1YIJQ

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yijQ00
1VQLQ 1N8RR 3I56Q 1M90R 3CCQQ 1VQMQ 1VQ6Q 3CCVQ 3OW2P 1VQOQ 1W2BP 1VQPQ 1KD1R 1S72Q 3G71Q 3CPWP 1YI2Q 1YJNQ 1KC8R 1QVFP 1VQNQ 1VQ8Q 1YITQ 1K73R 1K8AR 1K9MR 3CCRQ 3CMAQ 1Q7YR 1Q86R 3CD6Q 1QVGP 2QEXQ 3CCJQ 1NJIR 3I55Q 3CMEQ 3CCMQ 3CCSQ 2OTJQ 1Q82R 1VQ5Q 1YJ9Q 1KQSP 3CCLQ 3CC4Q 1Q81R 3G4SQ 3G6EQ 2QA4Q 2OTLQ 3CCUQ 3CXCP 3CC7Q 1JJ2P 3CC2Q 1VQKQ 3CCEQ 1YHQQ 1VQ4Q 1M1KR 1VQ9Q 1VQ7Q 1YIJQ 1YJWQ
chains in the Genus database with same CATH superfamily
1GCQA 2YHTA 2M0YA 2HD0A 1PNJA 3FRNA 2DBMA 3CBMA 3V7SA 2EJFA 2QDYB 3JCMe 4E7ZA 3LGLA 1WXTA 1Q81R 3G6EQ 4ZNXA 4A4EA 2J6KA 3V7RA 4GLKA 2YUOA 4JLGA 5GAN3 4N0AA 4XU3A 2DO3A 5GAOm 3I55A 3QKJA 1Q86C 4M75A 4V2SA 1NEBA 2E70A 4J9CA 3BE3A 1KHCA 1QVGS 3FJ5A 1LVKA 2R58A 3VUZA 3H6ZA 1WNLA 3MJXA 5I2SA 3CC7Q 1C1AA 4DBRA 3G71T 2EWNA 1VYUA 1WXBA 5D6WA 2RHZA 1VQ6Q 1ZLMA 4A4FA 4M7AC 4AFZC 1M1FA 3E2UA 3QHSA 1ZA2B 1ZQ1A 4KGXB 5CKFA 2JW4A 5A0LA 1MHNA 3EGXA 3O5ZA 3CC2A 5GAOn 3CCMQ 4M7AA 2HL3A 2KYMA 2DL3A 2HQEA 2HKNA 1PM3A 1UHCA 2P4RA 3RBBB 4WTOB 3E9FA 3V7CA 2XG8D 3A8LB 1OU9A 4N4HA 2XDPA 2CKKA 4BE1A 4M75D 1XTDA 4BE2A 3BY7A 2LP5A 5CO7A 1VQPA 1BKBA 1OPLA 4QVCA 1QCOA 1KHIA 1AVZC 2VGNA 3OW2A 1I5LA 2AK5A 4BY6C 1KQ2A 2HL5C 3MEWA 5GAN5 5LJ5d 3FJPA 2FZGB 1WJQA 1TTHB 4L6V5 1VQPQ 2F2XA 3C95A 3EFOA 3RIRA 5LJ5e 2GFUA 4C8QF 4EPCA 1SSHA 2RHYA 1JJ2S 1VQ8A 1PHTA 3PT9A 3QWYA 3CCLQ 1VQLA 2MIOA 2Y4YA 1RACB 5LJ3g 2MCNA 2F69A 2VGMA 3WVEB 4RTTA 1ZUYA 4A4GA 2O01E 3G71Q 5AYFA 4HVUA 4HVWA 2JOYA 4JRKA 3A1PA 3RNJA 4PJOE 4GBQA 4PL6A 4C5GA 5I11A 2ZPHB 1Q81C 4F7UA 5HY6A 4IIMA 4J9DA 2V1QA 4HKEA 4EMHA 1NLPC 2QDLA 1QP2A 2LNVA 4M77G 1RUWA 2Y90A 2ZAEA 4NL2A 4O5VA 3CC7A 3I56Q 1ZSZB 2YRDA 2XI9A 5LJ5j 3JCMX 2QASA 4PNOA 1WI7A 5DM7R 2OX7A 5DY9A 2EQMA 5LJ3h 4BDYA 2RN8A 2RB6A 2FHDA 2PQWA 3FC3A 2L3RA 3OS0A 2KSSA 1NBEB 3M54A 2DX1A 2O2OA 1M1KU 1UUEA 1M3CA 3OYEA 3VS2A 5KE3A 1PKTA 3M0RA 2E5QA 4PFPA 2XKOC 2OTLT 3VS0A 2F2WA 2GTJA 4KH0B 3H8ZA 1B07A 4FW1A 2QA4Q 2KRMA 5GMKl 1NE8A 3JCMd 3M59A 1JEGA 1YITA 4JRIA 4A4KA 1D1CA 3CCJT 3OW2P 5AT1B 1VQNQ 1MMDA 3VJPA 1I4K1 4M77A 2BE9B 4OMNA 1T0HA 1X6OA 2KEAA 1YJNA 3EHRA 1GBQA 1XOVA 2RI3A 2EW3A 1IB8A 2OTJT 4QW2A 2LNHB 2LT4A 3T9NA 3NTKA 1FMWA 4FT2A 4Z8AA 4M77F 4RTZA 1JU5C 5A0DA 1VQ8Q 2QK0A 4Y91A 3CD6A 4EMKA 5KYWB 2DA9A 1YFNA 3MEUA 5LJ3j 2E4HA 4FSSA 2GGRA 1BCMA 5LJ3d 1X69A 3R6OA 1KJWA 1RABB 4M75E 2K3XA 2KXCA 2X3XD 2MWOA 4JRPA 2M16A 2E12A 2FL7A 4JDSA 4OMQA 1IREB 4ZTFA 1NM7A 4XTWA 2D6FA 2VKNA 1ABQA 1U1SA 5FU7B 1VQKQ 5D7UA 1VQNT 2O9VA 5GAMh 1N8RU 2PZ1A 2RQRA 2KXDA 3JB9I 4EIKA 4J83A 2RM4A 3A8GB 4OVAA 1MUZA 1B3QA 3H41A 3FIFA 1GL5A 4J5YA 1YHQT 2EKHA 2K9GA 1K9MU 2FRYA 2NUPA 4J9IA 1Q7YU 3SDZA 1HYOA 2K2MA 3TVTA 3OYLA 3P8DA 1WXUA 5KYXB 5GAOr 2JTFA 4PJLA 3RESA 4C8QB 5GAN6 4Z89A 1ZA1B 4PJOF 1QKWA 1KC8C 2DPPB 2K2VA 2DF6A 3MHXA 4M78B 3ZL7C 1C6VX 2O4XA 4ZGEB 1T0JA 1KQSP 2V8KA 2MAMA 2JMCA 2IIMA 1Q7YC 2RQVA 4UC4A 1PC0A 5FU7C 3R6NA 1SKUB 1QVFA 1M4ZA 1SHGA 1O75A 3FEOA 3REBB 3CPFA 1W2BA 2P0PA 3EGUA 2PUKB 5A2QE 1AWXA 4IUVA 3CCMT 3CCJQ 1ZBXA 2AKKA 2V8JA 3V8LA 2ZPEB 2LQ8A 4ZN1A 5DLQE 2A37A 4XTUA 3WXMB 5GAMj 4GLMA 2EYWA 4ELZC 3OYBA 3ER0A 3RUXA 2DTHA 1OOTA 4EMGA 2ABLA 1G3WA 4C5HA 1OQKA 4KULA 5L8RE 1IXDA 3OYHA 3A8MB 1Q95G 2DXCA 2RHIA 2CSQA 3EHQA 4X34A 2G6FX 1MGQA 3CCSQ 1WLPB 1D3BA 3HSBA 5C6SA 3C12A 3LX7A 1GXIE 1E6HA 1MMNA 4HVVA 1B34B 2X9HA 1QQJA 4N0AC 2DE0X 2LQKA 2KROA 1N9SA 2R5AA 1ZHIA 4J6XA 2K57A 4PJOA 3VS1A 4X1VA 3ME9A 8ATCB 2VV5A 2A0FB 1OZ3A 3M0UA 1N6AA 3L2ZA 2KGTA 4MZTA 2L89A 1WA7A 5LJ5f 4O6JA 1KG1A 3THKA 1QCFA 3OSSC 3OBYA 2AIRB 2RMOA 3E9GA 1Y0MA 5IH2A 3EGDB 2E64A 1YWOA 3QJYA 2HNIA 2XD0A 4JJNK 4DA4A 3EG0A 4M75F 3OSVA 2VYTA 3P8HA 1W1FA 4II1A 5LJ3f 4C92A 2K6DA 1K8AC 1TUDA 4FYVB 2E6NA 5GAN4 3IQLA 3CBPA 2ZPIB 2MOXA 1ZX6A 2DJQA 2YUNA 3OS5A 2X4XA 1VQ7A 2VXEA 3VS3A 2COYA 2DZCA 3GNFB 3M0SA 3LH5A 2JM9A 2C0OA 4OB3B 4M77E 2D8JA 2DERA 2ZCFB 2CREA 4RCBA 2E10A 3LWHA 3G4SA 2DNUA 2ZGWA 4AG1C 2KMTA 1VQNA 3LGFA 1AOJA 1K76A 3M58A 5CVIA 1S72Q 3GPLA 2W0ZA 1B7TA 1M1GA 2GBQA 1ZUKA 5CIUA 5IHKA 2DEUA 4FL6A 3CPWA 1U5SA 2PNIA 2QA4A 2O4XB 2FEIA 2DLPA 3PFSA 4HA8A 2DL4A 2BKDN 3CXCS 3M53A 2K5FA 2OTLQ 1GRIA 5EC7A 4FU6A 4J9HA 2FYKA 2K5LA 1NJIC 4E7IA 1HXDA 4OMMA 1W2BP 4YTLA 2RI2A 1VQPT 2SRCA 4EMKC 3UDCA 2KRSA 2O9SA 7AT1B 4M4ZA 5CKDA 3UATA 1AT1B 3CCVA 1WHLA 1PWTA 4M7DE 2BZYA 1NPRA 1NPPA 1K4US 1QLYA 4J9GA 2KK4A 1YIJT 4KUIA 4LXCA 3PVLA 1WJRA 4FT4A 3JCMJ 1I07A 3HHTB 3I56A 2C0IA 2VASA 3NGPA 4PJOD 2L3PA 1C0MA 1K73R 4M7AG 4M77C 2CYZB 3CC2T 2A08A 1RAHB 4Q5WA 4FM4B 3FB9A 1I0CA 1MMGA 1RAFB 3G71A 2KT1A 1JQQA 2EIFA 4FYYB 4PK4A 3E1SA 3E19A 5GANj 4JS4A 1YBYA 2CSIA 1S72T 3PNWC 1K73U 1YN8A 3H9NA 3S3NA 1SG5A 2DXUA 1ABOA 2RA2A 1M1KR 3WVDB 3MKDA 4C92C 4QQGA 2E6ZA 4BY6B 3QIIA 2ROLA 2XICA 1YCYA 2QI2A 5KYUA 4Z02A 4FYXB 3M9QA 3HRUA 4E7LA 5GANg 5GANd 1O9SA 4HXJA 4J9FA 3RMQA 3JCMW 4B9WA 4L59A 3VUBA 1BI1A 4LE9A 1FWZA 4F04B 5KCHA 2CP7A 2KVQG 4A4HA 4TVRA 1U1TA 4RG2A 4BI8B 2FVUA 2BE7D 2HMAA 1X6GA 2RQWA 1DJ7B 5KYYA 3OMCA 4C92G 1AWWA 3JV3A 4J6WA 4PLIA 3CC2Q 1NZ9A 4KRTA 1UEBA 3H0HA 3BW1A 1GFCA 3MP1A 3J80E 1MNDA 2EAYA 1SRLA 2JM8A 2X4JA 1KC8R 3QYGB 1U8RA 5GAOq 1BI0A 5KYUB 2NYSA 4M7DC 3HP9A 2DL7A 1X01A 2FZKB 5IAYA 3BFMA 5CQYA 4OMLA 2MPXC 2MYSA 3ZEHA 1HSQA 5GMKm 1VA7A 3JCMb 2FZCB 4X9CA 2YSQA 4LD6A 2YLCA 4LUEA 3CMAA 1E7OA 1R0BG 3TQ7P 3I35A 4AFSC 1IGUA 3GNGA 1S1NA 2GF7A 3MEVA 4PJOC 2NUZA 3CXCA 4D8KA 2VXFA 3L2UA 5FWBA 3X24B 3CC4T 2FPDA 1W70A 3NFCA 3NHNA 2CT3A 2JS0A 1UFFA 1VOMA 1OZ2A 3CCVQ 1HJDA 3OYKA 2F2VA 1OX9A 1GCPA 2KY9A 4KUDK 3CCRQ 3M57A 2JZ2A 3UT1A 4JZ3A 4OMOA 2QQSA 5FLXE 4CC4B 2OAWA 2EQKA 2COWA 1LOJA 2E65A 3PVQA 2DIQA 2JUFA 3NMZC 3UWNA 1JJ2P 1YP5A 3GIBA 2P0QA 4ESRA 1TH7A 5A0GA 2E3HA 1YIJQ 1M1KC 3CC4A 2JS2A 4OP0A 5IT9E 1UG1A 2ZPFB 3HRSA 4C8QD 1IRXA 3TCJA 4C5IA 1M27C 5KYNA 4BDZA 3A8HB 5I22A 1Q82R 2DZ9A 1ACMB 2LZ6B 3SWNC 4LDXA 5D6XA 3HKSA 2EYYA 3MEAA 3VV0A 2Y4XA 1N8RC 2CP2A 2R57A 2HAXA 2I0NA 5HK0A 1SHFA 4HCZA 2H8HA 1KSWA 2QA4T 2LQNA 3BDLA 2PVOB 4M78C 3SD4A 1CSKA 1GCQC 2KYBA 4M78E 3QZ5B 1LCKA 3DB3A 1VQ7Q 1TS9A 2JMAA 2L8DA 1FYNA 1V76A 3DLLA 2M1HA 2DD4A 1RAAB 5GAMf 3NTIA 4C8QA 4GY5A 1I8FA 3SB2A 2IG0A 2DM1A 5I21A 4JRQA 2QEXQ 3CMEQ 5GANf 2KI7A 3AT1B 1UGSB 1RAIB 1JJ2A 1X6BA 2GNCA 1YNZA 4FYWB 3I9QA 2DIGA 2CUBA 4M7AF 2FG0A 3OS2A 3RMSA 1UB4A 3FLGA 4CC2A 2CZ7B 4ME7A 2KT8A 4IUQA 4HCBA 3VS5A 2AZSA 1K8AR 1CKAA 3SHWA 3CD6Q 5D6YA 4AFQC 3EFRA 2RF0A 2Z0WA 1YWPA 3CXCP 3V8JA 1W6XA 5CCAA 3TSZA 5KCOA 3L1AA 1G2BA 4L5GA 2PVGB 2CP0A 8AT1B 1A0NB 3OW2S 1WHHA 4DOWA 5FU6B 1YJNQ 4E47A 1WQWA 4J8OA 1PD1A 1OU8A 1FMKA 1G3SA 2DETA 3UF4A 1X2KA 1LNXA 3CMAT 2FO0A 2WSCE 2M0OA 5FU6C 2V26A 3CCRA 4F7UG 1OEBA 2E3IA 2LJ3A 3QZ9B 1M90R 1MNEA 4OB0B 1NYGA 1NYFA 1LJOA 5IN1A 1KC8U 3EG2A 3G7ZA 1PG5B 5CKEA 2JNGA 2AKLA 1G83A 4D6WA 1BIAA 2K7AA 3EG9B 4LDUA 3KXTA 1LPLA 2HZYA 3RKWA 1XNIA 2EGEA 1SSFA 3VS4A 1FMVA 3HRTA 3URGA 2HEQA 4IUPA 4N4IA 1KD1R 2HQXA 1OI1A 1K0SA 4XK8E 3A8OB 3HPWA 4LDVA 2DK3A 4ORZA 3GP8A 4PLLA 4Y92A 1E6GA 2E5KA 5IXBA 1Y96A 2JN0A 2OTJA 2JJ9A 3S3MA 1K9MC 1XJWB 3QSUA 1VQ9Q 4A63B 4FCYA 3JCMc 1N27A 3OYDA 2E41A 3OB9A 2CP5A 1YI2Q 2DL5A 2FPFA 4M75B 3CMAQ 3HFOA 1QVGA 3M55A 4M7DA 2PUOB 3QPHA 3VS6A 2QQ9A 5GMKh 2WSEE 3L2RA 1JBMA 3CCQT 2NUTB 3M56A 1BB9A 1SEMA 2PTKA 2D0NA 1OV3A 4M7DG 4XU2A 2LC4A 3OQ5A 1K0XA 4RUGA 4WF2A 2QGGA 3QG1A 2ED1A 2RHXA 3EFOB 1BI2A 3CCEA 5I2MA 2JT4A 3G6ET 1HK9A 2P0KA 2CP3A 4KBMB 3GF5A 1FX7A 1CKBA 4XAXB 2O31A 2WACA 1WGSA 1QWEA 2YWWA 2ZPBB 3JB9D 4KGZB 1JXOA 2XU8A 2O88A 1G5VA 1KQSA 1RADB 1H92A 2EQUA 2LCCA 4NS5A 1UGQB 1VQ9T 2XIDA 3VYGA 2R5MA 5GAN7 3EFSA 1GFDA 2GQIA 5J39A 2YT6A 4OF1A 3LWIA 1IZ6A 4HCCA 2XMFA 3M0QA 1OULA 3GLXA 1SF9A 2RD1A 4M75C 1U06A 4NL3A 4ZGDB 1M2OA 1RAGB 3EG1A 1YI2A 2GTOA 1X43A 1I81A 5HCKA 4C0DB 2VC8A 1ARKA 2DBKA 1SRMA 5CKBA 1IO6A 2DMOA 1V29B 4QT7A 3CCQQ 4FW2A 2ENMA 4LDYA 4D8DA 3ZFJA 4CRIA 1YJNT 1UDLA 3FDRA 3I55Q 4J9EA 9ATCB 1BYMA 1MMAA 2ECZA 1K8AU 4PFZA 4C8QE 1YJWQ 1H3HA 3PIPA 4FIBA 2YDLA 2XDBA 2LCSA 2F5TX 3QUIA 3HL8A 3CCLT 4QQ6A 4RCCA 4C92F 2KNBB 4M7DF 3LYIA 1BI3A 1UE9A 4RTVA 2EYQA 2G3RA 1EIFA 3JB9G 4ELYC 4ZN3A 4CI0C 2RK2A 2OI3A 1N9RA 3CCUA 4R56A 1M9SA 1W2BS 2CP6A 2DTOA 2BUDA 3MP6A 4E6RA 4C0DC 3JB9H 1BCOA 4J7FA 3TREA 1BIBA 2YLBA 4DBQA 1VQ5Q 1M8VA 5M9OA 3MPUB 2LDMA 1V1CA 5CAIA 2K3YA 2NUTA 2DD5A 2NUPB 2QEXT 4IUTA 3CC7T 4C0ZA 4BI4A 5KYXA 1KIKA 2L0AA 2QGFB 2KAFA 2YRVA 1VQLQ 2DEQA 2CDTA 2EKOA 2OJ2A 3CPWS 1NJIU 2DKGA 3VKIA 3DLMA 1S72A 4E2FB 2QTXA 3RR6A 1Q81U 4KH1B 3PIOA 2BTTA 3OYIA 5FRNA 1X2QA 3CQTA 4M77B 2CT4A 1Q82U 5KYYB 2AHJB 3OYFA 2EJGA 2LVMA 4PJOG 2A28A 1WPYA 2CUDA 3G4SQ 4HCKA 2VVKA 1RI0A 1T3LA 4M78G 2QXFA 1AD5A 3KFVA 2EPDA 4IURA 1VUBA 4XU1A 3NTHA 4EMKB 4QKUA 4JZ4A 2RI5A 1NJIR 2ESWA 4OB2B 1WHMA 2DXBA 4F7UF 3SWNA 5LJ5g 2EFIA 5LJ3e 1AZEA 1TUGB 4Z88A 2XHCA 3EH2A 4RTWA 3EH1A 3LH0A 2EQIA 1WHGA 3QDFA 1K9AA 2KE9A 2RH2A 5IHIA 5HKCA 3U23A 3OYJA 3JSCA 3CCMA 4CC7A 2X4WA 4M78A 2J06A 3CD6T 5ECAA 3VS7A 2C0TA 2D8HA 1VQ6A 1D3BB 4F17A 2YUQA 1QKXA 1K73C 3J7AF 1B34A 1WX6A 1D09B 2CH4A 1VQ8T 1BK2A 4AMCA 2DVEA 1QVFS 1KK7A 2GQVA 2QQAA 1PRLC 3HTRA 4A54A 1QVGP 1H3ZA 2L3QA 4DEYA 2ATCB 3L2QA 3PGGA 1G8XA 3CMET 3CC4Q 3CCJA 2YRCA 3CCSA 2KBTA 2VUBA 2AZVA 1YITT 2M51A 1NLOC 1WIEA 3EGDA 3G4ST 2PVDB 1W4SA 2HKQB 3CCRT 2NLUA 1AWOA 2B86A 2DL8A 3UA7A 1EX4A 1D0YA 3QO3A 5IHNA 1Z9QA 2V8IA 1QVPA 4XTZA 3OYYA 3I55T 3L2VA 4OGCA 3X26B 1NG2A 4NOYA 1VQ7T 5IXFA 1VQ4Q 1U3OA 3SFMA 2JTMA 1UJYA 4RMOA 1KD1C 1QVFP 3C0CA 2K79A 2MWPA 3EAEA 2KR3A 1G3TA 4QQDA 4JJCA 4JS5A 1M3AA 4M7DD 3ASKA 2K5IA 1RLPC 3A98A 4LDWA 1PSFA 1PKSA 1VIEA 2X4YA 1H8KA 3CCUT 1JO8A 2LQWA 2M9UA 1Y57A 3REAB 2IVWA 2W10A 2EVRA 2JXBA 1TXQA 2RHUA 3OYMA 3S6WA 2ZZDA 2RNAA 4OMPA 2JTEA 1MV0B 1N5ZA 1KD1U 5GJWB 2CZ6B 1WJSA 1VQKA 1AEYA 2DAQA 2NWMA 1QW1A 2M02A 2DILA 5CR2A 3JB9F 4BUGA 1D0ZA 3QXEB 4RKUE 3MO8A 4EDUA 3M5AA 1WZOA 1M3BA 4RTYA 2MMPA 2P4TA 4BD3A 1Q86U 1RAEB 4ATOA 1UTIA 3DB4A 5GMKe 2D1XA 4PFOA 1VQ4T 2DTIA 1D1AA 4M7AB 4ZTJA 4HT8A 4IKFA 2RJCA 3MCAB 2X3WD 1PSEA 3LLRA 1M8MA 3JRZA 1K1ZA 3JAME 1VYVA 3CPWP 3H0IA 2FB7A 3VYHB 4XU0A 1UGVA 5GMKi 1JRIA 3GOXA 5J3BA 4C92B 3CEYA 1VQ5A 4QVZA 2QQBA 2A7YA 2EGCA 3META 3EG9A 1WYXA 4DOVA 1TSFA 1WFWA 4A53A 2HDAA 5GJVB 3VRYA 1T3SA 4C8QG 2QAZA 3OBWA 1YJWT 1YITQ 1TU0B 4M77D 5GMKj 3MP8A 3M4GA 4LD9K 3PTAA 4JLIA 5LL6S 5GANh 3JCMf 3JCMg 1PD0A 1Y7XA 1JB0E 3X20B 4C92E 4PJNA 2EJ9A 3HFNA 1UHFA 4B6MA 2QQRA 1IHWA 3NPFA 1M5Q1 2DRMA 4E7SA 4M78F 1M90U 3RDVA 2SEMA 3L42A 1YCSB 1KQSS 3CCET 4F7UB 1YJ9Q 2K3BA 1TG0A 1X27A 3M0PA 2J05A 4AT1B 4QVDA 3M4YA 4M7AE 3CCST 4N4GA 2HSPA 5FRMA 4C92D 4XTVA 3CCQA 1YJ9A 1OX8A 4RTUA 5EG2A 4DBHA 1YJWA 2LT1A 1M90C 1JXMA 5CQXA 3SWNB 3OMGA 1UGRB 5HK3A 5CK9A 1Y96B 4JPBW 3Q1JA 1QP3A 3QWXX 3CCVT 2DYBA 4M75G 2ROTA 1AHJB 3VU3C 2QG9B 1J3TA 5DLOA 1VQ6T 2QYZA 3QBYA 1QCNA 5C0MA 4WCIA 4JJBA 4F16A 1IGQA 5GAOp 2HQHA 1TUCA 2CZ1B 4F14A 4M7DB 2KDSA 1WQ7A 2DJZA 2GCXA 4VUBA 2J7IA 3CCLA 2B8AA 2CS7A 3VRZA 1QMCA 1ZSGA 1KQ1A 4F7UE 5GAMg 2CZ0B 3OS1A 1VQMA 4OGEA 2AT1B 2MI6A 2V1RA 2JVVA 2KQWA 2IPOB 3OA6A 4C5EA 1K9MR 2K4YA 4E7KA 2EYZA 4R55A 5GANe 4BI3A 2BZXA 2LJ0A 1HD3A 1UJ0A 5LJ5h 3L2WA 2RJFA 3G1JA 3CCEQ 3QDRB 2EYXA 1YHQQ 3JB9J 1YJ9T 1YHQA 1GBRA 2EQJA 1QWFA 3N5BB 4LUDA 6AT1B 2L3SA 1OPKA 2ED0A 2YUPA 5GAMd 2LRQA 1P92A 3D7SB 5KYWA 4ANJA 5J26A 4B9XA 3TU4K 3I5SA 5GAN8 2BZ8A 1ZSZC 4IUUA 4MDXA 1EZZB 3UPUA 3X28B 4XTYA 3QJ6A 3PMIA 1M30A 2LX9A 3EG3A 1SPKA 4XQ3A 4MZMA 2L2PA 3J81E 1VQMQ 1R0CB 1BU1A 3ULRB 4RTXA 1VQ9A 3S3OA 3EGXB 4AFUC 1H641 2XK0A 2LCLA 4IIOA 4E7HA 3OYNA 4PJMA 3I5RA 2EGAA 3OYGA 1AWJA 4C0FA 2LJ1A 3PMTA 4P5NA 3TSWA 3OYCA 3F70A 1WDXA 4MDWA 4DEXA 4C8QC 2MF2A 1Q7YR 1PCXA 2DYIA 3G6EA 1M2VB 2OTJQ 4J7IA 1EFNA 4PKCC 3DKMA 1ZBJA 5KE2A 1VQOT 4BACA 1ZUUA 4LN2A 2ZPGB 3PE0A 2XDDA 1RI9A 1N8RR 3H0FA 3C94A 2CH4W 2D9TA 4M78D 1VIFA 3ZBDA 5GAOl 1UGPB 1Q82C 4ZGJB 2RJDA 4E7JA 4MMLA 2RK1A 2H3EB 1VQMT 1RLQC 2FPEA 2HBWA 1OYXA 2QTVA 1VQOA 2RJEA 2RQUA 4RG8A 2OTLA 4OB1B 4MZPA 2EBPA 4BE0A 1UECA 3C4SA 3RKYA 5L23A 1Q86R 1KFZA 1TWBA 5CKHA 2X35A 1IHVA 3JCMV 2L5QA 2F1LA 2LMJA 4HT9A 1FXXA 1VQKT 4AG2C 3RKXA 1G3YA 5GAN2 1PRMC 1MV3A 3UA6A 2BIVA 1ZSZA 2DXTA 2RPNA 2WSFE 1WHKA 2LX7A 4MMKA 2HBPA 2F5KA 1XQHA 1VYTA 3JCMh 3P8BB 2HSEB 2A36A 3CBOA 1AZGB 4Y28E 2J6FA 1Z9ZA 3INZA 1NEGA 3SEMA 1I5OB 3V8KA 2YXYA 5KH6A 4XTXA 1R8OB 1WHJA 3GBQA 4R0KA 4M7AD 2VWFA 4DQ2A 1VQ5T 4PJOB 1Y07A 2J6OA 5GAMe 5FWCA 4K11A 2RO0A 2GFAA 3OY9A 1TOVA 4X9DA 2OAUA 2C06A 2LTOA 2E1HA 1VQLT 2D0QB 4KGVB 3RERA 1BBZA 3CMEA 2COZA 4PJJA 3BDUA 2QEXA 1F1BB 2X51A 4CC3A 3O8VA 3LW5E 2P84A 1X75C 2PU9B 4KT0E 3QYHB 4BB7A 3X25B 5FW9A 2I2LA 3JCMQ 4LNPA 3I56T 2DFUA 3M0TA 1D0XA 4FSXA 2MK5A 2H3JA 2DRKA 3OYAA 1D1BA 2FRWA 3AHUA 1VQOQ 1R77A 1YIJA 1Y71A 4DBFA 3TEEA 4J9BA 1M2VA 4C0GA 4JUVA 1YI2T 4OMFB 2RQTA 2HCKA 3KUFA 2A3LA 3CCUQ 5FROA 2DVJA 3A5ZB 2KRNA 2VB6A 3JCMP 1I1JA 3KBGA 4JJDA 4J6YA 1VQ4A 2CGHA 1RL2A
chains in the Genus database with same CATH topology
1VQLQ 1N8RR 3I56Q 1M90R 3CCQQ 1VQMQ 1VQ6Q 3CCVQ 3OW2P 1VQOQ 1W2BP 1VQPQ 1KD1R 1S72Q 3G71Q 3CPWP 1YI2Q 1YJNQ 1KC8R 1QVFP 1VQNQ 1VQ8Q 1YITQ 1K73R 1K8AR 1K9MR 3CCRQ 3CMAQ 1Q7YR 1Q86R 3CD6Q 1QVGP 2QEXQ 3CCJQ 1NJIR 3I55Q 3CMEQ 3CCMQ 3CCSQ 2OTJQ 1Q82R 1VQ5Q 1YJ9Q 1KQSP 3CCLQ 3CC4Q 1Q81R 3G4SQ 3G6EQ 2QA4Q 2OTLQ 3CCUQ 3CXCP 3CC7Q 1JJ2P 3CC2Q 1VQKQ 3CCEQ 1YHQQ 1VQ4Q 1M1KR 1VQ9Q 1VQ7Q 1YIJQ 1YJWQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL Q;  1N8R R;  3I56 Q;  1M90 R;  3CCQ Q;  1VQM Q;  1VQ6 Q;  3CCV Q;  3OW2 P;  1VQO Q;  1W2B P;  1VQP Q;  1KD1 R;  1S72 Q;  3G71 Q;  3CPW P;  1YI2 Q;  1YJN Q;  1KC8 R;  1QVF P;  1VQN Q;  1VQ8 Q;  1YIT Q;  1K73 R;  1K8A R;  1K9M R;  3CCR Q;  3CMA Q;  1Q7Y R;  1Q86 R;  3CD6 Q;  1QVG P;  2QEX Q;  3CCJ Q;  1NJI R;  3I55 Q;  3CME Q;  3CCM Q;  3CCS Q;  2OTJ Q;  1Q82 R;  1VQ5 Q;  1YJ9 Q;  1KQS P;  3CCL Q;  3CC4 Q;  1Q81 R;  3G4S Q;  3G6E Q;  2QA4 Q;  2OTL Q;  3CCU Q;  3CXC P;  3CC7 Q;  1JJ2 P;  3CC2 Q;  1VQK Q;  3CCE Q;  1YHQ Q;  1VQ4 Q;  1M1K R;  1VQ9 Q;  1VQ7 Q;  1YIJ Q;  1YJW Q; 
#chains in the Genus database with same CATH topology
 1GCQ A;  2YHT A;  2M0Y A;  2HD0 A;  1PNJ A;  3FRN A;  2DBM A;  3CBM A;  3V7S A;  2EJF A;  2QDY B;  3JCM e;  4E7Z A;  3LGL A;  1WXT A;  1Q81 R;  3G6E Q;  4ZNX A;  4A4E A;  2J6K A;  3V7R A;  4GLK A;  2YUO A;  4JLG A;  5GAN 3;  4N0A A;  4XU3 A;  2DO3 A;  5GAO m;  3I55 A;  3QKJ A;  1Q86 C;  4M75 A;  4V2S A;  1NEB A;  2E70 A;  4J9C A;  3BE3 A;  1KHC A;  1QVG S;  3FJ5 A;  1LVK A;  2R58 A;  3VUZ A;  3H6Z A;  1WNL A;  3MJX A;  5I2S A;  3CC7 Q;  1C1A A;  4DBR A;  3G71 T;  2EWN A;  1VYU A;  1WXB A;  5D6W A;  2RHZ A;  1VQ6 Q;  1ZLM A;  4A4F A;  4M7A C;  4AFZ C;  1M1F A;  3E2U A;  3QHS A;  1ZA2 B;  1ZQ1 A;  4KGX B;  5CKF A;  2JW4 A;  5A0L A;  1MHN A;  3EGX A;  3O5Z A;  3CC2 A;  5GAO n;  3CCM Q;  4M7A A;  2HL3 A;  2KYM A;  2DL3 A;  2HQE A;  2HKN A;  1PM3 A;  1UHC A;  2P4R A;  3RBB B;  4WTO B;  3E9F A;  3V7C A;  2XG8 D;  3A8L B;  1OU9 A;  4N4H A;  2XDP A;  2CKK A;  4BE1 A;  4M75 D;  1XTD A;  4BE2 A;  3BY7 A;  2LP5 A;  5CO7 A;  1VQP A;  1BKB A;  1OPL A;  4QVC A;  1QCO A;  1KHI A;  1AVZ C;  2VGN A;  3OW2 A;  1I5L A;  2AK5 A;  4BY6 C;  1KQ2 A;  2HL5 C;  3MEW A;  5GAN 5;  5LJ5 d;  3FJP A;  2FZG B;  1WJQ A;  1TTH B;  4L6V 5;  1VQP Q;  2F2X A;  3C95 A;  3EFO A;  3RIR A;  5LJ5 e;  2GFU A;  4C8Q F;  4EPC A;  1SSH A;  2RHY A;  1JJ2 S;  1VQ8 A;  1PHT A;  3PT9 A;  3QWY A;  3CCL Q;  1VQL A;  2MIO A;  2Y4Y A;  1RAC B;  5LJ3 g;  2MCN A;  2F69 A;  2VGM A;  3WVE B;  4RTT A;  1ZUY A;  4A4G A;  2O01 E;  3G71 Q;  5AYF A;  4HVU A;  4HVW A;  2JOY A;  4JRK A;  3A1P A;  3RNJ A;  4PJO E;  4GBQ A;  4PL6 A;  4C5G A;  5I11 A;  2ZPH B;  1Q81 C;  4F7U A;  5HY6 A;  4IIM A;  4J9D A;  2V1Q A;  4HKE A;  4EMH A;  1NLP C;  2QDL A;  1QP2 A;  2LNV A;  4M77 G;  1RUW A;  2Y90 A;  2ZAE A;  4NL2 A;  4O5V A;  3CC7 A;  3I56 Q;  1ZSZ B;  2YRD A;  2XI9 A;  5LJ5 j;  3JCM X;  2QAS A;  4PNO A;  1WI7 A;  5DM7 R;  2OX7 A;  5DY9 A;  2EQM A;  5LJ3 h;  4BDY A;  2RN8 A;  2RB6 A;  2FHD A;  2PQW A;  3FC3 A;  2L3R A;  3OS0 A;  2KSS A;  1NBE B;  3M54 A;  2DX1 A;  2O2O A;  1M1K U;  1UUE A;  1M3C A;  3OYE A;  3VS2 A;  5KE3 A;  1PKT A;  3M0R A;  2E5Q A;  4PFP A;  2XKO C;  2OTL T;  3VS0 A;  2F2W A;  2GTJ A;  4KH0 B;  3H8Z A;  1B07 A;  4FW1 A;  2QA4 Q;  2KRM A;  5GMK l;  1NE8 A;  3JCM d;  3M59 A;  1JEG A;  1YIT A;  4JRI A;  4A4K A;  1D1C A;  3CCJ T;  3OW2 P;  5AT1 B;  1VQN Q;  1MMD A;  3VJP A;  1I4K 1;  4M77 A;  2BE9 B;  4OMN A;  1T0H A;  1X6O A;  2KEA A;  1YJN A;  3EHR A;  1GBQ A;  1XOV A;  2RI3 A;  2EW3 A;  1IB8 A;  2OTJ T;  4QW2 A;  2LNH B;  2LT4 A;  3T9N A;  3NTK A;  1FMW A;  4FT2 A;  4Z8A A;  4M77 F;  4RTZ A;  1JU5 C;  5A0D A;  1VQ8 Q;  2QK0 A;  4Y91 A;  3CD6 A;  4EMK A;  5KYW B;  2DA9 A;  1YFN A;  3MEU A;  5LJ3 j;  2E4H A;  4FSS A;  2GGR A;  1BCM A;  5LJ3 d;  1X69 A;  3R6O A;  1KJW A;  1RAB B;  4M75 E;  2K3X A;  2KXC A;  2X3X D;  2MWO A;  4JRP A;  2M16 A;  2E12 A;  2FL7 A;  4JDS A;  4OMQ A;  1IRE B;  4ZTF A;  1NM7 A;  4XTW A;  2D6F A;  2VKN A;  1ABQ A;  1U1S A;  5FU7 B;  1VQK Q;  5D7U A;  1VQN T;  2O9V A;  5GAM h;  1N8R U;  2PZ1 A;  2RQR A;  2KXD A;  3JB9 I;  4EIK A;  4J83 A;  2RM4 A;  3A8G B;  4OVA A;  1MUZ A;  1B3Q A;  3H41 A;  3FIF A;  1GL5 A;  4J5Y A;  1YHQ T;  2EKH A;  2K9G A;  1K9M U;  2FRY A;  2NUP A;  4J9I A;  1Q7Y U;  3SDZ A;  1HYO A;  2K2M A;  3TVT A;  3OYL A;  3P8D A;  1WXU A;  5KYX B;  5GAO r;  2JTF A;  4PJL A;  3RES A;  4C8Q B;  5GAN 6;  4Z89 A;  1ZA1 B;  4PJO F;  1QKW A;  1KC8 C;  2DPP B;  2K2V A;  2DF6 A;  3MHX A;  4M78 B;  3ZL7 C;  1C6V X;  2O4X A;  4ZGE B;  1T0J A;  1KQS P;  2V8K A;  2MAM A;  2JMC A;  2IIM A;  1Q7Y C;  2RQV A;  4UC4 A;  1PC0 A;  5FU7 C;  3R6N A;  1SKU B;  1QVF A;  1M4Z A;  1SHG A;  1O75 A;  3FEO A;  3REB B;  3CPF A;  1W2B A;  2P0P A;  3EGU A;  2PUK B;  5A2Q E;  1AWX A;  4IUV A;  3CCM T;  3CCJ Q;  1ZBX A;  2AKK A;  2V8J A;  3V8L A;  2ZPE B;  2LQ8 A;  4ZN1 A;  5DLQ E;  2A37 A;  4XTU A;  3WXM B;  5GAM j;  4GLM A;  2EYW A;  4ELZ C;  3OYB A;  3ER0 A;  3RUX A;  2DTH A;  1OOT A;  4EMG A;  2ABL A;  1G3W A;  4C5H A;  1OQK A;  4KUL A;  5L8R E;  1IXD A;  3OYH A;  3A8M B;  1Q95 G;  2DXC A;  2RHI A;  2CSQ A;  3EHQ A;  4X34 A;  2G6F X;  1MGQ A;  3CCS Q;  1WLP B;  1D3B A;  3HSB A;  5C6S A;  3C12 A;  3LX7 A;  1GXI E;  1E6H A;  1MMN A;  4HVV A;  1B34 B;  2X9H A;  1QQJ A;  4N0A C;  2DE0 X;  2LQK A;  2KRO A;  1N9S A;  2R5A A;  1ZHI A;  4J6X A;  2K57 A;  4PJO A;  3VS1 A;  4X1V A;  3ME9 A;  8ATC B;  2VV5 A;  2A0F B;  1OZ3 A;  3M0U A;  1N6A A;  3L2Z A;  2KGT A;  4MZT A;  2L89 A;  1WA7 A;  5LJ5 f;  4O6J A;  1KG1 A;  3THK A;  1QCF A;  3OSS C;  3OBY A;  2AIR B;  2RMO A;  3E9G A;  1Y0M A;  5IH2 A;  3EGD B;  2E64 A;  1YWO A;  3QJY A;  2HNI A;  2XD0 A;  4JJN K;  4DA4 A;  3EG0 A;  4M75 F;  3OSV A;  2VYT A;  3P8H A;  1W1F A;  4II1 A;  5LJ3 f;  4C92 A;  2K6D A;  1K8A C;  1TUD A;  4FYV B;  2E6N A;  5GAN 4;  3IQL A;  3CBP A;  2ZPI B;  2MOX A;  1ZX6 A;  2DJQ A;  2YUN A;  3OS5 A;  2X4X A;  1VQ7 A;  2VXE A;  3VS3 A;  2COY A;  2DZC A;  3GNF B;  3M0S A;  3LH5 A;  2JM9 A;  2C0O A;  4OB3 B;  4M77 E;  2D8J A;  2DER A;  2ZCF B;  2CRE A;  4RCB A;  2E10 A;  3LWH A;  3G4S A;  2DNU A;  2ZGW A;  4AG1 C;  2KMT A;  1VQN A;  3LGF A;  1AOJ A;  1K76 A;  3M58 A;  5CVI A;  1S72 Q;  3GPL A;  2W0Z A;  1B7T A;  1M1G A;  2GBQ A;  1ZUK A;  5CIU A;  5IHK A;  2DEU A;  4FL6 A;  3CPW A;  1U5S A;  2PNI A;  2QA4 A;  2O4X B;  2FEI A;  2DLP A;  3PFS A;  4HA8 A;  2DL4 A;  2BKD N;  3CXC S;  3M53 A;  2K5F A;  2OTL Q;  1GRI A;  5EC7 A;  4FU6 A;  4J9H A;  2FYK A;  2K5L A;  1NJI C;  4E7I A;  1HXD A;  4OMM A;  1W2B P;  4YTL A;  2RI2 A;  1VQP T;  2SRC A;  4EMK C;  3UDC A;  2KRS A;  2O9S A;  7AT1 B;  4M4Z A;  5CKD A;  3UAT A;  1AT1 B;  3CCV A;  1WHL A;  1PWT A;  4M7D E;  2BZY A;  1NPR A;  1NPP A;  1K4U S;  1QLY A;  4J9G A;  2KK4 A;  1YIJ T;  4KUI A;  4LXC A;  3PVL A;  1WJR A;  4FT4 A;  3JCM J;  1I07 A;  3HHT B;  3I56 A;  2C0I A;  2VAS A;  3NGP A;  4PJO D;  2L3P A;  1C0M A;  1K73 R;  4M7A G;  4M77 C;  2CYZ B;  3CC2 T;  2A08 A;  1RAH B;  4Q5W A;  4FM4 B;  3FB9 A;  1I0C A;  1MMG A;  1RAF B;  3G71 A;  2KT1 A;  1JQQ A;  2EIF A;  4FYY B;  4PK4 A;  3E1S A;  3E19 A;  5GAN j;  4JS4 A;  1YBY A;  2CSI A;  1S72 T;  3PNW C;  1K73 U;  1YN8 A;  3H9N A;  3S3N A;  1SG5 A;  2DXU A;  1ABO A;  2RA2 A;  1M1K R;  3WVD B;  3MKD A;  4C92 C;  4QQG A;  2E6Z A;  4BY6 B;  3QII A;  2ROL A;  2XIC A;  1YCY A;  2QI2 A;  5KYU A;  4Z02 A;  4FYX B;  3M9Q A;  3HRU A;  4E7L A;  5GAN g;  5GAN d;  1O9S A;  4HXJ A;  4J9F A;  3RMQ A;  3JCM W;  4B9W A;  4L59 A;  3VUB A;  1BI1 A;  4LE9 A;  1FWZ A;  4F04 B;  5KCH A;  2CP7 A;  2KVQ G;  4A4H A;  4TVR A;  1U1T A;  4RG2 A;  4BI8 B;  2FVU A;  2BE7 D;  2HMA A;  1X6G A;  2RQW A;  1DJ7 B;  5KYY A;  3OMC A;  4C92 G;  1AWW A;  3JV3 A;  4J6W A;  4PLI A;  3CC2 Q;  1NZ9 A;  4KRT A;  1UEB A;  3H0H A;  3BW1 A;  1GFC A;  3MP1 A;  3J80 E;  1MND A;  2EAY A;  1SRL A;  2JM8 A;  2X4J A;  1KC8 R;  3QYG B;  1U8R A;  5GAO q;  1BI0 A;  5KYU B;  2NYS A;  4M7D C;  3HP9 A;  2DL7 A;  1X01 A;  2FZK B;  5IAY A;  3BFM A;  5CQY A;  4OML A;  2MPX C;  2MYS A;  3ZEH A;  1HSQ A;  5GMK m;  1VA7 A;  3JCM b;  2FZC B;  4X9C A;  2YSQ A;  4LD6 A;  2YLC A;  4LUE A;  3CMA A;  1E7O A;  1R0B G;  3TQ7 P;  3I35 A;  4AFS C;  1IGU A;  3GNG A;  1S1N A;  2GF7 A;  3MEV A;  4PJO C;  2NUZ A;  3CXC A;  4D8K A;  2VXF A;  3L2U A;  5FWB A;  3X24 B;  3CC4 T;  2FPD A;  1W70 A;  3NFC A;  3NHN A;  2CT3 A;  2JS0 A;  1UFF A;  1VOM A;  1OZ2 A;  3CCV Q;  1HJD A;  3OYK A;  2F2V A;  1OX9 A;  1GCP A;  2KY9 A;  4KUD K;  3CCR Q;  3M57 A;  2JZ2 A;  3UT1 A;  4JZ3 A;  4OMO A;  2QQS A;  5FLX E;  4CC4 B;  2OAW A;  2EQK A;  2COW A;  1LOJ A;  2E65 A;  3PVQ A;  2DIQ A;  2JUF A;  3NMZ C;  3UWN A;  1JJ2 P;  1YP5 A;  3GIB A;  2P0Q A;  4ESR A;  1TH7 A;  5A0G A;  2E3H A;  1YIJ Q;  1M1K C;  3CC4 A;  2JS2 A;  4OP0 A;  5IT9 E;  1UG1 A;  2ZPF B;  3HRS A;  4C8Q D;  1IRX A;  3TCJ A;  4C5I A;  1M27 C;  5KYN A;  4BDZ A;  3A8H B;  5I22 A;  1Q82 R;  2DZ9 A;  1ACM B;  2LZ6 B;  3SWN C;  4LDX A;  5D6X A;  3HKS A;  2EYY A;  3MEA A;  3VV0 A;  2Y4X A;  1N8R C;  2CP2 A;  2R57 A;  2HAX A;  2I0N A;  5HK0 A;  1SHF A;  4HCZ A;  2H8H A;  1KSW A;  2QA4 T;  2LQN A;  3BDL A;  2PVO B;  4M78 C;  3SD4 A;  1CSK A;  1GCQ C;  2KYB A;  4M78 E;  3QZ5 B;  1LCK A;  3DB3 A;  1VQ7 Q;  1TS9 A;  2JMA A;  2L8D A;  1FYN A;  1V76 A;  3DLL A;  2M1H A;  2DD4 A;  1RAA B;  5GAM f;  3NTI A;  4C8Q A;  4GY5 A;  1I8F A;  3SB2 A;  2IG0 A;  2DM1 A;  5I21 A;  4JRQ A;  2QEX Q;  3CME Q;  5GAN f;  2KI7 A;  3AT1 B;  1UGS B;  1RAI B;  1JJ2 A;  1X6B A;  2GNC A;  1YNZ A;  4FYW B;  3I9Q A;  2DIG A;  2CUB A;  4M7A F;  2FG0 A;  3OS2 A;  3RMS A;  1UB4 A;  3FLG A;  4CC2 A;  2CZ7 B;  4ME7 A;  2KT8 A;  4IUQ A;  4HCB A;  3VS5 A;  2AZS A;  1K8A R;  1CKA A;  3SHW A;  3CD6 Q;  5D6Y A;  4AFQ C;  3EFR A;  2RF0 A;  2Z0W A;  1YWP A;  3CXC P;  3V8J A;  1W6X A;  5CCA A;  3TSZ A;  5KCO A;  3L1A A;  1G2B A;  4L5G A;  2PVG B;  2CP0 A;  8AT1 B;  1A0N B;  3OW2 S;  1WHH A;  4DOW A;  5FU6 B;  1YJN Q;  4E47 A;  1WQW A;  4J8O A;  1PD1 A;  1OU8 A;  1FMK A;  1G3S A;  2DET A;  3UF4 A;  1X2K A;  1LNX A;  3CMA T;  2FO0 A;  2WSC E;  2M0O A;  5FU6 C;  2V26 A;  3CCR A;  4F7U G;  1OEB A;  2E3I A;  2LJ3 A;  3QZ9 B;  1M90 R;  1MNE A;  4OB0 B;  1NYG A;  1NYF A;  1LJO A;  5IN1 A;  1KC8 U;  3EG2 A;  3G7Z A;  1PG5 B;  5CKE A;  2JNG A;  2AKL A;  1G83 A;  4D6W A;  1BIA A;  2K7A A;  3EG9 B;  4LDU A;  3KXT A;  1LPL A;  2HZY A;  3RKW A;  1XNI A;  2EGE A;  1SSF A;  3VS4 A;  1FMV A;  3HRT A;  3URG A;  2HEQ A;  4IUP A;  4N4I A;  1KD1 R;  2HQX A;  1OI1 A;  1K0S A;  4XK8 E;  3A8O B;  3HPW A;  4LDV A;  2DK3 A;  4ORZ A;  3GP8 A;  4PLL A;  4Y92 A;  1E6G A;  2E5K A;  5IXB A;  1Y96 A;  2JN0 A;  2OTJ A;  2JJ9 A;  3S3M A;  1K9M C;  1XJW B;  3QSU A;  1VQ9 Q;  4A63 B;  4FCY A;  3JCM c;  1N27 A;  3OYD A;  2E41 A;  3OB9 A;  2CP5 A;  1YI2 Q;  2DL5 A;  2FPF A;  4M75 B;  3CMA Q;  3HFO A;  1QVG A;  3M55 A;  4M7D A;  2PUO B;  3QPH A;  3VS6 A;  2QQ9 A;  5GMK h;  2WSE E;  3L2R A;  1JBM A;  3CCQ T;  2NUT B;  3M56 A;  1BB9 A;  1SEM A;  2PTK A;  2D0N A;  1OV3 A;  4M7D G;  4XU2 A;  2LC4 A;  3OQ5 A;  1K0X A;  4RUG A;  4WF2 A;  2QGG A;  3QG1 A;  2ED1 A;  2RHX A;  3EFO B;  1BI2 A;  3CCE A;  5I2M A;  2JT4 A;  3G6E T;  1HK9 A;  2P0K A;  2CP3 A;  4KBM B;  3GF5 A;  1FX7 A;  1CKB A;  4XAX B;  2O31 A;  2WAC A;  1WGS A;  1QWE A;  2YWW A;  2ZPB B;  3JB9 D;  4KGZ B;  1JXO A;  2XU8 A;  2O88 A;  1G5V A;  1KQS A;  1RAD B;  1H92 A;  2EQU A;  2LCC A;  4NS5 A;  1UGQ B;  1VQ9 T;  2XID A;  3VYG A;  2R5M A;  5GAN 7;  3EFS A;  1GFD A;  2GQI A;  5J39 A;  2YT6 A;  4OF1 A;  3LWI A;  1IZ6 A;  4HCC A;  2XMF A;  3M0Q A;  1OUL A;  3GLX A;  1SF9 A;  2RD1 A;  4M75 C;  1U06 A;  4NL3 A;  4ZGD B;  1M2O A;  1RAG B;  3EG1 A;  1YI2 A;  2GTO A;  1X43 A;  1I81 A;  5HCK A;  4C0D B;  2VC8 A;  1ARK A;  2DBK A;  1SRM A;  5CKB A;  1IO6 A;  2DMO A;  1V29 B;  4QT7 A;  3CCQ Q;  4FW2 A;  2ENM A;  4LDY A;  4D8D A;  3ZFJ A;  4CRI A;  1YJN T;  1UDL A;  3FDR A;  3I55 Q;  4J9E A;  9ATC B;  1BYM A;  1MMA A;  2ECZ A;  1K8A U;  4PFZ A;  4C8Q E;  1YJW Q;  1H3H A;  3PIP A;  4FIB A;  2YDL A;  2XDB A;  2LCS A;  2F5T X;  3QUI A;  3HL8 A;  3CCL T;  4QQ6 A;  4RCC A;  4C92 F;  2KNB B;  4M7D F;  3LYI A;  1BI3 A;  1UE9 A;  4RTV A;  2EYQ A;  2G3R A;  1EIF A;  3JB9 G;  4ELY C;  4ZN3 A;  4CI0 C;  2RK2 A;  2OI3 A;  1N9R A;  3CCU A;  4R56 A;  1M9S A;  1W2B S;  2CP6 A;  2DTO A;  2BUD A;  3MP6 A;  4E6R A;  4C0D C;  3JB9 H;  1BCO A;  4J7F A;  3TRE A;  1BIB A;  2YLB A;  4DBQ A;  1VQ5 Q;  1M8V A;  5M9O A;  3MPU B;  2LDM A;  1V1C A;  5CAI A;  2K3Y A;  2NUT A;  2DD5 A;  2NUP B;  2QEX T;  4IUT A;  3CC7 T;  4C0Z A;  4BI4 A;  5KYX A;  1KIK A;  2L0A A;  2QGF B;  2KAF A;  2YRV A;  1VQL Q;  2DEQ A;  2CDT A;  2EKO A;  2OJ2 A;  3CPW S;  1NJI U;  2DKG A;  3VKI A;  3DLM A;  1S72 A;  4E2F B;  2QTX A;  3RR6 A;  1Q81 U;  4KH1 B;  3PIO A;  2BTT A;  3OYI A;  5FRN A;  1X2Q A;  3CQT A;  4M77 B;  2CT4 A;  1Q82 U;  5KYY B;  2AHJ B;  3OYF A;  2EJG A;  2LVM A;  4PJO G;  2A28 A;  1WPY A;  2CUD A;  3G4S Q;  4HCK A;  2VVK A;  1RI0 A;  1T3L A;  4M78 G;  2QXF A;  1AD5 A;  3KFV A;  2EPD A;  4IUR A;  1VUB A;  4XU1 A;  3NTH A;  4EMK B;  4QKU A;  4JZ4 A;  2RI5 A;  1NJI R;  2ESW A;  4OB2 B;  1WHM A;  2DXB A;  4F7U F;  3SWN A;  5LJ5 g;  2EFI A;  5LJ3 e;  1AZE A;  1TUG B;  4Z88 A;  2XHC A;  3EH2 A;  4RTW A;  3EH1 A;  3LH0 A;  2EQI A;  1WHG A;  3QDF A;  1K9A A;  2KE9 A;  2RH2 A;  5IHI A;  5HKC A;  3U23 A;  3OYJ A;  3JSC A;  3CCM A;  4CC7 A;  2X4W A;  4M78 A;  2J06 A;  3CD6 T;  5ECA A;  3VS7 A;  2C0T A;  2D8H A;  1VQ6 A;  1D3B B;  4F17 A;  2YUQ A;  1QKX A;  1K73 C;  3J7A F;  1B34 A;  1WX6 A;  1D09 B;  2CH4 A;  1VQ8 T;  1BK2 A;  4AMC A;  2DVE A;  1QVF S;  1KK7 A;  2GQV A;  2QQA A;  1PRL C;  3HTR A;  4A54 A;  1QVG P;  1H3Z A;  2L3Q A;  4DEY A;  2ATC B;  3L2Q A;  3PGG A;  1G8X A;  3CME T;  3CC4 Q;  3CCJ A;  2YRC A;  3CCS A;  2KBT A;  2VUB A;  2AZV A;  1YIT T;  2M51 A;  1NLO C;  1WIE A;  3EGD A;  3G4S T;  2PVD B;  1W4S A;  2HKQ B;  3CCR T;  2NLU A;  1AWO A;  2B86 A;  2DL8 A;  3UA7 A;  1EX4 A;  1D0Y A;  3QO3 A;  5IHN A;  1Z9Q A;  2V8I A;  1QVP A;  4XTZ A;  3OYY A;  3I55 T;  3L2V A;  4OGC A;  3X26 B;  1NG2 A;  4NOY A;  1VQ7 T;  5IXF A;  1VQ4 Q;  1U3O A;  3SFM A;  2JTM A;  1UJY A;  4RMO A;  1KD1 C;  1QVF P;  3C0C A;  2K79 A;  2MWP A;  3EAE A;  2KR3 A;  1G3T A;  4QQD A;  4JJC A;  4JS5 A;  1M3A A;  4M7D D;  3ASK A;  2K5I A;  1RLP C;  3A98 A;  4LDW A;  1PSF A;  1PKS A;  1VIE A;  2X4Y A;  1H8K A;  3CCU T;  1JO8 A;  2LQW A;  2M9U A;  1Y57 A;  3REA B;  2IVW A;  2W10 A;  2EVR A;  2JXB A;  1TXQ A;  2RHU A;  3OYM A;  3S6W A;  2ZZD A;  2RNA A;  4OMP A;  2JTE A;  1MV0 B;  1N5Z A;  1KD1 U;  5GJW B;  2CZ6 B;  1WJS A;  1VQK A;  1AEY A;  2DAQ A;  2NWM A;  1QW1 A;  2M02 A;  2DIL A;  5CR2 A;  3JB9 F;  4BUG A;  1D0Z A;  3QXE B;  4RKU E;  3MO8 A;  4EDU A;  3M5A A;  1WZO A;  1M3B A;  4RTY A;  2MMP A;  2P4T A;  4BD3 A;  1Q86 U;  1RAE B;  4ATO A;  1UTI A;  3DB4 A;  5GMK e;  2D1X A;  4PFO A;  1VQ4 T;  2DTI A;  1D1A A;  4M7A B;  4ZTJ A;  4HT8 A;  4IKF A;  2RJC A;  3MCA B;  2X3W D;  1PSE A;  3LLR A;  1M8M A;  3JRZ A;  1K1Z A;  3JAM E;  1VYV A;  3CPW P;  3H0I A;  2FB7 A;  3VYH B;  4XU0 A;  1UGV A;  5GMK i;  1JRI A;  3GOX A;  5J3B A;  4C92 B;  3CEY A;  1VQ5 A;  4QVZ A;  2QQB A;  2A7Y A;  2EGC A;  3MET A;  3EG9 A;  1WYX A;  4DOV A;  1TSF A;  1WFW A;  4A53 A;  2HDA A;  5GJV B;  3VRY A;  1T3S A;  4C8Q G;  2QAZ A;  3OBW A;  1YJW T;  1YIT Q;  1TU0 B;  4M77 D;  5GMK j;  3MP8 A;  3M4G A;  4LD9 K;  3PTA A;  4JLI A;  5LL6 S;  5GAN h;  3JCM f;  3JCM g;  1PD0 A;  1Y7X A;  1JB0 E;  3X20 B;  4C92 E;  4PJN A;  2EJ9 A;  3HFN A;  1UHF A;  4B6M A;  2QQR A;  1IHW A;  3NPF A;  1M5Q 1;  2DRM A;  4E7S A;  4M78 F;  1M90 U;  3RDV A;  2SEM A;  3L42 A;  1YCS B;  1KQS S;  3CCE T;  4F7U B;  1YJ9 Q;  2K3B A;  1TG0 A;  1X27 A;  3M0P A;  2J05 A;  4AT1 B;  4QVD A;  3M4Y A;  4M7A E;  3CCS T;  4N4G A;  2HSP A;  5FRM A;  4C92 D;  4XTV A;  3CCQ A;  1YJ9 A;  1OX8 A;  4RTU A;  5EG2 A;  4DBH A;  1YJW A;  2LT1 A;  1M90 C;  1JXM A;  5CQX A;  3SWN B;  3OMG A;  1UGR B;  5HK3 A;  5CK9 A;  1Y96 B;  4JPB W;  3Q1J A;  1QP3 A;  3QWX X;  3CCV T;  2DYB A;  4M75 G;  2ROT A;  1AHJ B;  3VU3 C;  2QG9 B;  1J3T A;  5DLO A;  1VQ6 T;  2QYZ A;  3QBY A;  1QCN A;  5C0M A;  4WCI A;  4JJB A;  4F16 A;  1IGQ A;  5GAO p;  2HQH A;  1TUC A;  2CZ1 B;  4F14 A;  4M7D B;  2KDS A;  1WQ7 A;  2DJZ A;  2GCX A;  4VUB A;  2J7I A;  3CCL A;  2B8A A;  2CS7 A;  3VRZ A;  1QMC A;  1ZSG A;  1KQ1 A;  4F7U E;  5GAM g;  2CZ0 B;  3OS1 A;  1VQM A;  4OGE A;  2AT1 B;  2MI6 A;  2V1R A;  2JVV A;  2KQW A;  2IPO B;  3OA6 A;  4C5E A;  1K9M R;  2K4Y A;  4E7K A;  2EYZ A;  4R55 A;  5GAN e;  4BI3 A;  2BZX A;  2LJ0 A;  1HD3 A;  1UJ0 A;  5LJ5 h;  3L2W A;  2RJF A;  3G1J A;  3CCE Q;  3QDR B;  2EYX A;  1YHQ Q;  3JB9 J;  1YJ9 T;  1YHQ A;  1GBR A;  2EQJ A;  1QWF A;  3N5B B;  4LUD A;  6AT1 B;  2L3S A;  1OPK A;  2ED0 A;  2YUP A;  5GAM d;  2LRQ A;  1P92 A;  3D7S B;  5KYW A;  4ANJ A;  5J26 A;  4B9X A;  3TU4 K;  3I5S A;  5GAN 8;  2BZ8 A;  1ZSZ C;  4IUU A;  4MDX A;  1EZZ B;  3UPU A;  3X28 B;  4XTY A;  3QJ6 A;  3PMI A;  1M30 A;  2LX9 A;  3EG3 A;  1SPK A;  4XQ3 A;  4MZM A;  2L2P A;  3J81 E;  1VQM Q;  1R0C B;  1BU1 A;  3ULR B;  4RTX A;  1VQ9 A;  3S3O A;  3EGX B;  4AFU C;  1H64 1;  2XK0 A;  2LCL A;  4IIO A;  4E7H A;  3OYN A;  4PJM A;  3I5R A;  2EGA A;  3OYG A;  1AWJ A;  4C0F A;  2LJ1 A;  3PMT A;  4P5N A;  3TSW A;  3OYC A;  3F70 A;  1WDX A;  4MDW A;  4DEX A;  4C8Q C;  2MF2 A;  1Q7Y R;  1PCX A;  2DYI A;  3G6E A;  1M2V B;  2OTJ Q;  4J7I A;  1EFN A;  4PKC C;  3DKM A;  1ZBJ A;  5KE2 A;  1VQO T;  4BAC A;  1ZUU A;  4LN2 A;  2ZPG B;  3PE0 A;  2XDD A;  1RI9 A;  1N8R R;  3H0F A;  3C94 A;  2CH4 W;  2D9T A;  4M78 D;  1VIF A;  3ZBD A;  5GAO l;  1UGP B;  1Q82 C;  4ZGJ B;  2RJD A;  4E7J A;  4MML A;  2RK1 A;  2H3E B;  1VQM T;  1RLQ C;  2FPE A;  2HBW A;  1OYX A;  2QTV A;  1VQO A;  2RJE A;  2RQU A;  4RG8 A;  2OTL A;  4OB1 B;  4MZP A;  2EBP A;  4BE0 A;  1UEC A;  3C4S A;  3RKY A;  5L23 A;  1Q86 R;  1KFZ A;  1TWB A;  5CKH A;  2X35 A;  1IHV A;  3JCM V;  2L5Q A;  2F1L A;  2LMJ A;  4HT9 A;  1FXX A;  1VQK T;  4AG2 C;  3RKX A;  1G3Y A;  5GAN 2;  1PRM C;  1MV3 A;  3UA6 A;  2BIV A;  1ZSZ A;  2DXT A;  2RPN A;  2WSF E;  1WHK A;  2LX7 A;  4MMK A;  2HBP A;  2F5K A;  1XQH A;  1VYT A;  3JCM h;  3P8B B;  2HSE B;  2A36 A;  3CBO A;  1AZG B;  4Y28 E;  2J6F A;  1Z9Z A;  3INZ A;  1NEG A;  3SEM A;  1I5O B;  3V8K A;  2YXY A;  5KH6 A;  4XTX A;  1R8O B;  1WHJ A;  3GBQ A;  4R0K A;  4M7A D;  2VWF A;  4DQ2 A;  1VQ5 T;  4PJO B;  1Y07 A;  2J6O A;  5GAM e;  5FWC A;  4K11 A;  2RO0 A;  2GFA A;  3OY9 A;  1TOV A;  4X9D A;  2OAU A;  2C06 A;  2LTO A;  2E1H A;  1VQL T;  2D0Q B;  4KGV B;  3RER A;  1BBZ A;  3CME A;  2COZ A;  4PJJ A;  3BDU A;  2QEX A;  1F1B B;  2X51 A;  4CC3 A;  3O8V A;  3LW5 E;  2P84 A;  1X75 C;  2PU9 B;  4KT0 E;  3QYH B;  4BB7 A;  3X25 B;  5FW9 A;  2I2L A;  3JCM Q;  4LNP A;  3I56 T;  2DFU A;  3M0T A;  1D0X A;  4FSX A;  2MK5 A;  2H3J A;  2DRK A;  3OYA A;  1D1B A;  2FRW A;  3AHU A;  1VQO Q;  1R77 A;  1YIJ A;  1Y71 A;  4DBF A;  3TEE A;  4J9B A;  1M2V A;  4C0G A;  4JUV A;  1YI2 T;  4OMF B;  2RQT A;  2HCK A;  3KUF A;  2A3L A;  3CCU Q;  5FRO A;  2DVJ A;  3A5Z B;  2KRN A;  2VB6 A;  3JCM P;  1I1J A;  3KBG A;  4JJD A;  4J6Y A;  1VQ4 A;  2CGH A;  1RL2 A; 
#chains in the Genus database with same CATH homology
 1VQL Q;  1N8R R;  3I56 Q;  1M90 R;  3CCQ Q;  1VQM Q;  1VQ6 Q;  3CCV Q;  3OW2 P;  1VQO Q;  1W2B P;  1VQP Q;  1KD1 R;  1S72 Q;  3G71 Q;  3CPW P;  1YI2 Q;  1YJN Q;  1KC8 R;  1QVF P;  1VQN Q;  1VQ8 Q;  1YIT Q;  1K73 R;  1K8A R;  1K9M R;  3CCR Q;  3CMA Q;  1Q7Y R;  1Q86 R;  3CD6 Q;  1QVG P;  2QEX Q;  3CCJ Q;  1NJI R;  3I55 Q;  3CME Q;  3CCM Q;  3CCS Q;  2OTJ Q;  1Q82 R;  1VQ5 Q;  1YJ9 Q;  1KQS P;  3CCL Q;  3CC4 Q;  1Q81 R;  3G4S Q;  3G6E Q;  2QA4 Q;  2OTL Q;  3CCU Q;  3CXC P;  3CC7 Q;  1JJ2 P;  3CC2 Q;  1VQK Q;  3CCE Q;  1YHQ Q;  1VQ4 Q;  1M1K R;  1VQ9 Q;  1VQ7 Q;  1YIJ Q;  1YJW Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...