H9UA 1TYCA 2VZEA 1Q3KA 3UK6A 1OLSB 5ALFA 1JAYA 3OJ0A 2QQ0A 1SELA 1SU4A 2VUIB 4YCLA 5A5FA 4NYJR 5LC1A 3EZ2A 1XELA 4UXHA 5E9AA 4B33A 2ZIFA 1DKUA 1U0GA 1PEKE 1DIGA 2J09A 5JECA 3HXQA 1DUVG 3M6UA 3MTIA 4LZLA 4DJEC 3E7PA 2B9EA 4MYHA 4F6LA 1IQPA 1V9LA 4XDHA 4Z9YA 9LDTA 5JI3E 1WXHA 2Y9PB 1VMDA 2KB0A 3E58A 3DDOA 4XPZA 4Y3UA 3SQNA 1MR3F 4WNYA 1YU9A 3DW1X 3BN3A 1SXHA 1YASA 2GCEA 3MWDA 4F6CA 3HKCA 3DLTA 2EX4A 1CY4A 4XD7A 1U7UA 4KHZA 4O25A 4YMWA 1NRXA 3U3RA 5DRTA 1A4IA 3KL2A 1QORA 3ZDYB 3ABOB 3S0JA 3FB1A 2E5WA 4NU6A 2M9MA 3L6OO 4L3OA 1G5FA 4X1KB 5BMOA 1LV8A 3L8HA 1NX9A 5LB2A 4XDZA 3L6BA 3IR7A 1JLMA 4IQ8A 1TFUA 4M9CA 4MS3B 2ZYIA 4S1NA 1QLJA 4J0IA 2G9QA 5DTEA 4QBIA 3MQ2A 4RK7A 3EGEA 1JMKC 1YB5A 1VLHA 3GJZA 4G63A 1AT1A 4RVFA 3SBEA 4MUEA 4FW9A 3PE6A 4DZZA 2EFEB 4MB2A 1HLPA 3LC0A 3LIPA 1NC3A 2O0LA 2HHHB 2F17A 2IOFK 2CXTA 3ELDA 4LHVA 1TUBB 1H1LA 5DIFA 2A4MA 4JJ6A 5B37A 4V1CI 5HKOA 2HBQA 2BRUC 4EEZA 1HMPA 3JX9A 1N2EA 4O2AA 4DUYB 3Q7IA 3DUWA 3KFXA 4US2R 3STVA 2RJOA 3HA2A 4L1KA 3OKCA 3E4DA 3NM5A 4P6VF 1RKVA 1YHYA 4BMOB 2PZEA 4LQLA 1ZUIA 4LSZA 3TM5A 1KOFA 1QQAA 5LLDA 1I2AA 2PE5A 1ODIA 5AESA 3ZGZA 2XXJA 3UMGA 4BX2A 1XZDA 4GBMA 3A6LA 3PUHA 1WL8A 4IIHA 5THKA 1T29A 3W90A 3ELYA 1J22A 1P7WA 2WD8A 4TTTS 4WNAA 2DT8A 3GDOA 3HY6A 3IMGA 4AZVA 4LXHA 1GQOA 1C7ZA 3NV7A 3K96A 3WQHA 1PT8A 4QNMA 1CR4A 5IABA 2C54A 2W6JA 5CDFA 3L1KA 1WMEA 3R3SA 4UBMA 1I4OA 3QUAA 4MPPA 5A71A 4N76A 3FSEA 3HQ4O 4EYSA 2ZT8A 4I4TA 4D57A 4A0FA 4EF5A 3PZRA 5KJ1A 4JNCA 2BPOA 1H6CA 1WP4A 4H7EA 5IN5A 2Q07A 2G88A 3VNAA 1QGYA 2NV0A 4JBHA 3S2IA 5KVVA 2Y1OA 1JIUA 4JBYA 5ENVA 1Z6ZA 3C43A 2A9FA 1G8HA 2KX7A 3RADC 5K0TA 1SAYA 1MX9A 1G17A 2VBIA 4ZKEA 3TQRA 5HEKA 5K8IA 1M6WA 4U6QA 2D4AA 3FDXA 1VLJA 3RJZA 3RVPA 1H0KA 1V45E 1C7IA 2CGEA 5EE0A 4ZIRB 1D09A 5KKAA 3I3OA 3A3PA 4O63O 4LYGA 4JEUA 1RZ3A 4NE2A 1RYBA 1NN5A 3O0DA 4GKVA 3SFVA 4NCHA 4MTCA 1A27A 3LHDA 3RYFB 3HY4A 1Z7GA 3EEOA 1QFSA 4I50A 1RTTA 3KJZA 1TAHA 1L3IA 2B37A 4U7JA 5TPZA 3WRYA 3HXOA 5AVXA 1XTUA 2GD0A 2G71A 1CFJA 1OXVA 1JTFA 1Y4ZA 4WNCA 2G9UA 1R6UA 1EFUA 3A05A 3QVTA 1NYLA 4UAUA 1BIFA 1SBQA 4M7RA 2JIDA 5J9FA 1DBVO 1FRVA 3MJFA 1YJBA 1Z0AA 2DKNA 4A8PA 4ZCIA 3PNQA 3B6IA 1T9ZA 3ZV3A 2ZCUA 3LLCA 2I65A 3LUJA 1NBWB 2R79A 4BQIA 4DMFA 2KQUA 3CEMA 3G82C 1RE0A 3OLCX 3OUZA 2WY2D 4DE5A 3EJ6A 4O1MA 4JYBA 2P1ZA 1PT6A 4JJ4A 1XE3A 1JKXA 1MU0A 5H68A 3RUPA 2AS0A 4C6RA 1QO9A 1M76A 4J0JA 1SD5A 1UZNA 3SJAA 1GTRA 2QM3A 4A0HA 1L4EA 3VU0A 1OW3B 2VQ3A 3A32A 5JYBA 2Y27A 3CLSC 1NA5A 2BGRA 4KG7A 4HV4A 3TE6A 2DCMA 2GA8A 1D4AA 3BULA 3ER9A 3D4BA 3PNYA 2YVKA 3VHXA 1KAGA 1NQAO 3WZMA 1IOZA 3MOSA 1Z2NX 3FTEA 3GBPA 4JLAA 2CVQA 1UC8A 4LGYA 3AJ9A 2I54A 2Z5LA 3LVQE 5HF8A 3AOEA 3RVBA 1J8QA 5LXTB 1GUYA 3E2PA 4JVLA 2YWFA 4GLBA 3VZRA 3DEIA 1PK7A 3CX8A 2BLNA 1Y4UA 1OFIA 5HPYB 3ZXIA 1HFWA 1OWPA 2Q8QA 1DKPA 3Q3EA 4GXTA 3KKPA 1I33A 2PL1A 4ESHA 3BHMA 3BEDA 3K6SA 4MQMA 3GPBA 5A3VA 4RYLA 3F4KA 3PQ2A 1NJGA 4LPSA 3P2EA 4ALIA 1A88A 4LKOA 5C8XA 2R3SA 1KPIA 3AFOA 4A2WA 3KD2A 1UWKA 2FPWA 4F3NA 2ZYGA 5D86A 1M2EA 3SXPA 4FJ0A 1GPH1 4HH4A 4I9FA 4K9PA 1PJAA 3ETEA 5FFMA 4A6EA 1YF3A 1LBTA 5JW6A 4TLDA 1DKNA 1JS1X 2EJBA 3R3ZA 5KYKA 2PSEA 4NH4A 1M1UA 2Q3HA 2RSLA 3EXFB 2X1LA 3NBZC 3Q9LA 2NUTA 5C2JB 4B3MB 4AKIA 2XUAA 1J8DA 1SKUA 1QOZA 3MWFA 2AMLA 3N87A 3ED1A 4LZWA 4PYJA 4OF4A 2VDRB 3DDCA 3U7QA 5ALYA 3ZHQA 1USKA 3D5EA 3EASA 4KN8A 5DISB 4ZCMA 2C2ZA 4ZHQA 4RPJA 2DQKA 4UPDA 1RPNA 4R54A 3I2KA 5E3IA 4YRGA 1LK0A 4I14A 3K0KA 1VIYA 4YMVA 1YQDA 1QONA 2CXPA 1Q92A 4A0RA 4DEXA 5ELXA 3ZBQA 5C1OA 3CX6A 1BCSB 3DW3X 4MUIA 3W9UA 1R0BA 2ID4A 3B1XA 4FILA 3C5EA 5DWDA 3AERA 4B3GA 3HYTA 5L53A 4CMJA 3L02A 4ZCTA 2B8NA 3E0QA 4RKQA 2P67A 5I9LA 5K4AA 1T1EA 2Q5JA 1O77A 2PA3A 3I8XA 5DTRA 1QGUB 5LZ4A 4CU5A 1QH9A 1ZMXA 1ZA2A 1UBNA 4K7JA 1JFFB 4Z0TA 3QPDA 3REQA 4XR9A 5GIOE 4A6PA 4COKA 1QK4A 3R6DA 5CFLA 3E7DA 1YE5A 2OQIA 4TKUA 1DQRA 1D9ZA 1SZJG 2WM3A 3EGVA 4KQXA 5AW4A 4DLTA 2C88A 3NBFA 2H65A 4LEIA 2DR0A 5DLDA 5KOJA 1HG1A 2W2KB 1X14A 2OP1A 3G9QA 1JQLB 1P33A 3RGGA 4FM9A 4KIWA 5FV7A 4EG6A 2VOEA 1PL0A 3ZU5A 1WDWB 4EG5A 4YCSA 1AUVA 2OBYA 1YDGA 1FVHA 2QUHA 1I4EB 4QFMA 4KPYA 1Z7WA 2XVYA 2C8KA 3CH7A 1NY6A 1XZPA 4IF4A 2P9CA 1AQIA 4CKEA 4X84A 3U37A 4IX9A 1RQ7A 1EX6A 4BN4A 1P2VA 3O8OA 3NYQA 4ISBA 4BO6A 4CKWB 5FPTA 4UZFA 5T41A 2XE8A 2AR7A 4WJKB 5IT5A 1J5EB 2C2MA 1M1YB 2YXLA 4FKMA 4BLTA 2BTQA 4R69A 3UV3A 3RD5A 2NQ2C 2AMJA 1J0CA 1IHYA 2KM1A 1K4KA 1U0OC 2Z8YA 4LK3A 3DBHB 4P38A 4R9SA 3BXZA 3F8WA 4MYTA 5LWHA 2BE7A 1CFZA 3V48A 1QK3A 3RUFA 1UT6A 2O7RA 4FDMA 1L9XA 4IDHA 1HO3A 2HFKA 3MK31 4RLHA 5AVJA 1C30A 3Q4GA 1WF6A 3Q1KA 5DP2A 4D3ZA 4F9GA 2XOEA 2REQA 1RPAA 1U8EA 1W75A 1NW5A 1X7WB 2KW5A 2MU1A 3N0XA 3L46A 4A15A 1L7RA 1EXWA 4G5OA 1A72A 3OJEA 1SQ5A 5IAJA 4GZ5A 2P3OA 2PGLA 3A26A 1CIVA 3DHNA 2SKEA 3PEFA 5ICGA 3T0IA 2H5LA 3Q3CA 1ZJ4A 1ZM9A 1B4DA 5H1YA 2DFTA 4BMZA 1J1ZA 1ORDA 3AL3A 3FLEA 4GYKA 4R1OA 3JQ6A 1QF6A 3R6GA 3EHEA 1SKBA 2AZMA 5DJ5A 3DVAA 3EUAA 5DP1A 3ZKWB 2BJVA 4Q3AA 5KIAA 1RYEA 3WTCA 2N1MA 3I6ZA 2DRIA 1YVDA 1TAGA 3DQQA 5BN5B 4AG3A 4Q4AA 1IM5A 1L3CA 2JIQA 2H5JA 3E48A 3A4NA 1C80A 4XARA 1QRSA 2GVNA 4N8SA 2W6ID 3C3WA 2VSYA 4Y2TA 1RRCA 2BFDA 4U7GA 4BFLA 3WHLA 2B35A 5ALWA 2PA0A 1UBUS 2E49A 3IEPA 4LRTB 1XZKA 3CUYA 4QPPA 5ALDA 1H94A 3VRHA 1R6TA 1LS6A 1R9NA 1TQ6A 4PLWA 4ZMRA 5I4IA 2QNRA 2OFWA 3MMPA 4PBRA 4IILA 4QX6A 4URUR 4I50F 5AXDA 4UEQA 5BOVA 3I04A 4K1XA 5ISMA 4WXYB 4JOQA 5G53C 3IL2A 1W30A 1TZ2A 1B6RA 1NUUA 2XCIA 4HWGA 3GLVA 2I34A 2RCYA 4OL0A 4ZO8A 1J1IA 4AZ3A 1L5YA 3SS7X 3GAAA 2RHOA 1B6SA 1OBFO 1LVHA 1ULZA 2W90A 1EU1A 3H2HA 3IH5A 2XMBA 3PP8A 5BYAA 1F20A 3H42B 4HCJA 4L4ZA 5JSZB 3PNSA 1BA2A 1JP7A 2WAMA 3PT5A 3VSAA 3QKRA 4EYGA 5E2IA 2DPHA 4Q93A 5CT6A 5DOZA 3AB7A 3K6KA 2ZU6A 1G8YA 4WZAB 3RKUA 2OBBA 3E18A 5M04A 2NPOA 4CN8A 2AEJA 3URKA 1FUEA 1C5KA 4GMXA 3VHXB 5F2NA 2VBGA 3DBRA 2H1CA 1KC1A 3HNPA 2PL3A 1ODKA 1QRDA 3BXPA 3QU7A 3R7SA 1JLRA 5M29A 2FUEA 1XVUA 4KQ9A 4GKKB 1NW9B 5LZ7A 2ZBFA 3KOZA 3FJOA 1U2DC 2NAFA 4ND7A 4MUHA 2PCJA 3L7YA 1Z25A 2WG2A 1E98A 1SG6A 5DTMA 1DFIA 4QD3A 4FZRA 4ZU1X 1TM2A 1E7RA 2GERA 1JG7A 3QRWA 1E1QA 1Q2XA 1TEVA 2AB0A 3IUMA 4FDAA 3L7OA 3G5AA 3BF8A 2E4YA 3ABQB 3HGQA 3IUJA 3L4BC 3MB8A 3MCWA 3OG9A 2VUHB 3ZW9A 3ZCVA 1LF5A 2XTMA 3ZWWA 1O95A 2Z2ZA 3I83A 1USIA 3R2JA 4FUTA 3KPUA 4G4GA 2WVHA 3WKAA 5ADHA 2J30A 2UVQA 3PWSA 5IJ9B 1AXEA 2E21A 1UOQA 2H2WA 1TRHA 5JSYA 5CB0A 4RHYA 5ESDA 1C9EA 1W35A 2Q5QA 5KTSA 4N3NA 2CNWD 2RGGA 2YJ6A 3NM6B 4QEDA 1C0IA 3DXZA 4FD2A 4P3XA 5L7TA 5IX8A 3DAHA 1CJSA 1BH2A 1VTKA 3QMMA 1L4UA 1AV7A 1JE0A 4KRYA 1SVKA 3G13A 1GADO 1GZUA 4U9UA 2QAIA 4XJTA 3PXCX 2AJBA 4HQNA 3QXHA 1JLLB 3PC6A 1ECFA 2CJPA 3QTTA 2I0FA 1RAIA 3R3JA 4MGZR 3S2SA 4DDUA 4WJZA 4RXMA 2CYCA 4KXQA 5JSZA 2XWBF 1ZJWA 2YIDA 4P4NA 2ATEA 4BQNA 4LF9B 5F98A 2AZ4A 4UCWA 3LWBA 3ZHOA 4A8HA 1QHYA 4NOKA 4C7BA 4CL3A 3GNTA 5IDXA 4LJ5A 2C4WA 2BHRA 3PQEA 1EPUA 1M1YA 2XDYA 1NOIA 1YRQA 1P75A 3LHSA 5IKEA 3LNTA 2EL9A 1J9GA 1E2QA 1EFKA 2DOKA 1IY0A 3BKXA 4MQLA 4R3NA 5ENDA 4CG0A 3J80A 1BXZA 5KSZA 1JQDA 1X1QA 1C1XB 3SP1A 4R1TA 5EWJA 1EBUA 2ZS8A 3AHDA 1F4PA 2QN7A 3EUFA 2A9KA 4Q24A 4EGJA 3AP3A 2UUBB 2J9RA 4LV5B 3R7FA 1NNLA 2J6IA 4YUAA 3UUGA 3HJGA 1E9EA 1V16B 2VA9A 1G19A 1WULS 2VA8A 3V7WA 3WGKA 5E9QA 1ZMRA 2I8AA 5CFZA 4NMHA 5KYXB 5CB4A 4X62B 1WUJS 1YXMA 3PF8A 1O6ZA 1NMYA 3RK4A 721PA 3IOMA 4LJRA 2PIDA 1T3HA 1DQYA 1RAHA 3P0EA 4PW0A 3WGHA 3D0OA 3SQMA 2YN2A 3AW8A 3EDMA 4WK0B 2NVUB 1X7YA 4F2GA 5C5CA 4E03A 2MINB 4DS3A 2JF0A 1XCBA 5BW4A 3HB9A 3PK0A 4QNRA 2IEYA 2XYPA 4W7HA 2PMDA 2A1UB 4L3VA 1KYWA 2ONYA 2L2QA 1E0SA 1I9CA 3JYHA 1YR2A 3IIEA 4Q3DA 4GNKA 1I4WA 2O9JA 3DOJA 2C9YA 4LX0A 4M49A 4R9RA 1KYZA 3ABRB 1ODCA 2YVAA 3TZHA 3F90A 2IBMA 4X85A 2I8LA 3V7FA 1TUEA 1Z26A 2IOFA 2VJCA 3ZJTA 5LD2C 2OV8A 2R9VA 3ADKA 1MAHA 4QOEA 1NV9A 5B6JA 4AJOA 5A2QA 2NZXA 4R8LA 3MZ0A 5C18A 2X8WA 3ABSB 4KLZA 1RKQA 2V1UA 2B20A 2YOFA 4MB6A 1X8LA 5HA5A 2W70A 3DT6A 1I2MA 2O2GA 5B2FA 5HRCA 3OCZA 3M3DA 3D3NA 3ITKA 4B2IA 3E81A 4ZQFA 5DPMA 2G82A 5KAPA 4F3RA 1FB5A 3ESZA 4JROA 4RSMA 5FYDA 1L5ZA 1UP7A 1XNQB 4WKNA 3DYIA 3VNSA 1X86B 3KDAA 4I81A 5G0WA 3SN6A 3C6ZA 2ZSDA 3WJ7A 2DX7A 4YQYA 4R7TA 3T4PA 4NE7A 3AESA 4OAQA 2QRGA 1E2FA 4DCGA 5DE3A 1AKRA 2XVAA 3EIHA 3JASB 4E5YA 5FWNA 4WINA 1XRQA 3O92A 4NJEB 2GJKA 4IDEA 1H4SA 2BUBA 4F86A 4OFXA 3EXHC 4DW8A 3OT5A 4TL8A 1EH5A 1H65A 1U3WA 2E82A 4UUMA 1YZUA 2VPZA 1ADFA 3O91A 4X1IA 4B82A 3DAGA 3K0AA 3ZHYA 4JP5A 4ENPA 1CNMA 3B1ZA 3MB5A 2IUYA 1RZVA 2C59A 2Z2YA 1XCJA 3PYLA 1E3WB 3OLQA 4IEEA 2FPOA 5EZYA 5AW2A 1GPAA 1ECCA 1Y0BA 4LW8A 3R9XA 1F5NA 3UB3A 2EG9A 3OLVA 2CL6X 3OD1A 2WM9B 5JCJA 4GMFA 4O2LA 1WXDA 1PLLA 3M82A 2A6PA 2WVJA 4KK4A 4UUAA 3Q6MA 1G2PA 2XDQB 4K9SA 3KT3A 4GEKA 3I64A 3QVWA 6AT1A 1WZUA 4DZRA 5JZ9A 1PFWA 4DRZA 4Q4LA 5FD8A 2VN8A 5MGBA 5AK0A 5F1YA 1RM3A 1YIAA 5HK8A 1OA0A 2YX1A 1IIRA 3PHBE 5DLYA 2PQ0A 1ETHA 2OXCA 4PN3A 1UJCA 4YGYA 2G80A 2XNHA 1BSVA 3RWMB 3AEKB 1XYVA 1P61B 1VP9A 1WAMA 3CT4A 1WUYA 2O8FA 4HS9A 1QRUA 2YY6A 1MNAA 1UK6A 1GYQA 4Q3BA 4Z99A 2WJ4A 4Z5XA 1JJ7A 1DRUA 3U44A 4L78A 4TXHA 1Y3AA 1NIPA 1E7YA 3DM5A 4LOKA 2VXOA 3VDXA 2V9PA 2R7AA 4Z1OA 4TLEA 1ZQ1A 1QTIA 2EVWX 2Q1TA 2B5VA 3D1LA 3DHEA 5F33A 1X13A 2PUBA 5C8YF 1BROA 2P11A 1OF1A 3FBGA 4Z7JA 5A5EA 2IKQA 1NX6A 4GPTA 4JLUA 4A91A 1TQHA 3DO8A 1Q1GA 2JFOA 3K16A 1DX6A 1U5CA 4HI0E 1B0ZA 2D8AA 1U6JA 2IZ6A 4WACA 5B57C 1HURA 2EYQA 1JZQA 2II6A 4A9AA 1C0KA 1H05A 1PTJA 4YUZA 1E5XA 5JZVA 4N5DA 3TZ6A 3V6LA 3BDAA 4CF4A 2R5FA 3A3NA 4Q34A 2XTZA 4HZUA 1OD6A 4KYTA 3HVHA 5D3MA 5G2OA 1W0JA 5LUBA 1Z4KA 3P32A 3ZCXA 3TDMA 5FBQB 1V3TA 2ISQA 3PJGA 4WV3A 2PQ6A 3NALA 4IH1A 4IKEA 2OBNA 1LBSA 5DN6A 1T35A 1ZS9A 4BBPA 1R8YA 1BDJA 5CIYA 4XM1A 2YUTA 5COAA 3BHNA 4NHOA 3RHSA 2P4HX 2QPLA 1U3UA 3G2PA 4IJWA 1J97A 2EFCB 1Z88A 4YYZA 5L4NA 1YQGA 2FW0A 3ZU2A 3JD2A 1H5UA 4RHEA 3FI0A 1Y9DA 1RPZA 1JI0A 3BK1A 3GEDA 1J2JA 1QKIA 2JIOA 3FKSA 1GV1A 2BMDA 3G8CA 2ZEJA 3OC6A 2J3QA 2O8VA 4RVCA 4BLWA 2XDAA 3BGIA 5B3LA 5AVWA 4A4DA 3N2LA 1ZO8A 4ZQHA 2JLQA 2WW8A 4KQFA 3B6JA 1HY3A 3GGJA 3IHTA 3NHJA 5LYYA 4QUEA 2UZIR 2IHJA 3ZNPA 2DKFA 1DAPA 1FFSA 5J58A 1N0VC 4W5JA 1E66A 2UV8A 4UDOA 5LZ5A 3LBHA 1JVSA 1UFVA 1KQGA 3N07A 4P8RA 1YACA 2B83A 2G1AA 2G4CA 4QAJA 3S2YA 3VFDA 1J9ZA 4B3BA 1CY6A 1EYZA 2QMHA 3IALA 1LDEA 4LXIA 3RJ9A 1SXJB 2BELA 3UBMA 3WMRA 5KWEA 3TEJA 2EL7A 5I51A 4MS4B 2UVPB 3HFSA 4B40A 1XQXA 4YY3B 4HAWA 1H9AA 1SXJD 3QFFA 4IHAA 5BO5A 2Q5OA 2R60A 3W7AA 5BR7A 1F60A 3NORA 5AJWA 2VC2B 3CONA 4D4IA 3RRJA 1VJ1A 3TQHA 3LLMA 4F6RA 4LSWA 1FNMA 1Y6QA 1DUSA 3INRA 3KZVA 3AUJB 4BLPA 4WKBA 1RJDA 1HOTA 1UBLS 1ONBA 2Q2OA 5JMPA 4ZPJA 1OX6A 1MW8X 2XCUA 1UC9A 4YV0A 3BJMA 4RPLA 4D8VA 2IU0A 4HB4A 3H16A 3RS4A 4XRRA 2ZUFA 4MS3A 5BWBA 3OZGA 4MSUA 2EWWA 4HT3B 2DULA 4IL5A 3G9TA 3L8ZA 1ENOA 4GBJA 2JKVA 2JVJA 3L5KA 2OC4A 1ZEJA 3UYLA 2YV5A 4NE9A 5LYJB 2YKGA 3CZ9A 1E3LA 121PA 1MH9A 2H29A 3ZTYA 3HLYA 3QXJA 5IZCC 3QYPA 3LLVA 1OGJA 3DDZX 3DTNA 1LQUA 5JAMA 4DYVA 5KI6A 3AVWA 2YDYA 1A9ZA 5HQJA 2YRFA 2EGHA 3D6TB 3W3ZB 2FMTA 1WXFA 2AJCA 1PD1A 3GIDA 5HF6A 1U0JA 3D8SA 4ZQEA 3OZSA 1BHO1 2EDAA 1NKTA 3MWJA 2HJSA 3CCFA 1VP3A 4DR7B 3P71T 4CEIA 1E7QA 2JGFA 2X5NA 5AM2A 3RVMA 4AY2A 3PL5A 4H3KB 1Q7RA 2GRUA 4GS5A 4PAMA 4XYEA 4J7CA 3M1IA 4ODIA 3T6KA 1E8NA 3UHJA 4D44A 3H5IA 4L02A 1U8ZA 1R16A 4OQFA 2OGWA 3RIYA 2CZQA 3EVFA 1E1CB 1NMXA 1BW9A 1KIAA 2ZB8A 1VYUA 1WKBA 1XYGA 2D2FA 4RE5A 1DBWA 5H02A 4Z86A 2QRKA 1QS0B 1MF7A 2WHQA 2F2TA 4ITVA 3SICE 1O94A 3O7MA 2J3KA 3IBGA 4YMGA 4MDYA 1G20A 3NGXA 3ZBTA 4AQYB 1GPYA 1P8AA 1IY8A 2D1RA 2V4UA 3LGAA 5B53A 4GP6A 1Y3CE 2IZ7A 3I0ZA 3Q40A 1GV0A 3SXJA 3EOAI 1JEEA 1F4VA 4AAYA 3WBKA 2XHEA 4IO1A 3TTSA 4UU7A 4KVGA 3TPZA 2HJRA 3GJTA 1VKJA 3ZWMA 5AKHA 2G9RA 4HAXA 4N49A 1USWA 2QR5A 4PPGA 3C1AA 5AW1A 5FORA 4HYQA 1NAHA 2H17A 4FDLA 3RNOA 4YWJA 1GFIA 3DH0A 1HYQA 4L8WB 3TR0A 3O4VA 3ANXA 1UXKA 4AP6A 2ZRKA 1Q7EA 3E8XA 1R9GA 4GUAA 3LJKA 7ABPA 5LKAA 2HBRA 1EP2B 1OLUB 1J2RA 6CHYA 2JLSA 3JATA 3LQ2A 3QGMA 4RMJA 4GZLA 4RM2A 1ONSA 3PTAA 2PUCA 3DB2A 1PSZA 2EP7A 4NOMA 4PR3A 1WRBA 3WS7A 5JAHA 1RTKA 5BNIA 1QFYA 4WKPA 1J24A 4PRKA 3BIJA 4CE6A 2PUWA 4FFBA 5I9NA 1K3UB 1C3EA 4WW0A 3FFWA 3IO5A 3QKWA 3ZY6A 1OLSA 2LZ0A 3H05A 1OBVA 4EF6A 3B48A 3O1HB 4ZODA 1GARA 2VDJA 2C3PA 3JWPA 4Y0AA 2JLAA 4R01A 3PRHA 3FYUA 2DTEA 4G81A 3T9EA 4JXXA 2YJ4A 3ORHA 4BO8A 2C5FA 1U3CA 1UOOA 4JEIA 4LZNA 3N76A 5AICA 5C5IA 1ZBQA 5JI2E 2PH5A 2O6LA 2JFGA 3OFKA 2GNAA 3PBKA 4AIIA 4RZHA 1VL6A 4TMXA 4WOCA 3VYWA 4M55A 4B76A 1SQ0A 1L9KA 3KBBA 4DSNA 1Z07A 1LWOA 5KQLA 2FRVA 1CS0A 1VBNA 3OQ6A 4B5KA 3PD7A 4R1PA 4BIMA 3N0TA 2PMKA 3O3OB 1P5ZB 2ZI7A 4PQYA 4BUJA 2R6JA 1U3GA 3H6KA 3K09A 2HV8A 2GD1O 2VTVA 3O84A 3EIWA 3DJFA 1LH0A 4ZVTA 3JPYA 1DBQA 1NJ1A 4X95A 2PEZA 3UJ7A 4JJZA 1H2ZA 3AHIA 3C14C 1NJ2A 4CLOA 2PH1A 3LSTA 2C2YA 4II2A 2QYHA 1GXSA 5EGSA 4CTOA 2WTNA 3ENWA 4TWRA 1E61A 5IASA 4NDNE 4XB1A 3VC1A 5CFMA 1LBIA 1UOPA 1E9AA 4ZOCA 1R15A 2CXOA 4M8LA 2QVXX 2VP5A 2XB4A 3GRFA 3CF4G 1MVNA 1W87A 1KGDA 5FUYA 3FE2A 1JIJA 3A04A 4HBGA 1XEXA 5T67A 2GESA 4NCNA 5AM3A 4O2AF 3SVZA 1G8PA 3G79A 1JDSA 4FKBA 3C3KA 4K88A 1KAEA 1P29A 2E1RA 4M1EA 3S1SA 5BN3A 2ECPA 3F6EX 1KC3A 3I4CA 3MBIA 1BX0A 4QGFA 3FNRA 4M8IA 5G40A 2VRCD 4OLFA 2W93A 3SMVA 4L9SA 4QYMA 1CJTC 4RIGA 2QRNA 4RDXA 4BFVA 2ZGVA 1E9FA 3SEZA 3OQNA 3H3FA 2ILTA 2V7XA 2ZJYA 4I8XA 3DEYX 4J6FA 4BGIA 3RWBA 1UEIA 2XQJA 4D3XA 4OHXA 2HSDA 3TPFA 4DDMA 2HNBA 3ROKA 4PGGA 4BP9A 4BVBA 3SHWA 3SLRA 4TTQA 5EP2A 3KQOA 8ADHA 1JQBA 3ODPA 1XDSA 1GZ3A 3L1VA 3OM8A 4I4TB 4J0DA 1JZSA 1GG2A 3OZTA 5JDIA 1Z0IA 4HGPA 1JHZA 1N0IA 2G08A 2ZDQA 5B58C 3KG2A 1JHYA 1EUDA 3H87A 4OXXA 3DLHA 1XXHA 2ZVDA 3L1HA 3AKEA 4MRNA 2WDZA 1TQ2A 1OAKA 2XNCA 3CZPA 5C3UA 2FI1A 4BNUA 4EI9A 2GF9A 2CSUA 3HBJA 1UXGA 2FCAA 2QHXA 4IY1A 5L3ZA 2C9OA 5J2UB 1NN3A 3DKIA 3WLRA 1DPFA 4BRZA 2H8KA 3UENA 1W7AA 4MYSA 2OAP1 3PITA 4BJ6A 4IRXA 4FHCA 4CL8A 4C0AC 4ZMSA 3E1GA 2QX4A 3QE3A 2JIPA 2X58A 3N8IA 4JGIA 5AKKA 5AKEA 4EW2A 2BKUA 3UK7A 5T4EA 1K06A 2QGZA 4QRDA 5JMWA 3LD9A 5BWCA 3R77A 3T95A 3W05A 3TTVA 2CL0X 3GP8A 3P0JA 3JATB 1VL0A 3NBAA 4E6EA 4LDRA 3PRKE 5A03A 3V8MA 4KL8S 4R40A 1TW3A 2ZWVA 1BFKA 2BZ1A 1GGEA 2I55A 3DZCA 4RVUA 4Q7LA 4Y2RA 5TS3A 1CF9A 3CKMA 2JLUA 1HDXA 2QMYA 3AYXB 4JWTA 2C2OA 4QEZA 1DC6A 1C9MA 3GDGA 3HPRA 3VPHA 4C04A 4DLXA 5JNRA 2UXDB 2FMUA 2WAAA 2L17A 1AU9A 4OYLA 2WSBA 4ZVKA 4CM5A 5GZ3A 4RTPA 3H9BA 3E6AA 5JS6A 1T6ZA 4HDAA 1EUYA 3HB7A 3PGVA 1NKSA 5HJ7A 5DK4A 4NFLA 1MFPA 1PKEA 2YTZA 5JY1A 2OBFA 2FAXA 4L08A 3NMUF 3OBBA 3FGNA 3PQFA 4BCBA 1QO0D 1FMJA 2DHQA 5F64A 4GPD1 4LYEA 3GJ7A 4U2GA 3W5IA 5IULC 1KEUA 1TNDA 2A1IA 1ZVQA 4R2IA 4TTAA 8ATCA 1Z6TA 3QVSA 3I30X 1W8IA 3FNIA 1BD4A 4HYYA 2IQ5A 3SQXA 1DJPA 2QTNA 3F2VA 4PFSA 4QOSA 1FQOA 4Z0HO 3VA7A 3BD8A 3N28A 3L4SO 4Q7EA 1CLUA 3MCUA 3O3CA 4BVAA 1N2GA 3VJMA 2PLNA 1A9YA 3AONB 5LZ8A 2QX9A 4F38A 5BW5A 1T2NA 4NABA 4TMTA 3EN0A 3Q12A 4G5FA 4RH3A 4CF5A 2DLNA 4PFKA 4DA8A 1OAOC 1MQ8B 2B4YA 5CG2A 2R00A 2C8LA 3UJ9A 2EQAA 3WX0A 4XM0A 1IWPB 1M2OA 3BICA 3UPTA 2F8MA 5DWVA 1J06A 2BE9A 1VHDA 4G5RA 4M9ZA 4UCFA 3VPBA 3WV4A 4ZJUA 2FG6C 1JPVA 4OQXA 1JECA 3INGA 1U1FA 2Y67A 4ALKA 3DONA 3NTQA 4GXRA 4RA6B 1D2HA 4U4AA 1CZRA 3OEWA 2YNMA 4XQ0A 5FHQA 3DVLA 3R7DA 1JHPA 2OZEA 3AKCA 3OZEA 4BE7B 1NUTA 3G1WA 4V1CB 3ROXA 4CUZA 3RAEC 4BN5A 5CYOA 1O7JA 2X9NA 4NFSA 5CAEA 3VBEA 3U62A 2VTEA 3BMCA 1R37A 5FQOA 5KOHB 1SZDA 2PU5A 2Y2UA 1EFPA 4UHFA 3CVOA 1SVIA 2IU4A 2NX2A 2ZFUA 1XK6A 4CTJA 4CKYA 4MR7B 4O4HA 1A9QA 2YZGA 1TO2E 2J5KA 1AC5A 3PIRA 1TPZA 3OLWA 3T3GA 1BXRB 2FEMA 3WV5A 1Z5OA 4BNKA 4WTOA 4YJGB 1LI4A 5TQJA 4E2WA 4QTYA 3HCFA 3EPHA 1SULA 1Y7HA 4A7PA 3ZCRA 1L5KA 3WXMA 3ZV5A 2JL1A 4U39A 1ZIYA 1ZGAA 1EUZA 3IR6A 5LWQA 2OM2A 4YJ3B 1CW2B 1EVYA 2A84A 2OXRA 4P98A 3IAAA 4TN5A 4X91A 1FA9A 3E8SA 3K92A 3N05A 3KFVA 1QZZA 4DPLA 5EJ9A 5JXIA 5DXJA 3OTIA 3LF2A 2F43A 3Q7SA 4G1UC 4HNQA 3ZGXA 2G07A 3OZVA 5DYYA 5LA6F 1PL6A 3TTTA 3WSTA 1Q7TA 2R8OA 3H4MA 2P9JA 4DG5A 5L3SA 3QPCA 1ZXXA 4B4UA 5FTLA 1AZWA 1W0KD 3OT1B