1YIPA

Oxidized peptidylglycine alpha-hydroxylating monooxygenase (phm) in a new crystal form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
311
structure length
311
Chain Sequence
NECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
publication title The Catalytic Copper of Peptidylglycine alpha-Hydroxylating Monooxygenase also Plays a Critical Structural Role.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 63
structure length 311
sequence length 311
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yipA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 1yipA01
1PNGA 1PHMA 3MIDA 3MLLA 3MICA 1YJLA 3MIBA 3MIHA 3MIGA 4R4XA 3MLKA 3PMSA 1OPMA 4E4ZA 1YIPA 1PGSA 3KS7A 3MLJA 3MIEA 4R4ZA 1SDWA 3MIFA 1YI9A 4QHBA 1PNFA 1YJKA 3PHMA
chains in the Genus database with same CATH superfamily
2SLIA 5LBEA 2D98A 4NE9A 1VBC3 3HPNA 3SCHA 4MH0E 4A6OA 2IXHA 4BISA 2G9GA 3AZZA 2FDKA 1B09A 3MIGA 1W99A 3OG2A 2IVIB 1RUD1 1ND2B 1HX6A 2Q8DA 1NLQA 4K3UA 5FPZA 3I49A 2WNUC 2W94A 4LBLA 1VBD1 5A33B 3B3QE 1GOFA 1QJX1 2N7GA 4RHV3 1I5ZA 1R082 1LNSA 4W4ZA 2F6BA 1T2XA 4GWJA 3TRSB 2D5FA 3FHIB 3AMPA 1ULDA 3SLIA 1W0OA 4ZONA 2K0GA 4LBQD 2VE1A 3ASIA 1W6OB 5T5PA 5K0UC 3IDEA 4XPVA 3HQXA 1G6NA 4IV1B 2VXJA 2HEVF 1RUNA 1S2BA 2C9AA 2OS2A 4AAPA 2UWAA 4O9GA 3H0OA 5FPUA 1AYM1 1T6BX 3GCWA 4CDXB 3I2KA 5FP8A 1RXGA 2WO3A 3IIIA 5A3PA 1V00A 3OF1A 4ORFA 2FMDA 2WFF1 4P5YA 4UOJA 4CUGA 3BOPA 4LXLA 1W2UA 2QNKA 4JGYA 2C6SA 4YW4A 1ND3A 4JQTA 1WBLA 1AYN1 3I59A 4MV2A 2YPDA 4HOOA 4EWEA 3W20A 2VULA 4K8RB 2Q1MA 5A1LA 1C57A 4YLZA 3M3EA 3URFA 1A8MA 4GWIA 1GV9A 3WW2A 4XJWA 1NG0A 4Y24A 2AEZA 1RUJ2 2I74A 3J7LA 5EQUA 4AI2A 4BXFA 1H8TB 2QDRA 4L9BA 5DAPA 4C1XA 5A6XA 4X8PA 1AR72 2WQ4A 3VD4A 1UIJA 5I93A 4FOYA 2ZACA 2AACA 2VXRA 2WQ8A 3PVNA 2VW2A 4A2UA 4XUQA 3KV5A 4WZFA 1NUKA 4CDWC 3AK0A 3UL2A 5KHJA 3VBOA 2HYKA 5C33A 2ZJCA 4OZOA 5FZKA 3CJXA 2FDJA 5LA0A 3HVDA 4BK5A 2P6HA 1UZYA 3DV8A 1DG6A 2RMU2 2DTWA 4YZ4A 3NAPB 2IC1A 2VQAA 3PJQA 1E57A 3QACA 5FY5A 3V56A 2C9KA 2VZPA 2TUNA 3RJRA 2GNTA 2Y8KA 2YU2A 2MEV2 3IT8A 4F83A 1K3IA 1O6UA 5IAVA 1N1YA 1NCQA 1W06A 4NIHA 2VMEA 3T2QA 3VLBB 5GLTA 2Y33A 5E8AA 1OKQA 5FO9B 5LCWL 5A7WB 4A7KA 3IDAA 3KSCA 5A6YA 5JOYA 2RVAA 1WLWA 1US3A 1SCRA 1RUI1 4NIIA 3V0BB 5APAA 2EA7A 2VJXA 5FZ7A 1PGSA 1CAWA 1COV2 3POFA 4H14A 1DYPA 4XUNA 5F8PA 2PQSA 5ERLA 5C5UA 2WA4A 4DS0A 2YG0A 4AXOA 4F7ZA 3INAA 2KD7A 1JZ6A 2QQNA 5FZ3A 2PTMA 4EYUA 1N3OA 4QHBA 4XF3A 4AEDB 3DYPA 3WX5A 3M3OA 3GDBA 4CP2A 5BNNB 3ST7A 5JVVA 1CIYA 1PVC2 1LEMA 1GR3A 1H4GA 2WSUA 3WP4A 3WF1A 4YRDA 4W6XA 2R072 1O5LA 1PIV3 4B8EA 1FOD1 3VHOA 3RZMA 2VOVA 3O0XA 1AR91 1WGPA 5A6QA 3I2IA 2KR2A 1TME2 2RJ2A 4LTAA 4GMP1 1R1ZA 4QPIA 4X6QB 2PLV2 3ZN6B 4LEJA 3K4AA 1N1TA 3HAGA 1SDWA 4RGKA 4XJAA 3S7EA 3THTA 3RZLA 4JRLA 2WDBA 1RJ7A 4FVVA 3AP9A 1QJY3 3JU9A 1B35B 2CAUA 3AJZA 4BMBA 4B1MA 5EYYA 3RWNA 1UXXX 4HXCA 5JOZA 2XJRA 5FZ8A 4AI1A 3SH3A 2PAKA 4FPEA 1FATA 1GZCA 5HCBA 3B01A 3N36A 3MF9A 3GZTB 4IEWA 2CTVA 1YRZA 4AFBA 1WBFA 2X5IB 4BQXA 5C3QA 5EHDA 3WG3A 3WHUA 2X29A 4BA6A 4XOGA 3ZFFB 3JD71 1FV3A 1RHI2 1Y9MA 1UL9A 4WM7A 3BALA 4Y5TA 1POV1 5F5CA 1XOYA 3AZWA 4FAHA 2SBAA 4IESA 3PUSA 1UPSA 5FUNA 1SFYA 2VW1A 2HWC3 3MW4A 4RFT0 1CJPA 1CQ9A 3O1OA 1O4YA 3MFAA 4LKEA 3KB5A 1NX9A 1ZX5A 1BMV2 5A33A 3VDDB 5ACA1 2OQ7A 3ACLA 4OI4A 4L97A 5JR2A 3RRDA 2A75A 4Y1ZA 2K2SA 2G4IA 1H1MA 2WS91 4OHVA 5HCFA 4FTBA 1CONA 4LKDA 4LO8A 5IUQA 2HWF3 4CCOA 1QF3A 4FOWA 4CUAA 5C8CC 5E16A 1ZYBA 3I2JA 1NXMA 3AYDA 3LPGA 5JI7A 3TBDA 3WCSA 2C4XA 1W6OA 3OD4A 2VUDA 4YVWA 4HPKB 1NAEA 4V2VA 3W5MA 1PGW2 5F3GA 2Q30A 1V6NA 4CCLA 1A6CA 5I8SA 5F39A 3MICA 1CESA 1G86A 1MEC1 1WW6A 3NRUA 4YZ3A 3RZKA 1CD3G 2VNVA 4CDXA 5JWPA 1JYIA 3PUAA 2IVJA 1WMEA 2DUQA 4SLIA 5GZFA 3PL0A 4DO0A 1VBC1 1ZBA2 1TMF3 4PDWC 2RG4A 1FMD3 1SFNA 3OOXA 4RS5C 4XMIA 4XDOA 4BXSV 2ERFA 3BKZA 2F4PA 3AXEA 4C91A 4P9YA 3ZYPA 3RSJA 1YNAA 3ZXJA 2W0XA 1W8WA 3I8TA 3OGJA 1H8TA 1OI6A 1F31A 2E33A 2ZGKA 3N35A 1O3TA 3SKVA 4ISQA 4Y20A 4D6RA 4XCBA 3BGAA 2VMFA 2BU9A 3ZFEC 4LLOA 4TXWA 5T5JA 2KXLA 2FCUA 4KWKA 1ZZCA 2RS52 3LIGA 3CJIC 3ZR6A 4JGZB 1HB2A 1DGLA 3SCFA 3VHPA 1OLRA 3S5AA 1AHSA 3JBG2 1LCLA 3OBZA 3WDWA 4LK6A 4QU1A 3KS7A 2OVUA 3H9AA 3M2MA 1PGL2 4I0BA 3ZOIA 2ZX2A 1RUJ3 3NV1A 4XFCA 1O3QA 5JXGA 1RJ8A 4I0AA 1RUH3 1GMMA 2PAEA 5T5OA 2Z2SB 3AJYA 4TLGA 4DINB 1LHNA 2EXIA 2P3IA 3VHNA 2VUCA 2VZVA 4CDUB 2WN2A 2XR4A 1UN1A 1V0AA 2XJQA 3MLLA 3UETA 2HBTA 2IFWA 2GSYA 5HI0A 3PURA 4CRQA 1LGBA 1YFYA 2DYCA 3PU8A 3T08A 3V0AB 5FYTA 1H2KA 2J1UA 1OF3A 1MQTB 2YXSA 3JZVA 1GQPA 3I3BA 3BI3A 3RMYA 4QXCA 3I97A 2ORZA 4AEDA 3SISA 1Z7S2 5JDBA 4XBNA 4LQRA 2QQPA 3M3QA 4ZHNA 4XIOA 3ENRA 1VLNA 2RS32 1W6NB 5FCCA 5I0TA 2FHRA 2EICA 2X53S 4UW4A 4DMIA 3BTZA 1DU3D 1JZ2A 1NCRA 2FMYA 2JB4A 3Q8BA 1VMJA 2EXKA 3H1WA 4OCTA 2VZOA 2ZMLA 4PLNA 4C90A 2RR12 2D6NA 1COV3 1UD1A 1D4M2 1F2NA 3ZXLA 3HT2A 4V2WA 1YYNA 3WP5A 1JU3A 4B7KA 2A5ZA 1CZTA 2WKKA 5IVVA 5L7OA 4NWVA 4UFMA 3DF0A 5B4XA 2AGSA 1K5MA 5IVJA 4J1WA 3C7OA 2JWPA 3K77A 1S0EA 3KCCA 1B35A 1PVC3 4MXWA 4QX7A 4OQ9A 3WUCA 4KMQA 3VKLA 1FPN3 1H6XA 3ME2A 2ARAA 1NT0A 3T2TA 3HR9A 4Z07A 1IOAA 4BQ3A 1LAJA 3LGRA 3MIDA 3I3DA 2DF7A 2R6QA 2ZGTA 5AC92 5D8AC 4LA2A 3ZDSA 4E4SA 1TME3 1UY0A 1D4VB 2R062 4OLLA 5LK7B 3AP6A 1WCDJ 3KMHA 3OPZA 4GMP0 1J1LA 4HK8A 2OT7A 1UZVA 4PBPA 4DUXA 1FYUA 4K40A 1H2LA 1FXZA 1PIV1 3VN4A 4EQVA 5FWJA 1DZQA 1GP6A 5DUUA 4KG8A 4HSLA 3WXPA 3P3NA 5BYNA 4B1LA 1N47A 5C3RA 5FY1A 2DCJA 3T1LA 1K45A 3MIFA 3M70A 1Z78A 5LB6A 3VBFA 4AF9A 5BUVA 2CL2A 1KS5A 4YM1A 3VZLA 2PA7A 2PFWA 4MYEA 4AQSA 4OUSA 3BCWA 2XQRA 4BE3A 1ENSA 4LKFA 5FZBA 1RUE2 1UW8A 2XMLA 2D40A 4TZDA 3PTYA 3KV4A 4IEUA 5I0SA 1OQDA 1QJY1 4WZCA 3ZIXA 5IAXA 1JYNA 1RHI3 2Y34A 3NJYA 5SV8A 5IW0A 1DGWX 5DDJ2 4DB5A 3IAPA 1RUF3 1YUDA 1R092 2E7TA 4O9EA 3UKTA 3IMMA 4P00B 4N8MA 4QX8A 1POV0 1IPJA 3T3YA 3E6CC 2H0VA 1OQEA 4PIYA 2AEYA 5T5LA 2WAAA 3I2GA 3MUZ1 2TBVA 1F15A 1KDKA 2XB6C 1QJU1 4PLMA 4LHSA 2EXJA 4TN7A 3ZMOA 1W6PA 1Y3TA 3ZM8A 1VIWB 2RS13 2YGLA 1QOTA 4KGGA 1IPSA 1BXHA 1FNYA 1Z0HA 2VZRA 2X10A 3KQ4B 5C4WC 1WW4A 3WSOA 2VC9A 2XLAA 1IQAA 1UNBA 3KT7A 2VVDA 3J7MA 4AFAA 1O4TA 4IW3A 5K0UA 1AL23 1RVF2 4R9AA 4Z1VA 1JOPA 5FR3A 1D0HA 4QPGB 3P3PA 1UYPA 2DV9A 2PHTA 3KVBA 4ES9A 2XL7A 4G4FA 4HN1A 2WBKA 1C1LA 3FZ3A 5JPMB 4CYDA 3GBFA 4CCDA 1HLCA 4E4HA 2JIJA 4UFIA 3AMQA 1CAVB 1S4CA 4RR3B 4EZ4A 3MHZA 2WZEA 2QQIA 1KXGA 5FAXA 2HWF1 3ACGA 4JAAA 4FI9A 1W28A 4Y1XA 4DRVA 1J3QA 2B46X 4QKNA 4DNYA 2C26A 1RUD3 2O14A 2YC2A 4NN0A 4PLOA 1W9FA 1JYWA 2GMMA 1ZBA3 4DQAA 2O1QA 4WVWA 3K46A 4Q0QA 3OUHA 4HVRA 2YFUA 3AMHA 4WM8C 3LSEA 5T52A 1XXNA 1ZBE2 4Q1PA 4L11A 4M3CB 1KRIA 2J1AA 3A0NA 3RZGA 4CDWA 2R32A 1AX1A 5DAXA 5AVAA 3R4UA 5BNPB 5FYVA 3MW3A 1R081 1MZ6A 1Y4WA 1LB2A 3DYMA 4L92A 1TMF1 3VV1A 4NHXA 2JG8B 1W3VA 1XE8A 5FZ9A 2EAAA 2XLGA 1RC6A 1VBE2 3RGBA 1RUOA 3OJBA 4F8AA 2B5HA 1W9SA 1LOGA 4NRPA 2ES3A 3JBG3 1EV13 1PVXA 3POSA 3VKOA 4L8QA 3B5LB 1VRBA 2DBNA 2ZGOA 4KWJA 4LMFA 2BFUS 4W6YA 1ZM1A 4TSVA 3U75A 3ZVXA 3MW2A 4KI5M 3N7JA 2QQWA 1F35A 2RDNA 3NWKA 2VZ1A 4AK3A 5A7NA 4IEXA 4E27A 2Q4SA 3IDBB 1MS3A 4R52A 4X6RB 2BEOA 2BGOA 3QH7A 4EZHA 4LK7A 3MYXA 3A0KA 3VZOA 4AQ6A 3ZPYA 2V5DA 3LDKA 1U5IA 1LOCA 3VL8A 1RUJ1 5ABJC 4KWUA 5IT6A 4NROA 2RJLA 2NZ9A 2VMDA 2WR9A 1RUH1 5F3EA 2DUOA 3POBA 1UYYA 4XILA 2A71A 3ZYHA 4XF0A 4WBBA 1BLZA 3OEBA 3WQ0A 2E7AA 1CJDA 2UYBA 3IAQA 3LA3A 4EN0A 1TEIA 2Y64A 2RDSA 3ON7A 4XFHA 1KQRA 1Y43B 5LA1A 3GGLA 3CHXA 4I09A 2F4LA 1V9U2 1BHGA 2V09A 3EYPA 3KQRA 2TNFA 5F5QA 1T6GC 2YHJA 2W1WA 1QQP2 1XYNA 2P34A 1DLCA 1ND3B 4JGYB 4Q0SA 5F2WA 3WNPA 2NM1A 2DCYA 2R043 2W95A 3FMGA 3AL6A 1F4HA 1UY1A 2VUJA 5DUXA 1D4M3 3LFMA 5LZ6A 4A42A 4MGYE 2BV4A 3BU0A 2DFCA 4HBNA 4IQPA 1DQ5A 1BEV3 4FBFA 1V6OA 2GU9A 4B4RA 4CDQC 2W91A 4M00A 1OUXA 3OBAA 2KM2A 3C7GA 5EWSA 3OCPA 4HVQA 5FDBA 3VBOB 1TVGA 1COV1 4AVTA 4W65A 4XTPA 3UGGA 2YC0A 1WLCA 5F37A 3I3QA 5EFUA 1X9TA 1YEWA 2IXKA 3UESA 1G7YA 3C7EA 5LWBA 1OFSA 1BYHA 4PHZA 3KV9A 3DN7A 2DVFA 2VQTA 2R063 2QQMA 5CB7A 3ZYBA 4CP0A 1PVC1 3WW3A 1AR93 1FPN1 2WNVB 1C4RA 2R071 3NKGA 3DXTA 1BBT2 1ASJ2 1H1AA 5DXDA 3SNMA 3GHMA 3ZSJA 2D3PA 3AMNA 3TN93 1OLMA 1S0JA 4FP3A 3LD8A 5FZIA 2XWBB 5IK7A 4JX0A 5GLZA 4P9WA 3UJOA 4EN7B 1TME1 1XSQA 1IQDC 4OMDA 1VBB2 3K4ZA 4U36A 2EIDA 5A3TA 3RI9A 5KXEA 3EHKA 4MUVA 4YSFA 2WSVA 4CXYA 4NPLA 3WF0A 4QXHA 4K7JA 1BK1A 2D7FA 4AQTA 3LA7A 2LTNA 4N53C 5KHIA 4GULA 4M4PA 1S0DA 5C8CA 5GZGA 3UNPA 2GC3A 5C3PA 3ZXGA 2QUOA 4RD7A 3IIAA 4XUPA 3KZ4C 3ZDVA 4C0HA 4K9SA 5GLVA 1QNYA 3RYPA 4AAXA 3JD73 3VDBA 3JQXA 3LWCA 1GU3A 3LAGA 1WD4A 4R9DA 2E31A 4HK9A 2C0ZA 4L0PA 4MHRA 4N7UA 4NOTA 3POWA 4URTA 4XABA 4DRRA 2BBVA 5KHKA 4LBKA 5I0RA 1S0GA 4RR3A 1RHI1 5FMOS 5FUPA 3W21A 5IYYA 4MOAA 3A23A 4YWAA 3DECA 1RUF1 2W1SA 4QPIB 4RS5A 4YARA 2GNDA 3S0MA 4JZRA 3KHCA 3MV11 1DGWA 5C71A 4KWLA 1RUG2 4NIAA 2YB7A 1S0BA 3AZYA 1X82A 1ZZ9A 1MS5A 4XHBA 2P37A 4MGTA 4ZXKA 2ZGMA 2W46A 2BOJA 1YWKA 4CCJA 4MADA 3H3UA 3THPA 3ZFEA 5CEHA 2WUHA 4HKWA 2B7YA 1O7FA 5H9QA 4X8NA 3UJQA 3H8XA 1K5JA 4RGAA 2IXJA 2W87A 3CJIA 2WLPA 3T0DA 1UCXA 3DGTA 3G6JB 4QDSA 4LBQA 5GLWA 5AFEA 4UFHA 1NZCA 1JBCA 1LRHA 3PMEA 3KCXA 4ZY9A 1AL21 4KGQA 5CFCC 4BQ1A 4DXZA 5IK4A 3VDAA 4PIZA 1FNZA 2A6ZA 4OULA 1AXZA 4IE4A 5GZDA 4QKFA 1MEC3 1Q8QA 2D6KA 4Q4Y3 4YYOA 1HKDA 5CIRA 1PGW1 4JHZA 2Y6GA 5LASA 1D2QA 1EP0A 3B02A 4ATFA 2P4EA 1C8M3 1S0CA 2W1QA 1O4ZA 5T3NA 1X9PA 4BK4A 3AKTA 3H3ZA 1IS3A 1GLHA 1NYWA 1WWYA 3ZSKA 1QH6A 1NE6A 3LB9A 3VKMA 1ZBA1 5AVPA 5LEJA 3IN9A 3F2ZA 2XJUA 3MLJA 3P5BA 4BJ0A 2RDQA 1ULOA 1WCKA 4LULA 4PBOA 4QPWA 2DURA 2HWB2 4XEZA 1DQ1A 3ZN4A 5KBFA 1UOBA 3VBSC 3MF6A 4AI3A 3I2HA 2VMGA 5FZ4A 2VTFA 1M4WA 1XNCA 4BDVB 1G9DA 2JD9A 3AB0A 3HQUA 2ZX0A 3VBUC 5CG9A 1HIXA 2MHFA 2NQYA 3RYRA 3TWIA 1OPOA 3QBQA 5FMCA 3RI8A 3ECQA 4YVWB 2RS51 2JXAA 3MIHA 2YV8A 3ZXFA 2Q0AA 4IV3B 1UKRA 3OY8A 4QHOA 4YGDA 3E5QA 5FZDA 1J83A 2RM22 2ID4A 1UMIA 3ZSLA 2X8KA 3JBG1 3WLUA 1I6XA 4E4DX 1EV11 4FTSA 4Q2FA 2W39A 1QXRA 4RFRB 1O5UA 2ZBJA 2VG9A 4JKKA 2WZPP 5C6CA 2YZ4A 4DOUA 2W47A 1PGL1 5K8SA 3ZXKA 2CDPA 3A4UA 5JMOA 2XBO2 1W2NA 4D8MA 2GALA 5CKNA 2QJVA 3Q8AA 3DUIA 3AKRA 5FYIA 3KWVA 5E89A 4Y20B 1N1SA 3NL1A 4EWDA 4K6BA 1AR62 4D3WA 1GUIA 5FO7B 2YY1A 2CHHA 3AYEA 1UWWA 2XLFA 3GBGA 2ADDA 4Y22A 2FQPA 3TOJA 3ZYRA 1DCSA 4GWMA 2XJVA 1QHDA 3JB4C 5D8AA 5JSPA 4IEVA 1HQLA 3ZIWA 3OB8A 4NVPA 5C3SA 1HN0A 1ST8A 5KR7A 3NJZA 1REFA 1D7PM 3R4DB 3B00A 3H8OA 4JVAA 4Q0UA 2PAMA 5J98B 4YVSB 5I0UA 1F9KA 3OBTA 3TB0A 5LBCA 1TE1B 3H8RA 2WNEA 2WNVA 2CWMA 2WZR2 3NO8A 2BUKA 3VBHC 2FCVA 4UFJA 2Q8OA 3KV6A 4Y33A 3WQBA 2R041 3BIWE 2EVXA 1JOJA 2RHPA 2EIEA 3GJBA 4COZA 2GDFA 5DAQA 2RR11 3HWJA 5H9SA 1D4M1 2D93A 3HQRA 4I2OA 5FXWA 5CADA 3AZVA 4ZZ5A 1ZZ8A 1J3RA 5A3MA 4QX3A 3HN3A 3WR0A 1BEV1 4DXRA 5G05L 5A32A 2E32A 2BNMA 4QX0A 3B69A 1GNHA 2C1FA 5GZCA 3HMYA 3DEMA 3WINE 2Z42A 2JKXA 4ZPIA 1E5SA 3ILFA 5FZOB 3K3OA 3RWKX 3VZJA 2I2SA 5JSRA 5CG8A 2Z4FA 2DWRA 1UMZA 4PQQA 1GYKA 1BBT3 2IWGB 5CNAA 3LCPA 5H9PA 3O7OA 4YG6A 2XVKA 5DUWA 1W9WA 2R061 1QEXA 1QJEA 4Q4X3 1NCRB 2AC1A 3ALQA 2JD4A 2MPFA 4XFGA 1UZ0A 4IGOA 3WY6A 2Y26A 5C4WA 1S2KA 2Y38A 3EB7A 4PF5A 5FPAA 4FPCA 4BM8A 3TN91 2ETEA 4FTEA 2VAUA 3QOPA 5DABA 1NY72 1RUC2 4JDMA 5L7OB 1U12A 2HWE2 4NPRA 1QGLA 3E5UA 1K5MB 5EJZB 4BB3A 1XBFA 3MGUA 3JUUA 2VY0A 5FWEA 2IUWA 4MXWB 1DHKB 1UIKA 1RUE1 4DFSA 1HB1A 3VZKA 2PHLA 3H50A 5FP7A 2B9VA 3GXUA 4XFIA 1OVSA 2PQQA 3FC0A 5D1IA 5FBZA 1W0NA 4M01A 5A7PA 4D6QA 1ZREA 1LTEA 1JW6A 1UF2C 5J09A 3BVCA 3IWZA 4OMCA 3TYJA 3WG2A 3RDIA 4FPFA 1CIWA 3OUIA 1SCSA 1R091 2C24A 1MPXA 2HWD3 4ZS3A 4B4PA 4O7XA 2VD7A 3J8F3 1OSGA 4HETA 5DZGA 2LW8A 4AI9A 1QJU3 4WM8A 3D4KA 2W9XA 3ILNA 1UAIA 1H2NA 4NUBA 2AENA 1ALYA 4ONUA 4QAWA 2VL4A 3O1UA 1YQ8A 3PVOA 3VBFB 5KXDA 2O0OA 1SDDB 3B93A 5JOWA 4N7IA 3AXDA 2VZSA 2WABA 4RQPC 3WZ1A 4B4QA 1L7RA 4L99A 5IVCA 1WMFA 4MLOA 4PQ9A 2VCMA 1LHVA 3KCYA 3RFRA 4Q4V2 2J1VA 1MS9A 4KBBA 5C9AB 4AZZA 2A7AA 5CVRA 2E63A 4LPLA 2AZ5A 5LRSA 5FXZA 4FFFA 3C8XA 1DDLA 4U2AA 3WT3A 1NA1C 5FYMA 4MVTA 3T0BA 4AEMA 2VECA 3MIEA 2GN3A 2JE9A 5D21A 5FY9A 1VALA 1OA4A 2D3RA 1VE0A 2Y6LA 1SLBA 3GZUC 2ZZQA 1CZVA 1R64A 3MEPA 1AR82 2OUJA 1H4HA 4AFCA 4P14A 5FZCA 4D0QA 1MR5A 2WNUB 2VZQA 1OOPC 4IV3A 2WQZC 3O14A 1MZ5A 4FCAA 4FO9A 4WVVA 5D2AA 3SKJE 1J1TA 4Q4W2 5C70A 4QQLA 4YW2A 4A41A 4A44A 1W6PB 4CEYC 4Q4Y1 4B3NA 2E51A 4CXXA 4RN5A 1OH3A 4LHNA 1A3KA 1V6IA 1R083 1C8M1 4DY5A 3Q8EA 1YFWA 1UPIA 1AJKA 4DIQA 5K0UB 1IGOA 4LOSA 2QTWB 3VD5A 5FQ0A 3A21A 2W68A 2AR6A 4LIVA 2OQ6A 2NYYA 3WG4A 4CEWC 1QXJA 4K21A 2ZGNA 5T54A 1GP4A 1YJKA 3PHMA 5HCHA 2V73A 3C3VA 2WFPA 5FYSA 4BOWA 1KDMA 4MGKE 2ZKNA 4ARXA 4DEVA 3TEXA 1F8VA 4DZGA 1S55A 3ZO0B 5FLHA 1W9TA 1UX7A 3LF7A 2RDRA 4MZUA 3FL7A 3VHRA 4H7LA 1H9WA 4ZZ8A 1QJZA 2EIGA 3PIGA 3OBRA 4GB32 2PHXA 2Z79A 4TTGA 1QDOA 4E8DA 1W2TA 4ASLA 2Y0IA 1CN1A 4RL7A 3AKPA 1SZBA 5CFDC 2JDKA 4YVSA 3O1RA 4R4ZA 4Y3OA 4AL9A 4CDQA 2VM9A 2XG3A 1OXCA 3ZYJB 4ASKA 4B7EA 3D6EA 4CDWB 1SMVA 1AR73 4HMZA 4IGPA 4CPBD 1C1FA 2UY9A 3CL1A 4H55A 4Q26A 2XVLA 1LKNA 1JODA 3WNKA 4EE2A 4GH4C 1YFXA 4P9LA 2R16A 4XJUA 2GC2A 5A6ZA 2YBKA 3I2DA 1HXS2 4J6GA 3PIJA 4LO7A 2Q1FA 3USUB 5LA2A 1AYM2 1YHFA 2BBAA 2RMU3 2NMOA 2WN3A 5CZKA 4JDNA 3N9QA 2ATFA 5EYXA 4DXTA 1GP5A 1GZ9A 2YBSA 3KF3A 4CU6A 2DBIA 1ZA7A 5FZOA 1X36A 2MEV3 4LKSA 2FZ2A 1V9U1 2XJPA 1ULCA 2BERA 2OX0A 3CKHA 4FPGA 3POJA 4IUGA 4D7YA 4QQPA 4CA9A 4FPYA 5FYZA 2A6YA 3IB3A 1IZ3A 1X7NA 4JTOA 4BMEA 3ZR5A 2HKXA 4P02B 3SHRA 4HKLA 2BOIA 3V64A 4N43C 4EN8B 4MXVA 1DZTA 2Y0OA 2ET7A 4IEOA 3WW1A 1PZ7A 4LNVA 1DQ0A 1PMHX 1UO9A 2ZZJA 2VW0A 3AYAA 4LE4A 3KT4A 4LUMA 4BHPA 2ZMNA 1YXWA 5EJ3A 3VBRC 3ES1A 1G9BA 1KD7A 3I2FA 2WAOA 4J1XA 1X8MA 2VTXJ 3J26N 4QKBA 5FREA 2R073 4AVAA 3POIA 2PYTA 1JXNA 1ZRRA 3AP7A 4RGGA 4ARYA 2H6CA 3GALA 1HN1A 2WO7A 3C7FA 3FBMA 4QMAA 3M3CA 4GJYA 1RMU2 2JDUA 4QM9A 1V6LA 3IKWA 1RUI2 4R8HA 2W5FA 1BBT1 3CMGA 2ZEYA 1OHFA 1GWKA 4S2DA 2PLV3 3O0VA 5FBJA 2VR4A 5I91A 1XJAA 3FJSA 4GALA 4LE3A 2G19A 4OZXA 1RUC3 1L7LA 3WDXA 1LOFC 2PHWA 4CTEA 1KFXL 5JZGC 1TG7A 4Q4X1 3QCWA 1L3JA 3DPRC 1D2SA 1JTZX 1URXA 1VMHA 4P08A 3UKVA 1FAYA 1C3HA 4AVSA 2BP6A 2A3YA 1XU1A 1XPWA 2UU8A 5HCAA 3T1MA 2O8QA 4BYYA 1PNFA 2VNRA 2XHNA 4QHZA 5FPXA 2WWJA 3R05A 5CFCA 1TZOA 2YBPA 2QE3A 3ZPOA 2VBPA 1FOD2 4JC1A 5FZ0A 3E6DA 4FPOB 5C9AA 2Q8EA 3LIHA 5KHGA 4BWOA 1LESA 2ZKLA 3AZXA 4R4XA 4Q27A 5F6LB 3WHTA 3B7MA 1UZWA 2QZ3A 4NAOA 4COUA 4Q5OA 3DXUA 2A1XA 2UWBA 3OGVA 1XC6A 3ZFGC 3H3LA 5BNOC 4AHZA 2ZGSA 3BU7A 2CDOA 4IE7A 3S7IA 4WV8A 1WCUA 5ANQA 4BZ4A 5B4NA 2JG9C 1UY3A 2WNUA 5I0DA 4MGSA 1REEA 4HG6B 2HWD1 5A7SA 3RNSA 4ES8A 3J8F1 3N9LA 3ACFA 3B9CA 3Q8CA 4XMAA 3N4MA 4IE5A 1RGSA 2WNOA 1E5IA 2ZS6B 4XYXA 1I9RA 1WA4A 3DYOA 4UWDA 3VBSA 3KLSA 4E9KA 3LQCA 4ET7A 3BIEA 2F17A 4XDPA 4BPZA 5L19A 5C8CB 3VBUA 3G7DA 4I02A 1XE7A 4Q1RA 5FZGA 4PCRA 3EQEA 5F3CA 3W5NA 4XXAA 3VKNA 2ADEA 2GAUA 2YPJA 1IS5A 1PMJX 5FKCA 4OUMA 2NMNA 3M4FA 1PO12 3H1MA 4QX2A 5DUVA 5JI9A 2HEYF 4MG2A 1SLLA 3NKTA 3OTFA 4CCCA 2FDGA 4CUCA 5FP4A 1W6MA 1W0PA 1XE0A 3KGZA 2ET1A 5DG1A 3JXSA 4A4AA 3D3AA 3EJKA 3PVBB 3UYJA 1EY2A 1HB3A 2Q8CA 4ISRA 4C1WA 1HRI2 2Z69A 4PDWB 4RS5B 4LUKA 1VRH2 2BGCA 1NKGA 3Q9OA 3ZYFA 1ENXA 2V4AA 3LEMA 3TAYA 4QX5A 5ACA2 2NP0A 3K51A 1WCQA 4XW3A 5FOBB 2VZUA 2WWSA 2JECA 3O1TA 3EO6A 4Z2AA 3U37A 2WS92 1JUHA 5K9YA 3M3IA 3O1MA 2BRTA 3NJXA 1XSRA 3ZFEB 4M3CE 4PJYA 3ROUA 5GJ6A 1PX3A 1SBEA 3CJIB 1MZFA 3OYWA 2J7MA 4Y5Z0 4LBQB 5J48A 3BTYA 1OFNA 1VP6A 4G3YC 4LA3A 2VMCA 4LBOA 2WL1A 1U5YA 3RZZA 1EUUA 3UGFA 2RS53 1OT5A 2V4VA 3DL3A 3VZNA 4M0HA 2OA2A 1SLAA 3USUA 5F32A 4JKLA 1MS4A 1W90A 2BWAA 2ZX4A 2G9ZA 3AC0A 4QGLA 4QB6A 2A73B 2BVVA 3ZKYA 4MSVA 1S2EA 1VBC2 4WM7C 3PUQA 1CAXA 3VBHA 1RIRA 5GZEA 5FIXA 3RZJA 1JS9A 2B8MA 1CPMA 3FLTA 2GP3A 3O12A 2JDZA 2ZTNA 5CKMA 1ULFA 5FUIA 5LBFA 1KJLA 4OHYA 3LSDA 1OH4A 4UFKA 2ZGPA 4RHV2 4Q8KA 3HD8B 1ND2C 3W59A 2BQPA 4YZ1A 3ZXDA 4CVUA 1LHUA 1ZRDA 3PLQA 1RTVA 4BQ5A 3LEGA 3QH6A 4OI2A 2B42B 2B45X 4P9JA 5JLVA 1MZEA 1AR71 4Z2WA 3GNEA 3NNLA 2CGOA 2YMZA 4ITCA 1GBGA 1VAKA 4XC9A 3CNAA 1BVVA 1OA2A 2VOKA 4FXGB 5GM0A 4CU7A 2TEPA 1GSLA 1Z7S3 3OY8B 1CAUB 5DN2A 4XTMA 4XQWA 3K2OA 4IV1C 3E6BA 3SC7X 2RS33 2RMU1 1YQ2A 2GNBA 3GZEA 2E6VA 1SLCA 4P9XA 1HQNA 2FZ1A 3AX4A 2D6PA 4CDXC 5F5AA 2QQVA 2UURA 5F3IA 3NMBA 4GWNA 1HW5A 2MEV1 4FSJA 1PZ9A 2WZR1 4S2GA 3U1XA 2RR13 3POEA 5A7OA 4AFDA 3NNJA 4JV4A 4XVHA 1U5ZA 3IDCB 5FLJA 1DZRA 1SPPA 4Q29A 4XF4A 3THCA 4LO6B 1JYVA 1W6QA 1UYXA 3I3EA 2PXJA 2L9LA 2OZ6A 1UOJA 2QQOA 4Y22B 3POGA 1GWLA 3OPTA 5J7MA 1OF4A 5D8AB 4JRAA 3VL9A 4ATEA 2FCTA 5A3OA 1HJFA 3VUOA 5FZHA 1AXYA 1RINA 3IMNA 5AC93 4ASMB 2JDPA 2VTXA 3WQ1A 1NXD1 2OIIA 3CIHA 3NAPC 2D3SA 4QM8A 3SH5A 3WUDA 1TNRA 3LOBA 4LO5B 2ZAAA 3I2OA 4XHXA 1UOGA 1XNDA 1P8JA 4AOCA 4DPNA 4UBHA 1JOBA 3HOBA 1QKQA 5C5TA 1DFQA 4UW3A 4MX3A 4RQPA 4Q0VA 1VAMA 4QGNA 3U4SA 3J7HA 1UZZA 5FY8A 3K3NA 1LGNA 2PLV1 2AUYA 3N9MA 2Y60A 2D6LX 3N3HA 4M4RA 5JUVA 1N1VA 1NY71 1RUC1 1RUE3 4NWWA 3KVAA 5A32B 1IG0A 2HWE1 1NA1A 4LBMA 3MV01 2JENA 1IKPA 4NRMA 5E6HA 3CO2A 3NNFA 3T30A 5A70A 3N7MA 5L73A 3RYKA 3W58A 4DUWA 4XQ4A 1PMIA 1ZRIA 2R7EB 1IS4A 4AGVA 5DDJ3 4AEDC 1W8UA 4UT5A 2ZGRA 1PIV2 1R093 1WD3A 3WP3A 3OEAA 4BLIA 5BNNC 3AM2A 1YCIA 2JIGA 1FX5A 4AQ2A 2D44A 4CXWA 1Q8SA 4OVEA 1JZ8A 4SBVA 4EWAA 1ENQA 5C3OA 5C4WB 2P3JA 4PDWA 2Y6KA 4IDZA 3TNQA 2CSGA 2ARBA 4A7ZA 4DEQA 4E2QA 4IGQA 2DDUA 1KITA 3TEYA 2ORXA 4O61A 3WEZA 4UI9L 3H7YA 2GN7A 4CEWA 1WMDA 2K9ZA 2Q1ZB 4TYSA 1RVF3 4YGCA 5FZAA 4XAEA 1H9PA 3MLKA 2Q5TA 2DUPA 1GZTA 1B35C 3RPQA 1PO13 2LROA 1BMV1 3MBWA 4YG3A 2VH9A 2YU1A 1W2OA 3B9IA 1DGRA 4IL7A 1NQJA 4CUBA 5C7GA 3VD3A 1GANA 5HXMA 4CE8A 5E88A 4FFHA 2CU5A 1H30A 4W8JA 1HRI3 3GHNA 1S0IA 1WW7A 2X5IC 5CFDA 1I3HA 2JDNA 4WM8B 2ILMA 3ZFFC 5BV6A 4ZU4A 3SITA 1R1A2 4JKMA 1XYOA 3HBZA 4QXKA 3J9SA 3HN1A 4JDOA 5FK8A 1MVEA 3U14A 4XETA 3S6PA 1ZBE3 5CBLA 2E7QA 2HWC2 3D8CA 1GKBA 3GM8A 3LZZA 1UU6A 4GH4A 2BFUL 3WNXA 1J59A 4ZU5A 3LA2A 5FZLA 2DCTA 5FY0A 4CCNA 4PF1A 4OYUA 5LY1A 1K42A 4YNIA 3I3MA 1NE4A 1EAH2 3ES4A 5FPLA 5IK8A 1MS8A 1U5XA 1YO8A 4LT5A 5FZFA 1VBE3 3VDDC 1C8NA 2HWF2 3WW4A 3K4DA 5KHHA 5KXBA 1SLIA 2P6CA 3KF5A 4FFIA 3WV6A 1WKYA 4P9GA 2VPVA 2X09A 5IVEA 2BPA2 4COVA 3VB9A 3AP5A 4JCKA 1YLLA 3VD9A 5A1FA 2VCBA 2ENRA 3T4HB 2ARXA 2XVGA 2H0BA 4AW7A 3FX3A 4YM2A 5FP3A 1CAUA 1GOHA 1C5HA 1VAVA 3FUQA 4D7SA 1Y9GA 4AVBA 4GB31 3SCGA 5ABJB 3MPPG 1F5FA 4N43A 2E53A 4UBGA 2P3YA 1XNKA 3RG0A 1TMF2 1DIWA 1FMD2 3E1F1 1EPWA 2HLEA 3WNLA 2ZHMA 1ULGA 3T2OA 2GH8A 2YROA 3LKJA 2B39A 5FQ0B 5IVFA 1IKQA 2AYHA 3MI8A 3VBRA 3H8UA 4Q0PA 1LHWA 1JN2P 4XJZA 5J3UA 4IERA 1DF0A 1VBA2 1O3RA 1LJ7A 3NJVA 2NPIA 3LDBA 3ZYIB 2ZAHA 1HXS1 1LOBA 1OLQA 1Q56A 4XUOA 1RB8G 5AFBA 3ATGA 2XH6A 3SEEA 1LOEA 1W05A 3IZOA 4EN6B 2GMPA 3POYA 4FOVA 5DPNA 2OKXA 1UU4A 1AUYA 2JJ6A 1CX4A 1V9U3 2VCAA 2PN5A 1K12A 1QQP3 4JGZC 1ENRA 3WQ7A 2JDYA 2WA3A 4CCEA 2ZOEB 3AL5A 1PM7A 3ETPA 5HXVA 1Z7S1 1LOFA 1N3PA 2CV6A 1BCXA 1NLRA 5JZGA 1UYZA 1PK6C 2VNGA 4AHWA 3DPRA 2RS31 4GKYA 1WW5A 4Y5SA 4BCUA 4CDQB 4F3JA 5J37A 1RUH2 5FZ1A 1FI2A 5FK7A 2HEWF 3SQOA 4N9IA 4AGGA 4YFWA 5CA6A 1JU4A 3AKSA 4MHUA 5HPOA 2QFEA 3NVCA 2UY8A 2VCCA 3CZJA 2XONA 2HYXA 4O65A 2ZX3A 2FDIA 1ZRCA 4QB2A 3OGSA 2W08A 1HQWA 2QBXA 3WDTA 2WIIB 4CDUC 4URAA 4YZ2A 1QOOA 5LBBA 3CBNA 3CQOA 3H1YA 5FPBA 3VD7A 5IVBA 5TSWA 3PUIA 1AF9A 2XGXA 2I45A 5GALA 3EBRA 4QDQA 1MQTC 4IEPA 1DYOA 2C5DA 3ZFGA 1MACA 4BQYA 5BNOA 1DQ4A 4E2GA 3MDPA 1SFPA 2IZWA 1ASJ3 1CR7A 2QCSB 4FQ4A 2JG9A 4AR2A 2EIBA 5IJRA 1I5PA 1SG3A 1TNFA 5AC91 1RMU1 2FDFA 2QKDA 1AZDA 5A1AA 4NIDA 2PHRA 5IHRA 4W6WA 3FLRA 1VBB3 4M3CF 3VGIA 4LBNA 4HL0A 4N53B 4MGQA 4C0BA 3HBKA 1GZWA 3EMRA 1LOAA 5FMOL 4XURA 2VUAA 1YQCA 4XQDA 3S5QA 1WUVA 2D6OX 4IXLA 4IEYA 3WDYA 1YI9A 2XOMA 3ZLIA 1OA3A 3K48A 5ISLA 1RL3A 2QQUA 4UF0B 4NJ4A 1WZXA 3AVSA 2YC4A 4CP9A 4FPJA 3WNNA 2VO5A 4A3XA 5JPNB 4YGEA 5L36A 1FPN2 3H7JA 1W03A 1ZVFA 5F5IA 3J7NA 4D94A 2DVGA 2A3XA 3OD0A 3I54A 1QWRA 5EJ1B 1RITA 1L7QA 1CWPA 1OD3A 3ACIA 3GZAA 4Z92B 5EZWA 4G9SB 2O8OA 3PJYA 2J42A 4BQ2A 1JH5A 3HJRA 4I30A 2BYVE 3O1SA 2XHKA 3BB6A 3CDZB 5DDJ1 5JR7B 5L9RA 1YQ6A 3IPVA 5JXIA 4XF9A 2OPWA 4BU2A 4HZFA 2CWSA 3GCXA 4OI0A 3FWEA 4Q8LA 3OGRA 1AJOA 3FLPA 4ZXEA 3ETQA 4YPJA 3ZX7A 1RUG3 2WT1A 4AEJA 1GNZA 5A3LA 4Y1UA 4HVOA 1OURA 1PO22 1W39A 2QQKA 4Z82A 2BVBA 2GZWA 3J4UH 1QJFA 2J1EA 3FN9A 3HEIA 4EROA 3O5SA 5IFTA 1JMUB 2R1DA 4GAZA 3ZXEA 2GH2A 5CFCB 5L9BA 5FO8B 4AG4A 1WA6X 1IHMA 3TEZA 2BJSA 1VMFA 1CVNA 2BGPA 2BNNA 4CSWA 3S57A 5T50A 3I7DA 1UQXA 1RVF1 1CGPA 2VZTA 1YI7A 1RUF2 1PO11 1GQGA 4XZPA 1HRV2 1D0GA 2ZXQA 1R1A3 4XCAA 3PUHA 2R0FA 2E9QA 3M7AA 4PIXA 3BTXA 3WP6A 1QY4A 1YC61 2HH9A 4LITA 5F2SA 2YYOA 4QQ2A 1LECA 4KL1A 2VQ0A 5F1RA 3RMXA 2DCZA 4QX1A 3U11A 1HRI1 4FP2A 4AFMA 2RJKA 5CISA 4ZU7A 1ND2A 1NOVA 1VRH1 1ZZ7A 4KBZA 4NAMA 2IXIA 4XJ9A 5DG2A 5FLIA 2RS12 1G9AA 1QOSA 3O1VA 4QWNA 1W8TA 2AREA 3FFZA 1DBNA 5IVYA 5FYHA 1UXZA 3VBSB 5ABJA 4NIGA 3CF6E 4CP1A 4CPBA 1EAH3 3GF6A 2J1RA 2W1UA 2HWB3 1ZBE1 1KS4A 3VBUB 4RA0A 1AL22 1CZSA 5I8TA 1V6MA 1A34A 1LU2A 5FV3A 4QXBA 2WT0A 4XE9A 1BJQA 4I3PA 2IXCA 5FXVA 3D5OA 3BYWA 4HT1T 1SQ4A 3L9JT 1JYTA 1POQA 4IV1A 1Y7BA 4QPGC 4GQ7A 1W6MB 2CNAA 2WLQA 3JQWA 4QGMA 1VBE1 4KU8A 3S30A 2JDHA 3THDA 1NLSA 4LHLA 3RJ2X 4AYUA 4HN0A 2RM23 4D7TA 4HSJA 4XBQA 3U07A 4UAPA 3WDVA 4KNCA 4RR3C 1X8EA 1RUD2 4QB1A 5JXHA 2VOWA 4K8FA 4E4ZA 3AKQA 1VBD2 5EV7A 2ZA9A 1QJX2 3ILRA 1O8PA 4E2SA 1APNA 2DCKA 2OUHA 1C28A 1ZZBA 3A7QA 5FY4A 3U0ZA 2XBO3 1GFF2 1ACCA 2EXHA 2VOTA 1KEXA 3PVEA 3SH4A 4XAAA 5F6KA 1J58A 3FBYA 3I4IA 5FJKA 4AHYA 4LO4B 1ZRFA 5JSOA 1VJ2A 1VBA3 1JHJA 1N3QA 4RHV1 3SMHA 4GZ9A 3C7HA 3SXWA 1G9FA 1AR63 1DP0A 1PHMA 3OYWB 4NMIA 5M0TA 4AEKA 1Q43A 1US2A 4AVVA 1OVPA 5BNPC 5IATA 4GJZA 1YIFA 1SHWB 4R9CA 4OFGA 5FXXA 2A6XA 2LRPA 2ZEXA 4WVZA 2JG8C 4Y4RA 2PHFA 3MUY1 3UKNA 3KD4A 2ARCA 3NAPA 1AVBA 1LGCA 1MVQA 1EV12 1PK6B 4INDA 3U10A 3UT0A 2WO1A 2WFF2 2WC2A 2XKOA 4P9IA 1DQ6A 2A3WA 2I07B 1C5IA 1CAXB 1UY4A 1AYN2 2OZJA 4TWTA 3VBHB 3VKFC 2DU0A 4UYBA 3VDCA 2BW8A 1XB9A 2JX9A 1JZ5A 4S2FA 5DZFA 2JE7A 2R0HA 4IE0A 4E8CA 5F7UA 2WZR3 4WVMB 4FQZA 1ULPA 4I3GA 3DKQA 4R9BA 4AI0A 3NSTA 1QQP1 1GNYA 3KM5A 5A7WA 4OHZA 3T4VA 3GBWA 2ZGLA 4RSUA 2D5HA 1A78A 4LHKA 4KG0A 2ZPXA 4S2HA 3V0BA 1YJLA 1E5RA 2VMIA 4B29A 4OQ8A 1ODNA 2XUMA 1OC1A 1AX2A 3FHQA 4K1YA 5GKAC 5CAZA 5BNQA 2YUEA 1UKGA 2WWUA 4UW6A 4N53A 1Q3EA 5DZEA 2XPJA 4NHKA 2UWCA 1HJGA 1AX0A 3HT1A 4PT6A 3MPBA 4OHXA 3HNYM 3P1IA 1UX6A 4HANA 4NRQA 4RYDA 4CCMA 2P2KA 4UF0A 4Y26A 4FPHA 5A3NA 4A45A 5BNNA 2DTYA 3PU3A 3IBMA 3Q8FA 1Q8VA 2D43A 3D82A 5JIAA 4XIKA 5A80A 3NV2A 1O59A 2GP5A 4LLFA 1QXPA 1JYXA 3M8LA 2B4KA 3FUOA 4QPYA 1U0AA 2AH2A 2R042 4D69A 5DAVA 4FT8A 5BY5A 5FY7A 3MZHA 2Y6JA 2J1TA 4JGYC 3DKWA 3GJAA 1ND3C 3BPZA 5FMDA 1REDA 1ASJ1 3ZN6A 4BQWA 1JZ4A 3O1PA 2JDMA 3M1HA 5K4LA 1WLTA 4NHLA 3ACHA 3MO4A 1BEV2 4YZ5A 2CGPA 1SPPB 4KU7A 3D0SA 1W6QB 4LBJA 2HJIA 2HWE3 3V65A 2V5YA 2G1MA 3WOGA 1VBB1 2JB8A 5EP9A 5BXXA 4K1ZA 3R0RA 4AWDA 2V72A 1XQNA 2Z5WA 1O8SA 1UMHA 4XDQA 5BPXA 1W8NA 1KJRA 2BNOA 2NN8A 4DXSA 1EYBA 3VBOC 2WYSA 5KC5A 3OUJA 5DMYA 1DQ2A 2X5IA 3CU7A 4JQRA 5FRAA 4PI2A 2XKPA 4PI0A 2WT2A 1JYCA 2W52A 1AR92 1IG3A 5DAWA 3ZFFA 2XUEA 3PMSA 1F5JA 2X05A 1J84A 3DCQA 1V6KA 5LEKA 1OQ1A 3N9NA 2OPKA 5JAXA 3QD6A 5CYYA 3TN92 1F4AA 2WNVC 2W3JA 4QD2A 2ZCWA 1O3SA 1OLME 4RQPB 1NCQC 1PO23 1PZ8A 1IPKA 2PELA 3N7LA 1XNTA 3RVHA 5L9VA 2FDHA 1X50A 4COWA 5KC6A 4NHYA 1JZ7A 1VPHA 2IXLA 1GOGA 3E5XA 5H9RA 2R30A 4I01A 1V70A 1OKOA 2ZHKA 2P17A 4Q4V3 1NA1B 5FYBA 3VDDA 2LM3A 1RUG1 4COYA 1VR3A 5A3UA 4V1PA 3KT1A 4Z8BA 1UY2A 4KH9A 4YFZA 1W8HA 4FXKB 2LALA 1LU1A 4GKXA 3BTAA 4H2AA 5JOXA 5GLUA 1HRV3 3JD72 2YGMA 2XWJB 5A3WA 1MS1A 2J22A 3W9AA 2LUWA 1OOPB 2W92A 4IETA 3ZSEA 1AR83 4Y4YA 3WNOA 4JTNA 4C8DA 4HPKA 4CU8A 4HKOA 2G9FA 4CEYB 1XRUA 2VVEA 4QKDA 5A7QA 1J3PA 1SBDA 5FZ6A 5B2GB 4XFBA 4FPKA 3GYDA 4J25A 4N90A 4BIFA 2EF6A 1XNAA 1PNGA 4Q4W3 4UFLA 4LOTA 3ZMNA 5I8YA 2J1SA 3D0JA 3P6BA 5E1RA 1OMIA 1R1A1 2ZHNA 4N9HA 1DYKA 3ZKUA 1YFUA 2CYFA 3UGHA 3LEIA 2HBUA 4XBLA 4QPIC 1ODMA 3BOWA 5EPAA 5JXJA 2VNOA 1OPMA 2HWC1 2WZ8A 3HIFA 3LFIA 4CEWB 5F9TA 2PHDA 2VBDA 3ORJA 1QMJA 1SACA 1W04A 4YGBA 2JE8A 2OYZA 4K20A 2B9UA 4UW5A 1LULA 1EAH1 1LODA 3FHAA 4YG0A 1DGRN 2HWB1 1UU5A 2GC0A 3WCRA 3LOIA 5K7PA 5ANNA 1QDCA 1KFUL 4JGZA 1OBNA 5FOJB 2ZMKA 2MNGA 4LORA 2NLRA 2VU9A 2D6MA 2XDVA 4TLFA 1MEC2 1ZA4A 3MIBA 4Q4Y2 4DUVA 5CFDB 5KWRA 1VBD3 2XXZA 1PK6A 2VZ3A 1QJX3 4GB33 5IK5A 5LY2A 2RV9A 4YW3A 1W9YA 1C8M2 5IFPA 1SEFA 4FAGA 2EALA 3BPSA 1UOFA 2DVAA 4KQ7A 2RM21 2ZEZA 3CZUA 4YM0A 1I1EA 1QH7A 4GH4B 1W3XA 3AVRA 3NW4A 1GWMA 4WM7B 4WVMA 4IEZA 4A3ZA 1FMD1 4CDUA 1BVP1 3TEWA 4XF1A 2P5BA 3HNMA 4HFSA 4EN9B 3U78A 2XBO1 1LHOA 4CU9A 1E5HA 1CPNA 4MO3M 1HXS3 4FOQA 4NR1A 2ZHLA 3V0AA 1W8OA 1AYM3 5LW9A 3FFQA 4GA9A 4LJHA 1VBA1 1A8DA 2Y6HA 3MFCA 5LA9A 3UV9A 4FPLA 1SLTA 2XJSA 1MQTA 2WFF3 5CU1A 1LENA 4QQOA 4QDRA 1AR61 4QU2A 3R4SA 4ZS2A 4AE2A 4IE6A 1AYN3 4XJ8A 1WLDA 4A7YA 1HB4A 3L2HA 1ULEA 5JCTA 5LRRA 1BQPA 1JZ3A 2A70A 4YW1A 4YVWC 1W6NA 4EJRA 2DFBA 4IV3C 3R6SA 5HV0A 1DLLA 1X33A 4N43B 2JEMA 2KA3A 2CY6A 5FTTC 3KGLA 1HV1A 2VQUA 2ZGQA 1YQ5A 4XFAA 3RS6A 2WINB 1G9CA 5FZEA 3EXUA 3WVJA 1H1IA 1QIQA 2PHUA 1OUSA 1TQ5A 2ZABA 4NPMA 1IS6A 1Q5OA 3NV3A 1GQHA 3VBRB 4GD4A 3NNGA 4XZUG 3JCIA 1PX4A 4IEQA 3BN6A 5C8WA 2WRAA 3BODA 1BK0A 1LEDA 1XU2A 4EV0A 2BZDA 3SEPA 3ZN5A 1H8TC 1Q8OA 3N9OA 3FE5A 5FMBA 4Y1YA 5G04L 3LDRA 3ZSMA 3BUCA 2A6VA 3WNMA 5KXCA 3WF3A 3ELNA 2GC1A 1LR5A 3AP4A 5HV4A 1MS0A 3WDUA 3I59B 2WO2A 4I0WB 4OI1A 1VB2A 4CCKA 2EAKA 1RMU3 5FYUA 3F95A 1W8FA 3A22A 4HLTA 4BLJA 3APBA 1O91A 1RUI3 5J1XA 1QNWA 1RYYA 1H2MA 4YW6A 5JZGB 2Y6FA 1WCSA 3DPRB 4M0NA 3HNBM 2IFRA 4ZKTB 3KHBA 4QT6A 2XQXA 4YVSC 3B94A 1QU0A 4XXPA 1HDKA 4UXAA 2E26A 4MGZE 1NZIA 2ZEWA 2YDEA 2ZGUA 5J96B 2R49A 2WYFA 4P5HA 1W8ZA 2GNMA 2DU1A 3NV4A 3UK9A 4A6SA 1JHNA 1STMA 2R1BA 3LE0A 5JMCA 3PTRB 5HBAA 5CKQA 5DQ0A 3N7KA 4AI8A 1FOD3 5FP9A 3WF4A 2K46A 3LEKA 2FBEA 2WJSA 2CGNA 4XFFA 4BQ4A 3L2YA 2UYAA 1BZWA 1S0FA 5FJHA 3ZFGB 3CLPA 4BH9A 5BNOB 1NCQB 4GMP3 1S1AA 1WMXA 4AGRA 2VGDA 4Y1VA 2JG9B 3O0WA 1JUIA 4MGIE 1XNBA 2QDNA 2A6WA 3ZXAC 1V6JA 2JDAA 3RZHA 1OOPA 4Q4X2 3T0AA 2BDRA 3E97A 3ABZA 1EUTA 2P3KA 3PNAA 1JI6A 4YW5A 4CEYA 1CAWB 3JB8A 2ZX1A 2JICA 2FD8A 4W50A 2VVFA 2BWCA 1GZWB 1NCRC 2GMEA 4LIUA 4QQHA 3WG1A 4D6SA 2DVBA 4L2NA 1FV2A 1XYPA 3OGGA 1PO21 1H0BA 2JKBA 4AHXA 3U4XA 3OPWA 1QJY2 1HV0A 3QLQA 3AFKA 5FKBA 4CP9B 1OD5A 1H6YA 3WF2A 2QQJA 3ITQA 1KGYA 4QPGA 3T09A 4BIOA 5L7OC 4XUTA 1K5MC 2RE9A 3USSA 4YW7A 4Q4V1 3N9PA 2D97A 4LR4A 1ZZ6A 4HONA 3K75B 5EIYB 1CX1A 5SV5A 5T55A 3AMMA 1POV3 3AYCA 4AVCA 2P1BA 3LPFA 1CAVA 2PMWB 4JHTA 1M06G 1PM4A 2VOXA 4NO4A 2BTVC 3T2PA 2DVDA 1GICA 3VZMA 5J36A 2XJTA 1HRV1 2HWD2 1G8WA 4GXLA 5FPVA 3NQHA 5LATA 2VMHA 3IPVB 1Y9QA 2QVSB 3J8F2 4H3WA 3ZYGA 5JIUA 1VRH3 1QJU2 1W2AX 1ZNPA 4FFGA 5EXOA 1AR81 3C2UA 2YFZA 3X29B 2QQLA 5FYCA 5ACA3 1NQDA 3NNMA 2XL9A 3CEWA 1EPZA 4NHMA 4CZSA 2WS93 3TNPB 4M3CA 2RS11 3H42B 3AFGA 4Q4W1 4XACA 5FYYA 5LK5A 1Q8PA 2H6BA 5BNPA 1YIPA 3VBFC 2CAVA 5IWFA 1BKZA 4H7MA 1AL0G 2LS6A 4OUEA 1VB4A 2OW4A 4DY3A 2JG8A 3PDQA 3WD5A 1H8VA 5FFOC 2W2IA 5FZMA 3IM0A 2VBBA 1RXFA 4GIQA 1FT9A 1ONAA 1SBFA 4YM3A 2OXBA 1AXKA 5C9AC 3RQ0A 2QZ2A 4META 3OSDA 4OHWA
chains in the Genus database with same CATH topology
2SLIA 2D98A 1VBC3 3SCHA 4MH0E 2IXHA 2G9GA 3AZZA 1B09A 3MIGA 1RUD1 1ND2B 1HX6A 4K3UA 5FPZA 2WNUC 4LBLA 1VBD1 5A33B 3B3QE 1QJX1 2N7GA 4RHV3 1I5ZA 1R082 2F6BA 3TRSB 2D5FA 3FHIB 3AMPA 1ULDA 3SLIA 1W0OA 2K0GA 4LBQD 3ASIA 1W6OB 5T5PA 5K0UC 3IDEA 4XPVA 3HQXA 1G6NA 4IV1B 2HEVF 1RUNA 1S2BA 2C9AA 2UWAA 4O9GA 3H0OA 1AYM1 4CDXB 1V00A 3OF1A 4ORFA 2FMDA 2WFF1 3BOPA 1W2UA 2QNKA 4JGYA 4YW4A 1ND3A 1WBLA 1AYN1 3I59A 4MV2A 4EWEA 2VULA 2Q1MA 1C57A 4YLZA 3M3EA 3URFA 1A8MA 1GV9A 3WW2A 4XJWA 1NG0A 4Y24A 2I74A 1RUJ2 4AI2A 4C1XA 1H8TB 2QDRA 4L9BA 4X8PA 1AR72 2WQ4A 1UIJA 5I93A 4FOYA 2ZACA 2VXRA 3PVNA 4A2UA 2VW2A 4WZFA 4CDWC 3AK0A 3UL2A 5KHJA 3VBOA 2HYKA 5C33A 2ZJCA 3CJXA 3DV8A 1UZYA 1DG6A 2RMU2 2DTWA 4YZ4A 3NAPB 2IC1A 2VQAA 3PJQA 1E57A 3QACA 3V56A 2TUNA 3RJRA 2GNTA 2MEV2 3IT8A 4F83A 1N1YA 1NCQA 3VLBB 5GLTA 5E8AA 1OKQA 5FO9B 4A7KA 3KSCA 5JOYA 1WLWA 1SCRA 1RUI1 3V0BB 2EA7A 1PGSA 1CAWA 1COV2 4H14A 1DYPA 2WA4A 4DS0A 4AXOA 4F7ZA 3INAA 2PTMA 1N3OA 4QHBA 4XF3A 4AEDB 3WX5A 3M3OA 4CP2A 5BNNB 3ST7A 5JVVA 1PVC2 2WSUA 1LEMA 1GR3A 1H4GA 3WP4A 4YRDA 4W6XA 2R072 1O5LA 1PIV3 4B8EA 1FOD1 3VHOA 2VOVA 3O0XA 1AR91 1WGPA 1TME2 4LTAA 4GMP1 1R1ZA 4QPIA 4X6QB 2PLV2 3ZN6B 4LEJA 1N1TA 3HAGA 1SDWA 4XJAA 3S7EA 3THTA 4JRLA 1RJ7A 4FVVA 3AP9A 1QJY3 3JU9A 1B35B 2CAUA 3AJZA 4BMBA 5EYYA 3RWNA 5JOZA 2XJRA 4AI1A 3SH3A 2PAKA 4FPEA 1FATA 1GZCA 5HCBA 3B01A 3N36A 3MF9A 3GZTB 4IEWA 2CTVA 1YRZA 4AFBA 1WBFA 2X5IB 3WG3A 3WHUA 2X29A 4BA6A 4XOGA 3ZFFB 3JD71 1FV3A 1RHI2 1UL9A 4WM7A 3BALA 1POV1 3AZWA 4FAHA 2SBAA 4IESA 1UPSA 1SFYA 2VW1A 2HWC3 3MW4A 4RFT0 1CJPA 1CQ9A 1O4YA 3MFAA 3KB5A 1ZX5A 1BMV2 5A33A 3VDDB 5ACA1 3ACLA 4OI4A 4L97A 3RRDA 2A75A 4Y1ZA 2K2SA 2G4IA 1H1MA 2WS91 4OHVA 5HCFA 4FTBA 1CONA 4LO8A 5IUQA 2HWF3 1QF3A 4FOWA 5C8CC 5E16A 1ZYBA 5JI7A 1NXMA 3AYDA 3TBDA 3WCSA 1W6OA 3OD4A 4YVWA 4HPKB 1PGW2 2Q30A 1V6NA 1A6CA 5I8SA 3MICA 1CESA 1G86A 1MEC1 1WW6A 4YZ3A 1JYIA 1CD3G 5JWPA 4CDXA 1WMEA 2DUQA 4SLIA 5GZFA 1VBC1 1ZBA2 1TMF3 4PDWC 4RS5C 1FMD3 1SFNA 4XMIA 2ERFA 2F4PA 3AXEA 4C91A 4P9YA 3ZYPA 3RSJA 1YNAA 3ZXJA 2W0XA 3I8TA 3OGJA 1H8TA 1OI6A 1F31A 1O3TA 2ZGKA 3N35A 4ISQA 4Y20A 3ZFEC 4LLOA 5T5JA 2KXLA 4KWKA 1ZZCA 2RS52 3CJIC 4JGZB 1DGLA 3SCFA 3VHPA 1OLRA 1AHSA 3JBG2 1LCLA 3WDWA 3KS7A 2OVUA 3H9AA 3M2MA 1PGL2 4I0BA 2ZX2A 1RUJ3 3NV1A 4XFCA 1O3QA 1RJ8A 4I0AA 1RUH3 5T5OA 2PAEA 4DINB 2Z2SB 3AJYA 1LHNA 2EXIA 2P3IA 3VHNA 4CDUB 1UN1A 2XJQA 3MLLA 2IFWA 2GSYA 5HI0A 4CRQA 1LGBA 1YFYA 2DYCA 3V0AB 1H2KA 1MQTB 2YXSA 3JZVA 3RMYA 4AEDA 3SISA 1Z7S2 5JDBA 4XBNA 2QQPA 3M3QA 4XIOA 3ENRA 1VLNA 2RS32 1W6NB 5FCCA 5I0TA 2FHRA 2X53S 4UW4A 4DMIA 1DU3D 1NCRA 2FMYA 2EXKA 3H1WA 2ZMLA 4PLNA 4C90A 2RR12 2D6NA 1COV3 1UD1A 1D4M2 1F2NA 3ZXLA 3HT2A 1YYNA 3WP5A 4B7KA 2A5ZA 2WKKA 5L7OA 4NWVA 3DF0A 2AGSA 1K5MA 4J1WA 1S0EA 3KCCA 1B35A 1PVC3 4MXWA 3WUCA 3VKLA 1FPN3 3ME2A 3T2TA 3HR9A 4Z07A 1IOAA 3LGRA 3MIDA 2DF7A 2R6QA 2ZGTA 5AC92 5D8AC 4LA2A 3ZDSA 4E4SA 1TME3 1D4VB 2R062 4OLLA 5LK7B 3AP6A 1WCDJ 3KMHA 3OPZA 4GMP0 1J1LA 4HK8A 4PBPA 1FYUA 4K40A 1H2LA 1FXZA 1PIV1 3VN4A 1DZQA 5DUUA 4KG8A 4HSLA 3WXPA 3P3NA 5BYNA 1N47A 2DCJA 3T1LA 3MIFA 3VBFA 3M70A 1Z78A 4AF9A 5BUVA 2CL2A 1KS5A 4YM1A 3VZLA 2PA7A 2PFWA 4MYEA 4AQSA 4OUSA 3BCWA 4BE3A 1ENSA 1RUE2 1UW8A 2D40A 4TZDA 3PTYA 4IEUA 5I0SA 1OQDA 1QJY1 4WZCA 3ZIXA 1RHI3 5SV8A 1DGWX 5DDJ2 4DB5A 1RUF3 1YUDA 1R092 2E7TA 4O9EA 3UKTA 1POV0 1IPJA 3E6CC 2H0VA 1OQEA 4PIYA 5T5LA 2TBVA 1KDKA 2XB6C 1QJU1 4PLMA 2EXJA 3ZMOA 1W6PA 1Y3TA 1VIWB 2RS13 2YGLA 1QOTA 4KGGA 1BXHA 1FNYA 1Z0HA 5C4WC 1WW4A 2XLAA 1IQAA 3KT7A 2VVDA 4AFAA 1O4TA 5K0UA 1AL23 1RVF2 4R9AA 4Z1VA 1D0HA 4QPGB 3P3PA 2DV9A 2PHTA 4ES9A 2XL7A 4G4FA 4HN1A 5JPMB 1C1LA 3FZ3A 4CYDA 3GBFA 1HLCA 3AMQA 1CAVB 4RR3B 1KXGA 5FAXA 2HWF1 4JAAA 4Y1XA 4DRVA 1J3QA 2B46X 4DNYA 1RUD3 4NN0A 4PLOA 2GMMA 1ZBA3 4DQAA 2O1QA 4WVWA 4Q0QA 4HVRA 3AMHA 4WM8C 3LSEA 5T52A 1XXNA 1ZBE2 4Q1PA 4L11A 4M3CB 1KRIA 3A0NA 4CDWA 2R32A 1AX1A 5AVAA 3R4UA 5BNPB 3MW3A 1R081 1MZ6A 1LB2A 4L92A 1TMF1 3VV1A 2JG8B 1XE8A 2EAAA 2XLGA 1RC6A 1VBE2 1RUOA 3OJBA 4F8AA 2B5HA 1LOGA 2ES3A 3JBG3 1EV13 1PVXA 3POSA 3VKOA 4L8QA 3B5LB 2ZGOA 4KWJA 2BFUS 4W6YA 1ZM1A 4TSVA 3ZVXA 3MW2A 3N7JA 3NWKA 4AK3A 4IEXA 4E27A 2Q4SA 3IDBB 1MS3A 4R52A 4X6RB 2BEOA 3QH7A 3MYXA 3A0KA 3VZOA 4AQ6A 3ZPYA 1U5IA 1LOCA 3VL8A 1RUJ1 5ABJC 5IT6A 2RJLA 2NZ9A 1RUH1 2DUOA 4XILA 2A71A 4XF0A 4WBBA 3WQ0A 2E7AA 1CJDA 2UYBA 3LA3A 4EN0A 1TEIA 4XFHA 1KQRA 1Y43B 4I09A 1V9U2 2V09A 3KQRA 2TNFA 5F5QA 1T6GC 2YHJA 1QQP2 1XYNA 2P34A 1ND3B 4JGYB 4Q0SA 2NM1A 2DCYA 2R043 3FMGA 2VUJA 5DUXA 1D4M3 4MGYE 2DFCA 4HBNA 4IQPA 1DQ5A 1BEV3 4FBFA 1V6OA 2GU9A 4B4RA 4CDQC 4M00A 4HVQA 2KM2A 5EWSA 5FDBA 3OCPA 3VBOB 1COV1 4AVTA 4W65A 4XTPA 2YC0A 1WLCA 5EFUA 2IXKA 1G7YA 1OFSA 1BYHA 3DN7A 2DVFA 2R063 5CB7A 4CP0A 1PVC1 3WW3A 1AR93 1FPN1 2WNVB 1C4RA 2R071 3NKGA 1BBT2 1ASJ2 1H1AA 5DXDA 3SNMA 3GHMA 3ZSJA 2D3PA 3AMNA 3TN93 1S0JA 4FP3A 5IK7A 2XWBB 5GLZA 4P9WA 3UJOA 4EN7B 1TME1 1VBB2 4U36A 3RI9A 5KXEA 3EHKA 4MUVA 4YSFA 2WSVA 4K7JA 1BK1A 2D7FA 4AQTA 3LA7A 2LTNA 4N53C 5KHIA 4GULA 1S0DA 5C8CA 5GZGA 2GC3A 3ZXGA 2QUOA 4RD7A 3IIAA 3KZ4C 4C0HA 4K9SA 5GLVA 1QNYA 3RYPA 3JD73 3JQXA 3LWCA 3LAGA 1WD4A 4R9DA 4HK9A 2C0ZA 4N7UA 4URTA 4NOTA 3POWA 4DRRA 2BBVA 5KHKA 4LBKA 5I0RA 1S0GA 4RR3A 1RHI1 5FMOS 1RUF1 4QPIB 4RS5A 4YARA 2GNDA 3S0MA 1DGWA 4KWLA 1RUG2 1S0BA 3AZYA 1X82A 1ZZ9A 1MS5A 4XHBA 2P37A 4ZXKA 2ZGMA 1YWKA 3THPA 3H3UA 3ZFEA 4HKWA 2B7YA 1O7FA 5H9QA 4X8NA 3UJQA 4RGAA 2IXJA 3CJIA 2WLPA 1UCXA 3DGTA 3G6JB 4LBQA 5GLWA 5AFEA 5CFCC 1NZCA 1JBCA 1LRHA 3PMEA 3KCXA 1AL21 4KGQA 4BQ1A 4DXZA 5IK4A 4PIZA 1FNZA 2A6ZA 4OULA 1AXZA 5GZDA 1MEC3 1Q8QA 2D6KA 4Q4Y3 4YYOA 1HKDA 5CIRA 1PGW1 1D2QA 1EP0A 3B02A 4ATFA 1C8M3 1S0CA 1O4ZA 5T3NA 3AKTA 3H3ZA 1IS3A 1GLHA 1NYWA 3ZSKA 1QH6A 1NE6A 3LB9A 3VKMA 1ZBA1 5AVPA 5LEJA 3IN9A 2XJUA 3MLJA 1WCKA 4LULA 4PBOA 4XEZA 2DURA 2HWB2 3ZN4A 1DQ1A 5KBFA 3VBSC 3MF6A 4AI3A 2VMGA 1M4WA 1XNCA 1G9DA 3AB0A 2ZX0A 3VBUC 5CG9A 1HIXA 2MHFA 2NQYA 3RYRA 3TWIA 1OPOA 3QBQA 3RI8A 3ECQA 4YVWB 2RS51 2JXAA 3MIHA 2YV8A 3ZXFA 2Q0AA 4IV3B 1UKRA 3OY8A 4YGDA 3E5QA 2RM22 3ZSLA 2X8KA 3JBG1 3WLUA 1I6XA 4E4DX 1EV11 4FTSA 4Q2FA 2W39A 1QXRA 1O5UA 2ZBJA 2VG9A 2WZPP 5C6CA 1PGL1 2YZ4A 4DOUA 5K8SA 3ZXKA 3A4UA 2XBO2 2GALA 2QJVA 3DUIA 3AKRA 5E89A 4Y20B 1N1SA 3NL1A 4EWDA 4K6BA 1AR62 4D3WA 5FO7B 2YY1A 3AYEA 2XLFA 3GBGA 4Y22A 3ZYRA 2FQPA 3TOJA 4GWMA 2XJVA 1QHDA 3JB4C 5D8AA 5JSPA 4IEVA 1HQLA 3ZIWA 4NVPA 3NJZA 1REFA 3R4DB 3B00A 4JVAA 4Q0UA 2PAMA 5J98B 4YVSB 5I0UA 1F9KA 3OBTA 3TB0A 1TE1B 2WNEA 2WNVA 2CWMA 2WZR2 3NO8A 2BUKA 3VBHC 2Q8OA 2R041 3BIWE 2EVXA 1JOJA 2RHPA 4COZA 2GDFA 5H9SA 2RR11 3HWJA 1D4M1 2D93A 4I2OA 5CADA 3AZVA 1ZZ8A 1J3RA 5A3MA 3WR0A 1BEV1 5A32A 2BNMA 3B69A 1GNHA 2C1FA 5GZCA 3HMYA 3WINE 2Z42A 3ILFA 3VZJA 5JSRA 2I2SA 5CG8A 2DWRA 1UMZA 1GYKA 1BBT3 2IWGB 5CNAA 3LCPA 5H9PA 3O7OA 4YG6A 2XVKA 5DUWA 2R061 4Q4X3 1NCRB 3ALQA 2JD4A 2MPFA 4XFGA 3WY6A 2Y26A 5C4WA 1S2KA 2Y38A 4PF5A 4BM8A 4FPCA 3TN91 2ETEA 4FTEA 3QOPA 1NY72 1RUC2 4JDMA 5L7OB 1U12A 2HWE2 4NPRA 1QGLA 3E5UA 1K5MB 3MGUA 3JUUA 2VY0A 4MXWB 1DHKB 1UIKA 1RUE1 4DFSA 3VZKA 2PHLA 3H50A 4XFIA 2PQQA 3FC0A 5D1IA 5FBZA 4M01A 1ZREA 1LTEA 1JW6A 1UF2C 5J09A 3IWZA 3TYJA 3WG2A 3RDIA 4FPFA 1CIWA 1SCSA 1R091 2HWD3 4B4PA 3J8F3 1OSGA 4HETA 5DZGA 1QJU3 4WM8A 3D4KA 3ILNA 1UAIA 1H2NA 2AENA 1ALYA 4ONUA 3PVOA 3VBFB 5KXDA 2O0OA 5JOWA 3B93A 4N7IA 3AXDA 4RQPC 3WZ1A 4B4QA 4L99A 1WMFA 4MLOA 4PQ9A 1LHVA 3KCYA 4Q4V2 1MS9A 4KBBA 5C9AB 2A7AA 5CVRA 2E63A 2AZ5A 5LRSA 1DDLA 4U2AA 3WT3A 1NA1C 4AEMA 4MVTA 2VECA 3MIEA 2GN3A 2JE9A 1VALA 1OA4A 2D3RA 1SLBA 3GZUC 2ZZQA 3MEPA 1AR82 2OUJA 1H4HA 4AFCA 4P14A 1MR5A 2WNUB 1OOPC 4IV3A 2WQZC 3O14A 1MZ5A 4FCAA 4FO9A 4WVVA 1J1TA 4Q4W2 4QQLA 4YW2A 1W6PB 4CEYC 4Q4Y1 4B3NA 2E51A 4LHNA 1A3KA 1V6IA 1R083 1C8M1 4DY5A 1YFWA 1UPIA 1AJKA 5K0UB 1IGOA 5FQ0A 2W68A 2AR6A 2NYYA 3WG4A 4CEWC 1QXJA 4K21A 2ZGNA 5T54A 1YJKA 3PHMA 2V73A 3C3VA 2WFPA 4BOWA 1KDMA 4MGKE 2ZKNA 1F8VA 4DZGA 1S55A 3ZO0B 5FLHA 4MZUA 3VHRA 4H7LA 1H9WA 1QJZA 2EIGA 3OBRA 4GB32 2PHXA 2Z79A 1QDOA 4ASLA 2Y0IA 1CN1A 4RL7A 3AKPA 5CFDC 4YVSA 4R4ZA 4CDQA 2XG3A 3ZYJB 4B7EA 3D6EA 4CDWB 1SMVA 1AR73 4HMZA 1C1FA 2UY9A 3CL1A 4H55A 4Q26A 2XVLA 1LKNA 4GH4C 1YFXA 4P9LA 2R16A 4XJUA 2GC2A 3I2DA 1HXS2 4J6GA 4LO7A 3USUB 1AYM2 1YHFA 2RMU3 2NMOA 4JDNA 2ATFA 5EYXA 1GZ9A 1X36A 2MEV3 2FZ2A 1V9U1 2XJPA 1ULCA 4FPGA 4D7YA 4QQPA 4FPYA 2A6YA 1IZ3A 1X7NA 4JTOA 4BMEA 2HKXA 3SHRA 4HKLA 3V64A 4N43C 4EN8B 4MXVA 1DZTA 2Y0OA 2ET7A 4IEOA 3WW1A 1PZ7A 4LNVA 1DQ0A 2ZZJA 2VW0A 3AYAA 4LE4A 3KT4A 4LUMA 4BHPA 2ZMNA 1YXWA 5EJ3A 3VBRC 3ES1A 1G9BA 1KD7A 4J1XA 1X8MA 3J26N 5FREA 2R073 4AVAA 2PYTA 1JXNA 1ZRRA 3AP7A 4RGGA 2H6CA 3GALA 4QMAA 3FBMA 3M3CA 1RMU2 4QM9A 1V6LA 3IKWA 1RUI2 4R8HA 1BBT1 1OHFA 4S2DA 2PLV3 3O0VA 5I91A 3FJSA 4GALA 4LE3A 4OZXA 4CTEA 1RUC3 3WDXA 1LOFC 2PHWA 1KFXL 5JZGC 4Q4X1 3QCWA 1L3JA 3DPRC 1D2SA 1JTZX 1URXA 3UKVA 1FAYA 1C3HA 4AVSA 2A3YA 1XU1A 2UU8A 5HCAA 3T1MA 2O8QA 4BYYA 1PNFA 2VNRA 5FPXA 3R05A 5CFCA 2QE3A 1FOD2 4JC1A 3E6DA 4FPOB 5C9AA 5KHGA 4BWOA 1LESA 2ZKLA 3AZXA 4R4XA 4Q27A 5F6LB 3WHTA 3B7MA 2QZ3A 4COUA 2UWBA 3ZFGC 5BNOC 4AHZA 2ZGSA 3BU7A 3S7IA 4WV8A 4BZ4A 2JG9C 2WNUA 1REEA 3RNSA 2HWD1 4ES8A 3J8F1 3N4MA 3B9CA 4XMAA 1RGSA 2ZS6B 4XYXA 1I9RA 1WA4A 3VBSA 3KLSA 4E9KA 4BPZA 5L19A 5C8CB 3VBUA 3G7DA 4I02A 1XE7A 4Q1RA 4PCRA 3EQEA 4XXAA 3VKNA 2GAUA 2YPJA 1IS5A 4OUMA 2NMNA 3M4FA 1PO12 3H1MA 5DUVA 5JI9A 2HEYF 1SLLA 3NKTA 3OTFA 1W6MA 1W0PA 3KGZA 5DG1A 2ET1A 3EJKA 3PVBB 1EY2A 4ISRA 4C1WA 1HRI2 2Z69A 4PDWB 4RS5B 4LUKA 1VRH2 2BGCA 3Q9OA 1ENXA 3TAYA 4QX5A 5ACA2 2NP0A 3K51A 4XW3A 5FOBB 2WWSA 2JECA 3EO6A 2WS92 1JUHA 5K9YA 3M3IA 3ZFEB 4M3CE 4PJYA 3ROUA 5GJ6A 1SBEA 3CJIB 1MZFA 3OYWA 4Y5Z0 5J48A 4LBQB 1OFNA 1VP6A 4G3YC 4LA3A 4LBOA 3RZZA 2WL1A 1U5YA 2RS53 3DL3A 3VZNA 4M0HA 2OA2A 1SLAA 3USUA 1MS4A 2ZX4A 2BWAA 4QGLA 2A73B 2BVVA 4MSVA 1VBC2 4WM7C 3VBHA 1CAXA 1RIRA 5GZEA 2B8MA 1CPMA 3FLTA 3O12A 2JDZA 2ZTNA 1ULFA 1KJLA 4OHYA 3LSDA 2ZGPA 4RHV2 4Q8KA 3HD8B 1ND2C 3W59A 2BQPA 4YZ1A 3ZXDA 1LHUA 1ZRDA 3PLQA 1RTVA 3QH6A 4OI2A 2B42B 2B45X 4P9JA 5JLVA 1MZEA 1AR71 4Z2WA 3GNEA 2CGOA 2YMZA 4ITCA 1GBGA 1VAKA 3CNAA 1BVVA 1OA2A 2VOKA 4FXGB 5GM0A 2TEPA 1GSLA 1Z7S3 3OY8B 1CAUB 4XTMA 4XQWA 4IV1C 3E6BA 2RS33 2RMU1 2GNBA 2E6VA 1SLCA 4P9XA 1HQNA 2FZ1A 3AX4A 2D6PA 4CDXC 2UURA 4GWNA 1HW5A 2MEV1 4FSJA 1PZ9A 2WZR1 4S2GA 2RR13 4AFDA 4JV4A 1U5ZA 3IDCB 5FLJA 1DZRA 4Q29A 4XF4A 4LO6B 1W6QA 2OZ6A 4Y22B 5J7MA 5D8AB 4JRAA 3VL9A 4ATEA 3VUOA 1AXYA 1RINA 3IMNA 5AC93 4ASMB 3WQ1A 1NXD1 2OIIA 3NAPC 2D3SA 4QM8A 3SH5A 3WUDA 1TNRA 3LOBA 4LO5B 2ZAAA 4XHXA 1XNDA 4DPNA 4UBHA 1QKQA 1DFQA 4UW3A 4MX3A 4RQPA 4Q0VA 1VAMA 4QGNA 1UZZA 1LGNA 2PLV1 2AUYA 3N3HA 2D6LX 1N1VA 1NY71 1RUC1 1RUE3 4NWWA 5A32B 2HWE1 4LBMA 1NA1A 2JENA 1IKPA 3CO2A 3N7MA 5L73A 3RYKA 3W58A 4XQ4A 1PMIA 1IS4A 4AGVA 5DDJ3 4AEDC 2ZGRA 1PIV2 1R093 1WD3A 3WP3A 4BLIA 5BNNC 3AM2A 1YCIA 1FX5A 4AQ2A 2D44A 1Q8SA 4OVEA 4SBVA 4EWAA 1ENQA 5C4WB 2P3JA 4PDWA 3TNQA 2ARBA 4A7ZA 4E2QA 1KITA 3H7YA 2GN7A 4CEWA 1WMDA 2K9ZA 2Q1ZB 4TYSA 1RVF3 4YGCA 1H9PA 3MLKA 2Q5TA 2DUPA 1B35C 3RPQA 1PO13 1BMV1 4YG3A 2VH9A 3B9IA 1DGRA 4IL7A 1NQJA 1GANA 5E88A 1H30A 1HRI3 3GHNA 1S0IA 1WW7A 2X5IC 5CFDA 1I3HA 4WM8B 2ILMA 3ZFFC 5BV6A 4ZU4A 3SITA 1R1A2 1XYOA 3HBZA 4QXKA 3J9SA 3HN1A 4JDOA 1MVEA 4XETA 3S6PA 1ZBE3 5CBLA 2E7QA 2HWC2 3D8CA 1GKBA 1J59A 3LZZA 1UU6A 4GH4A 2BFUL 3WNXA 4ZU5A 3LA2A 2DCTA 4YNIA 1NE4A 1EAH2 3ES4A 5IK8A 1MS8A 1U5XA 1YO8A 4LT5A 1VBE3 3VDDC 1C8NA 2HWF2 3WW4A 5KHHA 5KXBA 1SLIA 3WV6A 4P9GA 2VPVA 2BPA2 4COVA 3AP5A 4JCKA 1YLLA 2ENRA 2ARXA 2XVGA 2H0BA 4AW7A 3FX3A 4YM2A 4D7SA 1CAUA 1C5HA 1VAVA 3FUQA 4AVBA 4GB31 3SCGA 5ABJB 3MPPG 1F5FA 4N43A 2E53A 4UBGA 1XNKA 3RG0A 1TMF2 1DIWA 1FMD2 1EPWA 2ZHMA 1ULGA 2GH8A 2YROA 3LKJA 2B39A 5FQ0B 1IKQA 2AYHA 3MI8A 3VBRA 3H8UA 4Q0PA 1LHWA 1JN2P 4XJZA 5J3UA 4IERA 1DF0A 1VBA2 1O3RA 1LJ7A 2NPIA 3ZYIB 2ZAHA 1HXS1 1LOBA 1OLQA 1Q56A 1RB8G 5AFBA 3ATGA 2XH6A 1LOEA 4EN6B 2GMPA 3POYA 4FOVA 1UU4A 1AUYA 2JJ6A 1CX4A 1V9U3 2PN5A 1QQP3 4JGZC 1ENRA 3WQ7A 2WA3A 2ZOEB 1PM7A 5HXVA 1Z7S1 1LOFA 1N3PA 2CV6A 1BCXA 1NLRA 5JZGA 1PK6C 2VNGA 4AHWA 3DPRA 2RS31 4GKYA 1WW5A 4BCUA 4CDQB 4F3JA 5J37A 1RUH2 1FI2A 2HEWF 4N9IA 4AGGA 4YFWA 5CA6A 3AKSA 2QFEA 3NVCA 2UY8A 2ZX3A 1ZRCA 4CDUC 2W08A 1HQWA 3WDTA 2WIIB 4YZ2A 1QOOA 3H1YA 5TSWA 1AF9A 2XGXA 2I45A 5GALA 3EBRA 1MQTC 4IEPA 2C5DA 3ZFGA 5BNOA 1MACA 1DQ4A 4E2GA 3MDPA 2IZWA 2QCSB 1ASJ3 1CR7A 4FQ4A 2JG9A 1TNFA 5AC91 1RMU1 2QKDA 1AZDA 2PHRA 4W6WA 3FLRA 1VBB3 4M3CF 3VGIA 4LBNA 4HL0A 4N53B 4C0BA 1GZWA 1LOAA 5FMOL 2VUAA 4XQDA 1WUVA 2D6OX 4IXLA 4IEYA 3WDYA 1YI9A 1OA3A 3K48A 1RL3A 4FPJA 5JPNB 4A3XA 4YGEA 5L36A 1FPN2 3H7JA 1ZVFA 4D94A 2DVGA 2A3XA 3OD0A 3I54A 1QWRA 1RITA 3GZAA 4Z92B 5EZWA 4G9SB 2O8OA 3PJYA 1JH5A 4I30A 2BYVE 2XHKA 3BB6A 5DDJ1 5JR7B 3IPVA 4XF9A 4HZFA 2CWSA 4OI0A 3FWEA 4Q8LA 1AJOA 3FLPA 3ETQA 3ZX7A 4AEJA 1RUG3 2WT1A 1GNZA 5A3LA 4Y1UA 4HVOA 1PO22 1W39A 4Z82A 2BVBA 2GZWA 3J4UH 4EROA 3O5SA 2R1DA 3ZXEA 2GH2A 5CFCB 5FO8B 4AG4A 1IHMA 2BNNA 1CVNA 5T50A 3I7DA 1RVF1 1CGPA 1YI7A 1RUF2 1PO11 1GQGA 4XZPA 1HRV2 1D0GA 1R1A3 2R0FA 2E9QA 3M7AA 4PIXA 3WP6A 1QY4A 2YYOA 4QQ2A 1LECA 4KL1A 2VQ0A 5F1RA 3RMXA 2DCZA 3U11A 1HRI1 4FP2A 4AFMA 2RJKA 4ZU7A 1ND2A 1NOVA 1VRH1 1ZZ7A 2IXIA 4XJ9A 5DG2A 5FLIA 2RS12 1G9AA 1QOSA 2AREA 3FFZA 1DBNA 5ABJA 3VBSB 3CF6E 4CP1A 1EAH3 3GF6A 3VBUB 2HWB3 1ZBE1 1KS4A 4RA0A 1AL22 5I8TA 1V6MA 1LU2A 2WT0A 4XE9A 1BJQA 4I3PA 2IXCA 3D5OA 4HT1T 1SQ4A 3L9JT 4IV1A 1Y7BA 4QPGC 4GQ7A 1W6MB 2CNAA 2WLQA 3JQWA 4QGMA 1VBE1 4KU8A 3S30A 1NLSA 4LHLA 3RJ2X 4AYUA 4HN0A 2RM23 4D7TA 4HSJA 4XBQA 3U07A 3WDVA 4KNCA 4RR3C 1X8EA 1RUD2