1YIJE

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
172
structure length
172
Chain Sequence
b'PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1yijE02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1yijE01
4WFAE 3CC2E 5GAHG 5DM6E 5GAGG 3CCSE 3CPWE 4WFNE 3CC4E 3CMAE 3OW2E 3CCJE 1M90G 1Q82G 3J7ZG 5GADG 1YIJE 1QVFE 1VQNE 5MLCH 3G71E 3CCUE 1YJ9E 1M1KG 2OTLE 2CQLA 3CCME 3CMEE 1VQPE 2ZJQE 1RL6A 3I55E 3CCVE 4WFBE 1VQ5E 4IOCE 3DLLE 3CD6E 5HL7E 5H1SI 2QEXE 1VQ4E 4IOAE 1KD1G 3CCQE 5GAEG 1VQKE 3PIPE 3CC7E 1W2BE 3CXCE 1VQ8E 5DM7E 1K8AG 3CF5E 1VQOE 1YJNE 1JJ2E 3CCEE 1KC8G 1Q81G 2ZJPE 3PIOE 4UY8G 4WCEE 3G4SE 1YI2E 5AN9B 3G6EE 3CCLE 1K73G 1VQ9E 1YJWE 1K9MG 1VQME 1S72E 1YHQE 1N8RG 4WF9E 1VQ6E 4U67E 2QA4E 2ZJRE 3I56E 1VQLE 1VQ7E 1NJIG 3CCRE 1Q86G 5JVHE 2OTJE 1Q7YG 1YITE 1QVGE 1KQSE 5JVGE 4IO9E
chains in the Genus database with same CATH superfamily
4WFAE 1RJLC 3CC2E 5GAHG 3CKGA 5DM6E 5GAGG 3CCSE 3CPWE 4WFNE 3CC4E 3CMAE 3OW2E 3CCJE 2AF5A 1M90G 1Q82G 1FJ1E 5GADG 3J7ZG 1YIJE 3IG9A 1QVFE 1VQNE 5MLCH 3G71E 3CCUE 1YJ9E 1M1KG 2OTLE 2CQLA 2PI3O 3CCME 3EC5A 3CMEE 1VQPE 2ZJQE 2FKJA 1RL6A 3I55E 3CCVE 4WFBE 1VQ5E 1P4PA 2HKDA 4IOCE 5B3MO 5B2AO 3DLLE 3CD6E 5HL7E 5H1SI 2QEXE 1VQ4E 4IOAE 1KD1G 3AUMO 3CCQE 1OSPO 5GAEG 2FKGA 2G8CO 1VQKE 3PIPE 3CC7E 1W2BE 3CXCE 1VQ8E 5DM7E 1K8AG 2OY5O 3CF5E 2OYBO 2OL7A 1VQOE 1YJNE 1JJ2E 2OY1O 3CCEE 1KC8G 1Q81G 2ZJPE 3PIOE 4UY8G 4WCEE 3G4SE 2I5VO 1YI2E 5AN9B 3G6EE 3CCLE 1K73G 1VQ9E 1YJWE 1K9MG 5B10O 1VQME 1S72E 3CKFA 1YHQE 1N8RG 2OY7A 4WF9E 1VQ6E 4U67E 2OL6O 2QA4E 2ZJRE 3I56E 1VQLE 1VQ7E 1NJIG 3IGEA 2OY8A 3CCRE 1Q86G 5JVHE 2OTJE 5B11O 1Q7YG 2OL8O 1YITE 1QVGE 1KQSE 5JVGE 4IO9E 2I5ZO
chains in the Genus database with same CATH topology
4WFAE 3CC2E 5GAHG 5DM6E 5GAGG 3CCSE 3CPWE 4WFNE 3CC4E 3CMAE 3OW2E 3CCJE 1M90G 1Q82G 3J7ZG 5GADG 1YIJE 1QVFE 1VQNE 5MLCH 3G71E 3CCUE 1YJ9E 1M1KG 2OTLE 2CQLA 3CCME 3CMEE 1VQPE 2ZJQE 1RL6A 3I55E 3CCVE 4WFBE 1VQ5E 4IOCE 3DLLE 3CD6E 5HL7E 5H1SI 2QEXE 1VQ4E 4IOAE 1KD1G 3CCQE 5GAEG 1VQKE 3PIPE 3CC7E 1W2BE 3CXCE 1VQ8E 5DM7E 1K8AG 3CF5E 1VQOE 1YJNE 1JJ2E 3CCEE 1KC8G 1Q81G 2ZJPE 3PIOE 4UY8G 4WCEE 3G4SE 1YI2E 5AN9B 3G6EE 3CCLE 1K73G 1VQ9E 1YJWE 1K9MG 1VQME 1S72E 1YHQE 1N8RG 4WF9E 1VQ6E 4U67E 2QA4E 2ZJRE 3I56E 1VQLE 1VQ7E 1NJIG 3CCRE 1Q86G 5JVHE 2OTJE 1Q7YG 1YITE 1QVGE 1KQSE 5JVGE 4IO9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFA E;  3CC2 E;  5GAH G;  5DM6 E;  5GAG G;  3CCS E;  3CPW E;  4WFN E;  3CC4 E;  3CMA E;  3OW2 E;  3CCJ E;  1M90 G;  1Q82 G;  3J7Z G;  5GAD G;  1YIJ E;  1QVF E;  1VQN E;  5MLC H;  3G71 E;  3CCU E;  1YJ9 E;  1M1K G;  2OTL E;  2CQL A;  3CCM E;  3CME E;  1VQP E;  2ZJQ E;  1RL6 A;  3I55 E;  3CCV E;  4WFB E;  1VQ5 E;  4IOC E;  3DLL E;  3CD6 E;  5HL7 E;  5H1S I;  2QEX E;  1VQ4 E;  4IOA E;  1KD1 G;  3CCQ E;  5GAE G;  1VQK E;  3PIP E;  3CC7 E;  1W2B E;  3CXC E;  1VQ8 E;  5DM7 E;  1K8A G;  3CF5 E;  1VQO E;  1YJN E;  1JJ2 E;  3CCE E;  1KC8 G;  1Q81 G;  2ZJP E;  3PIO E;  4UY8 G;  4WCE E;  3G4S E;  1YI2 E;  5AN9 B;  3G6E E;  3CCL E;  1K73 G;  1VQ9 E;  1YJW E;  1K9M G;  1VQM E;  1S72 E;  1YHQ E;  1N8R G;  4WF9 E;  1VQ6 E;  4U67 E;  2QA4 E;  2ZJR E;  3I56 E;  1VQL E;  1VQ7 E;  1NJI G;  3CCR E;  1Q86 G;  5JVH E;  2OTJ E;  1Q7Y G;  1YIT E;  1QVG E;  1KQS E;  5JVG E;  4IO9 E; 
#chains in the Genus database with same CATH topology
 4WFA E;  1RJL C;  3CC2 E;  5GAH G;  3CKG A;  5DM6 E;  5GAG G;  3CCS E;  3CPW E;  4WFN E;  3CC4 E;  3CMA E;  3OW2 E;  3CCJ E;  2AF5 A;  1M90 G;  1Q82 G;  1FJ1 E;  5GAD G;  3J7Z G;  1YIJ E;  3IG9 A;  1QVF E;  1VQN E;  5MLC H;  3G71 E;  3CCU E;  1YJ9 E;  1M1K G;  2OTL E;  2CQL A;  2PI3 O;  3CCM E;  3EC5 A;  3CME E;  1VQP E;  2ZJQ E;  2FKJ A;  1RL6 A;  3I55 E;  3CCV E;  4WFB E;  1VQ5 E;  1P4P A;  2HKD A;  4IOC E;  5B3M O;  5B2A O;  3DLL E;  3CD6 E;  5HL7 E;  5H1S I;  2QEX E;  1VQ4 E;  4IOA E;  1KD1 G;  3AUM O;  3CCQ E;  1OSP O;  5GAE G;  2FKG A;  2G8C O;  1VQK E;  3PIP E;  3CC7 E;  1W2B E;  3CXC E;  1VQ8 E;  5DM7 E;  1K8A G;  2OY5 O;  3CF5 E;  2OYB O;  2OL7 A;  1VQO E;  1YJN E;  1JJ2 E;  2OY1 O;  3CCE E;  1KC8 G;  1Q81 G;  2ZJP E;  3PIO E;  4UY8 G;  4WCE E;  3G4S E;  2I5V O;  1YI2 E;  5AN9 B;  3G6E E;  3CCL E;  1K73 G;  1VQ9 E;  1YJW E;  1K9M G;  5B10 O;  1VQM E;  1S72 E;  3CKF A;  1YHQ E;  1N8R G;  2OY7 A;  4WF9 E;  1VQ6 E;  4U67 E;  2OL6 O;  2QA4 E;  2ZJR E;  3I56 E;  1VQL E;  1VQ7 E;  1NJI G;  3IGE A;  2OY8 A;  3CCR E;  1Q86 G;  5JVH E;  2OTJ E;  5B11 O;  1Q7Y G;  2OL8 O;  1YIT E;  1QVG E;  1KQS E;  5JVG E;  4IO9 E;  2I5Z O; 
#chains in the Genus database with same CATH homology
 4WFA E;  3CC2 E;  5GAH G;  5DM6 E;  5GAG G;  3CCS E;  3CPW E;  4WFN E;  3CC4 E;  3CMA E;  3OW2 E;  3CCJ E;  1M90 G;  1Q82 G;  3J7Z G;  5GAD G;  1YIJ E;  1QVF E;  1VQN E;  5MLC H;  3G71 E;  3CCU E;  1YJ9 E;  1M1K G;  2OTL E;  2CQL A;  3CCM E;  3CME E;  1VQP E;  2ZJQ E;  1RL6 A;  3I55 E;  3CCV E;  4WFB E;  1VQ5 E;  4IOC E;  3DLL E;  3CD6 E;  5HL7 E;  5H1S I;  2QEX E;  1VQ4 E;  4IOA E;  1KD1 G;  3CCQ E;  5GAE G;  1VQK E;  3PIP E;  3CC7 E;  1W2B E;  3CXC E;  1VQ8 E;  5DM7 E;  1K8A G;  3CF5 E;  1VQO E;  1YJN E;  1JJ2 E;  3CCE E;  1KC8 G;  1Q81 G;  2ZJP E;  3PIO E;  4UY8 G;  4WCE E;  3G4S E;  1YI2 E;  5AN9 B;  3G6E E;  3CCL E;  1K73 G;  1VQ9 E;  1YJW E;  1K9M G;  1VQM E;  1S72 E;  1YHQ E;  1N8R G;  4WF9 E;  1VQ6 E;  4U67 E;  2QA4 E;  2ZJR E;  3I56 E;  1VQL E;  1VQ7 E;  1NJI G;  3CCR E;  1Q86 G;  5JVH E;  2OTJ E;  1Q7Y G;  1YIT E;  1QVG E;  1KQS E;  5JVG E;  4IO9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...