1YIAA

Crystal structure of tryptophanyl trna synthetase ii from deinococcus radiodurans in complex with 5-hydroxy tryptophan.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
331
structure length
331
Chain Sequence
b'ARPRVLTGDRPTGALHLGHLAGSLQNRVRLQDEAELFVLLADVQALTDHFDRPEQVRENVLAVALDYLAAGLDPQKTTCVVQSAVPELAELTVYFLNLVTVSHLRQNPTVKAEIAQKGYGERVPAGFFVYPVSQAADIAAFGATLVPVGDDQLPMLEQTREIVRRFNALYAPVLAEPQAQLSRVPRLPGLDGQAKMSKSLGNAIALGDSADEVARKVMGMYTDPGHLRASDPGRVEGNPVFTFLDAFDPDPARVQALKDQYRAGGLGDVKVKKHLIDVLNGVLAPIRTRRAEYERDPDAVLRFVTEGTARGREVAAQTLGQVRRAMRLFGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tryptophanyl-tRNA synthetase
publication title Structure and activity of an aminoacyl-tRNA synthetase that charges tRNA with nitro-tryptophan.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ligase
total genus 104
structure length 331
sequence length 331
chains with identical sequence B, C
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1yiaA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1yiaA01
4MULA 2X3FA 1M83A 4MVYA 2QJFA 1O95C 4MW9A 4P2BA 1VL2A 1MC1A 3KT6A 1KQPA 1COZA 1RQGA 3HFJA 4QRDA 3ZXSA 1BS2A 2J09A 3PNBA 2A84A 1MAWA 5IJXA 4ND7A 4OUDA 4UZFA 1FFYA 4X0EA 4EG5A 4YP5A 3H05A 1VBKA 4QREA 3SP1A 3CA8A 4R2LA 4MUKA 4CT0A 1O0CA 3N8HA 1JEDA 1YULA 1N2OA 1GZUA 3HGMA 3H97A 4R2MA 4DJAA 1ZJWA 4OUDB 5DK4A 1ZH6A 3P52A 4G6ZA 5BNZA 1QU2A 5DEOA 4MW0A 1TYDE 1NUQA 4ZCPA 1QNFA 3FY4A 3A04A 5LM3A 3NBKA 1IHOA 1KORA 2QJOA 2Z3VA 4J76A 1I6MA 1X8XA 3FETA 4YMIA 3VGJA 2J07A 2HZ7A 4MAFA 4CDMA 1OWOA 4EG8A 4MW1A 1WXGA 1N1DA 3ND7A 1WJGA 1JIJA 4ZT4A 3RFFA 3A2KA 1YUMA 2GOYA 4NAHA 4MW2A 5TS2A 3KT8A 1J1ZA 1UFVA 1G8GA 4DNXA 2WQ6A 1QQTA 1PG2A 1R6UA 2WB2A 3COWA 4R0NA 3UK2A 3MLBA 2ZUEA 4JZYA 4Q16A 4EG7A 1MAUA 4RPIA 1EJ2A 5TGTA 3X1KA 2WQ7A 4JFAA 5DB4A 2BYTA 3AFHA 4MUGA 2A1TR 3E27A 2ZP1A 3A05A 4KPUA 3FG9A 3CVWA 1CT9A 3UOWA 4F4HA 1U7XA 3UC5A 1I2DA 1K92A 5F23A 2YXNA 1Q15A 2VTBA 4HK4A 4KR9A 3IOEA 1O0BA 1F7UA 4MW5A 3TS1A 1Q19A 5JBNA 1DNPA 1GN8A 2GM3A 1JHDA 2E0IA 2HGZA 2VTBB 2A4MA 2JA2A 4MWBA 2DUMA 3P0IA 4EG3A 3ZGZA 2RD2A 2CYCA 2IP1A 3AL0C 1O97D 4KR6A 4MW4A 3RK0A 3X1MA 5FNZA 3TZEA 1VBMA 1KAQA 2V0GA 1MBZA 2YWBA 3QTTA 3A4IA 1JIIA 2E18A 5EKDA 4AS1A 1R6XA 5HUHA 1IQRA 1O97C 3IVGA 4JXXA 2AKEA 3LOQA 1GTRA 1EE1A 2RE8A 2BTEA 3QE4A 4EFKA 1M8JA 1TFUA 1JMVA 3HL4A 1OWLA 4MVWA 2QUHA 2EJCA 2J4DA 1V47A 1NUPA 2PZAA 4PBRA 1N78A 3F3MA 3CLRD 2HMAA 2X0KA 3CLUD 4U63A 3Q4GA 1IVSA 4YP7A 3GUZA 1KP2A 1XNJA 2B7LA 2DEUA 4MUIA 1JIKA 4JYZA 1U3CA 3IMCA 3CLRC 3G6KA 3AG5A 3CLUC 1QJCA 4A91A 4HPWA 4MW6A 3ZUGA 3TQOA 3IMEA 1KH1A 1XJQA 4WNYA 4EG4A 2WSIA 3LE8A 4TS1A 5H7XA 5K0SA 5LFAA 1KKUA 1K97A 5J58A 3IDFA 3I05A 4ARCA 1IH8A 1H3NA 3KT0A 2VXOA 4I6JA 3OP1A 1XNHA 1J70A 2X1MA 1O6BA 3G59A 4NAUA 2IJGX 1V8FA 3GMIA 2QUKA 2DERA 3IH5A 4XFJA 1M8KA 4PBSA 1KP3A 1OWMA 2A1UA 2QTRA 1GPMA 1LI5A 1T6YA 4ZT6A 3MLAA 4PBTA 1NURA 3FH0A 3CLTC 1HYBA 3DLAA 3BL5A 1P7PA 2XRZA 3NBAA 1H3FA 1Y42X 2A1UB 2A86A 2NSYA 1J1UA 1N77A 4J75A 1M8FA 1MB2A 2PZBA 1IQUA 3CVYA 2ZUFA 1J09A 1QU3A 4MWEA 1N2IA 3RBAA 1MB9A 1N75A 3K32A 2DETA 1WXHA 1ULHA 2E21A 4DDHA 3NV7A 2D54A 3FOCA 3ZJVA 5H16A 2GKSA 4L2IB 4NZPA 1MOPA 4MUFA 4GRIA 1NUSA 3ND6A 4CQNA 1T9GS 5J5AA 1ZH0A 1KQNA 4ZT3A 1H1TA 1FYDA 2CSXA 3TQIA 2QTMA 3ELBA 3COYA 1TYCA 4XFDA 1B6TA 5AHWA 3FNRA 2JANA 3HMQA 4ZT5A 4ZCSA 1NSYA 3M5WA 2Z09A 4Q93A 4DDMA 2O5RA 1PFVA 1WXFA 4U8HA 4YP6A 1A8HA 2DLCX 4ZCTA 3FDXA 3C8ZA 2IELA 1YI8A 1PFUA 1SURA 4MW7A 1JZQA 2OV4A 3U1VA 1I6LA 2XRYA 2PIDA 4ZCRA 3KFLA 5J59A 1N2GA 3COZA 2CYBA 4F3RA 4MUEA 1YIAA 4I6GA 4MVCA 3H9BA 3H99A 2PG3A 3D6VA 4FZJA 4U7JA 3CVXA 3N2YA 2V0CA 5FO1A 3UY4A 2QTNA 1YIDA 3MMXA 2DPLA 3ZJTA 2A1TS 3PNYA 1QRTA 3CVVA 1M8GA 1XNGA 4G5YA 4PY2A 1I6KA 4HJXA 1JECA 4MLPA 1U0BB 4ARIA 2YY5A 4G5FA 3VRHA 2TS1A 3HV0A 3K9WA 4I6EA 2JAXA 1IFXA 2EL7A 3ZXIA 1R6TA 3MXTA 2CYAA 1WY5A 1KH3A 1VLHA 1F7VA 1WQ3A 5LLTA 1ZUNA 1YUNA 3ILVA 4MUNA 5TEWA 4AQ7A 3D6UA 2J08A 5TEVA 4NDAA 1N2HA 3Q10A 5K0TA 4EGAA 5KHAA 1X6VA 1N2EA 4HJRA 1JZSA 4JXZA 5FO0A 1TQ8A 1KAMA 1KR2A 1LW7A 1LI7A 3CVUA 3IMGA 3SYTA 1OBCA 1U7DA 2Z08A 1EUYA 1J21A 3N05A 3CLTD 3AKZA 1O96A 3OTWA 1T9GR 1WKBA 2QUJA 2E89A 3H9CA 3SZGA 2X1LA 5DASA 3PNVA 1H3EA 4XSVA 1OBHA 1GTSA 1O96B 1O5TA 4ZCQA 4KKVA 1D2RA 1OWNA 3SEZA 1VBNA 3DV2A 1N2BA 1G8HA 1NP7A 3IOBA 4MUHA 5KWVA 1EXDA 3TZLA 1K4KA 3IVXA 3RJZA 1OWPA 3SEQA 1PG0A 4EF6A 1NYLA 1WOYA 4KR7A 1F9AA 4ND6A 3HZRA 3COVA 1M8PA 2A7XA 1PFYA 4MVXA 1T6XA 4L2IA 2O8VA 1N3LA 4CDNA 1IRXA 1G59A 4H3SA 1F4LA 2D5BA 2G36A 3ND5A 3Q12A 2CV1A 3DPIA 3G5AA 1T6ZA 1MJHA 4BWVA 1WQ4A 1M1ZA 4MQ6A 1TEZA 2CV0A 1EFVA 2DXIA 2CT8A 2PXHA 3IUBA 1QTQA 2NZ2A 3P0JA 1NI5A 2AZXA 3PXUA 3SZ3A 4NX2A 1EFVB 1JEEA 3ZJUA 3IODA 2PFSA 1IQ0A 2R5WA 1ILEA 3S3TA 3GLVA 4ZT2A 4DLPA 3ISJA 1Q11A 1U3DA 5HUJA 4MUJA 3PRHA 3FI0A 4GU5A 2C5SA 5HG0A 1QRSA 1GAXA 3MUEA 3VU8A 3RK1A 1EUQA 4K0RA 3CLSD 3IOCA 1O94D 4MWDA 4KPUB 4NATA 1JGTA 1G8FA 5KCMA 4MWCA 3FWKA 2QJTA 3X1JA 3QTBA 4E1AA 1TYBE 2AG6A 1PFWA 3CR8A 3L92A 2A88A 2PZ8A 1WXEA 3CLSC 1O94C 5IHXA 4UZEA 1OD6A 3RHSA 1S4MA 2I1LA 1JILA 2OQ2A 4ZT7A 4QBTA 3L93A 3TNJA 1MRZA 4K03A 1N2JA 2CUZA 3JXEA 3LCJA 4EG1A 3P0HA 1Q77A 3IVCA 3AG6A 1WZ2A 3KT3A 2D13A 3N9IA 1KH2A 2H2AA 3INNA 3SDBA 2CFOA 3FIUA 1K4MA 2YWCA 4EG6A 4YBRA 1QRUA 1NUUA 2CV2A 1EFPA 1GLNA 2H29A 1WXIA 3DO8A 1NUTA 3FHJA 3ZIUA 4S1OA 2J5BA 2QUIA 4DE5A 1TYAE 3IUEA 1O95D 4RUKA 1EFPB 1KQOA 3UMVA 4OJMX 4WSOA 4DDKA 2DR2A 1NZJA 3AIIA 1J20A
chains in the Genus database with same CATH superfamily
3T34A 3QPAA 1V0JA 1WU8A 1GITA 1IEQA 2IE0A 1BC5A 4MRMA 5H68A 3RUDA 2W6OA 3K2QA 3SR3A 2OMKA 1KYIA 3WGMA 3V42A 5CLGA 1EGQA 1TUEA 2ESRA 3IXLA 1U3GA 1JQLB 3OI7A 4FQ7A 4L4SA 4PZZA 5JXHA 4IWNA 1HDZA 4O6VA 5KYUB 4GG1A 1P4JA 1W47A 3HFJA 2FTKE 1TE2A 4GR5A 4WN9A 3QVSA 4LYDA 1OVMA 4XQCA 5AKXA 5CBPA 3V55A 2ZRQA 5M2QA 1XVVA 1AURA 1GA6A 4HO1X 3Q8XB 1YB2A 1Z0SA 3BFJA 2FQ1A 1D4OA 3GN2A 1VBKA 5TF0A 3T5MA 1DC4A 4CM9D 3ANLA 4PQFA 2NQ8A 4IXDA 4G01B 1N25A 1SRQA 2D1FA 4C7VA 3TXXA 4HXGA 3UPUA 4NBNA 2QX7A 4B4VA 1GUZA 1YA8A 2V5AA 2PKWA 2K5UA 1EXMA 1EGAA 2WT4A 3KS9A 4MW0A 5FP0A 1Z47A 1FYEA 2HMTA 1T9ZA 3A04A 1PAUA 3FX2A 3NONA 5AOAA 1Y5RA 3ISTA 3S40A 3W3AA 4F2PA 1H4VB 4DQVA 5T7BA 4AMBA 5F2NA 4IIDA 1SQFA 5CLLA 4ETIA 3OEED 3IQWA 2WUFA 2GBLC 2ZRPA 1UC5B 2ZVDA 3GH1A 4BGIA 4GRAA 1KU6A 4TT8A 4BE4A 1YASA 1QQ6A 4MKIA 4DIOA 2JFFA 4CMBA 2COKA 4XLTA 3RS0A 1SUIA 1IUNA 5A71A 2R6DA 3A6GA 4PTLA 1U5BB 3I9OA 3EGDB 4LBWA 4KITB 1IZ0A 1PG2A 3A1EA 3QF4B 5L6LB 4LK2A 5EMKA 4TXHA 2ZIWB 4C4XA 5K3SA 3PPIA 3SK0A 3HEBA 4F04A 3DZHA 2R0QC 2ZUEA 4FSHA 1P1BA 3CEJA 1W87A 2AEJA 2J3MA 4NYMQ 3PEYA 3R0IA 3TL6A 1TU3A 4MO9A 1KL7A 4R1MA 1QFJA 2B0CA 1ZSVA 3ZDRA 3PNOA 3MMSA 3DONA 1C8BA 4B0PA 4CLXA 1SQ5A 3DM5A 3TW8A 3ZGXA 2G88A 2ZATA 1HURA 1CUFA 2HK7A 4EY8A 1WO8A 4Y8VA 3UUEA 1U80A 2PM8A 1MAVA 3CVWA 3AU9A 1X1BA 3NEYA 3OU7A 2IH5A 3E7WA 3B48A 3GRAA 2GXQA 2HU2A 4TUYF 4ZU6X 1CB7A 5JYDA 1T4MA 3ZX5A 1T13A 3PHJA 1FDWA 3IDZA 2XEXA 3L0CA 2B20A 1A9TA 4LYEA 4N39A 3NIFB 4TKLA 4CT5A 4UM9B 1I7NA 3HFRA 3CU5A 5BOSB 2E4YA 5TVGA 3OKCA 3JD2A 3GCWA 3BGSA 4RVOA 4ENPA 5JBNA 1JA0A 2VJAA 4UFPA 4C0HA 3QOFA 2AI3A 4WNAA 1GVHA 1NW6A 2HGZA 1KVUA 2PZMA 3VYTB 1TD9A 2FW6A 3KTFA 3LJKA 4GS5A 4ICIA 3L01A 3P0IA 2DT8A 2ZJ1A 3PDWA 4IDGA 2CCKA 2V7TA 3L6OO 1T8TA 2RD2A 3ZGZA 2CBGA 4NK5A 4D3SA 5B6IA 2IP1A 3IPYA 3RAEC 4ZD6A 1ETUA 1O97D 5CP8A 2IBSA 2DLDA 1PI3A 1SBNE 3K6KA 1F3LA 4G5RA 4N3BA 4CMJA 3DUWA 2ZXFA 1PP4A 1GCIA 2BGMA 3I5MA 2GEKA 2NPFA 2G28A 2QLLA 1W93A 4NPHA 3GK3A 3IT0A 4P4UA 5J2UB 3A4IA 2FH5B 2DF8A 1VL5A 2QTLA 4BO4A 4R1OA 1R6XA 1E2KA 1UT6A 3D3NA 2ANCA 5HFNA 3NT2A 4DPMA 1THMA 4N1AA 2D3WA 1E1DA 3T3OA 4ZP1A 3PG5A 3VTKA 3WB1A 1SHJA 1TKBA 4JMLA 1OI2A 2E4AA 3GFSA 5T3YA 3PTAA 2JLQA 4OH7A 4RGYA 3IFSA 5K6TA 1I5EA 2FPPB 1G3UA 1TFUA 3QLVC 4XYBA 3W1VA 1EINA 1HKHA 1S3FA 3M9LA 1FS6A 3AESB 4HI0E 1E1LA 1NBMA 2EZ8A 2W2LD 4JUBA 1WXXA 4DMUB 4YMLA 1BXRA 5SYAA 1SCNE 2RBEA 4PANA 4OAPA 3NMUF 2QTFA 2XE8A 4UU1A 4AAYA 2YQ5A 4ZRDA 2IEAA 4B4WA 1IVSA 2WF7A 3A2LA 4CMAA 3IKLA 1YJAA 3KHSA 4YP7A 1L8XA 2BDEA 3T9AA 5COQA 2Y6VA 2PRSA 3OZRA 4J3JA 2Z0MA 2BMDA 5CLIA 5GWXA 4WNIA 3GFOA 4GKJB 1EQUA 3GBVA 3ZGOA 1EVZA 1VCMA 2QI9F 1W4RA 4P84A 1SC6A 1SUWA 4MH0R 4RVUA 4YT5A 1EHYA 1JJIA 2I2FA 2QGNA 3OA0A 4LBZA 3RJTA 2BRUC 3IAEA 1HG1A 2YXDA 4GQIA 4NWIA 4RFLA 4XJSA 1OA0A 3T9BA 1N2CB 1HE5A 4RSRA 4BOYA 1AXGA 3IAAA 2DH5A 4L7QA 2WE8A 2AD1A 3ZTWA 5ICSA 5JDIA 2VHXA 2Q45A 2I7CA 3CZ5A 2JD2A 1IEVA 4FIZA 4FT4A 4XCQA 4EJ0A 5GTDA 5J58A 2QAGC 2WJZB 2XGSA 4XVHA 3H0CA 5AMXA 1YHZA 3R24A 1NW4A 2ZULA 3PBKA 3AVTA 1Q1EA 2OYSA 3CNHA 2GAIA 2VCHA 4XIFA 3W2TA 4QGSA 3B82A 5CM8B 5LKAA 1ZQ1A 2C7OA 1N6RA 2B5OA 2XVAA 4ML3A 5CA1A 1EM8B 3KOYA 4QPZA 3SXUB 1R0KA 4CMCA 4RK6A 3TUJC 4BQNA 1FLVA 2HUPA 2NX2A 1YZ3A 3M49A 3WQRA 4E03A 4YAIA 2H65A 1K6EA 1RKUA 2WR8A 1XC7A 3C1OA 3L9WA 5D6OA 3R7NA 1Y5MA 3KD3A 3NAMA 2M6LA 1GQFA 1M73E 2J45A 3JQEA 4WOBA 4LWZA 4PONA 4RQUA 5A5VA 3LDFA 2XNSA 3L6BA 4N5MA 3T0GA 4ALLA 4B7XA 4BX8A 1XTKA 6PFKA 4LV8B 5F5XA 2Q1WA 2JCXA 4F8EA 2PJRA 1N32B 1R0SA 4TS9A 4JKIA 2C5FA 1GKKA 2OGUA 4RIGA 3PFHA 3UHFA 4EVSA 3D43A 2C7BA 4PO9A 2EF1A 4EUKA 1OBVA 5IDXA 3GAMA 3SHFA 2VJCA 3RQSA 3AFMA 2IODA 1P5FA 1FU8A 4C2AA 5TGZA 4YQEA 1AVTA 2ZS8A 4QFMA 3T7KA 3A9SA 2RCYA 1R4NA 2IYZA 5GIOE 1OH6A 4NMHA 3GZTB 2J9RA 3WJ7A 1I36A 2YCBA 4YDRA 3AVPA 1P33A 1TEXA 3DBIA 3LRPA 1VHQA 4MGIR 4J0IA 5EJ6A 4O8CA 3LOUA 3AVUA 1OFVA 1I94B 3L7KA 1CWUA 3C3EA 3CZPA 2EC5A 5IVDA 3HYSA 4BATA 1OH5A 1XJ0A 3LSTA 1IOZA 3ELBA 4LTDA 1OH8A 2JCGA 3J81A 1LDNA 1XR3A 1YI0A 3QVWA 3WGUA 1Q1NA 3K71B 2H1LA 4LN1A 1PTJA 4M1OA 5AHWA 3U31A 3VAYA 3HY6A 1RW4A 3QELB 3QBJA 2QGZA 2IL1A 5DHQA 1B8OA 2DBRA 3VGPA 1AQNA 1YXMA 5C7YA 3OCVA 4LVUA 4L1KA 1AY0A 2RI6A 4QQRA 4AZWA 3QKRB 4N7RA 1UBJS 1ZXBA 3A1FA 5IZ4A 4PWYA 4DNFA 3I76A 4G0UA 1EZ4A 5EOVA 5F7XA 2QMYA 3MD9A 2DCMA 3VC3A 3MAAC 1ODJA 3EVNA 4RFVA 3BIFA 3VU1A 1JZQA 2OV4A 2P5YA 5C1IA 2IH2A 1U7ZA 1V5EA 3LFHA 3MWEB 1KMHB 2IYQA 1JMKC 3KFLA 1OU0A 5SY4A 3MS4A 5FWYB 1N9KA 4PV7A 4B33A 5IFLA 3VI3B 4JXJA 4JC4A 2QTVA 2GJ4A 3HBAA 4FNOA 5JMWA 5ED4A 1SA0A 1DT3A 2VRBA 1QE0A 2AJBA 2RHRA 2YJTD 3MRVA 4MVCA 3E7PA 5F78A 5IMSA 2I5PO 2QP9X 1PS0A 2LGJA 4BFXA 1RI1A 3ZE8A 1JDJA 1KRHA 4HNHA 2WPDA 1RKBA 3REQA 3VDMA 4D8TA 3N2YA 2FZKA 2V0CA 4KMMA 2ACVA 3UY4A 2P35A 4M6WA 4HNAA 1Y1LA 2AB0A 3BXZA 2VBIA 1SIUA 3L6UA 4BB6A 3A9VA 4DNPA 5MN5A 1UZNA 3PNYA 5I7UA 5L3QA 1LBEA 1XIVA 2IYPA 4WBNA 1MTZA 1MGPA 4WZBB 4XPZA 3RFVA 2FSUA 3OOSA 1N1MA 4H7HA 2VAWA 3T4EA 4HSGA 3V2HA 3PUXA 2BJVA 2FMXA 4LGCA 2VSYA 2JFHA 3FNGA 4X5OA 4J2TA 3UF0A 4ZOLA 2DUUA 2OB1A 2I3AA 2SCUA 3BIWA 3ENQA 3BGVA 3VPHA 1QZZA 4BCDA 2OHFA 3WVNA 2F64A 5G4LA 3T4PA 1AM4D 3I9MA 3U7QB 1RXIA 2L17A 4H1TA 4YRSA 1GCOA 3GX1A 2H57A 5HIAA 3JTMA 2C78A 4MA4A 3LMKA 2I33A 1LSOA 2FETA 4PW0A 2P1DA 2P9JA 3D2AA 3WG9A 4CEIB 1J2EA 1XLWA 3HWWA 1RYYA 2ZM5A 2FN9A 2C8JA 1KMMA 1L5NA 4MUNA 3GHHA 4OL0A 4QARA 3WL6A 4B6PA 4P7KA 3OFSA 1GU0A 1N6IA 3L77A 5F21A 3RD5A 2JGNA 2WIAA 1F2VA 3GXBA 2GZHA 2YJ6A 1QQ5A 3CPHA 5AJXA 4CXMA 3HXQA 4NDNE 1L8LA 2P3LA 1R0WA 4KKXB 1M34E 5TNXA 2PUDA 1LI7A 4XYLA 5AI0A 5FWDA 2ZVQX 5JY1A 1Y7TA 3CWQA 1OFTA 3IKVA 4KL8S 2XQFA 1L5LA 2AE2A 3G9XA 1OR8A 4MJXA 1U0FA 2ZSAA 3SX0A 2AN1A 1LVHA 1U2GC 1YZHA 3OPMA 1I7LA 3R5KA 1ILWA 1MO3A 1TVCA 2ES4A 4HMQA 2X1LA 4IR7A 2JGLA 4K2HA 4I50F 1QHEA 4OAQA 2FFRA 2VT6A 4YV1A 4REQA 4RLQA 1UR5A 1UC9A 2I22A 2PH7A 4W63A 5FPSA 5KVQA 1G9XA 3EUAA 1K7EB 3M6AA 1KK0A 5GQSA 3DFKA 1ZHFA 2FP3A 4AC9A 1EK1A 4DR2B 5HE9A 2CUKA 3I83A 1TF7A 4F6LA 1E8DA 4X91A 2PL9A 3WQSB 1KAEA 1LU9A 3CNEA 2Q6IA 3F6SA 4RVCA 1CY7A 1AKTA 3OP4A 1D2GA 2OYCA 4TTSA 3W8FA 5AOCA 3N6VA 3F5DA 1IPFA 1U7PA 4MWOA 5F1PA 4WLOA 1I3KA 2DULA 1E1CA 2VQDA 3MTEA 3NRJA 1AO3A 2QSYA 2JLYA 1XWWA 2D7DA 1E62A 2WICA 5K3OA 1KPGA 3QG5A 5G0UA 2OC4A 3EXG2 3H3XA 1G4HA 3U37A 1WSWA 3OH8A 5AXBA 3P9ZA 4R2JA 2R7AA 3DHVA 1ZEJA 5LYYA 2Q0QA 1A2OA 3ZHCA 2FW0A 3MRSA 4BMZA 1O6GA 3T7IA 4ECEA 3HDTA 2JFYA 3OQMA 3JR7A 1AQLA 4KV7A 1ENOA 4KYUA 1UK6A 3P9QA 5J5VA 5AVSA 3LIIA 4AS3A 5KNBH 5KTMA 5IG2A 3AHHA 1DBRA 1SO8A 3IODA 2PGOA 1WU7A 3KL2A 5HKBA 5JJKA 5TPZD 2J6CA 1IQ0A 1GU7A 2PFSA 2R5WA 3D1LA 3MCTA 3PUZA 3R3VA 3FUCA 1VTKA 1XBTA 3O92A 2PXAA 3AJRA 1U3DA 3GJZA 1YE5A 2R4UA 3RF6A 4EYOA 3LO5A 4YUYA 5JZBA 5C5EA 1NVTA 2XWJI 3UFXB 3F6EX 3D6HA 3RT1A 2IEZA 4FI3C 3G8YA 4BQSA 2MSNA 3LAWA 1Z88A 2CF6A 2FK8A 3B1FA 1ND5A 3N2ZB 1RSZA 3RAJA 3TVDA 5JNVA 2DJIA 3EASA 2ZJFA 4O25A 2BE9A 5JZSA 2WHPA 5LD2B 4MMZB 5LZ7A 4P3PA 1HBJA 2WMOB 2E85A 2BSXA 2J6HA 1XVUA 1ULSA 2H6EA 4R1UA 3ZBPA 4TRMA 4FJ0A 1IOWA 2BE7A 1RWQA 2HDWA 1SBHA 3UBMA 4MUAA 4ZOEA 1GSOA 2JLBA 3C7CB 1WLSA 1P0MA 4R2KA 4M9XA 2XEDA 5KTNA 1UBUS 2G9QA 3AKYA 3MJSA 2OT3B 1MRZA 2E1RA 3K9BA 2VQEB 1QX3A 2FWJA 1PR5A 1AF4A 3C3BA 3VZRA 4MKGA 4P33A 3DE0X 2Q7DA 2MSWA 4BNZA 3FTCA 1JPUA 4TYMA 1QP0A 1MLDA 3FLEA 3N9IA 5HBGA 3FDZB 3INNA 3JYLA 3SDBA 3HLKA 4F0JA 4CNBA 3CSDA 1IAQA 3E9YA 1EZZA 1A5AB 3D6TB 4F85A 5HM6A 5KWEA 2E3JA 1WXIA 2OCGA 4KSCA 4RH0A 1W76A 1IZ8A 5CR9A 5K7SA 3ANTA 1TFRA 2Q5OA 1JXMA 2X4IA 4BVHA 1HE4A 4B6QA 1O95D 2GESA 2QVLA 3K0BA 3OE7D 4F96A 4LF9B 3UMVA 2XLBA 3QMMA 3Q9UA 5DHFA 4YK7A 3V80A 3I1YA 3CCFA 4N5DA 4DDKA 4ZWNA 4EI8A 3EGIA 1SB8A 4MVYA 2QJFA 3OD1A 4CQMA 3QKTA 4AJNA 2E7ZA 2X0FA 3SOPA 1G2OA 2FY8A 2D7JA 2P79A 3PWZA 1I32A 3V8PA 2O5CA 4FOSA 4CIWA 3TO5A 1TD1A 1BFDA 2P67A 3EODA 3OUUA 1Z75A 3QBEA 3CX8A 1XQVA 3NHKA 2VJPA 4E2YA 9ABPA 3DLHA 2BEWA 1ONNA 4IICA 2CZCA 3E35A 2J85A 1YRHA 4TRNA 1FQOA 3DDNA 2I4IA 4KQFA 1MR3F 1FFYA 4EG5A 1QK3A 2MMGA 1TVKA 3A1NA 3MJTA 4O5OA 4A0HA 4JC8A 5E6UB 4Z1MD 5KCZA 2F4NA 2HWXA 1EFKA 4MUKA 3ER8A 5GVRA 1IOLA 4QKQA 4DDTA 4EFMA 4YRTA 1JVSA 3OKPA 4BLSA 2OILA 4Q6BA 4HKTA 3DZ8A 3FFBA 1M2FA 1WZUA 3I28A 3USCS 3PXCX 4E5YA 3WGZA 4OQXA 3L4EA 5ECWA 2AJLI 4AF8A 4DA0A 3MFQA 5EHXA 3U19A 1A7KA 1DPFA 1SQ0A 4RQTA 3T7DA 1KXZA 2BHLA 2FPIA 2GCEA 4DPLA 1I6MA 1IEXA 2FK7A 1MAHA 1XCBA 1Y0BA 2HLPA 3QLUC 3KR2A 1U04A 4PSKA 2VT7A 1S01A 1XZ8A 2V6FA 4MCHA 3ND7A 2ZRJA 4J1TA 4NZYA 4QGFA 3SOZA 5CA0A 3GGOA 3PF9A 1GRVA 2OFXA 4M9SA 1UBEA 1XRQA 1ZCZA 4ND8A 3IPCA 4BYMA 4RACA 5J4VA 3SPXA 2YS6A 4F71A 2MDTA 3SAJA 1E99A 3H2HA 1FNSA 3MILA 5FBLB 4EGJA 3E7FA 4UATA 2ETXA 5KTTA 2WI8A 4UXJA 3S28A 4D02A 1RM4A 2AUMA 1XCPA 4CQLB 5CDFE 2GJAA 3WB9A 2GEVA 3BWXA 4JB2A 1IL0A 1FB5A 1IHUA 4IH1A 4QDUA 4EZEA 3AEKA 1CUUA 2PSEA 3FG9A 4JIGA 4LOIA 3RADC 5J47A 3SGLA 1Z8DA 3BDAA 4N12A 1OTYA 3VJLA 1PZXA 2W22A 1U7XA 5DTJA 4EKDA 1F0YA 4EB8A 4M0LA 4G8BA 5FB3A 5AVUA 1XF1A 1EMDA 3B12A 4ZGWA 2OG1A 1NXPA 3ETEA 2H06A 4ME6A 2C29D 3MS2A 2PX2A 3WMFA 1L5QA 3ZWNA 5AKGA 3THRA 2GTPA 2VJDA 3ABQB 4PZEA 1WV0A 4U2FA 5LQSA 4KXWA 2P9TA 5JCJA 4F4DA 4URUR 1S3IA 1KMQA 3GIWA 4B4UA 2GM3A 1JHDA 2ZK7A 3TSCA 3RVKA 1DJLA 4DUGA 4MWTA 1PBNA 3IBYA 4UDYX 4JCOA 3KEQA 4BNXA 1DRVA 4MWZA 1GFSA 2B8TA 5L3SB 1ZMRA 1P2GA 3PJFA 1HFWA 4WXEA 2R6JA 3D3JA 3K5HA 1XQ6A 1RM0A 3BFVA 3AJ9A 4JB0A 3WK5A 1JE0A 3JQ9C 5JFGA 5K99A 2H2GA 1P5HA 2V4UA 3PHBE 3WNCA 4AX4A 1KAQA 3PVCA 4ETNA 3QKIA 3A6ZA 4P08A 1ZCBA 4PLPA 3ZLVA 2YVUA 2CGEA 2FEOA 1EVYA 3FOWA 4OK5A 2P2SA 5E6SA 3STVA 4F56A 2Q3EA 2HNKA 5CLHA 3BDIA 3IVGA 2F62A 1BEZA 1IJFA 4GQBA 3IUSA 4V1CA 5JPIA 1PNOA 2RHCA 1SC9A 4BFYA 4EGSA 4KXVA 4C2TA 1EM6A 1BJKA 1Q0UA 5K6AC 4I55B 4GMXA 2LPMA 2EJUA 5HCIA 5EIEA 4PSDA 1U8YA 3HUFA 1J00A 4Z3DA 5T64A 5TQJA 3A6DA 1NX6A 4HRVA 1JX6A 1YGPA 4WN3A 1JVBA 3RSQA 1PL6A 4MSUA 2BF4A 4P54A 5AIAA 2Z1NA 4IDDA 3BB3A 2QVBA 3RANA 4HN2A 2B7LA 2ZE8A 1SVSA 3E9MA 1ZCAA 1TDJA 4NZ9A 3BD6A 3TLYA 4CL8A 2B4RO 4ZEVA 2OBNA 1L5YA 3KZKA 4BNIA 4BVLA 1TCAA 3IMCA 4NYIQ 3CLRC 3IELA 1NAIA 3LUKA 4IHJB 1EEXB 3Q7EA 3IA7A 1TAGA 3ICPA 4MV9A 4TV9B 5FOQA 1CQJA 2MU1A 2ZJZA 1F4PA 2VZ0A 3EMBA 3TQOA 4C4PA 1WEKA 2RHMA 3NM6B 1XDSA 1OTHA 4WNYA 4MHTA 1E32A 3CMMA 4U2BA 5KAMA 3RYCA 3JYPA 2ECQA 4ARZA 4U2EA 3A7DA 5EP1A 3KVRA 2IYSA 2ZTMA 3LLUA 2LWIA 3UKOA 3IDFA 4DV0B 3I05A 4XCVA 5KAPA 4S12A 5AVJA 4C14A 3S1AA 3NEJA 3IE0A 3MK31 2FX5A 3EQZA 4MP3A 4BZWA 2R8OA 2OZEA 4HEA6 4J91A 2PQ6A 3SQLA 2N42A 4PSVA 5KYXA 2WWIA 2AFHE 1H69A 2H51A 1U2RA 1X0VA 2WZBA 4C7BA 4UNRA 2J3LA 1G5TA 3WWDA 1P6QA 2VAVA 5LWQA 1ABBA 4MB6A 4FKZA 1J8FA 1XJ5A 2D1SA 2I7XA 1RHRA 2B4QA 3IQZA 3JQBC 2XDAA 5CK5A 4JJKA 4UEWA 1PVDA 1ZSYA 5DCYA 3KYBA 5H3CA 4KE6A 3VR6H 2WSBA 5HK9A 3FKSA 4GWLA 1QYWA 5CFOA 5ICFA 4B8YA 1WB9A 1N4DA 2X6RA 3ER6A 3GAZA 3HB4X 2D1RA 3RQIA 4F38A 1H4SA 3AERA 3Q3IA 1FP6A 4QHYA 4C04A 2W2VA 1Y48E 3DLTA 1ZX1A 3WYGA 4BMYA 1Y42X 3ZVLA 3N6XA 2QD2A 4C22A 4I50A 4JJ8A 3PUHA 4RHYA 2IVFA 1V7CA 1IQUA 3RU3A 2YN0A 3V7NA 1OY1A 1ACMA 1E9VA 4MWEA 2EHDA 3ROTA 1MB9A 4Q4JB 3UAXA 1PJCA 2AW3A 1KHTA 1W0KD 4C08A 4A8JB 4B4KA 1AKYA 2PUHA 1VA5A 3ENZA 1ULHA 1RKVA 4Y1RA 5ANRB 4EWLA 3HB5X 4IJUA 1Y8RB 4UTVA 3G7NA 3L1VA 2ISQA 3AB7A 3I6QA 4HXEB 1AK1A 3FNQA 3ZJVA 4KXXA 3LKDA 3BFPA 1TO1E 3PRJA 2HSEA 2D8AA 5CTAA 3TZHA 2YBEA 4O59O 3PHLA 1ZH0A 3F1KA 3UJ3X 4MR7B 4M76B 1JP7A 2VF5X 4WCDA 1TI7A 2BGUA 3UV7A 2HIAA 4KRYA 2JIQA 3ZCXA 5AVYA 2HA0A 4ZXFA 1D0VA 4IIJB 2C57A 5ALGA 2OBMA 3M1YA 4DRYA 5A4MS 1N6OA 2ADFA 2QPAA 2RHBA 4BS9A 2GFIA 1CFJA 1Z26A 2BCJQ 2GAAA 4Q0MA 4QODA 3QUSA 4FLMA 4ALNA 1BMFA 1MIHA 2HADA 3LCUA 1RAFA 2XCSB 1P0IA 1PFVA 5NLLA 1XMOB 2QD3A 2UUAB 3AM5A 4P32A 4F60A 3BE4A 3Q5GA 5A3JA 3WBJA 3W2EA 4FINA 4ZCTA 2ZROA 1PJ3A 4HGRA 3TR6A 2IELA 3UT5B 3PSAA 2JCSA 4XB6B 5KI6A 1SGWA 4QXQA 2OCPA 3NKFA 4MW7A 4V2IA 5KZMB 5FBVB 3QX7A 7GPBA 4E2XA 1X1QA 1U7HA 3TOXA 2GYUA 2BZSA 4CKCB 3R20A 1PQYA 3OZWA 3H4TA 1YK1A 1BD4A 2PANA 2ZIAA 4IKOA 5IASA 1TF5A 4GXQA 4ENVA 3E5HA 1N57A 4HGPA 2H9IA 2NV6A 4G24A 3RIXA 3TAUA 2CDAA 2CN1A 4ALJA 2DFDA 1RRVA 4WVFA 4ER3A 1YIDA 3JPWA 4HQOA 4Q4CA 1W8IA 2H59A 2ATVA 4YUWA 3OZSA 2IUFA 1JKJA 2RKOA 3DXYA 3OICA 4FMDF 4XUDA 1U02A 2VHCA 3B1JA 4QOGA 1KHHA 2XWPA 1A9SA 4PNZA 2F8LA 3P9IA 1E3IA 4H0NA 3HP4A 1TEVA 3IUJA 3OM0A 1TKCA 4P1ZA 4M0DA 1JQBA 1II8B 1PJ2A 4AUEA 1PJAA 4RK4A 3N7AA 4K86A 2ISSD 1NMEA 4LXXA 3L07A 3DKIA 4OHFA 2QBYB 1D4FA 2YJZA 4YCBA 4HF7A 1EHIA 4MR8A 3R9KA 1ZGZA 1MQAA 5D2CA 2IEGA 1XAJA 3DE1X 3DVAA 2GT1A 1T3LA 4FFVA 1KMCA 4LSGA 1WY5A 1YQXA 4PVDA 4LFCB 3UATA 1GKYA 5D1NA 3FNBA 1VKHA 4PFJA 2NXNA 4NFHA 2OCIA 2Y05A 2CMHA 1P19A 2AZ4A 3LT1A 1C1XA 3P45A 4P38A 4BJ6A 1COWD 5LQJA 2CDCA 3SU8A 1WBDA 5IYZB 4Z0PA 2WD7A 3Q0EA 2ZT5A 3U7RA 3V1MA 3FNHA 5JAHA 1D2AA 3I45A 3IAHA 4QTUB 4N76A 3IC5A 5CFMA 1X6VA 1O57A 4H1UA 4UCQA 3BJEA 4MRMB 1ZP6A 3L8GA 4YECA 5IWCA 1NWCA 4JXZA 2ATIA 1JXAA 1KR2A 3OQ1A 5HE8A 2WVGA 4DCTA 3CVUA 1FYWA 1OBCA 1WUJS 1XZJA 3DTVB 4ZEMA 2CNNA 1Q7CA 1QGAA 2EGUA 2Y77A 3GLQA 4Y6GB 5CVDA 4LOLA 4ZI5A 5DGDA 5HF9A 1E79D 3K6JA 4L78A 2LCQA 5CLQA 2X0IA 3U3RA 3KSRA 1FXUA 2A33A 3UXYA 1WMBA 1ABFA 3L1UA 3WV5A 4D80A 1W4BA 4H16A 4HWPA 4AI6A 1D2RA 1OWNA 4C7JA 2NUPA 3ACBA 3KQUA 3HBNA 3H0EA 3N2GA 3DUFB 1ZEMA 1LBQA 1Q6YA 2DHDA 3ROGA 5K8TA 3G0GA 1MX1A 3SR4A 2F59A 4P5PA 4X94A 8ADHA 3LQ4A 2EIHA 6Q21A 1CJMA 3LIPA 1T2AA 3KWJA 4XX1A 2JVKA 3DLIA 4GZ5A 1T6XA 4QDXA 2Y4NA 2EAUA 2BP7B 2RB5A 4YI5A 4URXR 5L53A 1SU7A 2C2OA 3DMGA 3H42B 5B3JA 4A6DA 3D5QA 5CFQA 2AG8A 5I7VA 2WWTA 4LNAA 1Y8CA 2D0DA 4R9RA 4ZVKA 4C4YA 1N1EA 3EGCA 4HXYA 3SKYA 4C0QC 2GBLA 2RGEA 4HQNA 1THZA 4HLDA 621PA 5L8VA 5JZ9A 3HDGA 1TEZA 2APJA 2H4FA 4RU1A 4URWR 3UM9A 3LLMA 1K0UA 2NAPA 1JNYA 3QEBZ 5L4NA 1NDUA 2GPTA 3QKSA 1DRUA 3BT7A 5EQDA 3P0JA 1SG9A 4TYWA 1RACA 3CYFA 4KQEA 3Q87B 5AK0A 5C8YB 1UMBB 2IV2X 2R6ZA 3PNMA 3C16C 4PX9A 5EYPA 4DMRA 2R85A 5GOZA 3ZX4A 2FPSA 2G1JA 2DECA 5EZSA 4RDCA 5LMNB 1KY5A 5JCPA 3IEIA 2WHEA 3HRKA 1C3OA 3PSHA 4V0NA 4NBKA 1X38A 1B2RA 1DWOA 3OTQA 4CNQA 5B64A 1PL8A 3QPCA 5JCXA 4L15A 4NMWA 5EJFA 3UA3A 1HZJA 2XKKA 1YS1X 5A3SA 4YGYA 1RRMA 2ZSBA 4FI3F 1JHQA 5KO2A 3HSYA 3H86A 1ZOIA 1XZBA 1ZC3A 4NNJA 1E7MA 1UK7A 1RQ2A 2RONA 4Q02A 2WYIA 1LV7A 3EG5A 5FWNA 1H0KA 1TA9A 1GZSA 1BN7A 1N3YA 2PZGA 4IXNA 1T0HB 1WP4A 4BE7B 2FMTA 5J2UA 5KMGA 2OB2A 3O4HA 1B00A 1FSGA 3DMPA 3DVLA 1SWWA 3R0VA 1IVNA 4LA4A 2O52A 3RSZA 3ZCVA 4GX0A 1E3MA 5FPPA 2BM9A 2FYTA 4QE3A 5AJUA 3HXLA 2NPOA 5CB4B 3WGGA 2OQ2A 2BFBB 4ESVA 4ARVA 2J9FA 4MQEA 4PQGA 2P2ZA 1Q84A 2JBHA 1ZIDA 2KSQA 1U3TA 3L93A 5LDGA 3GJ7A 2OO3A 1S89A 3OFJA 1XLTA 1P5ZB 3PD7A 2AQHA 4D81A 2MYPA 2G7ZA 2L69A 4JQZA 2H2AA 4O2BA 4WLUA 4JK3A 2UVPB 1GPWB 3FIUA 3F8WA 1VLQA 2YHBA 1JH9A 3MPUA 3WLOA 4ZV7A 1UXHA 4QX6A 2PBRA 1DIAA 2D1QA 2V45A 3FVWA 3I23A 4RM2A 1XYGA 4A6XA 3OT1A 4ILEA 1MO6A 4O4LF 4UVGA 3R76A 3S2GA 4M0CA 3UHPA 4ZREA 2IWHA 1GYQA 4PNEA 4O2LA 2QDXA 3A4MA 3MJDA 1TM3E 3EUEA 4Z6KA 4FJ1A 5IK2A 5I6DA 2VJYA 2DKOA 4GMHA 2V6IA 5JNLA 3HCNA 3LX5A 1UDAA 3PGLA 4NCIA 3O9MA 4J3NA 5HZKA 4RZHA 1WM1A 5F9HA 3VNRA 3VPCA 1Z63A 4CLEA 4K40A 1V6CA 2OGSA 1GQ2A 4P2BA 4LJ5A 3UWMA 4JKOA 1E3WA 3T54A 3UMJA 4JI0B 1Z29A 4E1VA 3QHAA 1BXGA 1XCMA 2H52A 2IFTA 3M2TA 1W0CA 4ETMA 1CYDA 2XMQA 3IP5A 4JBXA 4U2DA 5BMOA 3NPMA 4W6QA 2X6QA 4QYIB 3T94A 3MQ2A 1CKEA 2FW7A 4KBFA 4J7CA 3U0BA 4YP5A 5I7OA 3L1IA 4MVJH 3N8GA 4RIHA 4UPVA 3WLHA 5BR7A 4IV0A 1LSJA 3SP1A 3U3JA 1GUFA 2C9CA 2AG1A 1HE1C 4WW0A 1O0CA 1KDOA 3KZCA 1JR3E 1AO0A 1NI3A 3LYHA 2WB4A 3TRIA 5FAXA 1ZJWA 1NXXA 2GNOA 1Q1ZA 1TCUA 1XZQA 3N2EA 1F0NA 2BSQA 4LIPD 1QU2A 1S1MA 1FLDA 4Z4IA 5AW3A 1NUQA 3PPWA 2IYVA 5FRDA 5AW9A 1DEHA 1H2XA 2HCTA 2NN3C 4DOMA 4AO8A 2DPXA 1UWLA 4PVCA 1LNZA 1Z2PX 4KDRA 3NWPA 4NNPA 2G3YA 2QG4A 2F1KA 1W96A 3QNMA 3WI7A 3AF3A 5KNDD 4UHEA 3HUDA 4MAFA 2G77B 1F3OA 3RU2A 1YCFA 1VCHA 4KRXA 5L9AA 2IS6A 1DRJA 5JDCC 3UHOA 2I6FA 2TECE 2VHVA 4IIGA 4IIHA 2VYNA 5CA1B 2XZPA 3A2KA 3LF2A 4GDMA 3NIGB 4MGHA 2PL1A 4RGVA 4GT1A 5C80A 2PUGA 2X5OA 3WOHA 4TVSA 1KJJA 1RBQA 4ROTA 2G1PA 2B5VA 3G5MA 3BREA 3MLBA 4DIMA 3AM1A 1DP4A 4GF5A 4DB2A 4MB0A 5CDHA 3T3HA 2HMWA 2GN0A 3EYAA 4N18A 2OCBA 5B55A 2PNJA 4UHHA 2IYYA 2PMBA 2D2IA 1EJ2A 1KIFA 4GR9A 2F1JA 1U0RA 2VPPA 1S2OA 3MBKA 4IYJA 5DB4A 5DI3A 4KQIA 5D8DA 2RC6A 2H31A 1NVXQ 2GBCA 3FXAA 3G68A 1JTFA 2C4VA 3FPLA 1I2ZA 3Q2KA 4ZO7A 4EW1A 3GI1A 3TZQA 1KSFX 1IZZA 3IP8A 3K0CC 3CISA 4Q19A 3CKYA 3ID6C 4JLNA 4ZRMA 1SBQA 4FNAA 4IZOA 2A1IA 3IT3A 3KKQA 1VPVA 4ZGGA 4EVRA 1EXNA 1XZPA 1UPFA 4AW9A 3B70A 2AH5A 5H0IA 4G0WA 3B3QA 3O7WA 4RJ2A 1GAQA 1WCXA 2JC3A 1U4NA 3WBFA 3EZ7A 3EFOB 1ZH8A 5IAJA 5K0NA 4DIUA 3D3EA 1RVDA 4U7WA 1RZUA 1PWEA 2BMJA 1QE5A 4KZPA 4J0JA 5B1HA 2GCIA 1SIWA 5JG7A 5LQRA 1JIVA 1L7EA 4F91B 3CRMA 5HJEA 4IFBA 2XMZA 3MYRA 5FNZA 1Q14A 2UZIR 3DEYX 1PQ4A 2QRZA 1V7ZA 4WXYB 3VU9A 4WXRA 4M8SA 1WUHS 2VP9A 1P7WA 3IE2A 4DSAA 3OLXA 4YLGA 4Y2XA 4JOBA 5EXPA 4OIFA 4AS1A 4DKXA 4OY3A 4YAWA 4Y0NA 4Q3EA 3V7YA 3I6ZA 3SVZA 2YASA 3JYQA 4RK0A 1ZVQA 1GKLA 3C5WP 3EAQA 3YASA 4D9GA 4F4CA 5FTLA 2W6ID 1AOXA 3AINA 3ON5A 4I14A 5I7EA 4M9RA 2LCIA 3L06A 1Q6ZA 2AJCA 4U7TB 3TIVA 4B47A 1N0HA 3UJPA 1SA0B 2O1EA 2Q27A 2QL6A 3CXRA 4NFSA 3RKRA 4TGLA 3AIMA 2G76A 4KE8A 3RYIA 4I3HA 2QUHA 2PZAA 3QITA 3HU3A 2VYQA 2P3SA 5JSZA 1VL0A 1UXJA 2R1VA 3CLUD 2AEFA 3K94A 4J0DA 1L5RA 1QORA 2JZCA 2QRQA 2HCFA 2Q2VA 4OV6B 3HKBA 3GUZA 4R41A 1XNJA 3H7AA 3QX3A 5C8VA 3L8FA 3JQGB 1W1IA 1CPYA 2IZ0A 1Z2OX 3OZBA 1XN4A 5JNUA 4AM8A 3GOQA 5I5GA 3BM5A 4YQYA 1JBKA 3B3AA 4XVRA 1BW9B 4BO3A 1E2BA 1Q7TA 2BV3A 4IMPA 4RJLA 1HDIA 4HB4A 3ICQB 1KH1A 3PWSA 3NS7A 4TMFA 1VMIA 1HM5A 2KYRA 2CLSA 2VP3A 1DO2A 1OJ7A 5LFAA 3AFGA 4N8EA 5AXAA 2IHYA 4E13A 3E05A 5EWMB 3BXPA 3PUIA 3D0OA 5FR1A 3RNOA 3GYGA 4B6GA 2AXQA 5FYDA 4L8LA 1D2NA 3CEAA 3L82B 2ZSHA 1L4MA 2QVXX 4UC0A 4QJ5A 3K6SA 4I5IA 4AD8A 4IOMA 1GL3A 1LFAA 3JPYA 2OGZA 5EL0A 5JO9A 1UAGA 3LCRA 3U61B 2XE7A 1F8XA 3C48A 3HJUA 1QH9A 4G8DA 5A04A 5I9TA 1G63A 1Z7GA 5B5SA 5PGMA 1G42A 4MDYA 4ALKA 3BN3A 3I1JA 4K9SA 1XZDA 2FOLA 5E1MA 3UTCA 1GGNA 3JQAD 1IBMB 2TRSB 1C0IA 1IG3A 1G8PA 1KAHA 1OAOC 2F1HA 4ZT6A 5HTKA 3KYCB 2D5CA 4AB1A 3TLGB 2XQJA 1IWOA 1HYBA 2PSFA 4OB7A 1MEEA 4CEJA 4UAJA 4LX0A 1I9GA 4A2WA 2C5AA 2IOFA 1CY8A 3NRBA 3FOEC 5G1PA 4R51A 4J75A 3JRXA 2R9VA 4KB5A 1Y34E 1W2WB 2PH3A 2C2BA 2WM9B 4U5XA 4X71A 3VAAA 3W2HA 1D2EA 4L0DA 1XKXA 4JVMA 3TVTA 3TLAA 5IABA 4DLWA 2BR4A 2OQRA 2QIPA 2F3SA 5C4MA 2GYWA 2HZBA 2NUAB 3U7JA 3L6EA 4YUZA 1XZGA 2WIGA 2CL0X 2FW1A 4J94A 2ZAMA 3GFVA 2BKVA 2KQUA 1CRZA 1MVNA 1ZD2P 3OCYA 1H66A 1P61B 1ZYUA 3MEQA 5TS3A 1E1CB 5ELLA 4F2GA 4GRIA 1AH2A 2PUWA 3K4PA 4TT3A 1MT3A 3A9TA 4UCFA 4CW7A 4MUXA 4EYEA 2YIMA 5AKHA 3IBFA 2RGRA 1WDLA 4RD2A 4B74A 2H5LA 2QXYA 1UEIA 4UVEA 2AG5A 1IN8A 1YFZA 4BB5A 1KETA 3MHPA 3CEHA 4HDMB 3X1XA 1L3IA 2NO0A 1ZAKA 2Y1GA 3AV0B 5ESRA 3RVJA 3AR8A 3OEYA 4OLAA 3HXPA 1UXGA 2GWRA 3L18A 1U1FA 2Q21A 5TMDA 3NPAA 1TM4E 1NF9A 2H2WA 3V9PA 1ES9A 1E98A 5IHPA 5FTNA 1G18A 2CSUA 5F4ZA 4TM8A 3T1VA 3KQMA 4EL0A 2WJPA 4RSGA 1P1KA 2W2KA 3FDXA 4GSKA 2PCJA 1UF9A 4N8DA 1V5IA 3TOCA 3WMWA 1P2VA 1Q5PA 2XNCA 4IUYA 3L7BA 3TKYA 4NIMA 1UEXC 4F4FA 2ZSIA 2FPLA 2RFLA 3GARA 1FS5A 4EECA 5JS2A 5IDVA 1I33A 4JJIA 1BMTA 2P0AA 4X84A 2Y3IA 3FTDA 3NP7A 3ROPA 2GD0A 3F3SA 5G4KA 1YIAA 1QRAA 4EKGA 5IDQA 1CHDA 2N1MA 4ENRA 4YQFA 2GN1A 3VNQA 5G3ZA 3S70A 3H99A 1XRSB 4MLDA 4ZI7F 1L5FA 2QTWB 3GEIA 2FSHA 2J3DA 1IUPA 1J0CA 4LAFA 1M67A 1BMDA 1AKQA 2AK3A 3VKVA 3WTCA 3DQPA 1NIPA 3I42A 1ISMA 5DLYA 3WJ2A 4AF7A 4G0QA 2YXLA 5DTRA 1E1KA 1SK8A 3X43A 3C3XA 3N8DA 4YJ2B 1BVUA 1GADO 2PYZA 4QEDA 4EKNB 2Z43A 3LCCA 3WQBA 5K0EA 1B8VA 4QOIA 4L5AA 1R8XA 3QLTA 2RC5A 1ZN7A 3SE7A 3GRYA 5CD1A 4M9QA 4XIYA 1QGOA 4R2HA 5JZVA 3UMGA 3OQIB 1DTSA 3AXSA 3G9QA 2TS1A 4Q3AA 4S1NA 4KAFA 5DCWA 4V3CA 3VRHA 1Y7HA 2I80A 2EJVA 2ZVPX 2DFVA 2G5CA 3IP3A 3O0DA 5FLKA 3H5RA 3R7WA 1L5VA 2IW1A 2X77A 3CJRA 4FSDA 4XGKA 4XTCS 3JQ7B 3QVOA 3S1SA 3AF2A 4ZARA 1Z2EA 3AUFA 2JEYA 3B6ZA 1DUVG 4C0LA 4UNQA 5H82A 4HRAA 3WRXA 4O4LA 1NQTA 2LDBA 3WNZA 3EH1A 2FWRA 1R27A 5IUNC 4GI3A 2ZJ4A 2YV4A 5I45A 1YUNA 3CT6A 4Q7KA 1CZNA 3UQZA 5A9TA 5IJ0B 2IYOA 5F1KA 4V38A 4AY5A 3ABIA 1SXPA 2ZRGA 2YKGA 3OY7A 1ZVMA 1JEYA 4CCYB 1IB6A 3NJ8A 4HRYA 4XH9B 3B5JA 4AUNA 1Y6GA 1L9XA 1VM6A 2D5IA 2QMUA 3GMTA 5FV7A 3PE4A 4V0QA 1JJAA 4Z4HA 2WTUA 2XNDA 2VAPA 1RXCA 3CX7A 4YX9A 2WAYA 4GFDA 2ZBUA 2Z08A 3P97A 4QDOA 1YR9A 3HGTA 2NXEA 1SHTX 1GVNB 5E4YA 4Y67A 4FFRA 1AS2A 2C5BA 1WKBA 2HSGA 1QDEA 3VKHA 5TPWA 3UCEA 1I4TD 2WWYA 2NVUA 4GKBA 1J9ZA 1YZVA 1Y9JA 3OF2A 5BO5A 3O83A 4BBJA 5CNIA 3L3BA 4E6PA 4Q9IA 1DZIA 3TOZA 3AOEC 1YC2A 4HLQB 4Y1EA 4KKVA 4LZZA 4HAOA 4X8HA 1G8HA 2C0CA 2G67A 4HAIA 5HMMA 4MUHA 5B1SA 1RQRA 1F6WA 3CUUA 4EP1A 4S1VA 1J06A 1PG0A 4BE9A 1KVRA 1BVYF 4CIBA 3BRQA 4ND6A 3EDOA 2Q6VA 3F5SA 3COVA 3HA5A 1SZCA 3M4YA 3QY9A 4G0MA 4HLCA 4Z4FA 5C5CA 3TD6A 3ZOKA 1Z5WA 1HI9A 1TZBA 2G9VA 4IQ8A 1ZONA 1H2WA 2GTHA 2IHVA 3KAJA 1ZIXA 2W0SA 1UQTA 2ZS9A 1GZ5A 4KV9A 3TR5A 4PLFA 4F2DA 5CBKA 1O2DA 2P1ZA 2PN1A 3FYUA 4MVJI 1QJ4A 1T6ZA 3C8UA 2OFPA 3CX3A 3LPNA 4OHWA 4CEHA 2RHGB 1WQ4A 1XEFA 1R18A 1QC5A 3HEAA 3QLUA 2LE0A 4R8VA 4W6ZA 5CT9A 3D6JA 5JWOA 4WI1A 3LUCA 2XMDA 4QOSA 4Q1CA 3VPGA 3S2SA 4DR7B 5ABPA 3DAFA 1KQGA 1TO2E 5IM4A 1X9HA 2K2WA 3EWSA 2JLAA 1G19A 3A7EA 4YPFA 3PFFA 4ND8B 3TIFA 4N7MA 2JJ1D 4DWVA 2NZWA 3AV3A 3O26A 3HLTA 2WUEA 4L3WA 3P96A 3W1WA 3KPWA 5BSTA 1AJEA 3OCZA 2Z04A 4ZT2A 1KJWA 4KMOA 5AM0A 1IY2A 3VISA 3ZKAA 2L19A 4CMEC 5JSFA 1EBBA 3JD0A 4GU5A 1ZOOA 4OBEA 2IRWA 1QR6A 1M2NA 3I2GA 3P9KA 4W1RA 4KN5A 3G0HA 4JLAA 5DYIA 1AKVA 2R1UA 3CLSD 2FZCA 2QMHA 4AWBA 2R44A 4GZ3A 3TKAA 4OHOA 1PEAA 4EJSB 5I7RA 2CXQA 3EOBI 3B2NA 3DGEC 4WEQA 1SCUB 2PLAA 4AO6A 3V9AA 4FP9A 2GZSA 4MS4B 4KH1A 1Z6PA 2A88A 2R68A 3C24A 3P2IA 4K9PA 4KVGA 2Q3HA 1N4AA 4YRRA 1T1IA 4LJ4A 3HB9A 4YLEA 3ZDZB 5CYPA 1XLUA 4A0SA 3GJQA 1NRXA 4RZXA 5HRAA 3ASUA 4DYVA 1JVNA 2DWQA 5B6JA 3WYAA 2IDJA 2HU8A 1JILA 3KWMA 1T1JA 2ZBRA 3FPSA 3NBXX 3B3GA 4C5BA 4QM7A 3VXKA 5K2OA 1ULAA 1Z6QA 1C1HA 2Q3LA 2ZSDA 1R3DA 3VHQA 3HXMA 4MVJF 4QU9A 1GLVA 5B3KA 3FN4A 2BZGA 1E63A 2GPBA 2R6AA 3ETCA 3I5UA 3HJBA 4GBJA 1Z25A 4YACA 1TIPA 1V3TA 3GVIA 3M4XA 4LTNA 1B7GO 3DCNA 1SKUA 3ZDFA 4BVBA 1IVYA 1JHOA 2JD1A 3L0IB 5ILQA 1O3YA 3ZJ5A 1MT0A 1Z4QA 4EHBA 1L5WA 3KJHA 5HJ7A 2H29A 5HKKA 4U7FA 2BLLA 1G7RA 2II6A 1P0FA 5E7IA 1ZU4A 4ZJPA 1Z0FA 1PJLA 3U48A 4YIKA 5E6SB 1NMQA 2CBXA 1M66A 3IUEA 2ZDHA 3DO6A 3Q3JB 1AD2A 3IQDB 1J2JA 4HP8A 1O89A 2P27A 3JV7A 4BQFA 1YB7A 2VPYA 5MFPA 4V1CB 2TMYA 1CE8A 4BP9A 3TUZC 3SC4A 4ZU3A 2R60A 1CLEA 4KLZA 2M6KA 3MMNA 4M0EA 3B5EA 2WWFA 2F8MA 3Q7SA 2B8EA 4YONB 1JG3A 3P0FA 1D6NA 3T12A 3OT4A 3TI7A 2DFTA 4F5DA 1JDPA 2XMRA 2F48A 1Z0JA 3FOAA 1YUBA 4JKYA 2B61A 3D8RA 4BLQA 2G82A 4G4SP 1XO1A 2Z4RA 2O3SA 2UVQA 3GVHA 4KO4S 2X2FA 4DCCA 2FVYA 5EP2A 2RHDA 1TKAA 3WAKA 2NO4A 4GXNA 2WQ6A 3VH4A 5MFZA 4IVNA 5DHRA 1H6DA 4HH4A 4WA7A 3HBMA 3STWA 3T0FA 1S3SA 2WF5A 5EKSA 1WE2A 1XRPA 3HN2A 5H81A 3SS8A 4R0MA 4R2LA 1UMDB 5K3BA 3BWEA 2BJHA 3N8HA 3ZD9A 3ZV6A 3DKRA 1SBZA 1AQUA 1Q0ZA 3H97A 3NRCA 3OFVA 3GAFA 1JF8A 4MUYA 3PQ3A 4X6YA 1I01A 2C92A 2XODA 3EVCA 4N7BA 1CQJB 1LX6A 4F9GA 5FA5A 1LKZA 2A78A 2P1RA 1SHUX 3DTYA 3M8KA 1RJGA 3FY4A 1HFEL 1X1RA 1N5MA 1WIWA 1I80A 3RYCB 3K8ZA 1EE9A 4RJTA 4CL3A 1HDOA 3DOCA 1IPHA 3U81A 2B35A 2XD4A 4J76A 1KFKB 4KDEA 5FOUA 3ZVKA 1H8EA 3C39A 2IT1A 2XQKA 4K6HA 1KK3A 3CURA 5HBRA 2B1IA 4CDMA 2PYIA 4EG8A 4B40A 2A8YA 1NBME 3AY6A 1PYOA 3HCFA 2Q0HA 1L8OA 1UIRA 5F52A 2B1JA 3NU1A 3GGJA 3V4ZA 1Z34A 1FYVA 2QL5A 1I30A 1CUSA 2ZJ0A 3CE6A 4NS4A 5J4YA 1KYTA 1C0PA 1XA0A 4GVXA 1LS1A 3DMTC 4ZYUA 3C2QA 2A5FA 3T38A 1DJMA 3CRW1 1PKEA 1NY6A 3S8EA 1QPBA 1MRSA 1YZYA 2Q3CA 2VQFB 4DREA 3OOWA 5K3EA 1V1JA 5EP4A 4OQ4A 4KEAA 2P2NA 2XSZA 3DSRA 3VV2A 1EFHA 3I6IA 4EOGA 4TZ0A 3BFKA 1WD5A 4M38A 3RYHA 1L5SA 3HCCA 3EIEA 3EPJA 4YJFB 1ZA1A 16PKA 1P9WA 2AZTA 4DM4A 4AROA 3HYLA 5CLFA 3GLKA 4KPUA 1M2HA 2SECE 3KAKA 2QJRA 3OE5A 4MTLA 4B0OA 4C0KA 1REQB 3CIOA 3PNKA 5EQJB 3W5BA 2PGAA 2IU4A 4EBFA 3GNTA 1SCKA 3H2KA 4M7WA 3RS9A 3H9QA 2A4KA 3PFNA 1GTG1 2P9ZA 5EIXA 4YCAA 1FS4A 2P9BA 2RHHA 3L7CA 2GCNA 2VUUA 4BNNA 3RTCA 5FPYA 2P77A 2WF9A 3QXHA 3PKJA 1CY6A 3RROA 1U1IA 4Z0NA 3TB6A 1EDOA 3GLTA 4KO8A 4O4JB 3R0QA 3C5HA 1N3BA 3QGMA 2A94A 3O47A 4AZ0A 1BCSA 4YCCA 4A8PA 4W5OA 3TXYA 2XJ4A 3N1UA 3JWEA 4RJJA 3P9PA 3B7GA 3PJDA 3OX1A 2DUMA 5FOXA 4MK4A 3LU1A 2H7YA 4MIEA 1G17A 4KUGA 4MI9A 3P19A 2XVXA 2I0FA 3PEEA 3ZZ0A 4QUBA 1DQRA 3EGXB 3UT6A 1B0UA 1VZ3A 2YWXA 2FPRA 4KPGA 3TOSA 1FIUA 3HPRA 3ZXXA 1B1AA 4K6FA 3OQBA 3UANA 3NB0A 4ESHA 1GT91 1E18A 1GSIA 1VBMA 1YKFA 1EFRA 3SZOA 2PL5A 1MW9X 1X39A 3IJ5A 1OIXA 3COPA 2WTBA 5HZGA 1Y4DE 1E61A 2UXBB 3O4RA 3NBFA 1P6UA 2IYWA 1RC0A 2OC9A 3NIWA 4IVRA 2HKIA 4RC9A 2WYHA 3GG2A 4IV5A 4J6EA 4FE4A 4OHUA 4F21A 4JP8A 2AKEA 1VI2A 2PA0A 2GRJA 3PITA 2LKDA 1Q95A 3PFKA 5SZHB 2XMCA 3EZLA 3OU6A 4IIVA 3DDCA 4LJ8A 2DWUA 3QEKA 3SJAA 2Q0SA 3O73A 3M3DA 1JHMA 2YX1A 1I1NA 1T29A 3FCSB 2XAUA 1Z2CA 3QEMB 2O2XA 4OJTA 4OSEA 4CFZA 5HQ3B 1VKJA 2FWAA 5D01A 4OBXA 1Y9DA 3SSAA 4FFPA 3RC2A 1ECJA 1ODSA 3DULA 4KAAA 5GIPE 1NUPA 1NI4A 3CW9A 5AVOA 5IXYA 1U0HC 3F7NA 2Y1KA 4MQFA 5KSPA 1XX6A 2FRDA 4OOEA 1TW2A 4YYEA 3BJRA 1EYZA 3Q4GA 2BBOA 2H1VA 1CNMA 3A4LA 3GV0A 3NQ41 3FLAA 5G0SA 1DTWA 1OXXK 3H3FA 2C9OA 3WK9A 1TMKA 3TK1A 1SIOA 2VC2B 4O1MA 1KEEA 1TB4A 3F9CA 4QHSA 3AUYA 3W5JA 5EIBC 3O38A 3JCZA 4MW6A 3HXTA 2YN2A 2FHSA 1NKSA 4EH1A 1R4ZA 4GXTA 1FDUA 4KXUA 4Y0AA 4YA6A 2JH8A 5EY5B 3DMYA 2Y0BA 3AOGA 3O74A 5H7XA 1DAOA 1GUBA 2JHPA 2QTHA 4URZR 1DJOA 2COUA 4X63A 1VP3A 1E3LA 2IV3A 1USGA 1T10A 3RRYA 3T1YB 3D59A 1C1XB 4WE3A 1H3NA 5IULC 3ZR4B 4H1WA 3KT0A 2FUNB 3S99A 5DM1A 1XTUA 4R3NA 1FNNA 1ESEA 2A59A 3GMIA 4I8IA 4PR0A 4RTNA 4BJHB 2GCGA 2OUIA 3G2KA 1K5HA 1ULTA 3WSWA 4BVAA 1Z74A 4PG4A 3WRWA 2O1SA 2GLTA 4JVLA 3ABRB 2R65A 5HGJA 1KYQA 2GRUA 4D26A 3CNNA 2JI8A 1EX7A 1QHHA 1X0XA 2J5RA 1K7FB 3CTMA 1T5TA 5FNVB 4PBTA 4H77A 5KVCA 4TWIA 1WLYA 4M49A 1LWNA 3DDSA 4QGBA 3T0IA 1Q7BA 3GLIA 1HA3A 1E2HA 3BL5A 3ZWPA 1H3FA 1OGJA 2BONA 3ED1A 3R0ZA 4RW0A 1M5UA 1HUQA 4IIYA 3LFTA 5I3CA 4PYRA 4F5WA 3NT5A 2D06A 2GN8A 2WP0A 3KL4A 2RHTA 2XD9A 1M7BA 1XQWA 1Q3HA 1RPJA 3CT4A 4J0QA 4S2UA 1R0RE 4UD6A 2CNWA 1EXWA 5KNCD 4RA9B 3RBAA 3HU1A 4KK3A 4AKTA 1Z7EA 4EKIA 4ZICA 2PE5A 3NIDB 3WIOA 2JGRA 2FZ5A 1WDWB 4JI4B 2OLEA 3KJNA 4V0SA 5EEHA 1PUJA 5G02A 2NOAA 2RHJA 1TQ2A 3E3OA 3UXHA 2WWRA 1AHHA 4WK0B 5IT9A 2D7CA 1NNLA 4RPGA 1RABA 2W2QA 3WY9A 1QIJA 3TSAA 3ECCA 3QTLA 5IRCD 1P45A 1H1TA 2QD5A 5JS8A 1IK6A 2OTCA 3L8ZA 3TQIA 3G2JA 3RU7A 2QTMA 3M6VA 4E09A 5ICMA 2Q0XA 3COYA 1TYCA 2OXFA 5ERXA 1BYIA 1JSZA 1RE1A 2RGNA 2ZI9A 3FKJA 4ZT5A 4PHFA 3K4QA 2V58A 1PD0A 3F47A 1QIGA 2M2IA 3I92A 3QKSB 3K0EA 2VYVD 5AHOA 5IJ9B 1JFVA 3BFXA 2VUTA 1JNXX 5JCOA 4CM4A 5JECA 1NW3A 3CZ4A 3IT1A 2I2BA 4N9WA 4WACA 5CXQA 4QECA 1YBMA 2BGKA 1MO5A 1KBQA 1UC8A 3HDVA 5MDHA 1E9CA 1OF1A 1W85B 1E0AA 3AL2A 2QMOA 4ZVUA 3C8ZA 3OPQA 3QFFA 2QSJA 2V9ZA 3DZBA 4RF5A 3PYXA 1H4QA 3BXFA 2WJAA 1D5WA 3LLCA 2WD9A 3R3XA 4TLAA 3CF6R 3UIEA 2PQMA 4FW9A 2FN4A 1NYQA 2V1XA 3NUQA 3G2OA 4D97A 5A6VA 1NUAA 3JAKB 1YE8A 2UU9B 1YRWA 2DBQA 2N0SA 2R00A 1G8YA 4DSZA 5HDQA 1CZLA 4MUEA 2AHRA 4I6GA 1PQWA 3URMA 4ZYLA 1M1UA 3GFBA 5FWXB 2O8DB 5D84A 3VDXA 3D6VA 3CVXA 2QSUA 3E8XA 1DKNA 4U6QA 1NXOA 5JS6A 5TGDA 3ETNA 4EAQA 1V1MA 4E4RA 2BUCA 2IBMA 4OK3A 1JU9A 1LGYA 1CJKC 2C98A 2X1VA 2EFEB 3FWPA 4LE0A 1BH2A 3LYUA 4KR0A 3H8SA 4ZV4A 2A1TS 5FA6A 4ED9A 4WH0A 1JKFA 1XKTA 4BRWA 5I9SA 5AVXA 1GG2A 1M8GA 2GVZC 1OQAA 1SCAA 1XNGA 3I9FA 4G5YA 5DRYA 4L95C 4R01A 4QZVA 4K3VA 1T2FA 2AE1A 2IXEA 4M9CA 4MVJA 1QRDA 3BA1A 7REQB 2Z8XA 2JAXA 4O2BB 2ZYGA 4WT7A 2EL7A 1CJVC 4FWIB 1L8QA 2VA8A 2ZWVA 3A0RB 3BWCA 3DS8A 3LVQE 4RH1A 1UOQA 2X3UA 2YZGA 3Q3EA 3H19A 2CJWB 3B6MA 1V9CA 1QPZA 1QS0A 2FW8A 2ZUDA 3OT1B 4RE6A 5I7HA 2CL6X 2R4QA 1S2DA 4RESA 3HPQA 3HYTA 3U2QA 4D5EA 5ALKA 1LF0A 2NSLA 4MWGA 4CF4A 2ODTX 5EJIA 2GKGA 3D5TA 5KQSA 3ZHUA 5A62A 4MAAA 3VR4H 5I01A 4BU1A 4KR2A 4EGAA 4HGQA 1M75A 1WOMA 3ENWA 1N2EA 2QZZA 4KWHA 5E3JA 1FSZA 2C3UA 3LP5A 3M6IA 2O8CB 2JA1A 1E3WB 2R6R1 4G4JA 1A95A 2BELA 3V4LA 3C6BA 3AFIA 3FD8A 3ES9A 1BMQA 4OOFA 5BN1A 3QBTA 1J7KA 1XZEA 4Y2JA 4FM9A 4ES6A 5C31A 1N5KA 2I8AA 2J9YB 2QLFA 3E7DA 3P0EA 1MXFA 1RYMA 2EFHB 2QYTA 3PV0A 2PBZA 3W8NA 1USKA 1A4RA 5IVHA 3WK4A 4DCPA 3PT9A 1DIRA 2COEA 1HO3A 3IPAA 4XSVA 3R6GA 4GLOA 1YZFA 2PIAA 3DD1A 4H0CA 1WD7A 1O5TA 1OXSC 4ZYVA 4TV8F 5LDDC 2Y1DA 2QU7A 4EPWA 2AOTB 1N2BA 5C1PA 1QP7A 4WY8A 4H59A 1K4KA 1ORRA 4DRXB 3HO1A 1OWPA 4DMHA 2DUWA 3LSYA 4LI0A 3MNFA 3RLIA 1WHTA 5DNYB 1KR5A 4HGZA 4LEIA 1EZ1A 1WXDA 3CZCA 2FWNA 4WESB 1MO4A 4QFBA 3S2UA 4ZTZB 2B83A 3WFIA 4L2IA 5DNEA 3OIUA 1ZXLA 2OHXA 1TCBA 2JBAB 2OHIA 1OXBB 3LF1A 3K0FA 4MVJM 2QX6A 1IN1A 3ZE6A 3ZZMA 3W5DA 1U1CA 3QU5A 3DF7A 2E49A 1IM8A 3DPIA 4IG4A 4BO6A 1OX5A 4M9ZA 2J0VA 3B2QA 3WNVA 1P2BA 1TZ2A 3QU9A 3R1IA 4TZKA 4Q9DA 2PJDA 3QE3A 1FUEA 1NSTA 4ZVRA 4CM6A 4D2IA 1UOPA 2FAXA 5IDWA 3DBLA 1OT3A 2W98A 5LN1A 2GILA 2C94A 4D74A 2A67A 2PS1A 1KO8A 3DQQA 3R7LA 3T4UA 2FOXA 2NZ2A 4FHGA 1Z5NA 4BWYA 1KK2A 5FH9A 2ZPUA 1XDBA 1UT8A 3SIWA 2PAAA 3CUKA 4XQGA 1J8DA 3H3JA 3SMQA 4NULA 5IZCA 4BRSA 1YONA 1R9JA 4NI5A 3A58B 3C5EA 4Q1FA 4Q4HA 4DSNA 4CV3A 1EFUA 4R68A 2WJ4A 4L9AA 3K35A 3PRHA 1HH4A 1PJTA 1Y6RA 5DGXA 3EXEA 2YYYA 4JR1A 3ZY5A 2EQBA 5LQAA 1RXSA 3WGNA 4D8VA 1A4UA 1DLIA 1FFGA 4HBZA 1XTPA 1O94D 2HF2A 2FFHA 2VA9A 2ZIFA 3IOCA 5AHKA 1EPUA 3K9FC 1DC8A 2E37A 3RVRA 3ZHQA 3NTQA 3I2KA 1UPTA 3PQ5A 1K7YA 3G8DA 1JH8A 4R9NA 3VVMA 3W6UA 3T1TA 4QUJA 1BCRA 1TJNA 2I76A 4H7JA 4MJLA 4NLLA 2GAJA 4ZHSA 4Q05A 3TKLA 3EIXA 4KNYA 4EJFA 3DAHA 3ZQKA 1V8DA 4DLSA 2JH3A 2ZRCA 3C6MA 3UGQA 2G72A 4BMSA 2H63A 3VR2D 3AVXA 1DIOB 2N47A 2I1LA 2XDWA 1ZRHA 4ENTA 4ZIRB 2X2EA 2NZYA 2FCRA 4ZT7A 4C6SA 3DE4X 4JT9A 2ACWA 1AN0A 1PO7A 1T5LA 2DC1A 2ZE5A 1TTPB 2NP6A 1JEJA 1RJWA 3MINA 4J0EA 1IWPB 1A5ZA 2CUZA 4K26A 2AX4A 3ETHA 2R6HA 3KXIA 3EFEA 3FDIA 2D13A 3FZGA 3V1NA 5IXSA 1JE1A 2QGFA 4RKYA 2WNSA 3LVBA 4I5GA 4UFOA 5BV8A 3SLGA 2INGX 2A35A 1YDFA 4P31A 3T3GA 5C1BA 1T3TA 4PN7A 3SNKA 4UU8A 1NHGA 4ZVPA 3ZI4A 5KHOC 2NUTA 5JASA 3N39C 3U16A 4Q4AA 4P6VF 1K6JA 2QAJA 1NR5A 3I04M 2N75A 2FCAA 5FBKA 4PGAA 3I6BA 3MM4A 2A9PA 2RGGA 4WZAB 3SSNA 2VUSA 2HBRA 3AJ8A 2G9RA 3LHIA 4D3YA 1GA4A 1VIAA 2YWRA 2X0JA 1JPJA 2R6GA 4OP2A 2JFXA 3EIUA 3PYLA 3S29A 4B9EA 2QM3A 2VRCA 1E96A 1HETA 1VGQA 2WAMA 1NR1A 3QVGA 4Q1VA 3ZWXA 4I4CA 3ZCQA 1XZAA 4QJ3A 2KBFA 2J09A 3L7IA 3H5IA 3NC0C 1QK5A 4IXWA 5DSXA 2WA2A 3E1GA 2HT1A 5JAMA 8GPBA 3BTOA 1R3UA 2ODQA 2C03A 4U9UA 2QZ9A 5JE8A 1KP9A 4UZFA 4F92B 1NM5C 3IKJA 5IM4F 2QLTA 2IUTA 5K3DA 2PH1A 3OM9A 4QREA 4XEUA 2RG1A 4TSRA 5REQA 2VDPB 3M34A 2JB9A 1OVGA 4HS9A 1GZUA 4NEQA 4EYKA 2P0EA 1LTQA 3FBWA 4TVBA 4C6TB 1NNI1 5EHZA 4AG6A 3QHPA 3G2HA 2YHIB 3DAPA 3UGTA 5B7QA 4MDFA 1RXWA 3RC7A 2X7XA 1Q1BA 3ZU3A 2PKRA 4M8IA 5ALJA 2N46A 3ZK7A 1B76A 1X1CA 4G07A 5AUNB 5B3JC 3MG9A 3ENKA 4AWXA 2JCVA 4NARA 2J5KA 3QWHA 1NN0A 2ZQ5A 3FETA 4OP3A 3GA5A 2HZ7A 4X60A 3R9XB 1E5XA 5LYJF 2JS7A 5JTTA 3I34X 3ITEA 4QUEA 1MA3A 4DPKA 3GRUA 4A82A 1K8QA 1M2EA 3OBBA 5AFSA 5FX2A 1Z35A 4HQLA 4UBLA 5LP6B 2PJZA 3H5WA 2C9YA 3B1XA 1C81A 2C3PA 2OESA 5IBPA 1V37A 4UULA 3RJ5A 4JJEA 4M4SA 4KLAA 1T36B 1YO6A 2IK8A 2QROA 2GN9A 1DS6A 3UWKA 3Q11A 5IPFA 1T6NA 3OZFA 1RP1A 2FGJA 1E94E 1IIRA 4G5QA 4XARA 3WRYC 2CLCX 2XB8A 3DZIA 3G8CA 2JCBA 1MX3A 2ZEJA 3GRFA 4R2XA 4N4AA 5DGHA 5LD2C 3D4LA 4URHA 3EOAI 3T1QA 3QEOA 2G04A 3K0AB 4UHFA 1QP4A 5GV8A 1IBSA 4D4LA 1XELA 2HQOA 2XUJA 4CGYA 4JUCA 4WKGA 1ZPDA 1XU9A 2HA6A 1LSSA 1QCCA 3BCSA 4J07A 4NC9A 2WOOA 4NOMA 2W6JD 3BH6A 1LPBB 1W73A 4RENA 4F3TA 3BC1A 2JDIA 2SHKA 4NOJA 4TMWA 2JFVA 3N5KA 1OI3A 3NGMA 4EX7A 1NLUA 4MIYA 2P8JA 4YBZA 1N0IA 1VZ2A 1PRYA 3LPLA 5K0FA 1G3RA 4YP9A 1HDXA 3IOEA 2PGNA 4DEYA 1G20A 2PRYA 3TS1A 4UBIA 5FBRB 1ZBDA 4UJ5A 1TZJA 1E9AA 3LZDA 3SHTA 1OYVA 1PR6A 3WTBA 4PLHA 1W9MA 4CV0A 3BD7A 4GPEA 3OCWA 3CVOA 1WMAA 3A4YA 3GUVA 3QHQA 1DBIA 2CLMB 3R7BA 2EVWX 4A9AA 5D5PA 3NBZC 3VU3A 3KETA 2CYCA 2RGYA 3T4XA 3STXA 3R0JA 1SXIA 1QPGA 1UFRA 1GPYA 5DZSA 4QDTA 1DAHA 4QXAA 5JD3A 3DE7X 4B6SA 3X1YA 4U02A 3RS4A 1IJBA 4EEZA 2ZYRA 2CXHA 2I4MA 3D6AA 3TZEA 3K70B 3NAZA 1MBZA 2HN9A 1RWMA 2DT5A 2GJKA 2IDMA 4HX9A 1JIIA 1BROA 2W2KB 1FJXA 4C4ZA 3OZCA 1OXVA 3BB1A 5DN9A 4FILA 1IQRA 3EC7A 2R6CA 1QCDA 3WGHA 2AXNA 1OASA 5A1TA 3NWJA 6CHYA 1HMPA 1P2UA 1WULS 1Y3DE 1EE1A 5JATA 5BUQA 1IU9A 1HF3A 1Q7GA 3NI2A 4QJBA 1SBCA 3BTVA 2UYGA 2C8KA 3TNDA 4HZUA 1BRMA 1G60A 4R98A 3ZLBA 3RVBA 3EXFA 4MX8A 3VC7A 3EQ8A 1ISSA 1EVIA 1R6VA 2HMYB 1Q0RA 2G1AA 4DJJA 2X5XA 1RAIA 5HGXA 3AEYA 3O1JC 5G53C 4PSCA 1C30B 5ALNA 1P29A 2IGBA 3IQGX 2MINA 3FVQA 2OV2A 4KTVE 4N6GA 4L6AA 4TSFD 1OFGA 1V8BA 3HA3A 2V0NA 1WEHA 4X1YB 5JSKA 3TPCA 2ENWA 3QRWA 3W3AD 5IWAB 4JYZA 1V3VA 4QGAA 2IY7A 1B23P 3IB3A 3SEAA 5B1IA 2P9CA 1W94A 3D2BA 3IAS6 3M3PA 4JHXA 4EHJA 3F96A 1GZ3A 3FKQA 3ZWVA 3ADBA 1QJCA 4MCIA 1OI7A 2FI1A 2L18A 2Y0DA 3OZIA 5C34B 4INPA 5ILOA 1GUDA 1QMPA 1HL3A 2VATA 1ULZA 3BICA 3HEMA 3KHUA 4UBJA 4EUEA 5A9RA 1PQPA 5LWHA 3GWGA 4TRJA 1E4EA 2VNHA 3VKFA 2ZT7A 3A6LA 2ZI6A 3R3WA 2C9BA 3FAZA 3N5CA 2EX4A 2HB6A 2KS6A 5JAPA 4XDHA 3VTAA 4RM3A 2XI4A 1C1YA 4JR2A 4KGVA 4QFCA 4ZXPA 1A88A 4IDQA 2NGRA 2C0PA 4FBMA 2IJGX 4PC6A 1I4EB 1FX0A 1KO5A 3JQFA 1Y1TA 4PYMA 1N7GA 4ADSG 4YCSA 5A0TA 3BMCA 4XQ0A 3S2ZA 4F97A 1LBIA 1JI3A 4RORA 4KFSA 2ATEA 3D4BA 1SUBA 1PEDA 3QPDA 4Y1FA 1SUCA 1OWMA 5CEJA 5E4JA 4IDEA 2V7QA 1IQPA 3W34A 4L8WB 3LUJA 2QZ4A 4KOEC 1T43A 5CT5A 1U5CA 4HLNA 1RZRD 2GDZA 3CZ9A 1RE0A 3K09C 1SMKA 4NE2A 3WP0A 4J16A 4ZI2A 2DHCA 5TPWB 3WB2A 4IGIA 2FPGB 2YNMA 2A1UB 3FFXA 4GPZA 4OQPA 5EEGA 4ZAYA 5A4IS 2H1WA 1E7SA 1M8FA 5EMMA 1JFTA 4JELA 3FDFA 5HK8A 5DX0A 1CBUA 1FNMA 1I7SB 2JKVA 3BS4A 3T3IA 1LDEA 1M6EX 1RLMA 1J09A 1HG0A 3KCQA 4WLVA 3D7LA 3KC2A 5DXJA 4DG5A 3DR3A 4HH0A 4F1JA 1JXQA 3LUDA 4FCWA 4G0YA 4OB8A 5KOJB 1W5AA 1ZFNA 1OX6A 6ABPA 2XXBA 3CGWA 1JR4A 1SULA 2V59A 2PWBA 2J4CA 2P9EA 4PGHA 1XU4A 2LUOA 2EW8A 4C89A 4QOEA 4QUIA 2PT9A 3IEMA 1QQBA 1ZN8A 3FOCA 1RLIA 3LC2O 2FMHA 3PR2B 5DNUA 5CAEA 1S2MA 3I39X 3TGWA 1QO7A 3SYMA 2VWPA 4NP6A 4OBBA 4OLBA 1RWWA 1KQNA 3FYUB 3HYCA 2G4CA 1V11A 4RIEA 4CEHB 1UPXA 2PSHA 3L7AA 2D6FA 4N3GA 1QC5B 2VUIB 4OGKA 4KPFC 5K4GA 1AV6A 4QATA 2E1PA 2AOWA 5D5HA 5J2UF 4HX2A 3BH7A 2XV1A 2POQX 1GPBA 3BMNB 3PENA 4QPPA 1THTA 3C1TA 5IS2A 2ASEA 4B3FX 5DOZA 4EY5A 3ASVA 4KXLA 1X8JA 5JH7B 1P3Y1 3RSHA 4JGIA 1RKXA 3Q88A 3EVZA 4D98A 2AA3A 1L4EA 3IESA 4ZOCA 5DOVA 4X1KB 1LLDA 2N3ZA 3QVLA 3I8SA 4FDTA 2VK1A 3H9GA 4H6WA 3K9CA 1QGED 2YOFA 4M7OA 2FR8C 4ISCA 1RLJA 4U39A 3U1VA 1A69A 2QLBA 4GNRA 3G5UA 3F49S 3P9RA 4TYQA 2WFLB 2D59A 3ZGLA 2IEIA 2O57A 2RAVA 1FPMA 4OG2A 3ZHVA 5HVNA 5KYNA 5CHYA 4W5TA 4IH4A 4C6RA 5TE9A 4F72A 3FHTA 3OJCA 2FEPA 5F98A 3COZA 1B93A 1JDNA 1SY7A 2AN4A 4R6XA 3WWOA 5JS1A 1S8AA 4ZCIA 1KQ3A 2RH4A 3DZFA 1YZNA 3FGNA 4L5BA 1GDHA 3H9BA 3X2FA 5HZHA 3DBVO 5KJ1A 4JJZA 2J9ZB 2WILA 3S5JA 2PLFA 3EIHA 4U8GA 3QF7A 3JQDA 2QV0A 5CFNA 8AT1A 3IUQA 4FHEA 2YFQA 4QL3A 4LXGA 2HDNB 3DEIA 3ZDEA 1RTKA 5BW6B 5KYYA 1APBA 1ZMOA 1PU2A 3G88A 1D6JA 3M89A 4MXDA 5JLAA 5IKOA 4D9MA 5IBCA 4CIVA 2PUTA 4LOJA 3KJGA 1T1SA 2GZ1A 3AEXA 2JCYA 1DV1A 2O2EA 3SF0A 2KHZA 2IU6A 4PICA 2O3QA 1ZZGA 3NWBA 2LNDA 3LYAA 3K9WA 4G5FA 4BU0A 1L7PA 4GD3Q 2ZE7A 2JEOA 1OLXB 2P65A 5ER9A 1CRPA 1VKZA 3HACA 4I8DA 1E4VA 2ID7A 1ORHA 3HO6A 4MS3B 3ZXIA 4NE9A 4ZPXA 2C04A 1SKQA 4YT8A 3RC8A 1YZTA 4R3WA 5ALTA 1TZMA 1J25A 2X19A 4JUDX 4O4HA 4WNCA 1BWPA 4UNNA 2BH9A 3P26A 3D7SA 3D6UA 3K30A 5GADl 2G0AA 3AW9A 3JVEA 4BLOA 5IBQA 3NYIA 4QSHA 3GQVA 1ODIA 4HR7A 5AM2A 4JLUA 4YIHA 3L49A 4UASA 4UM5A 3CX4A 2NZJA 3BWBA 4KCGA 2I2AA 4OLFA 2EWVA 2HOQA 3DFFA 1Z36A 3T5DA 2YVKA 2FUG6 3ROEA 4DA7A 1PGPA 1M1NB 3E03A 1VI5A 3D7RA 5AJTA 3CLTD 3VR5A 2C61A 5EIHA 2BGJA 2RJOA 2XZTA 1SRRA 1Y82A 2X1HA 2Q5FA 4JSTA 4WV3A 2D4HA 1TQHA 4NBSA 3FTPA 5AUQA 2CXNA 5JYCA <