1YIJQ

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yijQ00
3CCLQ 1M1KR 3CCMQ 1KQSP 1VQ9Q 1VQ4Q 3CCSQ 1YJWQ 3G6EQ 1VQPQ 1JJ2P 3CC2Q 1K8AR 3CCVQ 1VQOQ 1KC8R 1QVFP 1YI2Q 1VQ6Q 3CCEQ 2OTJQ 1YJNQ 1VQ7Q 1NJIR 1N8RR 3OW2P 1YIJQ 1YJ9Q 1S72Q 1Q7YR 3CXCP 1K9MR 3I55Q 3CC4Q 3CCRQ 3CCJQ 1KD1R 1YHQQ 1VQKQ 1YITQ 1QVGP 1W2BP 2QA4Q 3G4SQ 3CCQQ 1VQ5Q 3CMAQ 1Q86R 1K73R 1VQNQ 3CC7Q 1Q81R 3I56Q 3CCUQ 1Q82R 3CPWP 1VQ8Q 3CD6Q 1VQMQ 1M90R 3G71Q 1VQLQ 2QEXQ 3CMEQ 2OTLQ
chains in the Genus database with same CATH superfamily
2YSQA 1KSWA 3URGA 3JAME 1Q7YR 4II1A 5LJ3h 4BACA 1HJDA 4KGVB 2QQBA 4IUVA 4E2FB 4RTTA 1K73U 1P92A 1X6GA 3KUFA 2L89A 3ER0A 3CCQA 3EFSA 2BE9B 3OYYA 1U8RA 3L1AA 4M7AB 2DTIA 2QTXA 1Y0MA 1WXBA 2RMOA 3JB9H 5IH2A 1EZZB 1X6OA 2FPFA 1QVGP 2MYSA 3CC2A 2AK5A 3CPWP 5KYUB 1ZQ1A 1UGRB 3CCMQ 3RBBB 1ZSZA 1QVFS 1VQOQ 4F7UG 2KMTA 1PG5B 1JBMA 2KRSA 3S3OA 1G2BA 1QVFA 2ZPHB 1BB9A 1EX4A 2A7YA 2EQJA 4X9CA 1H641 1TUDA 4RTZA 2O9VA 3QJYA 3J7AF 1QMCA 3VS4A 1JJ2S 2KRMA 2ZGWA 1D0XA 1BK2A 1WHLA 5IHKA 4FU6A 2JT4A 2JOYA 3EG2A 1Q82R 2LT1A 5HK0A 3VU3C 1QW1A 4C92A 3QHSA 2VV5A 2DVJA 2XDPA 5IT9E 2ZZDA 3MP6A 2PZ1A 2E1HA 4LDUA 3CCVQ 2OTLT 3OYBA 2KYBA 4OB1B 1MMDA 1VQ7Q 1VQ5T 2LNHB 3PT9A 4DBRA 2VWFA 3VRYA 1RUWA 3NFCA 4CRIA 1WQ7A 3M4GA 3G7ZA 2NUPB 1U3OA 5IHIA 2EYZA 3X20B 3OSVA 5GJVB 9ATCB 3MEWA 4PLLA 3UPUA 5CR2A 3CC2Q 1K8AR 3QG1A 4JRIA 3OMCA 3JCMh 4M78B 3SDZA 2A3LA 5FRNA 1YIJQ 3JCMb 1S72Q 3QSUA 2IVWA 2VGMA 3M55A 2COYA 2XMFA 4E7KA 1LNXA 4EPCA 3NPFA 3GNGA 1PSEA 3L2WA 2XI9A 1K0SA 3WXMB 1QKWA 5GANg 1ACMB 3CCEQ 2OTLA 4M78D 3JCMX 2LCCA 2IG0A 2K5IA 1SSFA 4JDSA 2ESWA 4X34A 1WJSA 3JCMW 2VYTA 3I56Q 1OULA 3I55T 4XTWA 4JS4A 3GOXA 3CC7T 2E12A 5AT1B 1B3QA 2QEXT 3LW5E 2O88A 4J8OA 2RQVA 4IIOA 4HVWA 2O4XA 4C5EA 2A36A 3SHWA 1HSQA 4YTLA 4RTXA 1VQ6T 2GQVA 5LJ3e 4C5IA 3H8ZA 3I35A 3R6NA 4M75C 2L3PA 2C0OA 3VKIA 1VQ6A 4JUVA 4L59A 1KHIA 3KFVA 4PFZA 1FMVA 1A0NB 1N6AA 3KBGA 2G6FX 4QVCA 3V8LA 1VQ9A 3SD4A 2VB6A 3A5ZB 4B9WA 1RABB 4LN2A 4KBMB 4QT7A 4C0DC 3A8OB 4PJJA 2MAMA 5GAN2 4A4EA 1S72A 2KYMA 4EIKA 3EG9A 1OOTA 4IUQA 3EGDB 3SFMA 1UUEA 2RI3A 3CMAA 4DEXA 4J9DA 1W4SA 2DLPA 1I1JA 1QKXA 2CH4W 4V2SA 1YFNA 4PJOF 1NJIU 2SEMA 2E70A 3VYGA 1Q81R 1AWJA 1GBRA 1M30A 5CKBA 4J7FA 3G4ST 1TTHB 1WHMA 1IHVA 4LE9A 1Y96B 3G71T 2ABLA 2JNGA 3INZA 3OW2S 4BDZA 1X27A 1YCSB 3EHQA 3HSBA 2LMJA 1RAGB 1D1AA 4M75B 2ZPGB 4ZGEB 1V76A 3UT1A 4RCCA 3N5BB 4C92E 5GAN6 1UGPB 3MCAB 2DL7A 2W10A 1BCOA 3M0QA 4EMKB 4LDYA 2RN8A 2HCKA 2EAYA 2B8AA 1WHGA 3EH1A 1FMWA 1X6BA 4PJOA 1XTDA 2PVOB 5FWCA 4EMGA 2KI7A 2JS2A 2DM1A 4JRKA 4RTWA 4M7DB 3VUBA 1TOVA 5AYFA 2CP7A 2X9HA 2DZCA 4M7DD 3A8HB 1X43A 2WSFE 2MI6A 1G3TA 2O01E 1YWPA 1VOMA 3P8HA 5FU6B 1JB0E 2RQTA 2AZSA 4C92D 3DB3A 1KD1C 4XTXA 4M7AE 2K3XA 2J6OA 2DNUA 2VVKA 3TCJA 2QA4A 3C0CA 1UJ0A 4CC4B 5M9OA 2AKKA 3CD6Q 5LJ5j 1G5VA 2HL5C 2PVDB 4Q5WA 4QVDA 3OS2A 3CCVT 3MO8A 2I0NA 3X26B 1O75A 4PK4A 3CMET 4N0AA 1UG1A 4C92B 1M9SA 4PLIA 4J6XA 3RR6A 4RKUE 3I55A 5C6SA 3RNJA 1OZ3A 4M4ZA 4C92G 1X01A 3NTHA 4Y92A 5IXBA 3THKA 5A0GA 1QWEA 3VS6A 4J7IA 1JJ2P 2KROA 4UC4A 1MMAA 5GAN4 2QQSA 5GAN8 2HBWA 2OTJQ 1GFCA 2DFUA 4QQGA 2LT4A 1MNDA 1JU5C 3HL8A 2GTJA 7AT1B 5GAMj 1LJOA 3VYHB 3VS0A 1MUZA 4JRQA 1YJ9T 5CK9A 1GBQA 4IUTA 2LC4A 3CCET 1K9AA 1Y71A 3ZFJA 5CKEA 3UATA 2X4WA 4AG1C 4CC2A 1JJ2A 2HQXA 1YHQT 2Y90A 3G4SA 1YJWT 4L5GA 1ZX6A 5GANj 1YJ9A 1OYXA 1VQNT 2COWA 1GCQC 2DPPB 2EJ9A 5FU7C 1FX7A 3JB9F 3CC7Q 1NZ9A 3H0IA 2QEXQ 1M3BA 2DXTA 1O9SA 2ED0A 2LP5A 1SRMA 1UGSB 3G6EQ 1VQ5A 1WLPB 3MJXA 4M78C 2FZKB 2KGTA 2A37A 1VQ6Q 3CCST 4C5HA 3CCSA 1CSKA 2FPEA 2K5FA 1T0JA 3RKXA 2YUNA 3CCRQ 4BE2A 2M16A 3M0PA 5D6YA 3QPHA 3LWHA 3EG3A 1IRXA 4HCBA 2ATCB 1N8RC 4XAXB 2DETA 4PJOB 5HCKA 2JMCA 3TQ7P 3I56A 1YJWA 2VC8A 3RIRA 4FM4B 3FC3A 2DIQA 3PVQA 1M90R 4JZ3A 1K73C 2HQEA 3M0UA 2MWOA 4M78F 2QEXA 2FO0A 2RHYA 4F17A 1KC8R 1C6VX 3OQ5A 2EIFA 1I5LA 3HRSA 4XTYA 2EQMA 2QI2A 5GAOr 4XU0A 5EC7A 3G4SQ 4F04B 1ZBXA 3CCLA 2YLCA 1QVGA 2C0IA 1KQSP 2ECZA 4LUEA 2V1RA 1RL2A 5I22A 2JW4A 4VUBA 1EFNA 4BI3A 3WVDB 2E4HA 5KE3A 3CCQT 2I2LA 2R57A 3OS0A 3M57A 3EH2A 6AT1B 2QAZA 2NYSA 1YHQA 4DBFA 1VQLQ 2AHJB 2VXEA 2LJ1A 3QIIA 3OYDA 3G71A 4M7DG 3SWNA 2CT3A 4D8KA 2CREA 5DLOA 2E5KA 1VQPT 4WF2A 1OX9A 1X2KA 1TS9A 2QQRA 3MP8A 3OYNA 2YRCA 2HDAA 4J5YA 2CGHA 3NMZC 2EWNA 1RI9A 5CKHA 5GAN5 3PIOA 2EGCA 5LJ3g 1Q82U 2DA9A 1KQSA 1UE9A 2K6DA 4AT1B 3S6WA 2LQWA 4EDUA 4M7AD 1G3WA 3MPUB 2HQHA 4KUIA 5LL6S 3MP1A 3L2RA 1N8RR 4IURA 3GIBA 1VQLA 3CD6T 1TSFA 4FSSA 1ZHIA 2EYWA 3JCMc 2L5QA 5KYYB 1M1KU 2LNVA 3FJPA 1VQ8T 4EMHA 4F7UE 2PTKA 3CCMA 4HT9A 2O9SA 1MMGA 2A08A 2F5KA 4ORZA 2GTOA 1F1BB 2RI5A 3HPWA 3HTRA 1GFDA 1U1SA 2CSIA 2AIRB 2DK3A 1K0XA 4OMLA 1G3SA 1U5SA 3GF5A 1UEBA 1ZSGA 4Z88A 1SSHA 1VQMT 1KQ2A 3CBMA 3DKMA 1PHTA 3JB9D 2CP0A 2FZCB 1QVFP 4F16A 3CQTA 1N9SA 1AVZC 1YN8A 2HZYA 5IHNA 4M7AF 3UWNA 1UGQB 4OP0A 5J26A 1V1CA 3OYFA 2LRQA 4C0DB 1YHQQ 2EJGA 1AHJB 4XU1A 4WCIA 1YJWQ 1VA7A 3P8BB 4ZN3A 1K8AU 4QQ6A 3OYEA 1C0MA 3OA6A 1D3BA 3M4YA 2HAXA 3OYHA 1LCKA 3M56A 4J83A 4PJNA 3CC4A 4C8QC 5HK3A 2CYZB 2DL8A 1KD1U 2X35A 1Q95G 1BI2A 1R77A 5LJ3d 1KIKA 3CCLQ 1M1KR 4MZTA 2FVUA 2JN0A 2FRWA 2MCNA 3CCSQ 3EFOA 5CVIA 1WHKA 2XD0A 2DXBA 1AZGB 2MF2A 2DMOA 1OQKA 3SWNC 1SHFA 2K79A 4PKCC 2DYBA 1ABOA 4A63B 3M0SA 3FEOA 1UGVA 1IB8A 2BE7D 3CMAT 3KXTA 3SEMA 3M54A 5DLQE 3JB9I 2RJCA 3BDUA 3TREA 3L2UA 4IKFA 3PNWC 4FIBA 3RMSA 3JCMe 2CUDA 1I0CA 1MV0B 3QDFA 4QQDA 4R0KA 3OYMA 3JCMd 1G83A 3FIFA 1WXTA 1QCFA 4PNOA 3JCMJ 1OX8A 1IHWA 4NS5A 2NUTA 4KGXB 4DA4A 4DQ2A 5D6XA 1Z9ZA 1RLQC 1LVKA 3F70A 2DRMA 2P4TA 1UECA 4E6RA 4AG2C 3TSWA 2HKNA 2RD1A 5CKDA 2MMPA 2GFUA 2P0QA 2PNIA 4XTVA 3CCJA 2HBPA 3A98A 5GAMe 4E7SA 1R0CB 4FW1A 3C12A 3PGGA 1VQ5Q 3G6EA 1J3TA 4F14A 5GAOn 3VS5A 3CEYA 4O5VA 4PJOC 2D9TA 2M9UA 2HSEB 1M5Q1 1M3AA 1IGUA 1XJWB 1X69A 1B07A 5KYXB 3AT1B 3RESA 3OYJA 1NE8A 4AMCA 1WFWA 1Q86C 1RAIB 2FL7A 5HKCA 1H3ZA 5FROA 4ZGDB 2ZPFB 1E6HA 1VQLT 4XTUA 3CD6A 1YIJT 1I07A 3JCMV 4BI8B 1UHCA 2WSCE 2KNBB 2A0FB 3RKWA 1R8OB 2JM9A 1M3CA 2V8JA 4BE0A 1VQPQ 2EPDA 3A8MB 1YJNT 2LVMA 4AFSC 2KT8A 2QXFA 5GAMg 2DO3A 5I11A 1K76A 1PWTA 4HXJA 1VQKQ 2E5QA 2KXCA 2J6FA 3TSZA 5CQXA 2DEUA 2DX1A 2QA4T 3EAEA 5IXFA 3I56T 1YBYA 2FHDA 2NUPA 2X3WD 1AZEA 1KHCA 3HP9A 3HHTB 2HL3A 4FT2A 2LTOA 2RQRA 5LJ3j 2CUBA 4MZMA 3J81E 1YITQ 4C8QE 2F2XA 4DBQA 1N27A 2PU9B 1BI0A 5GAOm 1IREB 1VYUA 1WDXA 4E7LA 5L23A 2L3QA 4RCBA 4HT8A 2DF6A 2R5AA 3LGLA 4X1VA 1NEGA 4MMKA 8ATCB 1PM3A 1W1FA 4PJMA 3V8JA 5I2MA 1U1TA 4E47A 4FYVB 2Y4YA 1BCMA 2CZ6B 4Y91A 1JEGA 1K73R 2GQIA 4OB3B 2EJFA 3CPFA 1VQPA 1SG5A 1IZ6A 1VQNA 2YT6A 1JXMA 2D6FA 5KYWA 2K5LA 2QQ9A 1QP2A 4DOWA 1BI1A 1NEBA 4C92F 3I9QA 4R55A 5GANe 4DBHA 4A53A 5EG2A 1NPRA 4HVUA 4A4GA 4BY6C 1H3HA 2O4XB 1NBEB 5GMKl 1VQ9Q 1R0BG 1M90C 2QDYB 4N4IA 1QLYA 2M0OA 2JZ2A 1HD3A 2EVRA 1BBZA 4Y28E 1KC8C 1M2VB 3ULRB 3VUZA 2M51A 2AKLA 3HFOA 5CAIA 2NUTB 1YI2T 2CS7A 4PL6A 3CCJQ 3EGXA 2CDTA 3CCLT 3UF4A 2P0KA 2E41A 2COZA 2GFAA 2SRCA 2FPDA 4RTYA 2HSPA 2RB6A 1TG0A 2KQWA 3GNFB 3QWYA 1PNJA 1DJ7B 4J9CA 3AHUA 3CCUA 2CP6A 4C92C 3HRUA 1NM7A 5GAMh 3EG9B 3V8KA 3GP8A 3CMAQ 2HKQB 5ECAA 4DOVA 3PIPA 3H0FA 1G3YA 2X51A 5GAMd 1B34A 4IUUA 5DY9A 1RLPC 2JTFA 1Z9QA 2V8IA 5DM7R 2QGGA 3CCEA 1VQ8A 5GANf 4PFPA 5KCOA 3BY7A 1H92A 4OB2B 5FU6C 2J7IA 3O5ZA 2F69A 1VYTA 1M1GA 1NPPA 3E1SA 3C4SA 2KE9A 1KJWA 1PKTA 2RJDA 3TVTA 1YJNA 1Y96A 2CP2A 5GAOp 2LQNA 5GAMf 1ZA1B 2LX7A 5L8RE 3ZBDA 3JB9G 2Z0WA 5LJ5h 2M0YA 1IO6A 2DIGA 4NL2A 1K8AC 4AFUC 2LJ3A 3R6OA 1NLPC 4FYXB 4JJCA 1KK7A 2BKDN 3CC4Q 1M8MA 4RG2A 4LUDA 3VJPA 4JRPA 2L3SA 5FU7B 2IIMA 3BE3A 2HNIA 2OTJA 1Q81C 2A28A 1VQ7A 3OSSC 4F7UB 2D0NA 3FJ5A 2DJQA 4F7UF 2KEAA 3D7SB 3ZL7C 4D6WA 4BUGA 2MWPA 1PD1A 2J6KA 3EGUA 1RADB 3META 2JTMA 5KYXA 1RAEB 3LWIA 2F5TX 2X4JA 1MGQA 2JTEA 4A4HA 3RUXA 2KY9A 2RHIA 1HK9A 4HVVA 2L8DA 1Y57A 2DTOA 4C8QG 2LCSA 3E9FA 1AWOA 2RNAA 1WIEA 4HKEA 2F2VA 2BTTA 3JB9J 1WZOA 4AFQC 2YRDA 4PJOG 3NTIA 5GMKh 1QQJA 8AT1B 2PUKB 3EHRA 2QA4Q 4M77A 4JPBW 3RMQA 1VQNQ 4JJNK 1M8VA 2AZVA 4FYWB 4GY5A 3QXEB 4M7DF 2DZ9A 2XIDA 3OMGA 1NJIC 3V7SA 2MPXC 2CZ0B 3FDRA 4Z02A 1M1KC 1ABQA 3QO3A 3LH5A 3VRZA 1YITT 5CO7A 2IPOB 2YUPA 3A1PA 2Y4XA 1D09B 5GANd 3V7CA 1UJYA 2ROTA 3OYCA 3PMIA 3OS1A 1ZSZB 2QASA 1JXOA 4ELZC 3CCRT 2CZ7B 4M78E 5GAOl 2X4XA 4ZTJA 2LQKA 4M77D 2HD0A 4BI4A 2E3HA 2FYKA 2VUBA 2EQUA 2L3RA 3QBYA 3CPWS 2ZCFB 4ZTFA 1LPLA 2RK1A 2D8JA 2K3YA 4FT4A 1TXQA 4IUPA 1FYNA 3QZ9B 1Q86U 3E9GA 3M59A 2OI3A 4QKUA 1D1CA 2MK5A 1VIFA 2ZPEB 3PE0A 4CI0C 2K9GA 1BI3A 1OPKA 2DD4A 1I5OB 1Y7XA 3REAB 2YWWA 1VQKA 1K1ZA 3VS2A 2CT4A 2CZ1B 2VKNA 1LOJA 3H9NA 1VQOA 2H3EB 2JXBA 1TWBA 1VQ9T 2XK0A 3WVEB 2DYIA 2CKKA 1FMKA 5I21A 1MMNA 4MDXA 3LYIA 1YI2Q 2QYZA 4AFZC 3CCJT 3SWNB 4M75F 4B6MA 4OMMA 2OX7A 4OGCA 4MZPA 3LGFA 1W70A 1SHGA 4BD3A 3CCQQ 1Q86R 2WACA 2E3IA 3X28B 5GAOq 1MV3A 2JM8A 4A54A 1AEYA 3J80E 1WI7A 1WNLA 1Q7YC 1JRIA 5A0DA 1OZ2A 2VXFA 2BUDA 3PMTA 1OPLA 3C95A 2EYXA 1NJIR 5LJ3f 2RJFA 2DVEA 3UA7A 1KD1R 1U06A 1PD0A 1M2VA 3X25B 2NWMA 1UHFA 3PVLA 2EW3A 4M77G 4QVZA 1RI0A 2KAFA 2L2PA 2D1XA 2EYYA 4M7AG 4GBQA 2QDLA 1PCXA 3T9NA 2PQWA 2EYQA 2CH4A 3QYGB 5I2SA 1YP5A 4J6WA 2DXCA 1VQ4T 2KK4A 1KFZA 4LD9K 1ZBJA 2E6ZA 4NOYA 2ROLA 3OBYA 5GMKe 2XKOC 3OYIA 2HEQA 1KG1A 4OGEA 2DE0X 4Z89A 1OEBA 1ZA2B 2JMAA 2M02A 3LLRA 4ZN1A 1VQ4A 2OTLQ 3OY9A 2DAQA 1FXXA 4LDWA 3CCUT 3L42A 1VQ7T 1SKUB 2LJ0A 1MNEA 5GAN3 1BU1A 1WJRA 5CQYA 4M77B 4P5NA 1RAHB 5GMKm 1Q7YU 5GMKj 2RQUA 1KQSS 1PRLC 2RH2A 3RKYA 2QQAA 3OBWA 2HMAA 2KR3A 4JLGA 4OMFB 2YDLA 4LDXA 2DKGA 2O2OA 3CBOA 2DL5A 1YWOA 2D0QB 2K2VA 3CXCS 2DJZA 1PRMC 2KBTA 3JCMQ 1K9MU 3OYGA 4M7DC 1EIFA 3OS5A 1VIEA 2ED1A 1RACB 1S1NA 4LD6A 3I5RA 4NL3A 2D8HA 1IXDA 1OU8A 2YRVA 1ZUUA 2RK2A 4L6V5 3CXCA 2OJ2A 2RM4A 2YUOA 4ESRA 1E7OA 1UFFA 3A8GB 3O8VA 3A8LB 1VYVA 3I55Q 1RAFB 3MHXA 2DILA 3BFMA 4QW2A 3QDRB 1M2OA 5CIUA 2DD5A 3GBQA 5C0MA 1I4K1 1M90U 3H6ZA 4HCKA 3FLGA 4C8QA 3MEUA 3UA6A 3HFNA 4BE1A 1B7TA 1KC8U 3GPLA 5KYYA 1X75C 3VS3A 3L2QA 3TU4K 2DXUA 1SF9A 3E19A 1AWXA 1G8XA 1T0HA 4TVRA 1QVGS 4PFOA 1W2BS 1ZSZC 4IIMA 4JLIA 2GCXA 4FCYA 5KE2A 4M7DE 1SPKA 2KXDA 2J06A 4M77E 3M5AA 1K9MC 4JJDA 2MOXA 2XDBA 2JJ9A 1UB4A 1E6GA 1D0YA 3GLXA 5HY6A 1CKBA 1GXIE 4KGZB 1GL5A 3S3MA 3MEAA 3OW2P 3S3NA 3JSCA 4OMNA 4K11A 3SB2A 2XDDA 3QUIA 1AOJA 2P4RA 4J6YA 3L2VA 4LDVA 2QTVA 3OYKA 2W0ZA 1YCYA 2BZXA 2KVQG 2FG0A 1VUBA 4RG8A 2LDMA 3RERA 2EFIA 3NHNA 1OV3A 4GLKA 2ZAEA 2JVVA 1D3BB 2EQIA 2LZ6B 1WHJA 1CKAA 1ZUKA 3M0RA 3G71Q 4HCZA 1QVPA 2CSQA 2X3XD 1GCQA 4M75E 1AT1B 3FRNA 4Z8AA 2F2WA 4A4KA 3P8DA 3M53A 4HA8A 3DLLA 4XK8E 1VQMA 2JS0A 1N8RU 2DL4A 2E65A 5GJWB 4KT0E 1BIBA 3TEEA 4RMOA 1TH7A 1NYGA 2V26A 5J3BA 1QCNA 1AD5A 1WGSA 3I5SA 2YXYA 2V8KA 3OYLA 2RPNA 4E7HA 2GF7A 3BW1A 4KRTA 1YJNQ 2L0AA 4FW2A 2KRNA 5J39A 4A4FA 4CC3A 1ZLMA 4BB7A 1YNZA 2YHTA 1VQKT 4M78G 1WXUA 4XU3A 2GGRA 1VQ4Q 4XQ3A 1T3LA 2NLUA 1Y07A 1IGQA 4N4GA 2R58A 4EMKA 2K57A 1HYOA 2OAWA 4PJLA 5GAN7 2NUZA 2DL3A 4OMPA 4GLMA 1W6XA 1N9RA 4C8QB 1XQHA 2BZYA 2OAUA 3IQLA 3CCUQ 5IAYA 4E7JA 3CMEA 2DEQA 2ENMA 3JRZA 1OU9A 3CMEQ 1NG2A 5CCAA 4OMQA 4R56A 3U23A 5LJ5e 2CP3A 2P0PA 1ZUYA 4PJOE 2K4YA 3JCMf 2DTHA 3PFSA 4FL6A 4KH0B 4M7AC 5LJ5g 5D6WA 4XTZA 5KYWB 1TU0B 5CKFA 2OTJT 2H3JA 5LJ5d 3CC7A 2XG8D 4D8DA 2J05A 4C0GA 4RTUA 3Q1JA 2C0TA 2H8HA 1YJ9Q 2E6NA 5KYUA 3CXCP 2O31A 3LX7A 1YIJA 1D0ZA 3ZEHA 4LXCA 2FEIA 3RDVA 2EGAA 2QG9B 4N4HA 5GMKi 3CPWA 1C1AA 1QWFA 4RUGA 4DEYA 3LH0A 4M75D 5D7UA 3G1JA 3CBPA 1FWZA 1UTIA 3M9QA 4M77C 1SEMA 2PVGB 4B9XA 3QZ5B 4E7ZA 4J9EA 2DBMA 5FLXE 4ZGJB 3DLMA 1I8FA 3DB4A 1M4ZA 1I81A 1K9MR 4FSXA 1XOVA 1Q81U 1TUGB 2RF0A 4MMLA 4RTVA 3G6ET 3CCVA 4ATOA 5FRMA 4M7DA 1MHNA 2QGFB 3PTAA 5FW9A 1RAAB 1WJQA 3CCMT 2E10A 1BKBA 3QJ6A 2RHZA 4JS5A 4PJOD 1GRIA 1VQOT 1YITA 1WYXA 4C0ZA 4HCCA 1GCPA 1B34B 4J9FA 1W2BP 1NYFA 2KSSA 1QCOA 2R5MA 1M1FA 2F1LA 4C8QD 2EBPA 3QWXX 4ME7A 3MKDA 1OI1A 2EQKA 2RO0A 2K3BA 2K7AA 3ME9A 2CP5A 4JZ4A 3NGPA 1WX6A 1WQWA 2P84A 4J9HA 3M0TA 4CC7A 3REBB 4C8QF 3JCMg 2EKOA 2LQ8A 2XHCA 1D1BA 4OF1A 2JUFA 4KH1B 4F7UA 4J9BA 4J9IA 1PSFA 2PUOB 1PKSA 2AT1B 3EGXB 3JV3A 3ASKA 1XNIA 4ELYC 2RHXA 3VS1A 4M7AA 1ARKA 1M27C 3H0HA 4ZNXA 4J9GA 4BDYA 1BIAA 2RI2A 1WPYA 4OVAA 3NTKA 1SRLA 1HXDA 1W2BA 3EGDA 1JQQA 3L2ZA 2DRKA 3MEVA 3EFOB 4EMKC 3CC4T 4KUDK 3V7RA 2RJEA 3E2UA 2V1QA 1KQ1A 3X24B 2KDSA 2EGEA 1V29B 2KT1A 1Q82C 2B86A 5FWBA 4LNPA 4E7IA 3CC2T 2RHUA 4XU2A 3QYHB 2DERA 4JJBA 2BIVA 1WHHA 4N0AC 4FYYB 1TUCA 1S72T 3BDLA 5KYNA 2M1HA 2FB7A 3UDCA 2RA2A 4ANJA 2GNCA 1JO8A 2DBKA 2MIOA 1N5ZA 3H41A 1WA7A 2GBQA 2X4YA 4O6JA 1K4US 4M75A 1NLOC 4M75G 2YUQA 2FRYA 2FZGB 1AWWA 2XU8A 2RQWA 4KULA 2XICA 3OB9A 3OYAA 3QKJA 3VV0A 2VASA 3CCRA 2ZPIB 5IN1A 4C5GA 1T3SA 2EKHA 4OB0B 4BY6B 3HRTA 2LCLA 3M58A 3JCMP 4C0FA 4MDWA 2E64A 2ZPBB 5A2QE 4X9DA 5LJ5f 4M78A 4OMOA 5KH6A 2BZ8A 2G3RA 4M77F 1VQ8Q 3EG0A 4WTOB 2K2MA 3EG1A 2QK0A 1QP3A 3VS7A 2WSEE 1YI2A 1H8KA 2YLBA 3FB9A 1X2QA 3C94A 5A0LA 3EFRA 5KCHA 2C06A 1BYMA 2VGNA 5GANh 3OW2A 2LX9A 1PC0A 1VQMQ 1UDLA 3HKSA
chains in the Genus database with same CATH topology
3CCLQ 1M1KR 3CCMQ 1KQSP 1VQ9Q 1VQ4Q 3CCSQ 1YJWQ 3G6EQ 1VQPQ 1JJ2P 3CC2Q 1K8AR 3CCVQ 1VQOQ 1KC8R 1QVFP 1YI2Q 1VQ6Q 3CCEQ 2OTJQ 1YJNQ 1VQ7Q 1NJIR 1N8RR 3OW2P 1YIJQ 1YJ9Q 1S72Q 1Q7YR 3CXCP 1K9MR 3I55Q 3CC4Q 3CCRQ 3CCJQ 1KD1R 1YHQQ 1VQKQ 1YITQ 1QVGP 1W2BP 2QA4Q 3G4SQ 3CCQQ 1VQ5Q 3CMAQ 1Q86R 1K73R 1VQNQ 3CC7Q 1Q81R 3I56Q 3CCUQ 1Q82R 3CPWP 1VQ8Q 3CD6Q 1VQMQ 1M90R 3G71Q 1VQLQ 2QEXQ 3CMEQ 2OTLQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL Q;  1M1K R;  3CCM Q;  1KQS P;  1VQ9 Q;  1VQ4 Q;  3CCS Q;  1YJW Q;  3G6E Q;  1VQP Q;  1JJ2 P;  3CC2 Q;  1K8A R;  3CCV Q;  1VQO Q;  1KC8 R;  1QVF P;  1YI2 Q;  1VQ6 Q;  3CCE Q;  2OTJ Q;  1YJN Q;  1VQ7 Q;  1NJI R;  1N8R R;  3OW2 P;  1YIJ Q;  1YJ9 Q;  1S72 Q;  1Q7Y R;  3CXC P;  1K9M R;  3I55 Q;  3CC4 Q;  3CCR Q;  3CCJ Q;  1KD1 R;  1YHQ Q;  1VQK Q;  1YIT Q;  1QVG P;  1W2B P;  2QA4 Q;  3G4S Q;  3CCQ Q;  1VQ5 Q;  3CMA Q;  1Q86 R;  1K73 R;  1VQN Q;  3CC7 Q;  1Q81 R;  3I56 Q;  3CCU Q;  1Q82 R;  3CPW P;  1VQ8 Q;  3CD6 Q;  1VQM Q;  1M90 R;  3G71 Q;  1VQL Q;  2QEX Q;  3CME Q;  2OTL Q; 
#chains in the Genus database with same CATH topology
 2YSQ A;  1KSW A;  3URG A;  3JAM E;  1Q7Y R;  4II1 A;  5LJ3 h;  4BAC A;  1HJD A;  4KGV B;  2QQB A;  4IUV A;  4E2F B;  4RTT A;  1K73 U;  1P92 A;  1X6G A;  3KUF A;  2L89 A;  3ER0 A;  3CCQ A;  3EFS A;  2BE9 B;  3OYY A;  1U8R A;  3L1A A;  4M7A B;  2DTI A;  2QTX A;  1Y0M A;  1WXB A;  2RMO A;  3JB9 H;  5IH2 A;  1EZZ B;  1X6O A;  2FPF A;  1QVG P;  2MYS A;  3CC2 A;  2AK5 A;  3CPW P;  5KYU B;  1ZQ1 A;  1UGR B;  3CCM Q;  3RBB B;  1ZSZ A;  1QVF S;  1VQO Q;  4F7U G;  2KMT A;  1PG5 B;  1JBM A;  2KRS A;  3S3O A;  1G2B A;  1QVF A;  2ZPH B;  1BB9 A;  1EX4 A;  2A7Y A;  2EQJ A;  4X9C A;  1H64 1;  1TUD A;  4RTZ A;  2O9V A;  3QJY A;  3J7A F;  1QMC A;  3VS4 A;  1JJ2 S;  2KRM A;  2ZGW A;  1D0X A;  1BK2 A;  1WHL A;  5IHK A;  4FU6 A;  2JT4 A;  2JOY A;  3EG2 A;  1Q82 R;  2LT1 A;  5HK0 A;  3VU3 C;  1QW1 A;  4C92 A;  3QHS A;  2VV5 A;  2DVJ A;  2XDP A;  5IT9 E;  2ZZD A;  3MP6 A;  2PZ1 A;  2E1H A;  4LDU A;  3CCV Q;  2OTL T;  3OYB A;  2KYB A;  4OB1 B;  1MMD A;  1VQ7 Q;  1VQ5 T;  2LNH B;  3PT9 A;  4DBR A;  2VWF A;  3VRY A;  1RUW A;  3NFC A;  4CRI A;  1WQ7 A;  3M4G A;  3G7Z A;  2NUP B;  1U3O A;  5IHI A;  2EYZ A;  3X20 B;  3OSV A;  5GJV B;  9ATC B;  3MEW A;  4PLL A;  3UPU A;  5CR2 A;  3CC2 Q;  1K8A R;  3QG1 A;  4JRI A;  3OMC A;  3JCM h;  4M78 B;  3SDZ A;  2A3L A;  5FRN A;  1YIJ Q;  3JCM b;  1S72 Q;  3QSU A;  2IVW A;  2VGM A;  3M55 A;  2COY A;  2XMF A;  4E7K A;  1LNX A;  4EPC A;  3NPF A;  3GNG A;  1PSE A;  3L2W A;  2XI9 A;  1K0S A;  3WXM B;  1QKW A;  5GAN g;  1ACM B;  3CCE Q;  2OTL A;  4M78 D;  3JCM X;  2LCC A;  2IG0 A;  2K5I A;  1SSF A;  4JDS A;  2ESW A;  4X34 A;  1WJS A;  3JCM W;  2VYT A;  3I56 Q;  1OUL A;  3I55 T;  4XTW A;  4JS4 A;  3GOX A;  3CC7 T;  2E12 A;  5AT1 B;  1B3Q A;  2QEX T;  3LW5 E;  2O88 A;  4J8O A;  2RQV A;  4IIO A;  4HVW A;  2O4X A;  4C5E A;  2A36 A;  3SHW A;  1HSQ A;  4YTL A;  4RTX A;  1VQ6 T;  2GQV A;  5LJ3 e;  4C5I A;  3H8Z A;  3I35 A;  3R6N A;  4M75 C;  2L3P A;  2C0O A;  3VKI A;  1VQ6 A;  4JUV A;  4L59 A;  1KHI A;  3KFV A;  4PFZ A;  1FMV A;  1A0N B;  1N6A A;  3KBG A;  2G6F X;  4QVC A;  3V8L A;  1VQ9 A;  3SD4 A;  2VB6 A;  3A5Z B;  4B9W A;  1RAB B;  4LN2 A;  4KBM B;  4QT7 A;  4C0D C;  3A8O B;  4PJJ A;  2MAM A;  5GAN 2;  4A4E A;  1S72 A;  2KYM A;  4EIK A;  3EG9 A;  1OOT A;  4IUQ A;  3EGD B;  3SFM A;  1UUE A;  2RI3 A;  3CMA A;  4DEX A;  4J9D A;  1W4S A;  2DLP A;  1I1J A;  1QKX A;  2CH4 W;  4V2S A;  1YFN A;  4PJO F;  1NJI U;  2SEM A;  2E70 A;  3VYG A;  1Q81 R;  1AWJ A;  1GBR A;  1M30 A;  5CKB A;  4J7F A;  3G4S T;  1TTH B;  1WHM A;  1IHV A;  4LE9 A;  1Y96 B;  3G71 T;  2ABL A;  2JNG A;  3INZ A;  3OW2 S;  4BDZ A;  1X27 A;  1YCS B;  3EHQ A;  3HSB A;  2LMJ A;  1RAG B;  1D1A A;  4M75 B;  2ZPG B;  4ZGE B;  1V76 A;  3UT1 A;  4RCC A;  3N5B B;  4C92 E;  5GAN 6;  1UGP B;  3MCA B;  2DL7 A;  2W10 A;  1BCO A;  3M0Q A;  4EMK B;  4LDY A;  2RN8 A;  2HCK A;  2EAY A;  2B8A A;  1WHG A;  3EH1 A;  1FMW A;  1X6B A;  4PJO A;  1XTD A;  2PVO B;  5FWC A;  4EMG A;  2KI7 A;  2JS2 A;  2DM1 A;  4JRK A;  4RTW A;  4M7D B;  3VUB A;  1TOV A;  5AYF A;  2CP7 A;  2X9H A;  2DZC A;  4M7D D;  3A8H B;  1X43 A;  2WSF E;  2MI6 A;  1G3T A;  2O01 E;  1YWP A;  1VOM A;  3P8H A;  5FU6 B;  1JB0 E;  2RQT A;  2AZS A;  4C92 D;  3DB3 A;  1KD1 C;  4XTX A;  4M7A E;  2K3X A;  2J6O A;  2DNU A;  2VVK A;  3TCJ A;  2QA4 A;  3C0C A;  1UJ0 A;  4CC4 B;  5M9O A;  2AKK A;  3CD6 Q;  5LJ5 j;  1G5V A;  2HL5 C;  2PVD B;  4Q5W A;  4QVD A;  3OS2 A;  3CCV T;  3MO8 A;  2I0N A;  3X26 B;  1O75 A;  4PK4 A;  3CME T;  4N0A A;  1UG1 A;  4C92 B;  1M9S A;  4PLI A;  4J6X A;  3RR6 A;  4RKU E;  3I55 A;  5C6S A;  3RNJ A;  1OZ3 A;  4M4Z A;  4C92 G;  1X01 A;  3NTH A;  4Y92 A;  5IXB A;  3THK A;  5A0G A;  1QWE A;  3VS6 A;  4J7I A;  1JJ2 P;  2KRO A;  4UC4 A;  1MMA A;  5GAN 4;  2QQS A;  5GAN 8;  2HBW A;  2OTJ Q;  1GFC A;  2DFU A;  4QQG A;  2LT4 A;  1MND A;  1JU5 C;  3HL8 A;  2GTJ A;  7AT1 B;  5GAM j;  1LJO A;  3VYH B;  3VS0 A;  1MUZ A;  4JRQ A;  1YJ9 T;  5CK9 A;  1GBQ A;  4IUT A;  2LC4 A;  3CCE T;  1K9A A;  1Y71 A;  3ZFJ A;  5CKE A;  3UAT A;  2X4W A;  4AG1 C;  4CC2 A;  1JJ2 A;  2HQX A;  1YHQ T;  2Y90 A;  3G4S A;  1YJW T;  4L5G A;  1ZX6 A;  5GAN j;  1YJ9 A;  1OYX A;  1VQN T;  2COW A;  1GCQ C;  2DPP B;  2EJ9 A;  5FU7 C;  1FX7 A;  3JB9 F;  3CC7 Q;  1NZ9 A;  3H0I A;  2QEX Q;  1M3B A;  2DXT A;  1O9S A;  2ED0 A;  2LP5 A;  1SRM A;  1UGS B;  3G6E Q;  1VQ5 A;  1WLP B;  3MJX A;  4M78 C;  2FZK B;  2KGT A;  2A37 A;  1VQ6 Q;  3CCS T;  4C5H A;  3CCS A;  1CSK A;  2FPE A;  2K5F A;  1T0J A;  3RKX A;  2YUN A;  3CCR Q;  4BE2 A;  2M16 A;  3M0P A;  5D6Y A;  3QPH A;  3LWH A;  3EG3 A;  1IRX A;  4HCB A;  2ATC B;  1N8R C;  4XAX B;  2DET A;  4PJO B;  5HCK A;  2JMC A;  3TQ7 P;  3I56 A;  1YJW A;  2VC8 A;  3RIR A;  4FM4 B;  3FC3 A;  2DIQ A;  3PVQ A;  1M90 R;  4JZ3 A;  1K73 C;  2HQE A;  3M0U A;  2MWO A;  4M78 F;  2QEX A;  2FO0 A;  2RHY A;  4F17 A;  1KC8 R;  1C6V X;  3OQ5 A;  2EIF A;  1I5L A;  3HRS A;  4XTY A;  2EQM A;  2QI2 A;  5GAO r;  4XU0 A;  5EC7 A;  3G4S Q;  4F04 B;  1ZBX A;  3CCL A;  2YLC A;  1QVG A;  2C0I A;  1KQS P;  2ECZ A;  4LUE A;  2V1R A;  1RL2 A;  5I22 A;  2JW4 A;  4VUB A;  1EFN A;  4BI3 A;  3WVD B;  2E4H A;  5KE3 A;  3CCQ T;  2I2L A;  2R57 A;  3OS0 A;  3M57 A;  3EH2 A;  6AT1 B;  2QAZ A;  2NYS A;  1YHQ A;  4DBF A;  1VQL Q;  2AHJ B;  2VXE A;  2LJ1 A;  3QII A;  3OYD A;  3G71 A;  4M7D G;  3SWN A;  2CT3 A;  4D8K A;  2CRE A;  5DLO A;  2E5K A;  1VQP T;  4WF2 A;  1OX9 A;  1X2K A;  1TS9 A;  2QQR A;  3MP8 A;  3OYN A;  2YRC A;  2HDA A;  4J5Y A;  2CGH A;  3NMZ C;  2EWN A;  1RI9 A;  5CKH A;  5GAN 5;  3PIO A;  2EGC A;  5LJ3 g;  1Q82 U;  2DA9 A;  1KQS A;  1UE9 A;  2K6D A;  4AT1 B;  3S6W A;  2LQW A;  4EDU A;  4M7A D;  1G3W A;  3MPU B;  2HQH A;  4KUI A;  5LL6 S;  3MP1 A;  3L2R A;  1N8R R;  4IUR A;  3GIB A;  1VQL A;  3CD6 T;  1TSF A;  4FSS A;  1ZHI A;  2EYW A;  3JCM c;  2L5Q A;  5KYY B;  1M1K U;  2LNV A;  3FJP A;  1VQ8 T;  4EMH A;  4F7U E;  2PTK A;  3CCM A;  4HT9 A;  2O9S A;  1MMG A;  2A08 A;  2F5K A;  4ORZ A;  2GTO A;  1F1B B;  2RI5 A;  3HPW A;  3HTR A;  1GFD A;  1U1S A;  2CSI A;  2AIR B;  2DK3 A;  1K0X A;  4OML A;  1G3S A;  1U5S A;  3GF5 A;  1UEB A;  1ZSG A;  4Z88 A;  1SSH A;  1VQM T;  1KQ2 A;  3CBM A;  3DKM A;  1PHT A;  3JB9 D;  2CP0 A;  2FZC B;  1QVF P;  4F16 A;  3CQT A;  1N9S A;  1AVZ C;  1YN8 A;  2HZY A;  5IHN A;  4M7A F;  3UWN A;  1UGQ B;  4OP0 A;  5J26 A;  1V1C A;  3OYF A;  2LRQ A;  4C0D B;  1YHQ Q;  2EJG A;  1AHJ B;  4XU1 A;  4WCI A;  1YJW Q;  1VA7 A;  3P8B B;  4ZN3 A;  1K8A U;  4QQ6 A;  3OYE A;  1C0M A;  3OA6 A;  1D3B A;  3M4Y A;  2HAX A;  3OYH A;  1LCK A;  3M56 A;  4J83 A;  4PJN A;  3CC4 A;  4C8Q C;  5HK3 A;  2CYZ B;  2DL8 A;  1KD1 U;  2X35 A;  1Q95 G;  1BI2 A;  1R77 A;  5LJ3 d;  1KIK A;  3CCL Q;  1M1K R;  4MZT A;  2FVU A;  2JN0 A;  2FRW A;  2MCN A;  3CCS Q;  3EFO A;  5CVI A;  1WHK A;  2XD0 A;  2DXB A;  1AZG B;  2MF2 A;  2DMO A;  1OQK A;  3SWN C;  1SHF A;  2K79 A;  4PKC C;  2DYB A;  1ABO A;  4A63 B;  3M0S A;  3FEO A;  1UGV A;  1IB8 A;  2BE7 D;  3CMA T;  3KXT A;  3SEM A;  3M54 A;  5DLQ E;  3JB9 I;  2RJC A;  3BDU A;  3TRE A;  3L2U A;  4IKF A;  3PNW C;  4FIB A;  3RMS A;  3JCM e;  2CUD A;  1I0C A;  1MV0 B;  3QDF A;  4QQD A;  4R0K A;  3OYM A;  3JCM d;  1G83 A;  3FIF A;  1WXT A;  1QCF A;  4PNO A;  3JCM J;  1OX8 A;  1IHW A;  4NS5 A;  2NUT A;  4KGX B;  4DA4 A;  4DQ2 A;  5D6X A;  1Z9Z A;  1RLQ C;  1LVK A;  3F70 A;  2DRM A;  2P4T A;  1UEC A;  4E6R A;  4AG2 C;  3TSW A;  2HKN A;  2RD1 A;  5CKD A;  2MMP A;  2GFU A;  2P0Q A;  2PNI A;  4XTV A;  3CCJ A;  2HBP A;  3A98 A;  5GAM e;  4E7S A;  1R0C B;  4FW1 A;  3C12 A;  3PGG A;  1VQ5 Q;  3G6E A;  1J3T A;  4F14 A;  5GAO n;  3VS5 A;  3CEY A;  4O5V A;  4PJO C;  2D9T A;  2M9U A;  2HSE B;  1M5Q 1;  1M3A A;  1IGU A;  1XJW B;  1X69 A;  1B07 A;  5KYX B;  3AT1 B;  3RES A;  3OYJ A;  1NE8 A;  4AMC A;  1WFW A;  1Q86 C;  1RAI B;  2FL7 A;  5HKC A;  1H3Z A;  5FRO A;  4ZGD B;  2ZPF B;  1E6H A;  1VQL T;  4XTU A;  3CD6 A;  1YIJ T;  1I07 A;  3JCM V;  4BI8 B;  1UHC A;  2WSC E;  2KNB B;  2A0F B;  3RKW A;  1R8O B;  2JM9 A;  1M3C A;  2V8J A;  4BE0 A;  1VQP Q;  2EPD A;  3A8M B;  1YJN T;  2LVM A;  4AFS C;  2KT8 A;  2QXF A;  5GAM g;  2DO3 A;  5I11 A;  1K76 A;  1PWT A;  4HXJ A;  1VQK Q;  2E5Q A;  2KXC A;  2J6F A;  3TSZ A;  5CQX A;  2DEU A;  2DX1 A;  2QA4 T;  3EAE A;  5IXF A;  3I56 T;  1YBY A;  2FHD A;  2NUP A;  2X3W D;  1AZE A;  1KHC A;  3HP9 A;  3HHT B;  2HL3 A;  4FT2 A;  2LTO A;  2RQR A;  5LJ3 j;  2CUB A;  4MZM A;  3J81 E;  1YIT Q;  4C8Q E;  2F2X A;  4DBQ A;  1N27 A;  2PU9 B;  1BI0 A;  5GAO m;  1IRE B;  1VYU A;  1WDX A;  4E7L A;  5L23 A;  2L3Q A;  4RCB A;  4HT8 A;  2DF6 A;  2R5A A;  3LGL A;  4X1V A;  1NEG A;  4MMK A;  8ATC B;  1PM3 A;  1W1F A;  4PJM A;  3V8J A;  5I2M A;  1U1T A;  4E47 A;  4FYV B;  2Y4Y A;  1BCM A;  2CZ6 B;  4Y91 A;  1JEG A;  1K73 R;  2GQI A;  4OB3 B;  2EJF A;  3CPF A;  1VQP A;  1SG5 A;  1IZ6 A;  1VQN A;  2YT6 A;  1JXM A;  2D6F A;  5KYW A;  2K5L A;  2QQ9 A;  1QP2 A;  4DOW A;  1BI1 A;  1NEB A;  4C92 F;  3I9Q A;  4R55 A;  5GAN e;  4DBH A;  4A53 A;  5EG2 A;  1NPR A;  4HVU A;  4A4G A;  4BY6 C;  1H3H A;  2O4X B;  1NBE B;  5GMK l;  1VQ9 Q;  1R0B G;  1M90 C;  2QDY B;  4N4I A;  1QLY A;  2M0O A;  2JZ2 A;  1HD3 A;  2EVR A;  1BBZ A;  4Y28 E;  1KC8 C;  1M2V B;  3ULR B;  3VUZ A;  2M51 A;  2AKL A;  3HFO A;  5CAI A;  2NUT B;  1YI2 T;  2CS7 A;  4PL6 A;  3CCJ Q;  3EGX A;  2CDT A;  3CCL T;  3UF4 A;  2P0K A;  2E41 A;  2COZ A;  2GFA A;  2SRC A;  2FPD A;  4RTY A;  2HSP A;  2RB6 A;  1TG0 A;  2KQW A;  3GNF B;  3QWY A;  1PNJ A;  1DJ7 B;  4J9C A;  3AHU A;  3CCU A;  2CP6 A;  4C92 C;  3HRU A;  1NM7 A;  5GAM h;  3EG9 B;  3V8K A;  3GP8 A;  3CMA Q;  2HKQ B;  5ECA A;  4DOV A;  3PIP A;  3H0F A;  1G3Y A;  2X51 A;  5GAM d;  1B34 A;  4IUU A;  5DY9 A;  1RLP C;  2JTF A;  1Z9Q A;  2V8I A;  5DM7 R;  2QGG A;  3CCE A;  1VQ8 A;  5GAN f;  4PFP A;  5KCO A;  3BY7 A;  1H92 A;  4OB2 B;  5FU6 C;  2J7I A;  3O5Z A;  2F69 A;  1VYT A;  1M1G A;  1NPP A;  3E1S A;  3C4S A;  2KE9 A;  1KJW A;  1PKT A;  2RJD A;  3TVT A;  1YJN A;  1Y96 A;  2CP2 A;  5GAO p;  2LQN A;  5GAM f;  1ZA1 B;  2LX7 A;  5L8R E;  3ZBD A;  3JB9 G;  2Z0W A;  5LJ5 h;  2M0Y A;  1IO6 A;  2DIG A;  4NL2 A;  1K8A C;  4AFU C;  2LJ3 A;  3R6O A;  1NLP C;  4FYX B;  4JJC A;  1KK7 A;  2BKD N;  3CC4 Q;  1M8M A;  4RG2 A;  4LUD A;  3VJP A;  4JRP A;  2L3S A;  5FU7 B;  2IIM A;  3BE3 A;  2HNI A;  2OTJ A;  1Q81 C;  2A28 A;  1VQ7 A;  3OSS C;  4F7U B;  2D0N A;  3FJ5 A;  2DJQ A;  4F7U F;  2KEA A;  3D7S B;  3ZL7 C;  4D6W A;  4BUG A;  2MWP A;  1PD1 A;  2J6K A;  3EGU A;  1RAD B;  3MET A;  2JTM A;  5KYX A;  1RAE B;  3LWI A;  2F5T X;  2X4J A;  1MGQ A;  2JTE A;  4A4H A;  3RUX A;  2KY9 A;  2RHI A;  1HK9 A;  4HVV A;  2L8D A;  1Y57 A;  2DTO A;  4C8Q G;  2LCS A;  3E9F A;  1AWO A;  2RNA A;  1WIE A;  4HKE A;  2F2V A;  2BTT A;  3JB9 J;  1WZO A;  4AFQ C;  2YRD A;  4PJO G;  3NTI A;  5GMK h;  1QQJ A;  8AT1 B;  2PUK B;  3EHR A;  2QA4 Q;  4M77 A;  4JPB W;  3RMQ A;  1VQN Q;  4JJN K;  1M8V A;  2AZV A;  4FYW B;  4GY5 A;  3QXE B;  4M7D F;  2DZ9 A;  2XID A;  3OMG A;  1NJI C;  3V7S A;  2MPX C;  2CZ0 B;  3FDR A;  4Z02 A;  1M1K C;  1ABQ A;  3QO3 A;  3LH5 A;  3VRZ A;  1YIT T;  5CO7 A;  2IPO B;  2YUP A;  3A1P A;  2Y4X A;  1D09 B;  5GAN d;  3V7C A;  1UJY A;  2ROT A;  3OYC A;  3PMI A;  3OS1 A;  1ZSZ B;  2QAS A;  1JXO A;  4ELZ C;  3CCR T;  2CZ7 B;  4M78 E;  5GAO l;  2X4X A;  4ZTJ A;  2LQK A;  4M77 D;  2HD0 A;  4BI4 A;  2E3H A;  2FYK A;  2VUB A;  2EQU A;  2L3R A;  3QBY A;  3CPW S;  2ZCF B;  4ZTF A;  1LPL A;  2RK1 A;  2D8J A;  2K3Y A;  4FT4 A;  1TXQ A;  4IUP A;  1FYN A;  3QZ9 B;  1Q86 U;  3E9G A;  3M59 A;  2OI3 A;  4QKU A;  1D1C A;  2MK5 A;  1VIF A;  2ZPE B;  3PE0 A;  4CI0 C;  2K9G A;  1BI3 A;  1OPK A;  2DD4 A;  1I5O B;  1Y7X A;  3REA B;  2YWW A;  1VQK A;  1K1Z A;  3VS2 A;  2CT4 A;  2CZ1 B;  2VKN A;  1LOJ A;  3H9N A;  1VQO A;  2H3E B;  2JXB A;  1TWB A;  1VQ9 T;  2XK0 A;  3WVE B;  2DYI A;  2CKK A;  1FMK A;  5I21 A;  1MMN A;  4MDX A;  3LYI A;  1YI2 Q;  2QYZ A;  4AFZ C;  3CCJ T;  3SWN B;  4M75 F;  4B6M A;  4OMM A;  2OX7 A;  4OGC A;  4MZP A;  3LGF A;  1W70 A;  1SHG A;  4BD3 A;  3CCQ Q;  1Q86 R;  2WAC A;  2E3I A;  3X28 B;  5GAO q;  1MV3 A;  2JM8 A;  4A54 A;  1AEY A;  3J80 E;  1WI7 A;  1WNL A;  1Q7Y C;  1JRI A;  5A0D A;  1OZ2 A;  2VXF A;  2BUD A;  3PMT A;  1OPL A;  3C95 A;  2EYX A;  1NJI R;  5LJ3 f;  2RJF A;  2DVE A;  3UA7 A;  1KD1 R;  1U06 A;  1PD0 A;  1M2V A;  3X25 B;  2NWM A;  1UHF A;  3PVL A;  2EW3 A;  4M77 G;  4QVZ A;  1RI0 A;  2KAF A;  2L2P A;  2D1X A;  2EYY A;  4M7A G;  4GBQ A;  2QDL A;  1PCX A;  3T9N A;  2PQW A;  2EYQ A;  2CH4 A;  3QYG B;  5I2S A;  1YP5 A;  4J6W A;  2DXC A;  1VQ4 T;  2KK4 A;  1KFZ A;  4LD9 K;  1ZBJ A;  2E6Z A;  4NOY A;  2ROL A;  3OBY A;  5GMK e;  2XKO C;  3OYI A;  2HEQ A;  1KG1 A;  4OGE A;  2DE0 X;  4Z89 A;  1OEB A;  1ZA2 B;  2JMA A;  2M02 A;  3LLR A;  4ZN1 A;  1VQ4 A;  2OTL Q;  3OY9 A;  2DAQ A;  1FXX A;  4LDW A;  3CCU T;  3L42 A;  1VQ7 T;  1SKU B;  2LJ0 A;  1MNE A;  5GAN 3;  1BU1 A;  1WJR A;  5CQY A;  4M77 B;  4P5N A;  1RAH B;  5GMK m;  1Q7Y U;  5GMK j;  2RQU A;  1KQS S;  1PRL C;  2RH2 A;  3RKY A;  2QQA A;  3OBW A;  2HMA A;  2KR3 A;  4JLG A;  4OMF B;  2YDL A;  4LDX A;  2DKG A;  2O2O A;  3CBO A;  2DL5 A;  1YWO A;  2D0Q B;  2K2V A;  3CXC S;  2DJZ A;  1PRM C;  2KBT A;  3JCM Q;  1K9M U;  3OYG A;  4M7D C;  1EIF A;  3OS5 A;  1VIE A;  2ED1 A;  1RAC B;  1S1N A;  4LD6 A;  3I5R A;  4NL3 A;  2D8H A;  1IXD A;  1OU8 A;  2YRV A;  1ZUU A;  2RK2 A;  4L6V 5;  3CXC A;  2OJ2 A;  2RM4 A;  2YUO A;  4ESR A;  1E7O A;  1UFF A;  3A8G B;  3O8V A;  3A8L B;  1VYV A;  3I55 Q;  1RAF B;  3MHX A;  2DIL A;  3BFM A;  4QW2 A;  3QDR B;  1M2O A;  5CIU A;  2DD5 A;  3GBQ A;  5C0M A;  1I4K 1;  1M90 U;  3H6Z A;  4HCK A;  3FLG A;  4C8Q A;  3MEU A;  3UA6 A;  3HFN A;  4BE1 A;  1B7T A;  1KC8 U;  3GPL A;  5KYY A;  1X75 C;  3VS3 A;  3L2Q A;  3TU4 K;  2DXU A;  1SF9 A;  3E19 A;  1AWX A;  1G8X A;  1T0H A;  4TVR A;  1QVG S;  4PFO A;  1W2B S;  1ZSZ C;  4IIM A;  4JLI A;  2GCX A;  4FCY A;  5KE2 A;  4M7D E;  1SPK A;  2KXD A;  2J06 A;  4M77 E;  3M5A A;  1K9M C;  4JJD A;  2MOX A;  2XDB A;  2JJ9 A;  1UB4 A;  1E6G A;  1D0Y A;  3GLX A;  5HY6 A;  1CKB A;  1GXI E;  4KGZ B;  1GL5 A;  3S3M A;  3MEA A;  3OW2 P;  3S3N A;  3JSC A;  4OMN A;  4K11 A;  3SB2 A;  2XDD A;  3QUI A;  1AOJ A;  2P4R A;  4J6Y A;  3L2V A;  4LDV A;  2QTV A;  3OYK A;  2W0Z A;  1YCY A;  2BZX A;  2KVQ G;  2FG0 A;  1VUB A;  4RG8 A;  2LDM A;  3RER A;  2EFI A;  3NHN A;  1OV3 A;  4GLK A;  2ZAE A;  2JVV A;  1D3B B;  2EQI A;  2LZ6 B;  1WHJ A;  1CKA A;  1ZUK A;  3M0R A;  3G71 Q;  4HCZ A;  1QVP A;  2CSQ A;  2X3X D;  1GCQ A;  4M75 E;  1AT1 B;  3FRN A;  4Z8A A;  2F2W A;  4A4K A;  3P8D A;  3M53 A;  4HA8 A;  3DLL A;  4XK8 E;  1VQM A;  2JS0 A;  1N8R U;  2DL4 A;  2E65 A;  5GJW B;  4KT0 E;  1BIB A;  3TEE A;  4RMO A;  1TH7 A;  1NYG A;  2V26 A;  5J3B A;  1QCN A;  1AD5 A;  1WGS A;  3I5S A;  2YXY A;  2V8K A;  3OYL A;  2RPN A;  4E7H A;  2GF7 A;  3BW1 A;  4KRT A;  1YJN Q;  2L0A A;  4FW2 A;  2KRN A;  5J39 A;  4A4F A;  4CC3 A;  1ZLM A;  4BB7 A;  1YNZ A;  2YHT A;  1VQK T;  4M78 G;  1WXU A;  4XU3 A;  2GGR A;  1VQ4 Q;  4XQ3 A;  1T3L A;  2NLU A;  1Y07 A;  1IGQ A;  4N4G A;  2R58 A;  4EMK A;  2K57 A;  1HYO A;  2OAW A;  4PJL A;  5GAN 7;  2NUZ A;  2DL3 A;  4OMP A;  4GLM A;  1W6X A;  1N9R A;  4C8Q B;  1XQH A;  2BZY A;  2OAU A;  3IQL A;  3CCU Q;  5IAY A;  4E7J A;  3CME A;  2DEQ A;  2ENM A;  3JRZ A;  1OU9 A;  3CME Q;  1NG2 A;  5CCA A;  4OMQ A;  4R56 A;  3U23 A;  5LJ5 e;  2CP3 A;  2P0P A;  1ZUY A;  4PJO E;  2K4Y A;  3JCM f;  2DTH A;  3PFS A;  4FL6 A;  4KH0 B;  4M7A C;  5LJ5 g;  5D6W A;  4XTZ A;  5KYW B;  1TU0 B;  5CKF A;  2OTJ T;  2H3J A;  5LJ5 d;  3CC7 A;  2XG8 D;  4D8D A;  2J05 A;  4C0G A;  4RTU A;  3Q1J A;  2C0T A;  2H8H A;  1YJ9 Q;  2E6N A;  5KYU A;  3CXC P;  2O31 A;  3LX7 A;  1YIJ A;  1D0Z A;  3ZEH A;  4LXC A;  2FEI A;  3RDV A;  2EGA A;  2QG9 B;  4N4H A;  5GMK i;  3CPW A;  1C1A A;  1QWF A;  4RUG A;  4DEY A;  3LH0 A;  4M75 D;  5D7U A;  3G1J A;  3CBP A;  1FWZ A;  1UTI A;  3M9Q A;  4M77 C;  1SEM A;  2PVG B;  4B9X A;  3QZ5 B;  4E7Z A;  4J9E A;  2DBM A;  5FLX E;  4ZGJ B;  3DLM A;  1I8F A;  3DB4 A;  1M4Z A;  1I81 A;  1K9M R;  4FSX A;  1XOV A;  1Q81 U;  1TUG B;  2RF0 A;  4MML A;  4RTV A;  3G6E T;  3CCV A;  4ATO A;  5FRM A;  4M7D A;  1MHN A;  2QGF B;  3PTA A;  5FW9 A;  1RAA B;  1WJQ A;  3CCM T;  2E10 A;  1BKB A;  3QJ6 A;  2RHZ A;  4JS5 A;  4PJO D;  1GRI A;  1VQO T;  1YIT A;  1WYX A;  4C0Z A;  4HCC A;  1GCP A;  1B34 B;  4J9F A;  1W2B P;  1NYF A;  2KSS A;  1QCO A;  2R5M A;  1M1F A;  2F1L A;  4C8Q D;  2EBP A;  3QWX X;  4ME7 A;  3MKD A;  1OI1 A;  2EQK A;  2RO0 A;  2K3B A;  2K7A A;  3ME9 A;  2CP5 A;  4JZ4 A;  3NGP A;  1WX6 A;  1WQW A;  2P84 A;  4J9H A;  3M0T A;  4CC7 A;  3REB B;  4C8Q F;  3JCM g;  2EKO A;  2LQ8 A;  2XHC A;  1D1B A;  4OF1 A;  2JUF A;  4KH1 B;  4F7U A;  4J9B A;  4J9I A;  1PSF A;  2PUO B;  1PKS A;  2AT1 B;  3EGX B;  3JV3 A;  3ASK A;  1XNI A;  4ELY C;  2RHX A;  3VS1 A;  4M7A A;  1ARK A;  1M27 C;  3H0H A;  4ZNX A;  4J9G A;  4BDY A;  1BIA A;  2RI2 A;  1WPY A;  4OVA A;  3NTK A;  1SRL A;  1HXD A;  1W2B A;  3EGD A;  1JQQ A;  3L2Z A;  2DRK A;  3MEV A;  3EFO B;  4EMK C;  3CC4 T;  4KUD K;  3V7R A;  2RJE A;  3E2U A;  2V1Q A;  1KQ1 A;  3X24 B;  2KDS A;  2EGE A;  1V29 B;  2KT1 A;  1Q82 C;  2B86 A;  5FWB A;  4LNP A;  4E7I A;  3CC2 T;  2RHU A;  4XU2 A;  3QYH B;  2DER A;  4JJB A;  2BIV A;  1WHH A;  4N0A C;  4FYY B;  1TUC A;  1S72 T;  3BDL A;  5KYN A;  2M1H A;  2FB7 A;  3UDC A;  2RA2 A;  4ANJ A;  2GNC A;  1JO8 A;  2DBK A;  2MIO A;  1N5Z A;  3H41 A;  1WA7 A;  2GBQ A;  2X4Y A;  4O6J A;  1K4U S;  4M75 A;  1NLO C;  4M75 G;  2YUQ A;  2FRY A;  2FZG B;  1AWW A;  2XU8 A;  2RQW A;  4KUL A;  2XIC A;  3OB9 A;  3OYA A;  3QKJ A;  3VV0 A;  2VAS A;  3CCR A;  2ZPI B;  5IN1 A;  4C5G A;  1T3S A;  2EKH A;  4OB0 B;  4BY6 B;  3HRT A;  2LCL A;  3M58 A;  3JCM P;  4C0F A;  4MDW A;  2E64 A;  2ZPB B;  5A2Q E;  4X9D A;  5LJ5 f;  4M78 A;  4OMO A;  5KH6 A;  2BZ8 A;  2G3R A;  4M77 F;  1VQ8 Q;  3EG0 A;  4WTO B;  2K2M A;  3EG1 A;  2QK0 A;  1QP3 A;  3VS7 A;  2WSE E;  1YI2 A;  1H8K A;  2YLB A;  3FB9 A;  1X2Q A;  3C94 A;  5A0L A;  3EFR A;  5KCH A;  2C06 A;  1BYM A;  2VGN A;  5GAN h;  3OW2 A;  2LX9 A;  1PC0 A;  1VQM Q;  1UDL A;  3HKS A; 
#chains in the Genus database with same CATH homology
 3CCL Q;  1M1K R;  3CCM Q;  1KQS P;  1VQ9 Q;  1VQ4 Q;  3CCS Q;  1YJW Q;  3G6E Q;  1VQP Q;  1JJ2 P;  3CC2 Q;  1K8A R;  3CCV Q;  1VQO Q;  1KC8 R;  1QVF P;  1YI2 Q;  1VQ6 Q;  3CCE Q;  2OTJ Q;  1YJN Q;  1VQ7 Q;  1NJI R;  1N8R R;  3OW2 P;  1YIJ Q;  1YJ9 Q;  1S72 Q;  1Q7Y R;  3CXC P;  1K9M R;  3I55 Q;  3CC4 Q;  3CCR Q;  3CCJ Q;  1KD1 R;  1YHQ Q;  1VQK Q;  1YIT Q;  1QVG P;  1W2B P;  2QA4 Q;  3G4S Q;  3CCQ Q;  1VQ5 Q;  3CMA Q;  1Q86 R;  1K73 R;  1VQN Q;  3CC7 Q;  1Q81 R;  3I56 Q;  3CCU Q;  1Q82 R;  3CPW P;  1VQ8 Q;  3CD6 Q;  1VQM Q;  1M90 R;  3G71 Q;  1VQL Q;  2QEX Q;  3CME Q;  2OTL Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...