1YIJQ

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
molecule tags Ribosome
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yijQ00
3CCLQ 2OTLQ 3CCSQ 3CCUQ 3OW2P 1K8AR 3CCEQ 1YJ9Q 1VQMQ 3CCJQ 1YHQQ 1QVGP 1YJWQ 1Q82R 1YJNQ 1VQ5Q 1VQLQ 3CCQQ 1K9MR 2QEXQ 3CD6Q 3G4SQ 3I56Q 3CMAQ 1VQNQ 2OTJQ 3CCMQ 2QA4Q 1KC8R 3CCRQ 1VQ7Q 3CCVQ 1VQPQ 3I55Q 1NJIR 1KQSP 1Q7YR 3CMEQ 1Q86R 1N8RR 3G71Q 1JJ2P 1YI2Q 3CPWP 1M1KR 1K73R 3CXCP 1VQ8Q 1VQ4Q 1VQOQ 1QVFP 1YITQ 3CC2Q 1VQ9Q 3CC7Q 1S72Q 1VQKQ 1YIJQ 1W2BP 1KD1R 1VQ6Q 1M90R 3CC4Q 3G6EQ 1Q81R
chains in the Genus database with same CATH superfamily
1YIJA 1WLPB 1Q81U 4RG2A 2JZ2A 2YUNA 1VQ5Q 3CC2A 2PUKB 3BDUA 1UEBA 2VB6A 1KHIA 1WYXA 2LCLA 2QXFA 2W0ZA 2NWMA 3OW2S 2XG8D 1NPPA 2PNIA 1FMKA 4PLIA 1BBZA 2F2WA 5KYWB 1T0JA 4J9DA 1PG5B 2VV5A 4B6MA 1C6VX 3LWIA 3OYJA 2EFIA 1LNXA 1RAIB 2FEIA 2JN0A 1HYOA 4TVRA 4E7ZA 3JCMd 2BKDN 2Y4YA 3EG1A 3LGFA 4Q5WA 2DXTA 4RTTA 1X2KA 2VXFA 3P8HA 5FU7B 3GPLA 2QQBA 3SB2A 4WF2A 2DL8A 2K57A 3G6EA 4EMKA 3VS0A 4M77D 2ABLA 1OPLA 4AG1C 3CD6Q 2E6ZA 3FJ5A 4J9EA 3CCUA 4JRKA 2JTEA 1V76A 3GIBA 4M75F 3MCAB 2SRCA 1BI3A 2EBPA 4M78E 4J6YA 2DAQA 1QVFP 1VQ9Q 2MMPA 2KDSA 4CI0C 3I5SA 1X2QA 1UG1A 3VS4A 2QAZA 1B34A 3FLGA 2X9HA 4RTUA 1GBQA 1WXUA 3EFRA 3HRTA 2QG9B 4EIKA 2DXBA 2FPFA 1Q82C 3CEYA 4RG8A 2CSIA 3OYFA 1M90R 2RQWA 2KYBA 1PKSA 2RM4A 4J83A 1IGQA 4M78C 1VQLQ 3QWYA 2F5TX 3V8LA 2WACA 3DB4A 2HZYA 1RL2A 2GQIA 2MAMA 5I21A 1WXBA 2LQKA 3M4YA 4JZ4A 2EJGA 4IUVA 3MEAA 1VQ4Q 4E7LA 3FIFA 2KT1A 1OU8A 5ECAA 1BKBA 2CYZB 1VQ9A 3MEWA 2HL3A 5GAN3 2DRMA 2K5LA 3HRUA 4QVCA 2BZYA 2OAWA 1KIKA 2NUTB 2RA2A 3QDRB 3RIRA 5GAN5 5GAMj 2L89A 3H0IA 3RBBB 1AVZC 4A4EA 2EIFA 5IAYA 5GMKm 4KRTA 1PSFA 1NLPC 3CPWA 2OX7A 1VYUA 3I55A 1K9MC 5LL6S 2XDDA 5HCKA 1P92A 5CK9A 2DLPA 4JLGA 3P8BB 4E2FB 1JB0E 1KC8U 1JEGA 2H3EB 2OTJA 2C0TA 3PE0A 5LJ3j 4P5NA 1CKBA 5CKHA 4C0FA 2EPDA 4PJOC 2CP3A 3S3NA 1YWPA 2YXYA 4IUPA 3LWHA 4OGCA 4C92A 4M7DF 1X27A 2HCKA 4C0DC 3JB9H 2YRVA 4JRQA 3GNFB 2E64A 5CR2A 4NOYA 4ZTJA 4JUVA 5KYUA 2O01E 2O4XB 4C8QB 2OTLA 4M78F 3CCJQ 3M0RA 1FWZA 2DRKA 4C92C 2E12A 3L2VA 1MMAA 2K7AA 1M2OA 4DOVA 1VQNT 2YUQA 2FB7A 1ARKA 1SSFA 1GFCA 3EG2A 1VQ9T 4C8QE 1AWJA 4GBQA 5LJ5e 1RAGB 2LQNA 1U06A 4O6JA 2FYKA 3M9QA 1N6AA 4RTYA 1M3CA 4ZTFA 7AT1B 2MI6A 1M1FA 5HK0A 2JW4A 3VRYA 4NL2A 1VQKQ 3VUBA 2DBMA 4KH0B 4C5GA 1BYMA 3RUXA 3MKDA 4ELYC 4PJOF 4A4HA 2G6FX 1BB9A 8AT1B 3LYIA 4M7DD 5CKFA 3OYKA 1ACMB 3CPFA 2LX7A 2RH2A 3C4SA 3RKXA 5GAMh 1YJNT 1SKUB 4Z02A 5GANd 1M90C 2ESWA 2K2VA 3QUIA 1NJIU 1XQHA 1NZ9A 3VS5A 1QVPA 5LJ5h 2GF7A 4C92F 3A5ZB 1O9SA 4YTLA 2QA4Q 2M02A 2L8DA 4BD3A 3G6ET 1AT1B 4OMFB 4HVVA 2QGGA 1JJ2P 1RAFB 4ZN3A 1VQ7A 3M59A 3I9QA 1G8XA 2RHUA 3UWNA 3CCVA 3OYYA 1OI1A 2L0AA 1H3HA 1AEYA 3PIPA 1NPRA 1MV3A 4R0KA 1UJYA 4M7AE 3CCVT 1IHVA 1KD1U 2QDYB 2M16A 3CCLA 1VQLT 4V2SA 3QWXX 1K73R 3CXCP 4HCZA 3HL8A 1GRIA 3FB9A 1YITQ 2RJEA 2EKHA 5FU6B 5DY9A 4L59A 5GAOm 3JCMh 3EGDA 2X35A 1KQSS 1QCNA 1K8AR 1PRLC 3M0TA 2E5KA 5KYWA 2XICA 4PJMA 5GAOq 1KHCA 3PGGA 3E1SA 1UHCA 1G3YA 4EMKC 2D9TA 2C0IA 4LDVA 1NM7A 3OSVA 3HRSA 3L2RA 1OX9A 1W1FA 1MHNA 1D3BA 3JCMg 1FMVA 2KSSA 5GAOr 3QDFA 4M75E 1PD0A 1SEMA 2LRQA 3GLXA 4J9GA 1M1KR 3VJPA 1M1KC 2P0PA 4M77G 1YI2T 1WA7A 2JNGA 4OVAA 1M8VA 1I8FA 2IVWA 4OB3B 6AT1B 1X6BA 3R6OA 1ZHIA 5CCAA 2XD0A 4N0AA 4ESRA 3OYBA 3OS0A 2DD5A 2RHIA 3QIIA 2MCNA 1OU9A 1HXDA 3QPHA 2OJ2A 3QBYA 1D1BA 1RLQC 3P8DA 3CCJT 3M56A 1BI1A 1M9SA 1VQ8Q 3MEUA 5GAMd 5GAMe 1LVKA 1RI0A 5GJWB 1KD1R 2KK4A 2F69A 4NS5A 1KSWA 1NJIC 4ZGEB 1Q7YC 4L6V5 4HCKA 3LH0A 2RI3A 3I35A 5IN1A 1K9MR 2EYWA 1VQ4A 1M30A 3C12A 2KRSA 3VV0A 2EJ9A 3E9GA 1Q86C 1KQSP 1IO6A 2GFAA 1MMGA 3OSSC 3PNWC 1VOMA 2EYZA 2KMTA 4BDZA 1Z9ZA 5GANh 3JCMQ 2RJCA 1D1CA 2V1QA 4AT1B 4DBHA 2BE9B 4E7SA 2OAUA 5I2MA 2CS7A 1GCPA 2DNUA 3H0HA 1WZOA 2HKQB 1BI0A 2XKOC 2DL3A 1BI2A 1YBYA 1D0XA 4OF1A 4M7AF 1SRMA 3UA7A 3JCMc 4IKFA 2QTVA 3CC7T 2O31A 2YSQA 4F7UG 3G71A 5KYXB 1G5VA 2EQUA 1SHGA 1WIEA 2EGCA 4R55A 5FRNA 1K9AA 2K3BA 1OULA 3CCLQ 2R58A 9ATCB 1VQ8T 1QMCA 2RF0A 3X26B 2E6NA 1U3OA 3CCRQ 2Z0WA 1PKTA 3L2ZA 2W10A 2DE0X 3PVLA 4C0DB 5HK3A 2XMFA 4KBMB 1LPLA 3NGPA 3NTKA 4CC3A 5I2SA 3MO8A 1PNJA 1PRMC 2ZPEB 1LCKA 3N5BB 3VKIA 1NE8A 2E5QA 3EG0A 2A08A 2LNHB 1FMWA 1O75A 5J26A 1BCMA 1VIFA 4M77F 4C5EA 1ZUKA 3UDCA 2GQVA 3H6ZA 5AYFA 5LJ3h 1R8OB 2ZPHB 1SG5A 2YRDA 3J80E 4OMOA 1G83A 1N9RA 4FSXA 4KT0E 4XU0A 3UATA 5A0GA 3I56A 1T3LA 3OMCA 5GAOn 1K76A 5FWCA 5FW9A 1M8MA 3I56Q 4X9CA 1KQ2A 4M7AC 2KR3A 1Q7YR 2WSCE 1JO8A 2KYMA 3WXMB 4GLMA 2K3XA 4PLLA 2EVRA 2CT3A 4FYVB 3H0FA 4ORZA 2YHTA 4BY6B 4DQ2A 5A2QE 2HQEA 1YITT 1HSQA 3V7CA 3EH2A 1VQPQ 1TSFA 1IZ6A 5CAIA 2WSEE 1YCYA 3I55T 3EGXB 4HXJA 4XTVA 2BE7D 3CCLT 2VUBA 4CC7A 1XNIA 4LDWA 2RNAA 2FVUA 1JJ2A 2ATCB 4Y91A 1Q81R 1I1JA 3QHSA 3OMGA 4F7UF 2QEXQ 2DK3A 2RHZA 1K1ZA 4BI4A 1YHQT 3GF5A 4M77C 4QKUA 1VYTA 4C0ZA 1M3AA 2CP7A 1PM3A 1YIJQ 4R56A 3EHQA 4WCIA 2D6FA 1YHQA 3A8HB 4F14A 2CT4A 1QW1A 1YHQQ 1H3ZA 2HMAA 3DKMA 4BE0A 2DERA 1UHFA 1KQSA 1WHLA 2O4XA 4KULA 1YP5A 4RTXA 1PD1A 1N27A 1B34B 2QQAA 1VQMA 3L1AA 1M27C 3NTHA 1IREB 3CMAA 2HNIA 2KNBB 2RB6A 3CMAQ 4CC4B 4FIBA 5LJ5j 1TU0B 4Z89A 1AOJA 1ZUUA 2QASA 1MNEA 2NLUA 3OYEA 4LDYA 5FWBA 4F16A 2LC4A 1VQOA 4E7KA 2QEXT 1QVGA 4J6XA 1HD3A 2RO0A 4PK4A 3CC4Q 3QXEB 1U1SA 3CCRA 3GBQA 3HHTB 2EW3A 3PMTA 1QKWA 3OS5A 2EQMA 2HD0A 2AKLA 3QG1A 3NMZC 3JCMf 3QJ6A 1E6HA 4HKEA 1Y57A 2ZPGB 1WHMA 4CRIA 4M4ZA 2J05A 2M0YA 2VWFA 3JB9D 4A4KA 4LNPA 1KJWA 4HCCA 2X4XA 2QQSA 3QZ9B 5GANg 4IIOA 3EAEA 3CC4A 2F5KA 3MP1A 1Q86R 1OEBA 2YLBA 2JTFA 2YUOA 3ER0A 5LJ5d 3UPUA 2ECZA 1FX7A 4AMCA 4GY5A 2QGFB 3QO3A 2A37A 1IHWA 1KD1C 1VQPA 5IH2A 5KYYB 1T0HA 2COYA 5CKEA 1HJDA 1R77A 1NG2A 2X4WA 3M0PA 1UDLA 2LQWA 5KYUB 2KEAA 3M0UA 1NEBA 3WVEB 3OBWA 2O9VA 4RCCA 2RJDA 3FJPA 3LX7A 3MPUB 1KC8C 4FM4B 1U1TA 4RTVA 4F7UB 1OOTA 2XHCA 4ELZC 2FZGB 4ZGDB 2DYBA 1IRXA 1AHJB 2YLCA 2RPNA 2B86A 1BCOA 5I22A 3OYLA 1FXXA 2MF2A 5L8RE 4FCYA 5FU6C 3TSZA 4IURA 1K8AU 3JCMP 1TG0A 2PUOB 3M53A 2RHYA 4D6WA 5FRMA 2A28A 1TTHB 1B3QA 1TOVA 4IUUA 2E4HA 4JRIA 1SRLA 3UT1A 3CCMA 2K5FA 3E9FA 3SWNB 1YI2A 2FPDA 1Q82U 4LDXA 1N8RU 1H8KA 5IHNA 1W2BS 1RAHB 4KUIA 1QWEA 3OW2A 3QJYA 5DLQE 3OS2A 2RQVA 1RACB 2I2LA 1OX8A 5HY6A 2MOXA 3RERA 3L2UA 4MZMA 4KGXB 1QP3A 3OW2P 1G3TA 4DEXA 2RI5A 1AD5A 2A0FB 2LNVA 2CZ1B 2LT1A 1BU1A 4KUDK 3M5AA 4NL3A 4K11A 1VQOT 3CPWP 1W70A 2EYYA 2ED0A 2CP0A 1M2VB 4PJNA 2JVVA 1M3BA 2L3SA 3V7RA 3ASKA 2KXCA 1QVGP 1JQQA 2VKNA 4XAXB 1I5LA 5L23A 2KI7A 3E2UA 3CCVQ 1I81A 2FZKB 4PJJA 2J7IA 2KXDA 2EGAA 1WJRA 4IUTA 2DL4A 4LD6A 1MMNA 2VGMA 3UF4A 1UB4A 1X43A 2H8HA 3L2QA 2GTOA 2IIMA 4E47A 2ZPIB 3HFOA 1QVFS 1MNDA 4OB1B 2LJ0A 3CMET 2BZXA 3H41A 4PJLA 3X25B 3BE3A 4XU1A 4AFUC 1W2BP 2LJ3A 3X20B 1D0YA 3OYCA 1VQLA 1Q81C 1RAAB 2PVGB 2OTLQ 2FG0A 5GAN7 1YJ9Q 1W4SA 1JXOA 2LMJA 1PSEA 4JDSA 2O2OA 2OTJQ 3V8KA 1IB8A 5LJ5f 2DEQA 4J7FA 4F7UA 5KCHA 4Y92A 5D7UA 3OQ5A 2HEQA 4BI8B 3RESA 1WHGA 2QQRA 3ZFJA 4BI3A 1WQWA 2CH4A 1M2VA 3JB9J 3EGUA 3DLLA 1OPKA 3V8JA 2KAFA 2HBWA 4D8KA 3CCEQ 1GBRA 2ED1A 4HT9A 4M77E 4PJOE 1U5SA 1PHTA 3HFNA 2C06A 1VQ6A 3A8MB 5IHKA 1ZUYA 1LOJA 1VQPT 4M75A 1VQ7Q 1H641 3I55Q 2QI2A 2KQWA 5KE2A 3QSUA 3X28B 3TREA 2V8JA 3EFOB 1AZEA 4C0GA 1EIFA 1KK7A 4M7AD 1TWBA 4AFSC 5CIUA 3CC4T 4XU2A 2VC8A 2GTJA 2NUZA 3BFMA 5EG2A 3DB3A 5IXFA 4DEYA 4MDXA 3QYHB 1MMDA 5CKBA 2CZ6B 1YJWQ 1RUWA 2FRWA 3ZL7C 2L3QA 3SFMA 4A4GA 2ZZDA 2CP2A 1KFZA 1ZSGA 2LX9A 1ZQ1A 3OYAA 2XK0A 3MP8A 3INZA 2EWNA 3CCMT 1IXDA 2D1XA 3CCJA 3R6NA 2G3RA 2DBKA 4JS5A 2RMOA 3MHXA 1YNZA 2JMAA 1NBEB 4J9CA 3JCMW 1TUCA 3HPWA 2DIQA 4XTZA 3LGLA 2D0QB 3OS1A 3RMSA 4JLIA 2E41A 3S6WA 2JM9A 2MPXC 1DJ7B 2H3JA 2ROTA 3CC7Q 4LD9K 3CC2T 2GNCA 2P0QA 2OTJT 3CPWS 3GOXA 3CCUQ 2F2VA 4LE9A 5GAMg 2CZ0B 3CMAT 1X01A 2OTLT 2DILA 3G71T 1RI9A 5GAN6 2CP6A 2Y4XA 1D3BB 3VS1A 3C94A 1XJWB 3WVDB 4ZN1A 4DBFA 3CD6T 2EYXA 3EG9B 5GAOp 4E7IA 2LCCA 1GFDA 1Q82R 2YWWA 4ZNXA 1UECA 5I11A 1JU5C 2SEMA 1Z9QA 1MV0B 2DTIA 3A8OB 1NYFA 1YJ9T 4CC2A 3M54A 2RQRA 2P4RA 2J06A 1OYXA 4OB0B 2EQIA 5GJVB 1IGUA 2HSPA 3KUFA 3FDRA 1D0ZA 4DBQA 3Q1JA 3RKWA 3X24B 3MJXA 4JJNK 4LN2A 5J39A 2L5QA 1XOVA 1S1NA 2QK0A 4C8QC 4ANJA 3C0CA 3A8LB 1UFFA 3URGA 4FU6A 5KH6A 4L5GA 1WHJA 3MP6A 3M4GA 4DOWA 1K0SA 4N4IA 1OQKA 5KYNA 4MMKA 1WPYA 4A4FA 2MIOA 5GMKj 3CCQA 1N5ZA 1NLOC 4VUBA 2KRNA 1S72T 2A3LA 3O8VA 4C92D 2DKGA 2QDLA 2IG0A 4OB2B 1S72A 4EMGA 2RK2A 3L2WA 1NYGA 3SWNA 4PFOA 1WX6A 2MWPA 1PWTA 1H92A 2NUPB 3BW1A 1N9SA 3RR6A 1YCSB 5GANf 1GL5A 3I56T 2X4JA 2GCXA 4J7IA 2CKKA 3TCJA 4X34A 2JJ9A 1V1CA 2YT6A 4QW2A 2RD1A 2EAYA 2AT1B 4X1VA 2QTXA 2CGHA 3HTRA 3JB9G 4BUGA 2D0NA 4F04B 1N8RC 1Y96A 5IT9E 3CCSQ 4N4GA 4M78B 2LDMA 3M0SA 4LDUA 1YJ9A 4C8QF 3CCQT 1R0CB 2KE9A 4FL6A 2JS2A 2O9SA 1VQKT 5AT1B 4N4HA 2K4YA 2V26A 4PL6A 4M7DB 4M7DG 4MZPA 4ME7A 2GBQA 1S72Q 4HCBA 3G7ZA 2M0OA 1VIEA 1M90U 2CUDA 3VS3A 5IHIA 5D6XA 2DYIA 4JJBA 2X4YA 5DLOA 3J7AF 2ZAEA 2YDLA 1GCQC 2HQXA 1RADB 1U8RA 3IQLA 1JXMA 1UGQB 2E3IA 3A1PA 3KFVA 2GGRA 4JZ3A 2LQ8A 3VS2A 4LXCA 1I4K1 1GCQA 3S3MA 5LJ3d 1TUDA 4RUGA 2R5AA 4F17A 5GAMf 5CO7A 4A54A 3TEEA 1VQ6T 2VASA 3M58A 3META 3C95A 1I0CA 1UTIA 2DIGA 4J9BA 3G1JA 3CD6A 5KYXA 4J8OA 3VS6A 2QQ9A 1VQ6Q 2V8KA 1K9MU 3UA6A 3EGDB 1TS9A 3TSWA 1EZZB 2E10A 3OY9A 3CCET 1JBMA 3FC3A 4HT8A 1YJNQ 3TVTA 3G4SQ 1WHKA 4JJCA 1SPKA 2CUBA 3PT9A 5A0DA 5GMKl 5GAN8 1QQJA 3QKJA 3HSBA 2PVDB 1K8AC 2X51A 5M9OA 1M1KU 3RNJA 4OGEA 3ME9A 2AIRB 1Y0MA 1QVFA 1BIAA 4OMQA 3T9NA 1VQNQ 3OYDA 2FPEA 4MDWA 1UGVA 2ZPBB 1AWOA 2CP5A 4Y28E 2XDBA 3BY7A 4J9HA 4ATOA 1AZGB 2AKKA 4PNOA 2D8JA 4M77B 2VGNA 4FW2A 1UE9A 2GFUA 4M75B 2L3PA 2EGEA 1ZLMA 4OMMA 2E3HA 1K0XA 3JAME 2M1HA 3CCEA 1E7OA 1I07A 4Z88A 4KH1B 4HA8A 3THKA 1R0BG 2DL7A 2XI9A 3REAB 4XU3A 4J9IA 3SEMA 2KY9A 4QVZA 2LJ1A 3VS7A 4E7JA 3PIOA 1UGRB 3J81E 1UGSB 4EPCA 2QA4A 3M57A 2K79A 2JTMA 2HDAA 1K73U 2EQJA 2XU8A 2NUTA 2DETA 1QCFA 1MUZA 1OV3A 4B9WA 2DJZA 5LJ5g 2COZA 4BB7A 3VYHB 2AZSA 1YJWA 3JCMX 3JB9I 4C8QD 3NHNA 2I0NA 4FYYB 1ZX6A 2AK5A 3V7SA 3EGXA 2FRYA 2FZCB 1Q95G 2DXCA 2PTKA 4M75D 4M7AB 2AHJB 2LTOA 2A7YA 3G6EQ 4KGZB 1B07A 3JSCA 4EMHA 2DA9A 1SF9A 3KXTA 2DZCA 1WFWA 1WI7A 3I5RA 3RDVA 1W6XA 2RQTA 1B7TA 3SD4A 2YRCA 5GMKe 4RTZA 1TH7A 2P84A 3EH1A 2K5IA 1Y07A 1OZ2A 3CBMA 4JS4A 1VQOQ 2JUFA 2PVOB 1YITA 1ABQA 3CMEA 1EX4A 1RLPC 5LJ3g 2NUPA 2MWOA 1ABOA 1JJ2S 2KGTA 4OP0A 2X3XD 3PMIA 4FT2A 2DZ9A 2R5MA 1F1BB 2JS0A 4RCBA 3U23A 1QLYA 2E70A 5KYYA 2K2MA 1JRIA 2ENMA 2K3YA 2PU9B 1CKAA 3VUZA 5FROA 1HK9A 4PJOA 4QQDA 3CXCS 4LUDA 1BK2A 4ZGJB 4M7AG 4OMLA 1YN8A 3LLRA 3JCMV 3G71Q 5GAN4 5HKCA 1UJ0A 2DTHA 2HAXA 3OB9A 5KE3A 1WQ7A 1PC0A 2C0OA 4FW1A 3VRZA 1ZSZB 1SSHA 2HL5C 1XTDA 4JPBW 3RKYA 2P0KA 3CQTA 2K9GA 2JOYA 4BDYA 2DX1A 2BIVA 3FRNA 4M7DE 2J6OA 3G4ST 4M77A 1WXTA 1WHHA 1QWFA 4F7UE 2RQUA 3VYGA 1VA7A 3M0QA 3ULRB 4C5HA 4JRPA 2KT8A 1ZBXA 1D1AA 1Q7YU 4QVDA 2K6DA 1D09B 5CKDA 1WNLA 2B8AA 1KC8R 2KROA 4M78D 4C5IA 4J6WA 4XTWA 4C8QA 4DBRA 5DM7R 1TXQA 2CREA 3CBPA 2PQWA 3OYMA 4HVWA 3JRZA 3HP9A 3JV3A 2JM8A 4PFPA 2V1RA 1AWWA 4BY6C 1WJQA 4XK8E 3QYGB 1YIJT 2DPPB 4OMPA 3OYHA 1YJNA 2KVQG 3D7SB 2DEUA 2JT4A 2QA4T 1VQ8A 1VYVA 5FU7C 1Y71A 4O5VA 1G3WA 3AHUA 2LCSA 1VQ5A 3CC2Q 2P4TA 4C92E 1KQ1A 5GANe 2EYQA 3BDLA 3CC7A 2DFUA 1ZSZA 1LJOA 2MYSA 4JJDA 2Y90A 3EFSA 4C92B 3H8ZA 1M4ZA 2F1LA 3JCMb 3JB9F 3OBYA 2J6KA 1NJIR 2DVEA 3M55A 2HSEB 3S3OA 4AG2C 1G3SA 3GNGA 2DL5A 4QQGA 2XIDA 1EFNA 3CCRT 2E65A 2IPOB 5IXBA 3QZ5B 4PJOB 4KGVB 4MMLA 1X69A 2BUDA 2EQKA 5A0LA 3CCSA 4Z8AA 1YFNA 2ZGWA 3CMEQ 1N8RR 3CXCA 2FO0A 1X75C 2DF6A 4M78G 2FHDA 3A8GB 1X6OA 1QVGS 4DA4A 3OYGA 1YWOA 4XTXA 2VXEA 8ATCB 4RTWA 1A0NB 1Y7XA 4QT7A 2HBPA 2FL7A 3PVQA 3JCMJ 1W2BA 1MGQA 4BE1A 3OYNA 1UUEA 4XTUA 5EC7A 3E19A 2R57A 2D8HA 1QKXA 5J3BA 3CCUT 3NPFA 2E1HA 4RMOA 2KBTA 1E6GA 4M7DA 2DO3A 3FEOA 2CH4W 2LT4A 2M51A 2X3WD 3REBB 5C0MA 4M75C 4BE2A 1I5OB 2HKNA 1VQMT 4XTYA 4M78A 1BIBA 1UGPB 2LP5A 5GMKi 2KRMA 4PKCC 1M1GA 5CVIA 4J9FA 1T3SA 4RKUE 1VQMQ 2ROLA 3PFSA 3CCMQ 2NYSA 4E7HA 5D6YA 4GLKA 5GMKh 2L3RA 2RJFA 2DM1A 1VQKA 1CSKA 1YI2Q 3H9NA 2V8IA 2DXUA 3LH5A 2PZ1A 1WJSA 2JMCA 4C92G 1YJWT 1X6GA 4D8DA 1VUBA 3GP8A 1V29B 1SHFA 2BTTA 1QP2A 3LW5E 2RN8A 4QQ6A 1ZSZC 2WSFE 2CSQA 1NEGA 3OYIA 4M7AA 1M5Q1 4BACA 2DMOA 4FT4A 5CQYA 1ZBJA 4J5YA 4LUEA 1Q86U 4PJOG 1ZA2B 1C0MA 4II1A 1VQ7T 2LZ6B 3KBGA 4X9DA 4PJOD 2QYZA 4IUQA 3NTIA 5C6SA 3CCQQ 2ZPFB 4M75G 4HVUA 2HQHA 4OMNA 4EMKB 1FYNA 1ZA1B 2MK5A 3F70A 3A98A 3EG9A 5LJ3e 4C8QG 4FYXB 2A36A 2DD4A 4XQ3A 5D6WA 3RMQA 2M9UA 1K73C 5LJ3f 1AWXA 3L42A 1GXIE 2DTOA 3SHWA 3EHRA 3JCMe 3TQ7P 4M7DC 1QCOA 3O5ZA 3SDZA 3DLMA 3G4SA 3TU4K 4AFZC 3HKSA 2AZVA 2RK1A 3CCST 1WGSA 2DJQA 2JXBA 3OA6A 1RABB 4A63B 5CQXA 2EJFA 4WTOB 2OI3A 3MEVA 3CBOA 2RI2A 2VVKA 3NFCA 1PCXA 3AT1B 5GAN2 2COWA 4EDUA 2VYTA 4B9XA 2QEXA 1RAEB 2BZ8A 2LVMA 2CZ7B 1J3TA 2DVJA 2CDTA 2YUPA 2RHXA 2O88A 3EG3A 4IIMA 3VU3C 2EKOA 1TUGB 1VQNA 2L2PA 5FLXE 5GANj 1C1AA 3ZEHA 1WDXA 1K4US 4MZTA 2XDPA 4E6RA 5GAOl 1G2BA 4UC4A 1OZ3A 2F2XA 1VQ5T 1VQ4T 4A53A 2ZCFB 1KG1A 3EFOA 4AFQC 4N0AC 4FSSA 3PTAA 4PFZA 5KCOA 3SWNC 4FYWB 3ZBDA 2J6FA 1Y96B
chains in the Genus database with same CATH topology
3CCLQ 2OTLQ 3CCSQ 3CCUQ 3OW2P 1K8AR 3CCEQ 1YJ9Q 1VQMQ 3CCJQ 1YHQQ 1QVGP 1YJWQ 1Q82R 1YJNQ 1VQ5Q 1VQLQ 3CCQQ 1K9MR 2QEXQ 3CD6Q 3G4SQ 3I56Q 3CMAQ 1VQNQ 2OTJQ 3CCMQ 2QA4Q 1KC8R 3CCRQ 1VQ7Q 3CCVQ 1VQPQ 3I55Q 1NJIR 1KQSP 1Q7YR 3CMEQ 1Q86R 1N8RR 3G71Q 1JJ2P 1YI2Q 3CPWP 1M1KR 1K73R 3CXCP 1VQ8Q 1VQ4Q 1VQOQ 1QVFP 1YITQ 3CC2Q 1VQ9Q 3CC7Q 1S72Q 1VQKQ 1YIJQ 1W2BP 1KD1R 1VQ6Q 1M90R 3CC4Q 3G6EQ 1Q81R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL Q;  2OTL Q;  3CCS Q;  3CCU Q;  3OW2 P;  1K8A R;  3CCE Q;  1YJ9 Q;  1VQM Q;  3CCJ Q;  1YHQ Q;  1QVG P;  1YJW Q;  1Q82 R;  1YJN Q;  1VQ5 Q;  1VQL Q;  3CCQ Q;  1K9M R;  2QEX Q;  3CD6 Q;  3G4S Q;  3I56 Q;  3CMA Q;  1VQN Q;  2OTJ Q;  3CCM Q;  2QA4 Q;  1KC8 R;  3CCR Q;  1VQ7 Q;  3CCV Q;  1VQP Q;  3I55 Q;  1NJI R;  1KQS P;  1Q7Y R;  3CME Q;  1Q86 R;  1N8R R;  3G71 Q;  1JJ2 P;  1YI2 Q;  3CPW P;  1M1K R;  1K73 R;  3CXC P;  1VQ8 Q;  1VQ4 Q;  1VQO Q;  1QVF P;  1YIT Q;  3CC2 Q;  1VQ9 Q;  3CC7 Q;  1S72 Q;  1VQK Q;  1YIJ Q;  1W2B P;  1KD1 R;  1VQ6 Q;  1M90 R;  3CC4 Q;  3G6E Q;  1Q81 R; 
#chains in the Genus database with same CATH topology
 1YIJ A;  1WLP B;  1Q81 U;  4RG2 A;  2JZ2 A;  2YUN A;  1VQ5 Q;  3CC2 A;  2PUK B;  3BDU A;  1UEB A;  2VB6 A;  1KHI A;  1WYX A;  2LCL A;  2QXF A;  2W0Z A;  2NWM A;  3OW2 S;  2XG8 D;  1NPP A;  2PNI A;  1FMK A;  4PLI A;  1BBZ A;  2F2W A;  5KYW B;  1T0J A;  4J9D A;  1PG5 B;  2VV5 A;  4B6M A;  1C6V X;  3LWI A;  3OYJ A;  2EFI A;  1LNX A;  1RAI B;  2FEI A;  2JN0 A;  1HYO A;  4TVR A;  4E7Z A;  3JCM d;  2BKD N;  2Y4Y A;  3EG1 A;  3LGF A;  4Q5W A;  2DXT A;  4RTT A;  1X2K A;  2VXF A;  3P8H A;  5FU7 B;  3GPL A;  2QQB A;  3SB2 A;  4WF2 A;  2DL8 A;  2K57 A;  3G6E A;  4EMK A;  3VS0 A;  4M77 D;  2ABL A;  1OPL A;  4AG1 C;  3CD6 Q;  2E6Z A;  3FJ5 A;  4J9E A;  3CCU A;  4JRK A;  2JTE A;  1V76 A;  3GIB A;  4M75 F;  3MCA B;  2SRC A;  1BI3 A;  2EBP A;  4M78 E;  4J6Y A;  2DAQ A;  1QVF P;  1VQ9 Q;  2MMP A;  2KDS A;  4CI0 C;  3I5S A;  1X2Q A;  1UG1 A;  3VS4 A;  2QAZ A;  1B34 A;  3FLG A;  2X9H A;  4RTU A;  1GBQ A;  1WXU A;  3EFR A;  3HRT A;  2QG9 B;  4EIK A;  2DXB A;  2FPF A;  1Q82 C;  3CEY A;  4RG8 A;  2CSI A;  3OYF A;  1M90 R;  2RQW A;  2KYB A;  1PKS A;  2RM4 A;  4J83 A;  1IGQ A;  4M78 C;  1VQL Q;  3QWY A;  2F5T X;  3V8L A;  2WAC A;  3DB4 A;  2HZY A;  1RL2 A;  2GQI A;  2MAM A;  5I21 A;  1WXB A;  2LQK A;  3M4Y A;  4JZ4 A;  2EJG A;  4IUV A;  3MEA A;  1VQ4 Q;  4E7L A;  3FIF A;  2KT1 A;  1OU8 A;  5ECA A;  1BKB A;  2CYZ B;  1VQ9 A;  3MEW A;  2HL3 A;  5GAN 3;  2DRM A;  2K5L A;  3HRU A;  4QVC A;  2BZY A;  2OAW A;  1KIK A;  2NUT B;  2RA2 A;  3QDR B;  3RIR A;  5GAN 5;  5GAM j;  2L89 A;  3H0I A;  3RBB B;  1AVZ C;  4A4E A;  2EIF A;  5IAY A;  5GMK m;  4KRT A;  1PSF A;  1NLP C;  3CPW A;  2OX7 A;  1VYU A;  3I55 A;  1K9M C;  5LL6 S;  2XDD A;  5HCK A;  1P92 A;  5CK9 A;  2DLP A;  4JLG A;  3P8B B;  4E2F B;  1JB0 E;  1KC8 U;  1JEG A;  2H3E B;  2OTJ A;  2C0T A;  3PE0 A;  5LJ3 j;  4P5N A;  1CKB A;  5CKH A;  4C0F A;  2EPD A;  4PJO C;  2CP3 A;  3S3N A;  1YWP A;  2YXY A;  4IUP A;  3LWH A;  4OGC A;  4C92 A;  4M7D F;  1X27 A;  2HCK A;  4C0D C;  3JB9 H;  2YRV A;  4JRQ A;  3GNF B;  2E64 A;  5CR2 A;  4NOY A;  4ZTJ A;  4JUV A;  5KYU A;  2O01 E;  2O4X B;  4C8Q B;  2OTL A;  4M78 F;  3CCJ Q;  3M0R A;  1FWZ A;  2DRK A;  4C92 C;  2E12 A;  3L2V A;  1MMA A;  2K7A A;  1M2O A;  4DOV A;  1VQN T;  2YUQ A;  2FB7 A;  1ARK A;  1SSF A;  1GFC A;  3EG2 A;  1VQ9 T;  4C8Q E;  1AWJ A;  4GBQ A;  5LJ5 e;  1RAG B;  2LQN A;  1U06 A;  4O6J A;  2FYK A;  3M9Q A;  1N6A A;  4RTY A;  1M3C A;  4ZTF A;  7AT1 B;  2MI6 A;  1M1F A;  5HK0 A;  2JW4 A;  3VRY A;  4NL2 A;  1VQK Q;  3VUB A;  2DBM A;  4KH0 B;  4C5G A;  1BYM A;  3RUX A;  3MKD A;  4ELY C;  4PJO F;  4A4H A;  2G6F X;  1BB9 A;  8AT1 B;  3LYI A;  4M7D D;  5CKF A;  3OYK A;  1ACM B;  3CPF A;  2LX7 A;  2RH2 A;  3C4S A;  3RKX A;  5GAM h;  1YJN T;  1SKU B;  4Z02 A;  5GAN d;  1M90 C;  2ESW A;  2K2V A;  3QUI A;  1NJI U;  1XQH A;  1NZ9 A;  3VS5 A;  1QVP A;  5LJ5 h;  2GF7 A;  4C92 F;  3A5Z B;  1O9S A;  4YTL A;  2QA4 Q;  2M02 A;  2L8D A;  4BD3 A;  3G6E T;  1AT1 B;  4OMF B;  4HVV A;  2QGG A;  1JJ2 P;  1RAF B;  4ZN3 A;  1VQ7 A;  3M59 A;  3I9Q A;  1G8X A;  2RHU A;  3UWN A;  3CCV A;  3OYY A;  1OI1 A;  2L0A A;  1H3H A;  1AEY A;  3PIP A;  1NPR A;  1MV3 A;  4R0K A;  1UJY A;  4M7A E;  3CCV T;  1IHV A;  1KD1 U;  2QDY B;  2M16 A;  3CCL A;  1VQL T;  4V2S A;  3QWX X;  1K73 R;  3CXC P;  4HCZ A;  3HL8 A;  1GRI A;  3FB9 A;  1YIT Q;  2RJE A;  2EKH A;  5FU6 B;  5DY9 A;  4L59 A;  5GAO m;  3JCM h;  3EGD A;  2X35 A;  1KQS S;  1QCN A;  1K8A R;  1PRL C;  3M0T A;  2E5K A;  5KYW A;  2XIC A;  4PJM A;  5GAO q;  1KHC A;  3PGG A;  3E1S A;  1UHC A;  1G3Y A;  4EMK C;  2D9T A;  2C0I A;  4LDV A;  1NM7 A;  3OSV A;  3HRS A;  3L2R A;  1OX9 A;  1W1F A;  1MHN A;  1D3B A;  3JCM g;  1FMV A;  2KSS A;  5GAO r;  3QDF A;  4M75 E;  1PD0 A;  1SEM A;  2LRQ A;  3GLX A;  4J9G A;  1M1K R;  3VJP A;  1M1K C;  2P0P A;  4M77 G;  1YI2 T;  1WA7 A;  2JNG A;  4OVA A;  1M8V A;  1I8F A;  2IVW A;  4OB3 B;  6AT1 B;  1X6B A;  3R6O A;  1ZHI A;  5CCA A;  2XD0 A;  4N0A A;  4ESR A;  3OYB A;  3OS0 A;  2DD5 A;  2RHI A;  3QII A;  2MCN A;  1OU9 A;  1HXD A;  3QPH A;  2OJ2 A;  3QBY A;  1D1B A;  1RLQ C;  3P8D A;  3CCJ T;  3M56 A;  1BI1 A;  1M9S A;  1VQ8 Q;  3MEU A;  5GAM d;  5GAM e;  1LVK A;  1RI0 A;  5GJW B;  1KD1 R;  2KK4 A;  2F69 A;  4NS5 A;  1KSW A;  1NJI C;  4ZGE B;  1Q7Y C;  4L6V 5;  4HCK A;  3LH0 A;  2RI3 A;  3I35 A;  5IN1 A;  1K9M R;  2EYW A;  1VQ4 A;  1M30 A;  3C12 A;  2KRS A;  3VV0 A;  2EJ9 A;  3E9G A;  1Q86 C;  1KQS P;  1IO6 A;  2GFA A;  1MMG A;  3OSS C;  3PNW C;  1VOM A;  2EYZ A;  2KMT A;  4BDZ A;  1Z9Z A;  5GAN h;  3JCM Q;  2RJC A;  1D1C A;  2V1Q A;  4AT1 B;  4DBH A;  2BE9 B;  4E7S A;  2OAU A;  5I2M A;  2CS7 A;  1GCP A;  2DNU A;  3H0H A;  1WZO A;  2HKQ B;  1BI0 A;  2XKO C;  2DL3 A;  1BI2 A;  1YBY A;  1D0X A;  4OF1 A;  4M7A F;  1SRM A;  3UA7 A;  3JCM c;  4IKF A;  2QTV A;  3CC7 T;  2O31 A;  2YSQ A;  4F7U G;  3G71 A;  5KYX B;  1G5V A;  2EQU A;  1SHG A;  1WIE A;  2EGC A;  4R55 A;  5FRN A;  1K9A A;  2K3B A;  1OUL A;  3CCL Q;  2R58 A;  9ATC B;  1VQ8 T;  1QMC A;  2RF0 A;  3X26 B;  2E6N A;  1U3O A;  3CCR Q;  2Z0W A;  1PKT A;  3L2Z A;  2W10 A;  2DE0 X;  3PVL A;  4C0D B;  5HK3 A;  2XMF A;  4KBM B;  1LPL A;  3NGP A;  3NTK A;  4CC3 A;  5I2S A;  3MO8 A;  1PNJ A;  1PRM C;  2ZPE B;  1LCK A;  3N5B B;  3VKI A;  1NE8 A;  2E5Q A;  3EG0 A;  2A08 A;  2LNH B;  1FMW A;  1O75 A;  5J26 A;  1BCM A;  1VIF A;  4M77 F;  4C5E A;  1ZUK A;  3UDC A;  2GQV A;  3H6Z A;  5AYF A;  5LJ3 h;  1R8O B;  2ZPH B;  1SG5 A;  2YRD A;  3J80 E;  4OMO A;  1G83 A;  1N9R A;  4FSX A;  4KT0 E;  4XU0 A;  3UAT A;  5A0G A;  3I56 A;  1T3L A;  3OMC A;  5GAO n;  1K76 A;  5FWC A;  5FW9 A;  1M8M A;  3I56 Q;  4X9C A;  1KQ2 A;  4M7A C;  2KR3 A;  1Q7Y R;  2WSC E;  1JO8 A;  2KYM A;  3WXM B;  4GLM A;  2K3X A;  4PLL A;  2EVR A;  2CT3 A;  4FYV B;  3H0F A;  4ORZ A;  2YHT A;  4BY6 B;  4DQ2 A;  5A2Q E;  2HQE A;  1YIT T;  1HSQ A;  3V7C A;  3EH2 A;  1VQP Q;  1TSF A;  1IZ6 A;  5CAI A;  2WSE E;  1YCY A;  3I55 T;  3EGX B;  4HXJ A;  4XTV A;  2BE7 D;  3CCL T;  2VUB A;  4CC7 A;  1XNI A;  4LDW A;  2RNA A;  2FVU A;  1JJ2 A;  2ATC B;  4Y91 A;  1Q81 R;  1I1J A;  3QHS A;  3OMG A;  4F7U F;  2QEX Q;  2DK3 A;  2RHZ A;  1K1Z A;  4BI4 A;  1YHQ T;  3GF5 A;  4M77 C;  4QKU A;  1VYT A;  4C0Z A;  1M3A A;  2CP7 A;  1PM3 A;  1YIJ Q;  4R56 A;  3EHQ A;  4WCI A;  2D6F A;  1YHQ A;  3A8H B;  4F14 A;  2CT4 A;  1QW1 A;  1YHQ Q;  1H3Z A;  2HMA A;  3DKM A;  4BE0 A;  2DER A;  1UHF A;  1KQS A;  1WHL A;  2O4X A;  4KUL A;  1YP5 A;  4RTX A;  1PD1 A;  1N27 A;  1B34 B;  2QQA A;  1VQM A;  3L1A A;  1M27 C;  3NTH A;  1IRE B;  3CMA A;  2HNI A;  2KNB B;  2RB6 A;  3CMA Q;  4CC4 B;  4FIB A;  5LJ5 j;  1TU0 B;  4Z89 A;  1AOJ A;  1ZUU A;  2QAS A;  1MNE A;  2NLU A;  3OYE A;  4LDY A;  5FWB A;  4F16 A;  2LC4 A;  1VQO A;  4E7K A;  2QEX T;  1QVG A;  4J6X A;  1HD3 A;  2RO0 A;  4PK4 A;  3CC4 Q;  3QXE B;  1U1S A;  3CCR A;  3GBQ A;  3HHT B;  2EW3 A;  3PMT A;  1QKW A;  3OS5 A;  2EQM A;  2HD0 A;  2AKL A;  3QG1 A;  3NMZ C;  3JCM f;  3QJ6 A;  1E6H A;  4HKE A;  1Y57 A;  2ZPG B;  1WHM A;  4CRI A;  4M4Z A;  2J05 A;  2M0Y A;  2VWF A;  3JB9 D;  4A4K A;  4LNP A;  1KJW A;  4HCC A;  2X4X A;  2QQS A;  3QZ9 B;  5GAN g;  4IIO A;  3EAE A;  3CC4 A;  2F5K A;  3MP1 A;  1Q86 R;  1OEB A;  2YLB A;  2JTF A;  2YUO A;  3ER0 A;  5LJ5 d;  3UPU A;  2ECZ A;  1FX7 A;  4AMC A;  4GY5 A;  2QGF B;  3QO3 A;  2A37 A;  1IHW A;  1KD1 C;  1VQP A;  5IH2 A;  5KYY B;  1T0H A;  2COY A;  5CKE A;  1HJD A;  1R77 A;  1NG2 A;  2X4W A;  3M0P A;  1UDL A;  2LQW A;  5KYU B;  2KEA A;  3M0U A;  1NEB A;  3WVE B;  3OBW A;  2O9V A;  4RCC A;  2RJD A;  3FJP A;  3LX7 A;  3MPU B;  1KC8 C;  4FM4 B;  1U1T A;  4RTV A;  4F7U B;  1OOT A;  2XHC A;  4ELZ C;  2FZG B;  4ZGD B;  2DYB A;  1IRX A;  1AHJ B;  2YLC A;  2RPN A;  2B86 A;  1BCO A;  5I22 A;  3OYL A;  1FXX A;  2MF2 A;  5L8R E;  4FCY A;  5FU6 C;  3TSZ A;  4IUR A;  1K8A U;  3JCM P;  1TG0 A;  2PUO B;  3M53 A;  2RHY A;  4D6W A;  5FRM A;  2A28 A;  1TTH B;  1B3Q A;  1TOV A;  4IUU A;  2E4H A;  4JRI A;  1SRL A;  3UT1 A;  3CCM A;  2K5F A;  3E9F A;  3SWN B;  1YI2 A;  2FPD A;  1Q82 U;  4LDX A;  1N8R U;  1H8K A;  5IHN A;  1W2B S;  1RAH B;  4KUI A;  1QWE A;  3OW2 A;  3QJY A;  5DLQ E;  3OS2 A;  2RQV A;  1RAC B;  2I2L A;  1OX8 A;  5HY6 A;  2MOX A;  3RER A;  3L2U A;  4MZM A;  4KGX B;  1QP3 A;  3OW2 P;  1G3T A;  4DEX A;  2RI5 A;  1AD5 A;  2A0F B;  2LNV A;  2CZ1 B;  2LT1 A;  1BU1 A;  4KUD K;  3M5A A;  4NL3 A;  4K11 A;  1VQO T;  3CPW P;  1W70 A;  2EYY A;  2ED0 A;  2CP0 A;  1M2V B;  4PJN A;  2JVV A;  1M3B A;  2L3S A;  3V7R A;  3ASK A;  2KXC A;  1QVG P;  1JQQ A;  2VKN A;  4XAX B;  1I5L A;  5L23 A;  2KI7 A;  3E2U A;  3CCV Q;  1I81 A;  2FZK B;  4PJJ A;  2J7I A;  2KXD A;  2EGA A;  1WJR A;  4IUT A;  2DL4 A;  4LD6 A;  1MMN A;  2VGM A;  3UF4 A;  1UB4 A;  1X43 A;  2H8H A;  3L2Q A;  2GTO A;  2IIM A;  4E47 A;  2ZPI B;  3HFO A;  1QVF S;  1MND A;  4OB1 B;  2LJ0 A;  3CME T;  2BZX A;  3H41 A;  4PJL A;  3X25 B;  3BE3 A;  4XU1 A;  4AFU C;  1W2B P;  2LJ3 A;  3X20 B;  1D0Y A;  3OYC A;  1VQL A;  1Q81 C;  1RAA B;  2PVG B;  2OTL Q;  2FG0 A;  5GAN 7;  1YJ9 Q;  1W4S A;  1JXO A;  2LMJ A;  1PSE A;  4JDS A;  2O2O A;  2OTJ Q;  3V8K A;  1IB8 A;  5LJ5 f;  2DEQ A;  4J7F A;  4F7U A;  5KCH A;  4Y92 A;  5D7U A;  3OQ5 A;  2HEQ A;  4BI8 B;  3RES A;  1WHG A;  2QQR A;  3ZFJ A;  4BI3 A;  1WQW A;  2CH4 A;  1M2V A;  3JB9 J;  3EGU A;  3DLL A;  1OPK A;  3V8J A;  2KAF A;  2HBW A;  4D8K A;  3CCE Q;  1GBR A;  2ED1 A;  4HT9 A;  4M77 E;  4PJO E;  1U5S A;  1PHT A;  3HFN A;  2C06 A;  1VQ6 A;  3A8M B;  5IHK A;  1ZUY A;  1LOJ A;  1VQP T;  4M75 A;  1VQ7 Q;  1H64 1;  3I55 Q;  2QI2 A;  2KQW A;  5KE2 A;  3QSU A;  3X28 B;  3TRE A;  2V8J A;  3EFO B;  1AZE A;  4C0G A;  1EIF A;  1KK7 A;  4M7A D;  1TWB A;  4AFS C;  5CIU A;  3CC4 T;  4XU2 A;  2VC8 A;  2GTJ A;  2NUZ A;  3BFM A;  5EG2 A;  3DB3 A;  5IXF A;  4DEY A;  4MDX A;  3QYH B;  1MMD A;  5CKB A;  2CZ6 B;  1YJW Q;  1RUW A;  2FRW A;  3ZL7 C;  2L3Q A;  3SFM A;  4A4G A;  2ZZD A;  2CP2 A;  1KFZ A;  1ZSG A;  2LX9 A;  1ZQ1 A;  3OYA A;  2XK0 A;  3MP8 A;  3INZ A;  2EWN A;  3CCM T;  1IXD A;  2D1X A;  3CCJ A;  3R6N A;  2G3R A;  2DBK A;  4JS5 A;  2RMO A;  3MHX A;  1YNZ A;  2JMA A;  1NBE B;  4J9C A;  3JCM W;  1TUC A;  3HPW A;  2DIQ A;  4XTZ A;  3LGL A;  2D0Q B;  3OS1 A;  3RMS A;  4JLI A;  2E41 A;  3S6W A;  2JM9 A;  2MPX C;  1DJ7 B;  2H3J A;  2ROT A;  3CC7 Q;  4LD9 K;  3CC2 T;  2GNC A;  2P0Q A;  2OTJ T;  3CPW S;  3GOX A;  3CCU Q;  2F2V A;  4LE9 A;  5GAM g;  2CZ0 B;  3CMA T;  1X01 A;  2OTL T;  2DIL A;  3G71 T;  1RI9 A;  5GAN 6;  2CP6 A;  2Y4X A;  1D3B B;  3VS1 A;  3C94 A;  1XJW B;  3WVD B;  4ZN1 A;  4DBF A;  3CD6 T;  2EYX A;  3EG9 B;  5GAO p;  4E7I A;  2LCC A;  1GFD A;  1Q82 R;  2YWW A;  4ZNX A;  1UEC A;  5I11 A;  1JU5 C;  2SEM A;  1Z9Q A;  1MV0 B;  2DTI A;  3A8O B;  1NYF A;  1YJ9 T;  4CC2 A;  3M54 A;  2RQR A;  2P4R A;  2J06 A;  1OYX A;  4OB0 B;  2EQI A;  5GJV B;  1IGU A;  2HSP A;  3KUF A;  3FDR A;  1D0Z A;  4DBQ A;  3Q1J A;  3RKW A;  3X24 B;  3MJX A;  4JJN K;  4LN2 A;  5J39 A;  2L5Q A;  1XOV A;  1S1N A;  2QK0 A;  4C8Q C;  4ANJ A;  3C0C A;  3A8L B;  1UFF A;  3URG A;  4FU6 A;  5KH6 A;  4L5G A;  1WHJ A;  3MP6 A;  3M4G A;  4DOW A;  1K0S A;  4N4I A;  1OQK A;  5KYN A;  4MMK A;  1WPY A;  4A4F A;  2MIO A;  5GMK j;  3CCQ A;  1N5Z A;  1NLO C;  4VUB A;  2KRN A;  1S72 T;  2A3L A;  3O8V A;  4C92 D;  2DKG A;  2QDL A;  2IG0 A;  4OB2 B;  1S72 A;  4EMG A;  2RK2 A;  3L2W A;  1NYG A;  3SWN A;  4PFO A;  1WX6 A;  2MWP A;  1PWT A;  1H92 A;  2NUP B;  3BW1 A;  1N9S A;  3RR6 A;  1YCS B;  5GAN f;  1GL5 A;  3I56 T;  2X4J A;  2GCX A;  4J7I A;  2CKK A;  3TCJ A;  4X34 A;  2JJ9 A;  1V1C A;  2YT6 A;  4QW2 A;  2RD1 A;  2EAY A;  2AT1 B;  4X1V A;  2QTX A;  2CGH A;  3HTR A;  3JB9 G;  4BUG A;  2D0N A;  4F04 B;  1N8R C;  1Y96 A;  5IT9 E;  3CCS Q;  4N4G A;  4M78 B;  2LDM A;  3M0S A;  4LDU A;  1YJ9 A;  4C8Q F;  3CCQ T;  1R0C B;  2KE9 A;  4FL6 A;  2JS2 A;  2O9S A;  1VQK T;  5AT1 B;  4N4H A;  2K4Y A;  2V26 A;  4PL6 A;  4M7D B;  4M7D G;  4MZP A;  4ME7 A;  2GBQ A;  1S72 Q;  4HCB A;  3G7Z A;  2M0O A;  1VIE A;  1M90 U;  2CUD A;  3VS3 A;  5IHI A;  5D6X A;  2DYI A;  4JJB A;  2X4Y A;  5DLO A;  3J7A F;  2ZAE A;  2YDL A;  1GCQ C;  2HQX A;  1RAD B;  1U8R A;  3IQL A;  1JXM A;  1UGQ B;  2E3I A;  3A1P A;  3KFV A;  2GGR A;  4JZ3 A;  2LQ8 A;  3VS2 A;  4LXC A;  1I4K 1;  1GCQ A;  3S3M A;  5LJ3 d;  1TUD A;  4RUG A;  2R5A A;  4F17 A;  5GAM f;  5CO7 A;  4A54 A;  3TEE A;  1VQ6 T;  2VAS A;  3M58 A;  3MET A;  3C95 A;  1I0C A;  1UTI A;  2DIG A;  4J9B A;  3G1J A;  3CD6 A;  5KYX A;  4J8O A;  3VS6 A;  2QQ9 A;  1VQ6 Q;  2V8K A;  1K9M U;  3UA6 A;  3EGD B;  1TS9 A;  3TSW A;  1EZZ B;  2E10 A;  3OY9 A;  3CCE T;  1JBM A;  3FC3 A;  4HT8 A;  1YJN Q;  3TVT A;  3G4S Q;  1WHK A;  4JJC A;  1SPK A;  2CUB A;  3PT9 A;  5A0D A;  5GMK l;  5GAN 8;  1QQJ A;  3QKJ A;  3HSB A;  2PVD B;  1K8A C;  2X51 A;  5M9O A;  1M1K U;  3RNJ A;  4OGE A;  3ME9 A;  2AIR B;  1Y0M A;  1QVF A;  1BIA A;  4OMQ A;  3T9N A;  1VQN Q;  3OYD A;  2FPE A;  4MDW A;  1UGV A;  2ZPB B;  1AWO A;  2CP5 A;  4Y28 E;  2XDB A;  3BY7 A;  4J9H A;  4ATO A;  1AZG B;  2AKK A;  4PNO A;  2D8J A;  4M77 B;  2VGN A;  4FW2 A;  1UE9 A;  2GFU A;  4M75 B;  2L3P A;  2EGE A;  1ZLM A;  4OMM A;  2E3H A;  1K0X A;  3JAM E;  2M1H A;  3CCE A;  1E7O A;  1I07 A;  4Z88 A;  4KH1 B;  4HA8 A;  3THK A;  1R0B G;  2DL7 A;  2XI9 A;  3REA B;  4XU3 A;  4J9I A;  3SEM A;  2KY9 A;  4QVZ A;  2LJ1 A;  3VS7 A;  4E7J A;  3PIO A;  1UGR B;  3J81 E;  1UGS B;  4EPC A;  2QA4 A;  3M57 A;  2K79 A;  2JTM A;  2HDA A;  1K73 U;  2EQJ A;  2XU8 A;  2NUT A;  2DET A;  1QCF A;  1MUZ A;  1OV3 A;  4B9W A;  2DJZ A;  5LJ5 g;  2COZ A;  4BB7 A;  3VYH B;  2AZS A;  1YJW A;  3JCM X;  3JB9 I;  4C8Q D;  3NHN A;  2I0N A;  4FYY B;  1ZX6 A;  2AK5 A;  3V7S A;  3EGX A;  2FRY A;  2FZC B;  1Q95 G;  2DXC A;  2PTK A;  4M75 D;  4M7A B;  2AHJ B;  2LTO A;  2A7Y A;  3G6E Q;  4KGZ B;  1B07 A;  3JSC A;  4EMH A;  2DA9 A;  1SF9 A;  3KXT A;  2DZC A;  1WFW A;  1WI7 A;  3I5R A;  3RDV A;  1W6X A;  2RQT A;  1B7T A;  3SD4 A;  2YRC A;  5GMK e;  4RTZ A;  1TH7 A;  2P84 A;  3EH1 A;  2K5I A;  1Y07 A;  1OZ2 A;  3CBM A;  4JS4 A;  1VQO Q;  2JUF A;  2PVO B;  1YIT A;  1ABQ A;  3CME A;  1EX4 A;  1RLP C;  5LJ3 g;  2NUP A;  2MWO A;  1ABO A;  1JJ2 S;  2KGT A;  4OP0 A;  2X3X D;  3PMI A;  4FT2 A;  2DZ9 A;  2R5M A;  1F1B B;  2JS0 A;  4RCB A;  3U23 A;  1QLY A;  2E70 A;  5KYY A;  2K2M A;  1JRI A;  2ENM A;  2K3Y A;  2PU9 B;  1CKA A;  3VUZ A;  5FRO A;  1HK9 A;  4PJO A;  4QQD A;  3CXC S;  4LUD A;  1BK2 A;  4ZGJ B;  4M7A G;  4OML A;  1YN8 A;  3LLR A;  3JCM V;  3G71 Q;  5GAN 4;  5HKC A;  1UJ0 A;  2DTH A;  2HAX A;  3OB9 A;  5KE3 A;  1WQ7 A;  1PC0 A;  2C0O A;  4FW1 A;  3VRZ A;  1ZSZ B;  1SSH A;  2HL5 C;  1XTD A;  4JPB W;  3RKY A;  2P0K A;  3CQT A;  2K9G A;  2JOY A;  4BDY A;  2DX1 A;  2BIV A;  3FRN A;  4M7D E;  2J6O A;  3G4S T;  4M77 A;  1WXT A;  1WHH A;  1QWF A;  4F7U E;  2RQU A;  3VYG A;  1VA7 A;  3M0Q A;  3ULR B;  4C5H A;  4JRP A;  2KT8 A;  1ZBX A;  1D1A A;  1Q7Y U;  4QVD A;  2K6D A;  1D09 B;  5CKD A;  1WNL A;  2B8A A;  1KC8 R;  2KRO A;  4M78 D;  4C5I A;  4J6W A;  4XTW A;  4C8Q A;  4DBR A;  5DM7 R;  1TXQ A;  2CRE A;  3CBP A;  2PQW A;  3OYM A;  4HVW A;  3JRZ A;  3HP9 A;  3JV3 A;  2JM8 A;  4PFP A;  2V1R A;  1AWW A;  4BY6 C;  1WJQ A;  4XK8 E;  3QYG B;  1YIJ T;  2DPP B;  4OMP A;  3OYH A;  1YJN A;  2KVQ G;  3D7S B;  2DEU A;  2JT4 A;  2QA4 T;  1VQ8 A;  1VYV A;  5FU7 C;  1Y71 A;  4O5V A;  1G3W A;  3AHU A;  2LCS A;  1VQ5 A;  3CC2 Q;  2P4T A;  4C92 E;  1KQ1 A;  5GAN e;  2EYQ A;  3BDL A;  3CC7 A;  2DFU A;  1ZSZ A;  1LJO A;  2MYS A;  4JJD A;  2Y90 A;  3EFS A;  4C92 B;  3H8Z A;  1M4Z A;  2F1L A;  3JCM b;  3JB9 F;  3OBY A;  2J6K A;  1NJI R;  2DVE A;  3M55 A;  2HSE B;  3S3O A;  4AG2 C;  1G3S A;  3GNG A;  2DL5 A;  4QQG A;  2XID A;  1EFN A;  3CCR T;  2E65 A;  2IPO B;  5IXB A;  3QZ5 B;  4PJO B;  4KGV B;  4MML A;  1X69 A;  2BUD A;  2EQK A;  5A0L A;  3CCS A;  4Z8A A;  1YFN A;  2ZGW A;  3CME Q;  1N8R R;  3CXC A;  2FO0 A;  1X75 C;  2DF6 A;  4M78 G;  2FHD A;  3A8G B;  1X6O A;  1QVG S;  4DA4 A;  3OYG A;  1YWO A;  4XTX A;  2VXE A;  8ATC B;  4RTW A;  1A0N B;  1Y7X A;  4QT7 A;  2HBP A;  2FL7 A;  3PVQ A;  3JCM J;  1W2B A;  1MGQ A;  4BE1 A;  3OYN A;  1UUE A;  4XTU A;  5EC7 A;  3E19 A;  2R57 A;  2D8H A;  1QKX A;  5J3B A;  3CCU T;  3NPF A;  2E1H A;  4RMO A;  2KBT A;  1E6G A;  4M7D A;  2DO3 A;  3FEO A;  2CH4 W;  2LT4 A;  2M51 A;  2X3W D;  3REB B;  5C0M A;  4M75 C;  4BE2 A;  1I5O B;  2HKN A;  1VQM T;  4XTY A;  4M78 A;  1BIB A;  1UGP B;  2LP5 A;  5GMK i;  2KRM A;  4PKC C;  1M1G A;  5CVI A;  4J9F A;  1T3S A;  4RKU E;  1VQM Q;  2ROL A;  3PFS A;  3CCM Q;  2NYS A;  4E7H A;  5D6Y A;  4GLK A;  5GMK h;  2L3R A;  2RJF A;  2DM1 A;  1VQK A;  1CSK A;  1YI2 Q;  3H9N A;  2V8I A;  2DXU A;  3LH5 A;  2PZ1 A;  1WJS A;  2JMC A;  4C92 G;  1YJW T;  1X6G A;  4D8D A;  1VUB A;  3GP8 A;  1V29 B;  1SHF A;  2BTT A;  1QP2 A;  3LW5 E;  2RN8 A;  4QQ6 A;  1ZSZ C;  2WSF E;  2CSQ A;  1NEG A;  3OYI A;  4M7A A;  1M5Q 1;  4BAC A;  2DMO A;  4FT4 A;  5CQY A;  1ZBJ A;  4J5Y A;  4LUE A;  1Q86 U;  4PJO G;  1ZA2 B;  1C0M A;  4II1 A;  1VQ7 T;  2LZ6 B;  3KBG A;  4X9D A;  4PJO D;  2QYZ A;  4IUQ A;  3NTI A;  5C6S A;  3CCQ Q;  2ZPF B;  4M75 G;  4HVU A;  2HQH A;  4OMN A;  4EMK B;  1FYN A;  1ZA1 B;  2MK5 A;  3F70 A;  3A98 A;  3EG9 A;  5LJ3 e;  4C8Q G;  4FYX B;  2A36 A;  2DD4 A;  4XQ3 A;  5D6W A;  3RMQ A;  2M9U A;  1K73 C;  5LJ3 f;  1AWX A;  3L42 A;  1GXI E;  2DTO A;  3SHW A;  3EHR A;  3JCM e;  3TQ7 P;  4M7D C;  1QCO A;  3O5Z A;  3SDZ A;  3DLM A;  3G4S A;  3TU4 K;  4AFZ C;  3HKS A;  2AZV A;  2RK1 A;  3CCS T;  1WGS A;  2DJQ A;  2JXB A;  3OA6 A;  1RAB B;  4A63 B;  5CQX A;  2EJF A;  4WTO B;  2OI3 A;  3MEV A;  3CBO A;  2RI2 A;  2VVK A;  3NFC A;  1PCX A;  3AT1 B;  5GAN 2;  2COW A;  4EDU A;  2VYT A;  4B9X A;  2QEX A;  1RAE B;  2BZ8 A;  2LVM A;  2CZ7 B;  1J3T A;  2DVJ A;  2CDT A;  2YUP A;  2RHX A;  2O88 A;  3EG3 A;  4IIM A;  3VU3 C;  2EKO A;  1TUG B;  1VQN A;  2L2P A;  5FLX E;  5GAN j;  1C1A A;  3ZEH A;  1WDX A;  1K4U S;  4MZT A;  2XDP A;  4E6R A;  5GAO l;  1G2B A;  4UC4 A;  1OZ3 A;  2F2X A;  1VQ5 T;  1VQ4 T;  4A53 A;  2ZCF B;  1KG1 A;  3EFO A;  4AFQ C;  4N0A C;  4FSS A;  3PTA A;  4PFZ A;  5KCO A;  3SWN C;  4FYW B;  3ZBD A;  2J6F A;  1Y96 B; 
#chains in the Genus database with same CATH homology
 3CCL Q;  2OTL Q;  3CCS Q;  3CCU Q;  3OW2 P;  1K8A R;  3CCE Q;  1YJ9 Q;  1VQM Q;  3CCJ Q;  1YHQ Q;  1QVG P;  1YJW Q;  1Q82 R;  1YJN Q;  1VQ5 Q;  1VQL Q;  3CCQ Q;  1K9M R;  2QEX Q;  3CD6 Q;  3G4S Q;  3I56 Q;  3CMA Q;  1VQN Q;  2OTJ Q;  3CCM Q;  2QA4 Q;  1KC8 R;  3CCR Q;  1VQ7 Q;  3CCV Q;  1VQP Q;  3I55 Q;  1NJI R;  1KQS P;  1Q7Y R;  3CME Q;  1Q86 R;  1N8R R;  3G71 Q;  1JJ2 P;  1YI2 Q;  3CPW P;  1M1K R;  1K73 R;  3CXC P;  1VQ8 Q;  1VQ4 Q;  1VQO Q;  1QVF P;  1YIT Q;  3CC2 Q;  1VQ9 Q;  3CC7 Q;  1S72 Q;  1VQK Q;  1YIJ Q;  1W2B P;  1KD1 R;  1VQ6 Q;  1M90 R;  3CC4 Q;  3G6E Q;  1Q81 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...