1YIPA

Oxidized peptidylglycine alpha-hydroxylating monooxygenase (phm) in a new crystal form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
311
structure length
311
Chain Sequence
NECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Catalytic Copper of Peptidylglycine alpha-Hydroxylating Monooxygenase also Plays a Critical Structural Role.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
total genus 63
structure length 311
sequence length 311
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yipA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 1yipA01
1YIPA 3PMSA 1PGSA 3MIGA 3MIDA 1SDWA 3MLKA 1PNGA 3PHMA 3KS7A 1YI9A 3MLLA 3MIEA 3MLJA 3MIFA 3MIBA 1YJLA 1PHMA 3MIHA 1OPMA 4R4XA 3MICA 4E4ZA 1YJKA 4R4ZA 1PNFA 4QHBA
chains in the Genus database with same CATH superfamily
3HAGA 4JGZB 1S55A 3RNSA 3N7KA 3RSJA 3HOBA 1GFF2 2VPVA 3K2OA 2VH9A 4HVQA 1S0EA 1ULPA 2UYBA 3M3EA 3NVCA 3MIDA 1RUF2 4E8DA 4CUCA 1UYZA 2GNDA 1LOBA 3HT2A 4QX7A 1E5SA 1JHJA 3ZSMA 3A21A 4JHTA 4MGYE 4OFGA 1DGWA 1KQRA 1LGCA 4ISQA 2R0FA 3LFIA 2R073 4A2UA 1RUG3 3EJKA 4YW7A 1MZ6A 1HRI1 3BOWA 4BB3A 1YHFA 4OHWA 4EQVA 1K45A 3UKVA 4O9EA 2RS51 4N8MA 3FN9A 2PTMA 4QPGC 3ZLIA 1ZZ7A 1UYYA 4LO4B 2OW4A 1NXMA 4PLOA 2W9XA 4PDWA 5HBAA 1IS6A 4Q4V3 2VTXJ 4ZU7A 3ENRA 3LZZA 4FXKB 3GBWA 2QUOA 2BGPA 2VU9A 4H7MA 3KSCA 3FL7A 2AREA 1RUH1 4R9AA 2JD4A 1ZRRA 2QTWB 1JYCA 1TME1 2DBNA 3LEMA 4DY3A 1VB2A 1QJFA 1X36A 3BTAA 1S0CA 1J84A 1WBFA 4YVWB 2RDNA 2XJPA 4W8JA 2WO2A 3B69A 2VZSA 4AE2A 5J48A 4QM9A 4ZONA 3WNPA 4LMFA 4CA9A 1POV1 3GALA 4A4AA 2VD7A 1KEXA 5L73A 1JMUB 3RJ2X 1L3JA 2Y26A 3ST7A 5CKQA 4CCNA 4L9BA 4HMZA 4CDQC 2VXJA 5CIRA 4BQ2A 5A6XA 3ZYJB 1OH3A 1O4ZA 2GN7A 2RS33 4I0WB 4XC9A 3OEAA 1WA4A 4AVCA 4DNYA 3FHIB 5IFPA 3WP6A 2VZRA 1WD4A 2W95A 4YG0A 1R64A 3MW4A 3OG2A 4RN5A 2YU1A 3VL9A 4Z1VA 2ARXA 2CAVA 2YPDA 4NRMA 1F9KA 4QPWA 3WNXA 4AAPA 4IESA 1W2AX 5KHGA 1QQP2 3MIFA 5A6YA 2LW8A 2WNVC 5FJHA 2QVSB 4IV1B 4Y22B 4KMQA 4AFDA 2YY1A 3DPRB 3MW2A 3PL0A 1H0BA 5GLTA 3VUOA 2YV8A 2D93A 2ZHMA 2P5BA 5I0RA 4DIQA 3E5UA 3FJSA 1V6JA 5FZ7A 2IXKA 3GBFA 1WW6A 4LIUA 1VP6A 4XQ4A 5FZAA 4F3JA 1ZBE1 4NOTA 4Q8LA 5FYSA 3M8LA 1SDWA 4MZUA 3I59A 4W6WA 1B35B 1D0HA 4XBQA 2EIDA 3I2OA 4A3ZA 1NZCA 2WWJA 2JDHA 4A41A 1DCSA 3ZSKA 5FY5A 2V09A 2R072 4FFIA 4FPFA 3VD5A 2MEV1 3N9MA 2Y0OA 1D4VB 4QX8A 4LKSA 3VBRC 3ZM8A 2JE9A 1ZRDA 4Q0PA 2YB7A 2GH8A 3DV8A 3WLUA 3O1UA 1RUF3 3ZIXA 4L11A 3FHQA 1HJFA 1LHNA 2D98A 3LDKA 2P6HA 2D6MA 2Q0AA 4N43C 4XF9A 5T3NA 5FUIA 3LPFA 4CDUB 3V0AB 3CL1A 2NP0A 2VCCA 1ZRCA 4HK8A 3H1WA 4FPJA 3SH4A 1POQA 4DXSA 1ND2C 3POBA 3WW4A 2PLV3 2I45A 2LALA 4LBJA 5ISLA 1HRI2 3ME2A 1NZIA 2PN5A 2VZVA 4O61A 1O4TA 2ZAAA 4QB6A 4XDQA 4YFWA 2NZ9A 5GLVA 4AI0A 4LR4A 3NJZA 4QB1A 3WP3A 3USSA 2E6VA 1WMEA 4FFGA 1EPWA 3Q9OA 5C6CA 1LHWA 5JPNB 4D7TA 2AENA 1ULGA 4IDZA 4XTPA 2LS6A 2D6PA 4YGCA 2VQUA 1A6CA 4DUXA 1REEA 3SEPA 5FMDA 3ETPA 4RR3A 1WCSA 4P9WA 4XMAA 5EFUA 4YG3A 3THCA 1RXGA 1VBA2 2V4AA 3ZYIB 1OVPA 4XJ9A 2J1RA 1MS1A 3ZIWA 3PNAA 1ZZBA 3WR0A 5HCHA 1NY72 3AZVA 4FOYA 2FZ1A 4P5YA 4OI0A 2VMIA 1SFNA 4JC1A 4PJYA 4IGQA 1OURA 3A22A 2GDFA 2ILMA 1WUVA 5IAVA 1YC61 3JQWA 1PZ9A 1UX6A 1WLDA 3ZFEC 4AFCA 4XFHA 5FPXA 1UN1A 3EO6A 5IWFA 3FMGA 1W2OA 1QJY2 4AFBA 2PHFA 1SBEA 2EIEA 5AFEA 5T55A 1Q3EA 4I30A 1TME2 4XOGA 1F15A 1FNZA 3DEMA 4A3XA 3DKQA 3K3OA 2PHTA 1QU0A 4S2FA 3DUIA 1FX5A 2YGMA 1E5HA 2J1UA 2OPKA 2VOWA 3E6BA 5AVPA 4EN7B 2BFUL 3H8RA 1XSQA 4BMEA 2ZHNA 1QQP1 1GNHA 4RGKA 1UYXA 2BOIA 1EV11 1J58A 2RV9A 3LDBA 4E27A 3CJIC 1SPPA 2PHLA 4CP9B 5F2WA 2CYFA 4M3CE 5DQ0A 1SPPB 3GJBA 4CP9A 1V0AA 1IQDC 1LULA 1ODNA 1ZBA1 4RL7A 2VOXA 2NMOA 5CISA 1V6KA 2P37A 3J7LA 4R9DA 3GHNA 5A3MA 1UMIA 1JYIA 2ZGQA 1SBDA 4BH9A 5JXJA 1OF4A 4MYEA 1WZXA 4D69A 1XU1A 4JKKA 4ZS2A 1SMVA 3OGGA 3EXUA 4JVAA 4AI9A 2WIIB 3NW4A 5F7UA 4Z82A 2R043 3WG2A 5F1RA 3ILRA 1A8MA 1OT5A 3B9CA 2MEV2 3B00A 1GR3A 1C8M1 2WS93 3M70A 4AAXA 2JKXA 3J9SA 4XURA 3NV1A 3VDDC 4PLNA 2I74A 4CCKA 2LM3A 3WX5A 3P6BA 1UAIA 5LEJA 4BYYA 1MS3A 1CAUA 3ZXKA 4ASLA 1AR62 1OHFA 4EWDA 1RUE1 4W50A 1MS4A 2D3RA 5J98B 5T50A 4MVTA 2W87A 4AHYA 4AI1A 5JAXA 2UU8A 3GCXA 5ABJC 3QCWA 3CF6E 4IUGA 1UW8A 4CDWA 2DFCA 1UIKA 2XDVA 4Y5SA 2ZBJA 1MS9A 3WG1A 2PXJA 5CEHA 1PHMA 4C90A 1F8VA 1ZZ8A 1KJRA 1UNBA 1JZ6A 2HEVF 2BVBA 2Q4SA 1O4YA 3BU7A 4PBOA 1JH5A 4RFT0 2QDRA 1WW4A 4GALA 3VBFA 1UZ0A 1DIWA 4KWJA 2WFPA 3I8TA 3VZLA 5DUVA 2XL9A 4FQZA 3NJXA 4Y20B 3TWIA 2DTWA 4E4HA 3V64A 2VCAA 2BGCA 4Q0SA 2A3WA 1YEWA 3W20A 1S0IA 2WR9A 3O1VA 3P5BA 4JKLA 3NRUA 5CNAA 2MEV3 1OD3A 3PVEA 5B4NA 1QH6A 2HLEA 4RS5B 4IV3A 5A3TA 3IZOA 2HWE2 2E31A 2YBKA 5IVFA 4NMIA 4UWDA 3WW2A 1VR3A 3PTRB 4XABA 2ZZQA 2FBEA 3OGRA 1I1EA 3PU3A 4Q0VA 1K5JA 2MNGA 1U5XA 2P3KA 1JUHA 3GYDA 3JU9A 4WVZA 1OBNA 5J3UA 1ZNPA 5T5JA 1MZ5A 2VOTA 5LBEA 1VAMA 3O12A 3BTXA 1XNBA 4XFAA 3OSDA 1BLZA 1O5UA 2A6VA 4K20A 1SBFA 4D0QA 1PIV1 1HV1A 5F5IA 5H9SA 1PIV2 1OLQA 1ULEA 2GH2A 4MGKE 4UFJA 5H9QA 5BNNC 1AL21 3U75A 1VB4A 1WD3A 4PT6A 5A80A 1RC6A 4N43B 4QPIC 4HKOA 3WDTA 5FMCA 2AYHA 3DYOA 5EJZB 4FAHA 4QKFA 4FI9A 1N1VA 4MXWB 1W9YA 5LB6A 5L7OC 1JZ4A 3PIJA 5A3OA 2UY9A 3PUHA 1MS8A 4XEZA 1UXXX 2NN8A 4Y5Z0 2YFZA 4E8CA 4MOAA 3IB3A 3ZR6A 2W1QA 4EZHA 1VBB3 1NYWA 5E8AA 4HPKB 2WFF1 4QHBA 1SCSA 4HPKA 5D1IA 1RUH2 5BNQA 1GV9A 3KWVA 4D3WA 4FTEA 1QDOA 2BPA2 1W6OA 5FYUA 3VBUA 4LNVA 1W6OB 3JQXA 4C1WA 3FUOA 3NAPC 2WZEA 3NJYA 1NA1A 1QOSA 2D7FA 3OYWA 2D6LX 4XJAA 3WHUA 1QJX1 3O0VA 3WDXA 1HQLA 3CJIA 2CAUA 4JGYC 1QWRA 4MLOA 4AGGA 4NIAA 1UY4A 1PMIA 1XBFA 3TNQA 3FLPA 3J8F2 2GU9A 3HNMA 1I9RA 1AUYA 2HJIA 2VUAA 1HRV1 1MR5A 1UZWA 4KWUA 3VN4A 3ZVXA 1AVBA 4YW5A 1Q8QA 4YZ4A 5F6LB 3VBHC 3FUQA 2VUJA 2F6BA 5H9RA 1R082 2ZKNA 4MHUA 4QDSA 3M3QA 3ZYFA 4RGGA 4NRPA 4NAMA 1BJQA 2Y6KA 4DS0A 1JU3A 1OOPA 1UY2A 1WCUA 5C8CB 2R063 1XNKA 2AC1A 1AYN2 3S6PA 4IQPA 1D2SA 4GMP3 3V56A 3OUHA 4I02A 1HRI3 5A7SA 3LF7A 3MLLA 2CDPA 1LOEA 2ORXA 3I2JA 4CDQB 5K0UA 3DECA 3W58A 2QQJA 1APNA 4AYUA 3AVSA 5ERLA 1UX7A 1FPN1 2DUOA 2DCJA 4OZXA 4Z2AA 5C3RA 1DU3D 1FMD2 4R4ZA 1SLLA 1ZBE2 2AGSA 1LHUA 2A71A 4AFMA 2QZ2A 5FUNA 5F6KA 4HSJA 2Q8DA 3FBYA 4B7EA 1BEV3 3ZYGA 5C3OA 4AEMA 3DYPA 2HKXA 2EA7A 4OZOA 1LEMA 3POEA 4GMP1 4HLTA 5GLWA 3APBA 4GD4A 4CDUC 1V9U1 2WO7A 5FZBA 5JOWA 3VDAA 3MLKA 1AR93 5JZGC 4YVWA 1LOFA 2YMZA 4ARXA 4Y1ZA 5LA0A 3RZLA 1F31A 3AP6A 4HVRA 3VHRA 3K77A 3NWKA 1VRH3 5FOJB 4K3UA 4Q26A 2EXIA 2BU9A 1RVF3 1WCDJ 3NL1A 4Q4X2 3HEIA 5C8CC 5C9AA 2Q30A 1JYXA 2HWF3 5FZDA 3U10A 4DY5A 3IBMA 4HN1A 1K12A 2FCVA 3ASIA 1Y9GA 2YUEA 3H1YA 2KD7A 3WQ1A 1BXHA 1UPIA 4BK4A 1C8NA 1UY1A 5DPNA 4AWDA 1XNTA 1GOFA 1I5PA 3FBMA 1W6PA 3OJBA 4KNCA 3SKJE 5C3SA 1CJDA 1W2UA 2H0BA 1T6GC 1A34A 1XNCA 2ZGTA 1Q8PA 2PYTA 4H3WA 4GIQA 5JIAA 4EE2A 3DPRA 3MIHA 4BISA 5LCWL 1UZZA 1UKRA 3TOJA 4F8AA 3N9LA 3CIHA 4IW3A 5JMOA 1UY3A 5IFTA 3ZFGA 5EJ3A 1XXNA 2D5HA 2PELA 3BOPA 5A32B 4RQPC 1Z7S3 4YFZA 1AR73 4QX1A 1PNFA 3RZHA 1QIQA 2RS32 2ZGKA 5BNOB 1GLHA 1H6YA 2W92A 3LB9A 1H9WA 5JWPA 2OPWA 3IN9A 2XJSA 2J42A 5FFOC 3BTYA 1U5ZA 1NQDA 3CJXA 1SLBA 2HWB1 3UJOA 2IVJA 5JMCA 1O8PA 2ZMKA 4LBLA 4YM2A 3VKMA 2K9ZA 4AEDB 2FDHA 2GC2A 3I59B 3SC7X 4A7KA 5FZIA 2ZX4A 3AYEA 4QGLA 5A33A 3DF0A 1JZ5A 3KT7A 3CKHA 5L7OA 1W2TA 4LA2A 5CG8A 4CDXB 2VUDA 5KHIA 3ZN5A 5JOXA 1WW5A 3AMQA 5FZ4A 5A6ZA 1OF3A 3VZKA 1CWPA 2MPFA 1YQ5A 3MO4A 1VBD3 4MGZE 3WUDA 1FOD2 4Y1YA 4Q4V2 1R081 3J4UH 5A70A 1WKYA 5DAQA 2DV9A 3RWKX 3GDBA 5I0TA 1NUKA 4PDWB 1LR5A 3S5QA 4IEWA 3V0AA 1OXCA 2DCKA 4BU2A 1ENXA 5ACA2 2L9LA 1TMF3 2RDRA 3WQ7A 1CIYA 3E6CC 1DZRA 1TNFA 4LA3A 4RS5C 3U07A 4BZ4A 4COUA 3AMMA 1O6UA 1EAH3 1QKQA 3T0AA 2W91A 1GU3A 2F4LA 1W8OA 3D5OA 2ADEA 4BWOA 2Y38A 1S2BA 5FMOS 3UV9A 2OUHA 3H7YA 2VZQA 1CVNA 5CA6A 3HT1A 3VV1A 4Y24A 1HX6A 2BZDA 3ILNA 1N1YA 1JUIA 4RHV3 3D0SA 1HB1A 1J3QA 4BOWA 2FDJA 4BQ3A 1FV2A 2DTYA 1SEFA 3KD4A 5HPOA 4FPOB 5FK8A 4CUGA 2WT0A 4BHPA 1W9SA 2XQXA 2CGNA 1WCQA 3O5SA 1QMJA 2VZ3A 3OGSA 5LBCA 2XLFA 4A6SA 5CVRA 1K3IA 3KF3A 5G05L 3KS7A 1Y7BA 5GZFA 4OI2A 3M2MA 3USUA 5A6QA 3WNKA 2WLQA 5IVBA 4DOUA 5K0UC 3ZN6A 5JR2A 1CAXB 3VLBB 1HN1A 1WW7A 2XWJB 1CAXA 2R041 4ATEA 2ZEWA 3A23A 3WG3A 3OBTA 4CP1A 1RUE2 4WVWA 4GXLA 1AR61 1AF9A 1B35C 1LOCA 4W65A 1RUH3 4CCDA 4AQ2A 2RM21 4OI4A 1YQ8A 2XBO1 2ZA9A 3GZEA 1BMV2 3POWA 5JCTA 1OKQA 3AP5A 4DFSA 4CTEA 1KS5A 4Q4Y1 1PGSA 1RUD2 4QX3A 5CFCA 4NIDA 4NHKA 5JLVA 2XLGA 2EXHA 1LESA 2GC0A 3K4AA 5IHRA 1GZWA 5JSPA 5C3PA 1LOFC 1QJU2 3NO8A 3N9QA 1FT9A 1YQ2A 3GZAA 4FFHA 3M3OA 3N7JA 5BXXA 2BWCA 3UL2A 4AL9A 5DAPA 3U0ZA 2GSYA 4NWWA 2ZAHA 2YZ4A 3AMPA 3LA7A 3E1F1 2DU1A 3NNGA 1PIV3 3D4KA 1FYUA 2XJVA 4PHZA 4HKWA 2ARCA 2VCBA 3RDIA 4UBGA 1SLTA 2ATFA 1C28A 3TAYA 1D2QA 2XUEA 2NLRA 1UQXA 2QCSB 2WZR2 4Y3OA 2RS12 1L7LA 3BPZA 4LHSA 1UXZA 1GICA 1I3HA 2RM22 5HXMA 4FTSA 2JEMA 2FDKA 3T08A 1JXNA 5A3PA 2KA3A 2ZABA 2D3SA 1GUIA 4P9GA 1JYVA 2JDPA 2HWE3 3W5NA 3PDQA 5FPVA 4MHRA 4PCRA 1JBCA 2KM2A 3VDDB 3WZ1A 1JYTA 1QXJA 1X9TA 3ORJA 2XL7A 2R061 4X6RB 1XE7A 5FYCA 5BNPC 5D21A 1NCRC 3FLTA 1LU2A 3OCPA 3WNLA 2ZOEB 1VLNA 3GZTB 3RVHA 3J8F3 3ZFGC 5EWSA 1W3VA 3ES1A 4GJZA 4YGBA 3ZO0B 2ET1A 4B4PA 3ABZA 2GC1A 5FRAA 5LRSA 5C71A 1JOPA 3W21A 5IT6A 4XUNA 1YYNA 4JDMA 2Y6FA 5JR7B 4PQQA 3H50A 1YQCA 4RYDA 4PIZA 5GZCA 1QJX3 3J7MA 1F2NA 5HV4A 4WVMB 2QQLA 2HBUA 4O9GA 3T0BA 2D97A 3I2HA 4KH9A 2GNMA 2ET7A 1XYPA 4WM8A 3RZMA 1PNGA 5FXVA 5HCFA 4IE6A 5F3GA 1OFNA 1V9U3 5A1FA 1VMHA 1EUUA 1ZZ6A 2AR6A 3R4DB 3ROUA 4AVVA 4DINB 1WMFA 5FP8A 1LEDA 1W06A 1QDCA 3NAPB 2V4VA 2VGDA 5E88A 1POV0 2A3XA 5C5TA 1ZRFA 2GNBA 4BE3A 3AB0A 3AKSA 4Y4RA 5IK5A 4XUTA 1DQ0A 2V72A 3IAPA 2HWD3 1U5YA 2O8OA 2WN3A 4GULA 1OQ1A 1PMJX 1IQAA 1CZSA 3DCQA 2O0OA 4KG8A 2IXHA 4KBZA 1JOJA 1MS0A 1W8NA 1LNSA 1US2A 2A1XA 3POYA 1CN1A 2Y0IA 3I2GA 4AHWA 2FMYA 3NNFA 1C8M2 3ZYPA 4RS5A 3VKFC 2Y33A 2ZS6B 2DVBA 4PI2A 5F39A 4E2SA 5JSRA 4YVSC 2R042 3MW3A 5B2GB 4IV1C 4MGQA 3VBSC 4CCJA 5BPXA 4NPLA 1OVSA 2C9AA 3RGBA 4PF1A 1DZQA 1SZBA 3VBFB 1P8JA 1OC1A 3MYXA 5J1XA 4IGPA 1GQGA 5F9TA 1N1SA 1SCRA 2XB6C 4QU1A 4HXCA 1AR81 1GQHA 4PIYA 1BK1A 3HIFA 2EXKA 3UGGA 1REFA 3MFCA 2XPJA 1HRV3 4QQPA 4UAPA 5BNPB 1NCQC 3JB8A 5FP3A 4MGTA 4XHXA 1SFPA 4XDPA 4XW3A 5L9VA 2OS2A 3PMEA 2AEYA 1ZZ9A 1W9FA 4RA0A 4QX5A 2Q1ZB 3FE5A 3MPBA 2AH2A 4AEJA 3JD71 1W28A 1FPN2 2ZX2A 2B9UA 2KXLA 3FX3A 3J26N 3JD72 3AZYA 3TB0A 4F7ZA 4Z2WA 2FDFA 2RR12 2WZR3 2DVGA 1F35A 1U12A 4BIOA 3C3VA 4KG0A 1YJKA 2O14A 2YGLA 2ZEXA 4H2AA 4Q4Y2 4YW3A 4BLIA 1IGOA 4YYOA 4LO5B 3ACLA 1V9U2 3R4UA 4JDOA 1V70A 4XQWA 2BOJA 1Q5OA 2C4XA 4BCUA 4IEZA 2XKPA 3OOXA 1DYPA 4Q29A 1AR82 3ZSLA 4LO7A 1S0JA 1QJU3 2JJ6A 4ES9A 3L9JT 1AYM3 1ZRIA 1NA1B 3KCCA 3GXUA 4GH4B 1FATA 3I2KA 3LE0A 2E51A 1V6IA 2JENA 4YW2A 1G9CA 5SV8A 1AX0A 1QXPA 4ASMB 2TEPA 1VBA1 3KT4A 1KDKA 2CGPA 1FXZA 5I0SA 4LBKA 3MF9A 4CUAA 4ARYA 1EAH1 4RQPB 4XIOA 2XBO2 1BMV1 4IGOA 4BQ1A 2UY8A 3AYCA 5IVCA 1RB8G 2J1AA 2HWF1 3UNPA 1W8ZA 2IWGB 1S0FA 4S2DA 4INDA 5LASA 3ZFFA 4CPBA 1ND3B 2BW8A 4LE4A 2DVFA 1YI7A 4PDWC 3RYKA 4URAA 3WW1A 3ES4A 5C3QA 3IWZA 1PM7A 5A7NA 3V65A 4DXZA 3VKNA 4Y33A 2G19A 5JIUA 2QQKA 5K8SA 2A75A 3I49A 1VMJA 2J1EA 1SACA 1XQNA 4PIXA 4XFFA 1OD5A 1YLLA 2D43A 3CEWA 3HQXA 3W5MA 4LBOA 5H9PA 2JX9A 2YC0A 2ZKLA 3KHBA 5E1RA 4BA6A 3ILFA 4PQ9A 4AI2A 5LBFA 1S0DA 3ZYHA 2W3JA 3ZYRA 2VMDA 2WZR1 2XVLA 3D0JA 2HWB2 1J3PA 1D4M1 1EAH2 1MEC1 1IG0A 3ALQA 1PZ8A 1Z7S1 1T6BX 3KGZA 3NNLA 1GSLA 2FHRA 1W04A 5DAXA 4A6OA 4CDQA 5L36A 3O1MA 2Z5WA 2C9KA 3HBZA 3J8F1 5A3WA 3WNMA 4UFIA 1LODA 1QJY3 1C1LA 5IK8A 2E53A 5JVVA 2W5FA 3MZHA 3M4FA 1ULDA 1SLIA 5LK5A 1TZOA 3RPQA 5FO7B 3PJQA 2WDBA 3AFGA 1FOD3 1KS4A 1KXGA 1RMU3 3VZOA 4IE7A 4K8RB 2TNFA 3AKPA 4CCLA 4FPCA 4CU7A 4IE0A 2FD8A 1F5JA 1YWKA 4GH4C 2PHXA 4TLGA 2ADDA 4CP0A 1RINA 4AGRA 4J1XA 3ZKUA 1HB3A 4RR3C 2ZX1A 3O7OA 1R1A3 4E2GA 4GWIA 5DZEA 1H2LA 1MQTC 3HMYA 4DMIA 5DMYA 4W6XA 5CFDA 3VBUB 5A3LA 3O14A 4XXPA 4NROA 1CZTA 3KV6A 4XJUA 3N3HA 3HNYM 1UU4A 3S30A 1GZ9A 3E5XA 5JXIA 2WC2A 1DGRN 2W08A 1ULFA 5HXVA 1YRZA 1CAWB 3KZ4C 3TEXA 3VBSA 4AOCA 2A5ZA 5FYZA 2RDSA 3FHAA 1J83A 3ZFGB 1UOJA 3BCWA 4UXAA 4GA9A 3WCRA 4DEQA 2BERA 3CO2A 3ZSJA 4AW7A 2J1TA 4XTMA 1COV3 1VE0A 1XSRA 4NHLA 5DDJ2 4QQHA 1IPSA 1AR91 3C7OA 3GNEA 1V00A 1VBE1 1NCQA 1TMF2 1XJAA 5C4WB 2JG9B 1NCQB 5D8AC 2YXSA 4CRQA 3QOPA 3EMRA 3PUQA 4Q4X1 5A33B 3PVNA 2DUQA 4NJ4A 3AK0A 2XLAA 5FYMA 2XKOA 1R1A2 3G7DA 1UCXA 2ZEYA 4NIGA 1O3SA 5FPAA 1VBD2 1PX4A 1NG0A 2SBAA 2ETEA 1IZ3A 1VBD1 1JHNA 1HN0A 1ND2A 4UW4A 3VHOA 4NIIA 1RMU2 4N7UA 3BVCA 5FYTA 4JTNA 2CHHA 3RYPA 4QX0A 2HWF2 1BHGA 1C5IA 3PUSA 3SNMA 1W0PA 2VNOA 2VBBA 2VG9A 5EZWA 1H4HA 3B7MA 1NE4A 5F3CA 1OA4A 5LEKA 3HNBM 1UZVA 4YLZA 3WUCA 5KHJA 2Z42A 5KC5A 4FOWA 3WW3A 1XNAA 1JZ2A 1GWLA 1N47A 3VBRA 2IXIA 2JICA 3PUIA 1IKPA 1QJEA 2UYAA 1WA6X 4XXAA 3WHTA 5F2SA 2W68A 4QXCA 1AL0G 1VALA 2RR11 3SCFA 4BIFA 2X10A 4P08A 4YNIA 4O7XA 4P00B 3UGHA 1PZ7A 1M4WA 2WA3A 4LO6B 5A7OA 2YPJA 3ACFA 4CXYA 4J1WA 1UO9A 4IEVA 1FMD3 4QAWA 1GANA 1KRIA 2C24A 1VBC1 3K48A 4K21A 4YW4A 3OUIA 3VZJA 3WF1A 4NUBA 4UYBA 4EROA 5KR7A 5FZ9A 4XAAA 3LEKA 1K5MB 2HWC3 2A3YA 3OPZA 1EUTA 1OQEA 3IPVB 3UGFA 4ATFA 4EYUA 3RWNA 2X09A 1YNAA 4QQ2A 1AYN3 4IERA 1UKGA 1JYWA 2R062 1RUI1 4WVVA 3O1PA 1W8HA 5E16A 3F95A 2VR4A 2UWAA 3DGTA 2NMNA 1HQWA 4CSWA 1UZYA 2OIIA 2YROA 4UFLA 4TZDA 4BK5A 4QMAA 5FYYA 4NAOA 3QD6A 1OLMA 4CE8A 1DP0A 3BN6A 4UW6A 3CU7A 1DLLA 1DDLA 2W39A 5FPLA 4F83A 1Y43B 1QF3A 4IEUA 4LTAA 4N53A 2DUPA 3POIA 4RR3B 5FY1A 4XAEA 3GF6A 2PHRA 2JDMA 1S1AA 1HXS2 2PAMA 1VBC2 1VPHA 2B46X 5K9YA 2X5IB 2TBVA 5FZ0A 3ZFEA 4Y4YA 3WDVA 4XUOA 2B4KA 1CGPA 3WF0A 1LRHA 2AZ5A 3S7IA 4OCTA 2UURA 2C6SA 3MIBA 5FZ8A 5LA1A 2K2SA 1S2KA 3CBNA 5DAVA 3RMXA 3WY6A 2IVIB 4RHV1 3VD4A 1RUI2 2ZGUA 3NSTA 5I8SA 1AZDA 4CPBD 4AR2A 3PTYA 2WJSA 3UYJA 4ZKTB 1W8TA 2FCTA 5DDJ1 1O59A 5FO8B 1K42A 1BK0A 3NV3A 4FP2A 4X6QB 2Q5TA 3AJZA 4H14A 2V5DA 2SLIA 3AZZA 1RIRA 1PX3A 5KXDA 2WNUA 4GMP0 4FP3A 5DUWA 2YYOA 3AP9A 1X33A 1PVC1 1FMD1 4YZ3A 2AACA 4Q2FA 3WDYA 4P9XA 4OHXA 1MS5A 4ZS3A 4UF0A 3N7LA 5FZMA 4BXSV 4YSFA 1H8VA 3ZDSA 5C70A 5KWRA 3PVOA 3RQ0A 3LOBA 1PM4A 1ZX5A 1GOGA 5DXDA 5FYVA 1AR71 2DWRA 3KVBA 2VW2A 5K7PA 5KHKA 5IAXA 2ZMLA 2C5DA 4Q0UA 4QT6A 4U2AA 2ZGLA 5L9RA 2A6XA 4EV0A 3KLSA 3CMGA 4P02B 1A8DA 1JODA 2R49A 1PVC3 4FXGB 3SCGA 2ZTNA 2WAAA 3N4MA 3R6SA 4L2NA 2CV6A 1RXFA 3BB6A 3VGIA 4FFFA 2EICA 2IC1A 1GWKA 3MDPA 2HBTA 3C7FA 1CJPA 1XOYA 2BVVA 4XZPA 2OXBA 3GGLA 1C8M3 2WS91 3PUAA 3OY8A 4JCKA 3VDDA 4ES8A 4WM8B 5FCCA 5FLJA 3MV01 3O1RA 1H1AA 5GZGA 3RI9A 2P1BA 4XF4A 3HR9A 5GZDA 3K75B 4BXFA 1COV1 2F4PA 2DCYA 1BQPA 4AFAA 3ZN6B 4YARA 1BVVA 2GP5A 5CADA 3O1OA 4B7KA 4W4ZA 1NE6A 5I8TA 4OHVA 5ABJA 2EF6A 5FXXA 4AVSA 3VKOA 2E7TA 4WVMA 4P9IA 1JI6A 5CU1A 3Q8BA 2R32A 1XYNA 1OOPC 2H0VA 1GZCA 4LITA 4LIVA 1Z78A 2JDAA 1E5IA 2RS31 2XXZA 4Q4Y3 4WV8A 3HBKA 2XJUA 2Y6JA 1R1A1 1UOFA 3POFA 1O91A 4IEQA 5KXBA 4XJZA 4LOSA 4QKDA 2OA2A 3RI8A 4FOQA 3AX4A 4HG6B 1W9TA 3V0BB 3OF1A 4EN0A 3J7HA 5EIYB 4QPIA 1W39A 3WP5A 3V0BA 4CDXC 4YZ5A 4FTBA 2JB4A 5FWJA 2VZ1A 3N9PA 3LEGA 1KFUL 1DQ6A 5FV3A 4WM7A 3EYPA 4MV2A 1TE1B 5DN2A 2W47A 3ACHA 4GB32 4YW1A 4IV3C 3T2PA 2JDUA 4GB33 2RHPA 3JBG3 1AJOA 1F5FA 1X8EA 2WFF3 4ISRA 2D6OX 4ONUA 4U36A 3VD9A 5BUVA 2R6QA 1JZ7A 1M06G 4J6GA 3P3PA 5LRRA 4YVWC 1W0NA 2K0GA 1H8TB 3I97A 4OQ9A 2A7AA 1L7RA 3LIHA 4M0NA 4BLJA 1PK6B 2H6BA 2WQ4A 2PHWA 4NRQA 2OZJA 4FPLA 4KU7A 4M3CF 2JG8A 3VBUC 4WZCA 4A7ZA 1QNWA 4SLIA 3ZX7A 5C9AC 4TLFA 1O8SA 1H2NA 1TEIA 2IUWA 2WYSA 5FZHA 5M0TA 2LUWA 2RVAA 5K4LA 2QQVA 3I3DA 4HSLA 5KXEA 5FOBB 1HKDA 4JGYA 1I5ZA 1HXS1 1OUSA 3LA2A 4OUEA 4AVAA 2VOVA 4TTGA 3ZMOA 4YG6A 2UWBA 1DQ4A 2E33A 1AYM1 3JB4C 2Q8CA 3SHRA 2YDEA 2VZTA 3RZZA 2OUJA 4LJHA 1JTZX 3AP4A 3VBHA 2RJ2A 5JSOA 2BRTA 4DQAA 3HVDA 4UBHA 2W52A 3WV6A 3H42B 2PLV1 4QM8A 4ORFA 3D8CA 4XPVA 1C1FA 3OBRA 3M3CA 4S2GA 1N3OA 1SLCA 1XNDA 4OUMA 4E4SA 4RQPA 1BZWA 3E6DA 4LLFA 3G6JB 3NAPA 4BQ5A 2WBKA 1G9FA 1NA1C 1G86A 1YXWA 2DVAA 4BQ4A 3Q8AA 5LZ6A 1JZ8A 2CWSA 3WSOA 4Q4W3 3IT8A 1TQ5A 5FZ3A 4GWMA 2LRPA 1AXYA 4M4PA 2VW1A 3GHMA 2WO1A 4XCBA 4YGEA 3MBWA 3AYDA 3OGJA 4LQRA 3ITQA 2NPIA 4AQ6A 3AXDA 5I8YA 3ZFFB 2VQ0A 4QDRA 2XG3A 5FKCA 4CEWB 5KC6A 5IW0A 2ZACA 4FPYA 2HYXA 4COZA 1W05A 4HONA 4IV3B 1AYN1 4XYXA 3N9OA 4AI8A 5T5LA 4YM0A 3SH3A 4EN8B 3LD8A 4YPJA 4GZ9A 2JD9A 2W94A 3MEPA 4AK3A 2WNOA 4XFCA 4B1MA 1VBE2 1TNRA 1LHVA 3WNOA 5C8CA 4QGMA 2RS13 4COVA 2IXCA 2EIGA 2X53S 3IDEA 5FZ1A 3T4VA 5EQUA 5HI0A 2FZ2A 4IE4A 4D6QA 1TME3 4XETA 1XE8A 3IIIA 2HWD1 5A1LA 4MGSA 1MQTB 2VVDA 2DFBA 4M00A 3U4XA 5T5OA 3T3YA 3LPGA 2HWE1 4MXWA 1HB4A 3AP7A 4JAAA 3S7EA 4AEKA 2V5YA 4AHZA 5C9AB 2O1QA 2CDOA 1LOGA 3MUZ1 2CL2A 4GB31 2NYYA 2BFUS 3D6EA 2R1DA 1DFQA 4XHBA 2X29A 5EXOA 2ZEZA 4JRLA 4AI3A 1RHI2 2J1VA 2X8KA 4N9HA 1H2KA 4NVPA 4E2QA 5JOZA 1OUXA 2BP6A 3MGUA 3TEWA 4YW6A 1GYKA 4DZGA 4L97A 5JXGA 1G9BA 3OYWB 1IS3A 4ZU5A 4FBFA 1J3RA 4XCAA 2FDIA 5T5PA 1WBLA 5LY2A 4A42A 2DURA 5KBFA 4XBLA 1UU5A 3WT3A 4MGIE 3BGAA 5FP4A 4B3NA 4JV4A 2A6YA 4KL1A 4IE5A 4JKMA 1Z7S2 4MSVA 3VBOA 3WF2A 3WDUA 1UPSA 1ALYA 2ERFA 2F17A 1C3HA 2XGXA 4LO8A 2HWC2 5FZCA 1XC6A 4A44A 3K3NA 3T09A 3KV4A 3NMBA 1R1ZA 3NQHA 4GWJA 4YGDA 4RHV2 5LATA 2W2IA 5C4WA 2ES3A 2JDZA 5FP9A 2XONA 2ZHLA 1VAVA 3HQUA 5DAWA 3PHMA 4QX2A 5C33A 4MUVA 4NE9A 1CPMA 2P3YA 4C1XA 2VM9A 1DGWX 1XE0A 4LUKA 4R9BA 1XPWA 4XFIA 5G04L 1TG7A 3SQOA 5A7QA 2GC3A 5DZFA 1QEXA 3CDZB 4I0BA 4V2VA 5I0UA 1QJZA 1NQJA 2OX0A 4S2HA 1MZEA 3SLIA 2A73B 4JGZA 4RD7A 4NPMA 1RVF1 5KHHA 5CBLA 5HCAA 4CXXA 1ZM1A 5F5QA 1RVF2 4NN0A 2JG9A 3A7QA 4MX3A 3BUCA 3WOGA 2D5FA 3BIWE 5ANNA 1QGLA 1PO11 5LY1A 4DUVA 2WQ8A 2QNKA 4Q4V1 4K1YA 1UMHA 1XB9A 1ZZCA 5I91A 2RS52 3HN1A 1RITA 1ODMA 4QXBA 1YI9A 5E89A 1W6MB 2V73A 4D94A 4AHXA 1F4HA 4QB2A 2KR2A 3WDWA 3WP4A 1CZVA 1BEV2 2Y6HA 2IZWA 2OQ6A 2D6KA 3WVJA 1J1TA 2Z79A 4BDVB 4P9LA 5FDBA 1WGPA 2P6CA 3KCXA 3AM2A 2JIJA 4I09A 4M3CB 3AJYA 2BNOA 1W03A 3DL3A 4LKEA 4RGAA 3AKRA 1G9AA 4Z92B 1STMA 1RUG2 1W99A 3AMNA 3IPVA 3U37A 4R52A 4KGGA 4GAZA 5DDJ3 4CCOA 1COV2 5IK7A 5FPBA 1K5MA 1H2MA 3AZXA 4WM8C 3TN92 1AR72 3ZSEA 1X7NA 2P3JA 1BCXA 3CZUA 2OKXA 1YQ6A 4XFGA 5IVVA 1LCLA 1RTVA 4KU8A 2GMPA 3WF3A 1BVP1 1DZTA 2VZPA 1W0OA 1ZREA 1OA2A 4Y22A 4OYUA 1L7QA 1OPOA 1OQDA 1RYYA 4OI1A 3UJQA 4YM1A 4N53B 3WXPA 1UL9A 1ULOA 4RFRB 1SG3A 4GKXA 2A6WA 3KVAA 4DXTA 2RE9A 2IFRA 1GP4A 5CFCB 5AFBA 5FZFA 2Y6LA 2XUMA 5F5CA 1H8TC 1V6LA 2OT7A 3OBAA 2B42B 1GZWB 1CAVA 1W6NB 2DCZA 2G9FA 4LKDA 5EPAA 3SKVA 2B9VA 4JRAA 1C5HA 2DF7A 3BIEA 1B35A 2VBDA 4LK6A 5A3NA 4Q4X3 2XVKA 4IV1A 4ZZ5A 1VIWB 1VRH2 5A7PA 3AKQA 2RJLA 2BNMA 5APAA 3M3IA 5L7OB 4UW3A 2J1SA 5FREA 1V6NA 3KT1A 3H8OA 1GOHA 1AR92 1MVQA 5JPMB 3DYMA 2WZPP 2HWC1 1ZA4A 4LK7A 3RZGA 4FPGA 1RUOA 3ZN4A 1O3RA 4OMDA 2P3IA 2ZGOA 2X5IA 2P2KA 1GP5A 2WNVA 1UF2C 2VMCA 2YG0A 3QH7A 3EB7A 4UFKA 3T4HB 1ENRA 2ZJCA 4YM3A 4N90A 3BODA 5FBJA 1ND3C 2GALA 2CWMA 4V2WA 2XQRA 4Y5TA 1NLSA 1Q8VA 1YFXA 2BNNA 3MF6A 3U11A 3LIGA 1SFYA 4HANA 5EP9A 2P17A 3WF4A 4CCEA 2GMMA 4P5HA 3LQCA 2VXRA 4OVEA 4PBPA 2Q1FA 2YC2A 4QPGA 4JQTA 2WNUB 1C4RA 1VBE3 3AFKA 4QPGB 4B4RA 5GLUA 1JOBA 2JKBA 2CTVA 2WZ8A 2BJSA 2XOMA 3F2ZA 1FOD1 4LULA 5FKBA 2HH9A 4XFBA 5CB7A 1R083 3POGA 3VZNA 4A45A 5LW9A 2GZWA 3LGRA 1SDDB 2XBO3 2ZXQA 4R8HA 1CESA 2GNTA 4K7JA 3ZKYA 5FZLA 5L19A 2P4EA 2ZGMA 3CHXA 2RMU3 3IMMA 5JZGB 1KGYA 1O5LA 2FMDA 3H3LA 5DUXA 3TEZA 3A0NA 4LXLA 3ZDVA 5FLIA 3C7HA 1VAKA 3L2HA 5CG9A 2EALA 2XR4A 3LWCA 2WWUA 1HW5A 1D4M2 2OZ6A 1MEC2 3RMYA 5I93A 1X9PA 3KM5A 5D2AA 1AYM2 3CLPA 3ZXJA 5ABJB 5F5AA 3I54A 1DQ2A 4QD2A 4BMBA 1PO12 1GP6A 1S2EA 4OQ8A 3D3AA 4BQXA 3THTA 1Z0HA 4LLOA 5A3UA 2BDRA 4LBQA 1JZ3A 2JXAA 2R16A 3LDRA 1W2NA 3B5LB 5FR3A 3O1TA 1VBB2 2VE1A 4ASKA 2QQIA 1A3KA 1S0GA 4EN6B 2YHJA 2C26A 1PO22 2ARBA 4JZRA 4NPRA 1DYOA 1R092 4A7YA 1OSGA 1R091 4FAGA 5GM0A 3K4ZA 5T54A 2C0ZA 2BGOA 4WBBA 4HK9A 4HT1T 5FMBA 1G9DA 4WM7B 4PLMA 1POV3 5FMOL 2ID4A 3EHKA 3ZXGA 1DG6A 1AL23 1HRV2 2JECA 1FV3A 1GQPA 1Y3TA 5IATA 4NR1A 2OVUA 5FZEA 1K5MC 4URTA 1DGRA 3UKTA 3WNNA 4UOJA 2I07B 5A1AA 4FT8A 1ZYBA 5IVJA 3N7MA 4UF0B 4XDOA 3WINE 4IEOA 2PHDA 1QJU1 1LAJA 5EHDA 1VBB1 3UETA 4JQRA 1D0GA 2VMEA 2YFUA 3GZUC 1ENSA 4L8QA 4ET7A 1G8WA 3Q8EA 1ZVFA 2Y8KA 4TWTA 1YIFA 3CZJA 3BKZA 3HD8B 3CNAA 4ZPIA 1BKZA 2XHKA 3EBRA 2G9ZA 3T1MA 4N43A 4KWLA 4HVOA 1IHMA 4QQOA 2WNEA 4FOVA 1NX9A 1AHSA 1H8TA 2QJVA 4EZ4A 2BBAA 3SMHA 3VBHB 3HPNA 4LBQD 2HWD2 1ACCA 1X50A 5FPUA 3VHPA 5FYIA 3O0XA 3MLJA 3OPWA 4C91A 2ORZA 3NKTA 3C2UA 4HFSA 2QFEA 3T0DA 3RYRA 1Y9MA 3SXWA 4R4XA 4BM8A 1PMHX 3MICA 5JI9A 1DF0A 3I3QA 2PAEA 4JGYB 4IETA 1DQ1A 2VNRA 2WN2A 3MFAA 4V1PA 5FJKA 1CAUB 5FYBA 3TBDA 2ARAA 3OTFA 4CCCA 3B93A 5B4XA 2VVFA 3RJRA 1DQ5A 3QBQA 2X5IC 4MXVA 4TSVA 3FFZA 3PMSA 4G9SB 2DVDA 1EYBA 1V6MA 2JE8A 3AL6A 4XACA 5D8AB 2W46A 5D8AA 2BQPA 2VZOA 5FQ0B 1H1MA 1UOGA 1LTEA 4N7IA 5F32A 3URFA 4ZZ8A 1HV0A 1ND3A 1VBA3 4GKYA 5CKMA 1QY4A 3H3UA 3ECQA 3MIEA 3PLQA 5GZEA 4CEWA 3KQ4B 3U1XA 1GZTA 4CU8A 5LK7B 5FZOA 3ZYBA 5GLZA 1OI6A 4OMCA 1LOAA 5A7WA 4AGVA 2BYVE 3ZFFC 2H6CA 2RS11 4QPIB 4LORA 1URXA 5A7WB 4G3YC 4AXOA 4TN7A 3B9IA 1OOPB 3HJRA 5IJRA 4D7YA 5AC91 2WT2A 3I3BA 2VTFA 2ZMNA 4HL0A 1BEV1 4YVSB 2R071 1E5RA 2VNVA 2Z69A 4XJ8A 4Y1UA 3U14A 2PLV2 1CX4A 4AVTA 5K0UB 1BYHA 4YRDA 1KJLA 1SLAA 5L9BA 2EIBA 1ENQA 4JDNA 2CSGA 4K40A 1PGW2 2DDUA 2VUCA 2B8MA 1UD1A 3R4SA 4GQ7A 2MHFA 2ZGSA 1RUF1 1LJ7A 5FIXA 1MQTA 3BYWA 4Q4W1 2Y60A 1NY71 5AVAA 2E9QA 5FK7A 3SISA 2PA7A 1R093 3K4DA 4FO9A 5FY8A 2QZ3A 4L0PA 4I3PA 4ZHNA 1GKBA 1HB2A 2JDKA 1YO8A 5EYXA 2GN3A 3J7NA 4B4QA 1RUD3 3GCWA 1RUC2 1ASJ2 3S5AA 3JUUA 1RUC1 4M4RA 1C57A 2QDNA 4CXWA 5FBZA 2QE3A 4X8NA 1ST8A 2CNAA 5FLHA 5TSWA 3SEEA 3I7DA 3OPTA 1WLWA 4XF0A 1IS5A 1RL3A 1RUE3 5FY7A 4AVBA 4QXHA 4P9JA 3KB5A 3FWEA 1PO13 1UU6A 3DN7A 1FAYA 3H0OA 4B8EA 1IOAA 4GH4A 3I2IA 4LBNA 2JE7A 4CU9A 3I4IA 5J09A 1VJ2A 3WD5A 1EV13 3WQ0A 3TEYA 1VBC3 3E5QA 4N9IA 5BNNA 3P3NA 2VO5A 4JX0A 1YFWA 1UOBA 1H6XA 1RUG1 2EAAA 5CFDC 1ZA7A 1H4GA 4N53C 2BEOA 2XMLA 4FCAA 4KGQA 3HQRA 4Q5OA 1W6PB 3B01A 2E7QA 1GMMA 2Y6GA 1Q56A 2VJXA 1KFXL 3PVBB 4BPZA 1OLME 1RUJ3 5JI7A 4XIKA 5LWBA 2TUNA 1IPJA 1PVXA 3CJIB 4LE3A 4CCMA 3VDCA 4I3GA 1PO21 4CDWC 4DPNA 1U5IA 2ZX3A 1S0BA 2JDYA 2C1FA 4MH0E 3WG4A 1GWMA 4CEYA 2XH6A 1WMXA 2ZZJA 3TN93 5A32A 4XMIA 3S57A 4HN0A 3MV11 4DO0A 2A6ZA 3A0KA 5FY9A 3NNMA 2EXJA 1W8FA 2J22A 3LSEA 2VMHA 1Q8OA 4LHKA 5T52A 1NLQA 3UESA 3VBFC 2CGOA 3MPPG 2K46A 5ACA3 4OULA 2WNUC 5J37A 4B1LA 5IK4A 2R1BA 2PQQA 2GP3A 1H30A 2YC4A 4AEDA 4LHNA 3GBGA 4FPEA 3SCHA 1Y9QA 2X05A 1UY0A 2QQPA 2VQAA 2WT1A 2JIGA 3R0RA 1CD3G 2BUKA 3VBRB 4QGNA 4YZ1A 4LKFA 1RUNA 5ANQA 5F3EA 3JXSA 2RS53 3I3MA 4OHYA 2ZGRA 2YBSA 5F8PA 4M0HA 4BQYA 1XRUA 4XUQA 5FTTC 2D6NA 2DYCA 2WSVA 1H9PA 3FZ3A 4QXKA 3RRDA 1B09A 4M3CA 3KGLA 3E97A 2XJQA 2YBPA 3ETQA 2P34A 1G6NA 2QQMA 3LKJA 4DRVA 5J7MA 2VZUA 2WA4A 3W9AA 5JOYA 3MIGA 2NM1A 1D7PM 3VBOC 3VD7A 1W6MA 4GWNA 4HZFA 3T2OA 4H55A 2GMEA 4UW5A 3IKWA 3ZOIA 4COYA 4CEWC 2B45X 1MZFA 3DKWA 5CFDB 4O65A 4MG2A 3M1HA 2FQPA 1HDKA 2WRAA 4QHZA 4ZXKA 1OFSA 1QQP3 2R30A 2WUHA 4ZY9A 4UFHA 1CAWA 4G4FA 4KQ7A 4XJWA 3VBSB 1J59A 2Z2SB 2ZCWA 4OHZA 4NWVA 1GNZA 1FNYA 2E26A 2O8QA 2WLPA 1RHI1 2RDQA 3QACA 4YZ2A 3VD3A 2Z4FA 4AG4A 1PGL1 4H7LA 4KI5M 2Q8OA 1PGL2 2JDNA 4YWAA 4W6YA 3Q8CA 2B39A 3POJA 1UWWA 3JZVA 3N9NA 4CU6A 3ZMNA 4E9KA 3IDBB 5GKAC 3VB9A 1CAVB 1W6NA 2BV4A 5J96B 1RJ7A 4QHOA 4I0AA 1IKQA 1XYOA 3IAQA 1ULCA 1AXZA 1X8MA 4OUSA 4LPLA 1AX1A 2HEYF 1RHI3 4CDXA 3KMHA 3BPSA 1IS4A 2GAUA 2XHNA 4QPYA 1ASJ1 1W8UA 4NO4A 1ND2B 5GALA 1NOVA 4LBMA 1DLCA 2AUYA 3ON7A 2OYZA 1Y4WA 1NLRA 5J36A 3ZXDA 1Q43A 4QQLA 3ZFEB 5IYYA 3DPRC 5FUPA 4L92A 4TYSA 1W3XA 1ZBE3 4XZUG 4C8DA 5FXWA 1H1IA 5EV7A 2QQNA 2XJRA 3PU8A 1PGW1 4B29A 1ZBA3 2ZPXA 3KV9A 2VBPA 5FXZA 2JG8C 5DZGA 1ASJ3 3JCIA 1BBT1 2ENRA 2PAKA 1QOTA 2IFWA 3LEIA 3ZXEA 1DGLA 1KD7A 3THDA 1U0AA 5C5UA 1F4AA 4J25A 3AC0A 5LA2A 5ACA1 4SBVA 1NAEA 3TN91 2HWB3 4AZZA 5IVYA 4Z07A 1YIPA 2JB8A 3AXEA 1WLTA 3KF5A 3I2FA 1REDA 3ZPYA 3NV4A 4X8PA 1JU4A 1EY2A 5C7GA 4NHMA 3RS6A 1RUJ2 2D40A 1CIWA 2D44A 1UMZA 4CDUA 1CX1A 3K46A 4QDQA 4Z8BA 1YFUA 3I3EA 4XILA 4CUBA 3BALA 5KXCA 5JZGA 3OY8B 5AC93 3LCPA 1ONAA 4K6BA 1WLCA 3IM0A 4COWA 4D7SA 4CEYC 1CONA 4NIHA 1O3TA 1XU2A 3H7JA 5GJ6A 1X82A 2ZGPA 3ATGA 4EN9B 1PK6C 3P1IA 1I6XA 3LFMA 1EV12 4LOTA 1IG3A 5EJ1B 3ZXFA 2DBIA 1JYNA 4C0HA 3VKLA 3FFQA 1DBNA 1LU1A 1QNYA 1CR7A 2DCTA 2HEWF 2JWPA 4Y26A 5CZKA 1TMF1 3ZR5A 2Y34A 1Q8SA 3UT0A 4AEDC 2VCMA 2R0HA 4ZU4A 3KQRA 3VBOB 3VDBA 4DRRA 4I2OA 2QQUA 3NV2A 2B5HA 4KBBA 2LTNA 4CDWB 2W1WA 1QH7A 2WKKA 3GM8A 2FDGA 1V6OA 2W0XA 3AKTA 4OLLA 1RUC3 2W1SA 4FSJA 1RGSA 3WQBA 3USUB 2N7GA 5FZKA 4NHXA 5F3IA 3VZMA 3JBG1 3THPA 5DUUA 3T30A 5CFCC 1MACA 1VRBA 2NQYA 2VOKA 2IXLA 5DG2A 1UIJA 2QQOA 2WABA 1WMDA 1YFYA 1AR83 1IPKA 1EP0A 1N3PA 2OQ7A 5C8WA 4LUMA 1CPNA 1W9WA 1WWYA 2WSUA 1G7YA 4XVHA 4IXLA 5SV5A 1US3A 2IXJA 2XVGA 4ZXEA 3H8XA 3POSA 3Q8FA 4MADA 3BI3A 4XF3A 3O1SA 3DXTA 3C8XA 4Q0QA 2WO3A 2RMU1 4HETA 1MPXA 1QOOA 2VAUA 4QKBA 2Q8EA 5IVEA 1GBGA 1NKGA 2RR13 2WWSA 5IUQA 4K1ZA 2WNVB 3JD73 2BBVA 1FPN3 4CP2A 2LROA 3QLQA 1AJKA 1LB2A 3HN3A 4WM7C 2E32A 2QKDA 2G1MA 2JG8B 4UI9L 1J1LA 1FI2A 2FCUA 2VNGA 2W1UA 2VL4A 2ZHKA 2G4IA 3GJAA 1QXRA 3IMNA 3JBG2 3VHNA 5BNOC 4QWNA 4LT5A 3TYJA 2WQZC 1CQ9A 3PJYA 3W59A 1NXD1 1S4CA 3OUJA 5BNPA 3OB8A 1OKOA 3ACIA 4XE9A 4IL7A 3C7EA 3NKGA 3OD4A 1LHOA 4QU2A 1T2XA 1YCIA 1O7FA 3NNJA 4EJRA 4KWKA 4Q27A 2HYKA 2UWCA 3AYAA 4IEXA 1DHKB 2WAOA 1RJ8A 1HQNA 1KDMA 3LAGA 4Q4W2 4XBNA 3RZJA 3SITA 4DUWA 3UKNA 3KCYA 2WYFA 3N36A 2PQSA 2PFWA 3T2QA 1OPMA 1AL22 2BTVC 1SHWB 1W8WA 4ITCA 1TVGA 5I0DA 2RG4A 3VL8A 1BBT3 2WINB 4IEPA 4D6RA 3FLRA 2DU0A 4Y1VA 5LBBA 2BWAA 3H3ZA 1RUJ1 3AZWA 4LEJA 5E6HA 1PO23 1AR63 1LENA 4BJ0A 3UK9A 5JXHA 3U4SA 4P9YA 5FQ0A 4TXWA 1BBT2 1O3QA 4WZFA 4LBQB 5CKNA 3C7GA 4FVVA 2R7EB 4AQTA 4Y1XA 1OMIA 3OEBA 2WS92 3T1LA 5F37A 1HIXA 1KITA 3TRSB 3KV5A 4HBNA 4PF5A 4DEVA 4Q1RA 1LGNA 3L2YA 1A78A 2ZGNA 4FPHA 4PI0A 1QJX2 4GJYA 1OA3A 3IDAA 5FY0A 1HJGA 4AQSA 2I2SA 1D4M3 1MEC3 3CQOA 4HKLA 4JGZC 3RG0A 4EWAA 4UFMA 1PVC2 2JG9C 4LHLA 4DXRA 3MI8A 4CZSA 1GNYA 4Y20A 1WCKA 2EAKA 1N3QA 2J7MA 3LA3A 4I01A 4EWEA 2WFF2 5HV0A 4L99A 4FPKA 2VTXA 3ZXAC 1QJY1 2AEZA 2VC9A 4XUPA 3ZXLA 5FZOB 3AVRA 2VMFA 3R05A 5FAXA 1QHDA 2YU2A 1JS9A 3A4UA 1UYPA 1YUDA 1NT0A 3INAA 3U78A 2PMWB 3M7AA 1AX2A 4CYDA 1DYKA 2Y64A 5CAZA 4P14A 3O0WA 1LGBA 1PK6A 3IDCB 3I2DA 2RM23 3LOIA 3WCSA 5DABA 1OLRA 2VY0A 5DG1A 1VMFA 2VECA 3QH6A 3ACGA 3TNPB 3HWJA 1LECA 1E57A 5LA9A 5FPZA 2VMGA 5JUVA 3H9AA 4XF1A 1RMU1 2VW0A 2VULA 4NHYA 4YVSA 4QKNA 4XQDA 5FO9B 2B7YA 4BQWA 3ZPOA 3EQEA 1ZBA2 5FP7A 2EVXA 1SQ4A 3IIAA 1RUI3 5FY4A 4K8FA 5JDBA 3MHZA 3PIGA 1VRH1 3OBZA 3NJVA 3OGVA 1W90A 4K9SA 3PURA 3DXUA 4E4DX 3N35A 4D6SA 3LSDA 4D8MA 2D3PA 4IEYA 2E63A 4Q1PA 1YJLA 1NCRB 2QBXA 4Q8KA 2CY6A 4JTOA 1NCRA 1LKNA 5C4WC 2CU5A 1HXS3 3H1MA 4HOOA 4META 2G9GA 2VQTA 4M01A 3S0MA 3K51A 1W6QB 2RMU2 3SH5A 2XJTA 1W6QA 5BYNA 1AXKA 3MUY1 5CYYA 5FZ6A 2XWBB 3T2TA 5BV6A 1JW6A 1EPZA 2WL1A 1JN2P 2PHUA 3D82A 4UT5A 2A70A 5FWEA 4MO3M 2ZX0A 3RZKA 3H8UA 2QQWA 3B3QE 2E7AA 4AF9A 3B94A 2VVEA 5FZGA 3RFRA 2RJKA 4DB5A 4JHZA 1OH4A 4RSUA 5BNNB 3AL5A 4C0BA 4FQ4A 3FC0A 5FYHA 5HCBA 3WEZA 4CEYB 4CVUA 3BU0A 4E4ZA 1MVEA 3AMHA 1N1TA 4R9CA 5AC92 1RUD1 3X29B 5BNOA 3BTZA 5EYYA 3B02A 3KHCA 3ELNA 5BY5A 2Q1MA 1HLCA 3OD0A
chains in the Genus database with same CATH topology
3HAGA 4JGZB 1S55A 3RNSA 3N7KA 3RSJA 1GFF2 2VPVA 2VH9A 4HVQA 1S0EA 3M3EA 2UYBA 3NVCA 3MIDA 1RUF2 2GNDA 3HT2A 1LOBA 3ZSMA 4MGYE 4OFGA 1DGWA 1KQRA 1LGCA 4ISQA 2R0FA 2R073 4A2UA 1RUG3 3EJKA 1MZ6A 1HRI1 3BOWA 1YHFA 4OHWA 3UKVA 4O9EA 2RS51 4QPGC 2PTMA 1ZZ7A 4LO4B 2OW4A 1NXMA 4PLOA 4PDWA 5HBAA 1IS6A 4Q4V3 4ZU7A 3ENRA 3LZZA 4FXKB 3GBWA 2QUOA 4H7MA 2VU9A 5SV8A 3KSCA 2AREA 1RUH1 4R9AA 2JD4A 1ZRRA 1JYCA 1TME1 4DY3A 1VB2A 1X36A 3BTAA 1S0CA 1WBFA 4YVWB 2XJPA 3B69A 4AE2A 5J48A 4QM9A 1POV1 3GALA 5L73A 3RJ2X 1L3JA 2Y26A 3ST7A 4L9BA 4HMZA 4CDQC 5CIRA 3ZYJB 2GN7A 1O4ZA 4I0WB 2RS33 4AVCA 1WA4A 4DNYA 3FHIB 3WP6A 1WD4A 4YG0A 3MW4A 3VL9A 4Z1VA 2ARXA 2CAVA 5KHGA 1F9KA 3WNXA 4IESA 1QQP2 3MIFA 2WNVC 2QVSB 4IV1B 4Y22B 4AFDA 2YY1A 3DPRB 3MW2A 1H0BA 5GLTA 3VUOA 2YV8A 2D93A 2ZHMA 5I0RA 3E5UA 3FJSA 1V6JA 2IXKA 3GBFA 1WW6A 1VP6A 4XQ4A 4F3JA 1ZBE1 4NOTA 4Q8LA 3M8LA 1SDWA 4MZUA 3I59A 4W6WA 1B35B 1D0HA 4XBQA 1NZCA 3ZSKA 2V09A 2R072 4FPFA 2MEV1 2Y0OA 1D4VB 3VBRC 2JE9A 1ZRDA 4Q0PA 2GH8A 3DV8A 3WLUA 1RUF3 3ZIXA 4L11A 1LHNA 2D98A 4XF9A 2D6MA 2Q0AA 4N43C 5T3NA 4CDUB 3V0AB 3CL1A 2NP0A 1ZRCA 4HK8A 3H1WA 4FPJA 3SH4A 1ND2C 3WW4A 2PLV3 2I45A 2LALA 4LBJA 1HRI2 3ME2A 2PN5A 1O4TA 2ZAAA 4YFWA 4XDQA 5GLVA 2NZ9A 4AI0A 4LR4A 3NJZA 3WP3A 3USSA 2E6VA 1WMEA 1EPWA 3Q9OA 5C6CA 1LHWA 5JPNB 4D7TA 2AENA 1ULGA 4XTPA 2D6PA 4YGCA 1A6CA 1REEA 4RR3A 1WCSA 4P9WA 4XMAA 5EFUA 4YG3A 1VBA2 3ZYIB 4XJ9A 1MS1A 3ZIWA 3PNAA 1ZZBA 3WR0A 1NY72 3AZVA 4FOYA 2FZ1A 4OI0A 2VMIA 1SFNA 4JC1A 4PJYA 2GDFA 2ILMA 1WUVA 3ZFEC 3JQWA 1PZ9A 1UX6A 1WLDA 4AFCA 4XFHA 5FPXA 1UN1A 3EO6A 3FMGA 1QJY2 4AFBA 2PHFA 1SBEA 5AFEA 5T55A 1Q3EA 4I30A 1TME2 4XOGA 1FNZA 4A3XA 2PHTA 1QU0A 4S2FA 3DUIA 1FX5A 2YGMA 5AVPA 2OPKA 2VOWA 3E6BA 4EN7B 2BFUL 4BMEA 2ZHNA 1QQP1 1GNHA 1EV11 1J58A 4E27A 3CJIC 2PHLA 2CYFA 4M3CE 1LULA 1ZBA1 4RL7A 2VOXA 2NMOA 1V6KA 2P37A 4R9DA 3GHNA 5A3MA 1JYIA 2ZGQA 1SBDA 4BH9A 4MYEA 4D69A 1XU1A 1SMVA 3OGGA 3EXUA 4JVAA 2WIIB 3NW4A 4Z82A 2R043 3WG2A 5F1RA 3ILRA 1A8MA 3B9CA 2MEV2 3B00A 1GR3A 1C8M1 2WS93 3M70A 3J9SA 3NV1A 3VDDC 4PLNA 2I74A 2LM3A 3WX5A 1UAIA 5LEJA 4BYYA 1MS3A 1CAUA 3ZXKA 4ASLA 1AR62 1OHFA 4EWDA 1RUE1 1MS4A 2D3RA 5J98B 5T50A 4MVTA 4AHYA 4AI1A 5JAXA 2UU8A 5ABJC 3QCWA 3CF6E 1UW8A 4CDWA 2DFCA 1UIKA 2ZBJA 1MS9A 3WG1A 1PHMA 4C90A 1F8VA 1ZZ8A 1KJRA 2HEVF 2BVBA 2Q4SA 1O4YA 3BU7A 4PBOA 1JH5A 4RFT0 2QDRA 1WW4A 4GALA 3VBFA 1DIWA 4KWJA 2WFPA 3I8TA 3VZLA 5DUVA 2XL9A 4FQZA 4Y20B 3TWIA 2DTWA 3V64A 4Q0SA 2BGCA 2A3WA 1S0IA 5CNAA 2MEV3 3PVEA 1QH6A 4RS5B 4IV3A 2HWE2 3WW2A 1VR3A 2ZZQA 2FBEA 1I1EA 4Q0VA 5J3UA 2P3KA 1JUHA 1U5XA 2MNGA 3GYDA 3JU9A 4WVZA 1ZNPA 5T5JA 1MZ5A 1VAMA 3O12A 1XNBA 4XFAA 1O5UA 2A6VA 4K20A 1SBFA 1PIV1 1HV1A 5H9SA 1PIV2 1OLQA 1ULEA 2GH2A 4MGKE 5H9QA 5BNNC 1AL21 1VB4A 1WD3A 1RC6A 4N43B 4QPIC 4HKOA 3WDTA 2AYHA 4FAHA 1N1VA 4MXWB 5L7OC 2UY9A 1MS8A 4XEZA 2NN8A 4Y5Z0 1VBB3 1NYWA 5E8AA 4HPKB 2WFF1 4QHBA 1SCSA 4HPKA 5D1IA 1RUH2 5BNQA 1GV9A 4D3WA 4FTEA 1QDOA 2BPA2 1W6OA 3VBUA 4LNVA 1W6OB 3JQXA 4C1WA 3FUOA 3NAPC 3OYWA 4XJAA 1NA1A 1QOSA 2D7FA 2D6LX 3WHUA 1QJX1 3O0VA 3WDXA 1HQLA 3CJIA 2CAUA 4JGYC 1QWRA 4MLOA 4AGGA 1PMIA 3TNQA 3FLPA 3J8F2 2GU9A 1I9RA 1AUYA 2HJIA 2VUAA 1HRV1 1MR5A 3VN4A 3ZVXA 1AVBA 4YW5A 1Q8QA 4YZ4A 5F6LB 3VBHC 3FUQA 2VUJA 2F6BA 5H9RA 1R082 2ZKNA 3M3QA 4RGGA 1BJQA 4DS0A 1OOPA 5C8CB 2R063 1XNKA 1AYN2 3S6PA 4IQPA 1D2SA 4GMP3 3V56A 4I02A 1HRI3 3MLLA 1LOEA 4CDQB 5K0UA 3W58A 4AYUA 1APNA 1FPN1 2DUOA 2DCJA 4OZXA 1DU3D 1FMD2 4R4ZA 1SLLA 1ZBE2 2AGSA 1LHUA 2A71A 4AFMA 2QZ2A 5F6KA 4HSJA 4B7EA 3FBYA 1BEV3 3ZYGA 4AEMA 2HKXA 2EA7A 1LEMA 4GMP1 4HLTA 5GLWA 3APBA 4CDUC 1V9U1 5JOWA 3MLKA 1AR93 5JZGC 4YVWA 1LOFA 2YMZA 4Y1ZA 1F31A 3AP6A 4HVRA 3VHRA 3NWKA 1VRH3 5FOJB 4K3UA 4Q26A 2EXIA 4Q4X2 1RVF3 1WCDJ 3NL1A 5C8CC 5C9AA 2Q30A 2HWF3 3U10A 4DY5A 3IBMA 4HN1A 3ASIA 2YUEA 3H1YA 3WQ1A 1BXHA 1UPIA 1C8NA 4AWDA 3FBMA 1W6PA 3OJBA 4KNCA 1CJDA 1W2UA 2H0BA 1T6GC 1XNCA 2ZGTA 1Q8PA 2PYTA 4H3WA 4GIQA 5JIAA 3DPRA 3MIHA 1UZZA 1UKRA 3TOJA 4F8AA 3ZFGA 5EJ3A 1XXNA 2D5HA 2PELA 3BOPA 5A32B 4RQPC 1Z7S3 4YFZA 1AR73 1PNFA 2RS32 2ZGKA 5BNOB 1GLHA 3LB9A 1H9WA 5JWPA 3IN9A 2XJSA 5FFOC 1U5ZA 1NQDA 3CJXA 1SLBA 2HWB1 3UJOA 5JMCA 4LBLA 2ZMKA 4YM2A 3VKMA 2K9ZA 4AEDB 2GC2A 3I59B 4A7KA 2ZX4A 3AYEA 4QGLA 5A33A 3DF0A 3KT7A 5L7OA 5CG8A 4LA2A 4CDXB 5KHIA 3ZN5A 5JOXA 1WW5A 3AMQA 3VZKA 2MPFA 3WUDA 4MGZE 1VBD3 1FOD2 4Y1YA 4Q4V2 1R081 3J4UH 2DV9A 5I0TA 4PDWB 1LR5A 4IEWA 3V0AA 2DCKA 1ENXA 5ACA2 1TMF3 3WQ7A 3E6CC 1DZRA 1TNFA 4LA3A 4RS5C 3U07A 4BZ4A 4COUA 3AMMA 1EAH3 1QKQA 3D5OA 4BWOA 2Y38A 1S2BA 5FMOS 3UV9A 2OUHA 3H7YA 5CA6A 1CVNA 3HT1A 3VV1A 4Y24A 1HX6A 3ILNA 1N1YA 1JUIA 4RHV3 3D0SA 1J3QA 4BOWA 1FV2A 2DTYA 1SEFA 3KD4A 4FPOB 2WT0A 4BHPA 2CGNA 3O5SA 1QMJA 2XLFA 5CVRA 3KS7A 1Y7BA 5GZFA 4OI2A 3M2MA 3USUA 5K0UC 2WLQA 4DOUA 3ZN6A 1CAXB 3VLBB 1WW7A 2XWJB 1CAXA 2R041 4ATEA 3WG3A 3OBTA 4CP1A 1RUE2 4WVWA 4GXLA 1AR61 1AF9A 1B35C 1LOCA 4W65A 1RUH3 4AQ2A 2RM21 4OI4A 2XBO1 2ZA9A 1BMV2 3POWA 5JCTA 1OKQA 3AP5A 4DFSA 4CTEA 1KS5A 4Q4Y1 1PGSA 1RUD2 5CFCA 4NHKA 5JLVA 2XLGA 2EXHA 1LESA 2GC0A 1GZWA 5JSPA 1LOFC 1QJU2 3NO8A 1FT9A 3GZAA 3M3OA 3N7JA 5BXXA 2BWCA 3UL2A 3U0ZA 2GSYA 4NWWA 2ZAHA 2YZ4A 3AMPA 3LA7A 2DU1A 1PIV3 3D4KA 1FYUA 2XJVA 3RDIA 4HKWA 4UBGA 1SLTA 2ATFA 1C28A 3TAYA 1D2QA 2NLRA 2QCSB 2WZR2 2RS12 3BPZA 1GICA 1I3HA 2RM22 4FTSA 2JEMA 1JXNA 2KA3A 2ZABA 2D3SA 4P9GA 2HWE3 3WZ1A 4PCRA 1JBCA 2KM2A 3VDDB 1QXJA 2XL7A 2R061 4X6RB 1XE7A 5BNPC 1NCRC 3FLTA 1LU2A 3OCPA 2ZOEB 1VLNA 3GZTB 3J8F3 3ZFGC 5EWSA 3ES1A 4B4PA 3ZO0B 4YGBA 2ET1A 2GC1A 5FRAA 5LRSA 5IT6A 1YYNA 4JDMA 5JR7B 3H50A 4PIZA 5GZCA 1QJX3 1F2NA 4WVMB 4O9GA 2D97A 4KH9A 2GNMA 2ET7A 1XYPA 4WM8A 1PNGA 5HCFA 1OFNA 1V9U3 3ROUA 1ZZ6A 2AR6A 3R4DB 4AVVA 4DINB 1WMFA 1LEDA 1QDCA 3NAPB 2VGDA 5E88A 1POV0 2A3XA 1ZRFA 2GNBA 4BE3A 3AB0A 3AKSA 5IK5A 1DQ0A 2HWD3 1U5YA 2O8OA 4GULA 1OQ1A 1IQAA 2O0OA 4KG8A 2IXHA 1JOJA 1MS0A 3POYA 1CN1A 2Y0IA 4AHWA 2FMYA 3ZYPA 1C8M2 4RS5A 3VKFC 2ZS6B 5JSRA 2DVBA 4E2SA 4YVSC 2R042 3MW3A 5B2GB 4IV1C 3VBSC 5BPXA 2C9AA 1DZQA 3VBFB 3MYXA 1GQGA 5F9TA 1N1SA 1SCRA 2XB6C 1AR81 1GQHA 4PIYA 1BK1A 3HIFA 2EXKA 1REFA 3MFCA 2XPJA 1HRV3 4QQPA 5BNPB 1NCQC 3JB8A 4XHXA 4XW3A 3PMEA 1ZZ9A 4RA0A 4QX5A 2Q1ZB 3FE5A 3MPBA 2AH2A 4AEJA 3JD71 1FPN2 2ZX2A 2B9UA 2KXLA 3FX3A 3J26N 3JD72 3AZYA 3TB0A 4F7ZA 2RR12 2WZR3 2DVGA 4BIOA 1U12A 3C3VA 4KG0A 1YJKA 2YGLA 4YW3A 4Q4Y2 1IGOA 4YYOA 4LO5B 3ACLA 1V9U2 3R4UA 4JDOA 1V70A 4XQWA 1Q5OA 4BCUA 4IEZA 2XKPA 1DYPA 4Q29A 1AR82 3ZSLA 4LO7A 1S0JA 1QJU3 2JJ6A 4ES9A 3L9JT 1AYM3 1NA1B 3KCCA 4GH4B 1FATA 2E51A 1V6IA 2JENA 4YW2A 1G9CA 1AX0A 1QXPA 4ASMB 2TEPA 1VBA1 3KT4A 1KDKA 2CGPA 1FXZA 5I0SA 4LBKA 3MF9A 1EAH1 4RQPB 4XIOA 2XBO2 1BMV1 4BQ1A 2UY8A 3AYCA 1RB8G 2HWF1 2IWGB 1S0FA 4S2DA 4INDA 3ZFFA 1ND3B 2BW8A 4LE4A 2DVFA 1YI7A 4PDWC 3RYKA 3WW1A 3ES4A 3IWZA 1PM7A 3V65A 4DXZA 3VKNA 5JIUA 5K8SA 2A75A 1SACA 1XQNA 4XFFA 4PIXA 1OD5A 1YLLA 2D43A 3CEWA 3HQXA 4LBOA 5H9PA 2JX9A 2YC0A 2ZKLA 4BA6A 5E1RA 3ILFA 4PQ9A 4AI2A 3ZYRA 1S0DA 2XVLA 2WZR1 3D0JA 2HWB2 1J3PA 1D4M1 1EAH2 1MEC1 3ALQA 3KGZA 1PZ8A 1Z7S1 1GSLA 2FHRA 4CDQA 5L36A 2Z5WA 3HBZA 3J8F1 1LODA 1QJY3 1C1LA 5IK8A 2E53A 5JVVA 3MZHA 3M4FA 1ULDA 1SLIA 5LK5A 3RPQA 5FO7B 3PJQA 3AFGA 1FOD3 1KS4A 1KXGA 1RMU3 3VZOA 2TNFA 3AKPA 4FPCA 1F5JA 1YWKA 4GH4C 2PHXA 4CP0A 1RINA 4AGRA 4J1XA 4RR3C 2ZX1A 3O7OA 1R1A3 4E2GA 5DZEA 1H2LA 1MQTC 3HMYA 4DMIA 4W6XA 5CFDA 3VBUB 5A3LA 3O14A 4XXPA 4XJUA 3N3HA 1UU4A 3S30A 1GZ9A 3E5XA 2WC2A 1DGRN 2W08A 1ULFA 5HXVA 1YRZA 1CAWB 3KZ4C 3VBSA 2A5ZA 3ZFGB 3BCWA 4UXAA 4GA9A 3WCRA 3CO2A 3ZSJA 4AW7A 4XTMA 1COV3 4NHLA 5DDJ2 4QQHA 1AR91 3GNEA 1V00A 1VBE1 1NCQA 1TMF2 5C4WB 2JG9B 1NCQB 5D8AC 2YXSA 4CRQA 3QOPA 4Q4X1 5A33B 3PVNA 2DUQA 3AK0A 2XLAA 2XKOA 1R1A2 3G7DA 1UCXA 1O3SA 1VBD2 2SBAA 1NG0A 2ETEA 1IZ3A 1VBD1 1JHNA 1ND2A 4UW4A 3VHOA 1RMU2 4N7UA 4JTNA 3RYPA 2HWF2 1C5IA 3SNMA 1W0PA 2VNOA 2VG9A 5EZWA 1H4HA 3B7MA 1NE4A 1OA4A 5LEKA 3WUCA 5KHJA 4YLZA 2Z42A 5KC5A 4FOWA 3WW3A 3VBRA 1N47A 2IXIA 2JICA 4XXAA 1IKPA 2UYAA 3WHTA 2W68A 1AL0G 1VALA 2RR11 3SCFA 4BIFA 4YNIA 1PZ7A 1M4WA 2WA3A 4LO6B 2YPJA 4J1WA 4IEVA 1FMD3 1GANA 1KRIA 3K48A 1VBC1 4K21A 4YW4A 3VZJA 4EROA 1K5MB 2HWC3 2A3YA 3OPZA 1OQEA 3IPVB 4ATFA 3RWNA 1YNAA 4QQ2A 1AYN3 4IERA 1UKGA 2R062 1RUI1 4WVVA 5E16A 2UWAA 3DGTA 2NMNA 1HQWA 1UZYA 2OIIA 2YROA 4TZDA 4QMAA 3QD6A 4UW6A 3CU7A 1DLLA 1DDLA 2W39A 4F83A 1Y43B 1QF3A 4IEUA 4LTAA 4N53A 2DUPA 4RR3B 3GF6A 2PHRA 1S1AA 1HXS2 2PAMA 1VBC2 2B46X 5K9YA 2X5IB 2TBVA 3ZFEA 4Y4YA 3WDVA 1CGPA 1LRHA 2AZ5A 3S7IA 2UURA 3MIBA 2K2SA 1S2KA 3WY6A 3RMXA 4RHV1 1RUI2 2ZGUA 3NSTA 5I8SA 1AZDA 3PTYA 2WJSA 4ZKTB 5DDJ1 5FO8B 4X6QB 3NV3A 4FP2A 2Q5TA 3AJZA 4H14A 3AZZA 2SLIA 1RIRA 5KXDA 2WNUA 4GMP0 4FP3A 5DUWA 2YYOA 3AP9A 1X33A 1PVC1 1FMD1 4YZ3A 4Q2FA 3WDYA 4P9XA 4OHXA 1MS5A 3N7LA 4YSFA 1H8VA 3ZDSA 5KWRA 3PVOA 3RQ0A 3LOBA 1ZX5A 5DXDA 1AR71 2DWRA 5KHKA 2VW2A 5K7PA 2ZMLA 2C5DA 4Q0UA 4QT6A 4U2AA 2ZGLA 2A6XA 4EV0A 3KLSA 1A8DA 2R49A 1PVC3 4FXGB 3SCGA 2ZTNA 3N4MA 3R6SA 4L2NA 2CV6A 3BB6A 3VGIA 2IC1A 3MDPA 1CJPA 2BVVA 4XZPA 3VDDA 3VBOA 4BLIA 1C8M3 2WS91 4JCKA 3OY8A 4ES8A 4WM8B 5FCCA 5FLJA 1H1AA 5GZGA 3RI9A 4XF4A 3HR9A 5GZDA 1COV1 2F4PA 2DCYA 1BQPA 4AFAA 3ZN6B 4YARA 1BVVA 5CADA 4B7KA 1NE6A 5I8TA 4OHVA 5ABJA 2EF6A 4AVSA 3VKOA 2E7TA 4WVMA 4P9IA 5CU1A 2R32A 1XYNA 1OOPC 2H0VA 1GZCA 1Z78A 2RS31 4Q4Y3 4WV8A 2XJUA 1R1A1 4IEQA 1O91A 5KXBA 4XJZA 2OA2A 3RI8A 4FOQA 3AX4A 3V0BB 3OF1A 4EN0A 4QPIA 1W39A 3WP5A 3V0BA 4CDXC 4YZ5A 4FTBA 1KFUL 1DQ6A 4WM7A 4MV2A 1TE1B 4YW1A 4GB32 4IV3C 4GB33 2RHPA 3JBG3 1AJOA 1F5FA 1X8EA 2WFF3 4ISRA 2D6OX 4ONUA 4U36A 5BUVA 2R6QA 1M06G 4J6GA 3P3PA 5LRRA 4YVWC 2K0GA 1H8TB 2A7AA 4M0NA 4BLJA 1PK6B 2H6BA 2WQ4A 2PHWA 2OZJA 4FPLA 4KU7A 4M3CF 2JG8A 3VBUC 4WZCA 4A7ZA 1QNWA 4SLIA 3ZX7A 5C9AC 4TLFA 1H2NA 1TEIA 2LUWA 4HSLA 5KXEA 5FOBB 1HKDA 4JGYA 1I5ZA 1HXS1 3LA2A 4AVAA 2VOVA 3ZMOA 4YG6A 2UWBA 1DQ4A 1AYM1 3JB4C 3SHRA 2YDEA 3RZZA 2OUJA 1JTZX 3AP4A 3VBHA 5JSOA 4DQAA 4UBHA 2W52A 3WV6A 2PLV1 4QM8A 4ORFA 3D8CA 4XPVA 1C1FA 3OBRA 3M3CA 4S2GA 1N3OA 1SLCA 1XNDA 4OUMA 4E4SA 4RQPA 1BZWA 3E6DA 4LLFA 3G6JB 3NAPA 4Z2WA 1G9FA 1NA1C 1G86A 1YXWA 2DVAA 2CWSA 4Q4W3 3IT8A 1TQ5A 4GWMA 1AXYA 2VW1A 3GHMA 4YGEA 3AYDA 3OGJA 2NPIA 4AQ6A 3AXDA 5I8YA 3ZFFB 2VQ0A 2XG3A 4CEWB 5KC6A 2ZACA 4FPYA 4COZA 4IV3B 1AYN1 4XYXA 4AI8A 5T5LA 4YM0A 3SH3A 4EN8B 3MEPA 4AK3A 4XFCA 1VBE2 1TNRA 1LHVA 5C8CA 4QGMA 2RS13 4COVA 2IXCA 2EIGA 2X53S 3IDEA 5HI0A 2FZ2A 1TME3 4XETA 1XE8A 2HWD1 1MQTB 2VVDA 2DFBA 4M00A 3U4XA 5T5OA 2HWE1 4MXWA 3AP7A 4JAAA 3S7EA 4AEKA 5C9AB 2V5YA 4AHZA 2O1QA 1LOGA 2CL2A 4GB31 2NYYA 2BFUS 3D6EA 2R1DA 1DFQA 4XHBA 2X29A 5EXOA 4JRLA 4AI3A 1RHI2 4N9HA 2X8KA 1H2KA 4NVPA 4E2QA 5JOZA 3MGUA 1GYKA 4DZGA 4L97A 1G9BA 3OYWB 1IS3A 4ZU5A 4FBFA 1J3RA 5T5PA 1WBLA 2DURA 5KBFA 4XBLA 1UU5A 3WT3A 4MGIE 4B3NA 4JV4A 2A6YA 4KL1A 1Z7S2 4MSVA 3WDUA 1UPSA 1ALYA 2ERFA 2XGXA 1C3HA 4LO8A 2HWC2 1R1ZA 4YGDA 4RHV2 5C4WA 2ES3A 2JDZA 2ZHLA 1VAVA 5C33A 3PHMA 4MUVA 1CPMA 4C1XA 1DGWX 4LUKA 4R9BA 4XFIA 2GC3A 5DZFA 4I0BA 5I0UA 1QJZA 1NQJA 4S2HA 1MZEA 3SLIA 2A73B 4JGZA 4RD7A 5KHHA 1RVF1 5CBLA 5HCAA 1ZM1A 5F5QA 1RVF2 4NN0A 2JG9A 4MX3A 3WOGA 2D5FA 3BIWE 1QGLA 1PO11 2QNKA 4Q4V1 4K1YA 1ZZCA 5I91A 2RS52 3HN1A 1RITA 1YI9A 5E89A 1W6MB 2V73A 4D94A 4AHXA 3WDWA 3WP4A 1BEV2 2IZWA 2D6KA 3WVJA 1J1TA 2Z79A 4P9LA 5FDBA 1WGPA 3KCXA 3AM2A 4I09A 4M3CB 3AJYA 2BNOA 3DL3A 4RGAA 3AKRA 1G9AA 4Z92B 1RUG2 3AMNA 3IPVA 4R52A 4KGGA 5DDJ3 1COV2 5IK7A 1K5MA 1H2MA 3AZXA 4WM8C 3TN92 1AR72 3ZSEA 1X7NA 2P3JA 1BCXA 4XFGA 1LCLA 1RTVA 4KU8A 2GMPA 1BVP1 1DZTA 1W0OA 1ZREA 1OA2A 4Y22A 1OPOA 1OQDA 4OI1A 3UJQA 4YM1A 4N53B 3WXPA 1UL9A 4GKXA 2A6WA 2RE9A 2IFRA 5CFCB 5AFBA 2XUMA 1H8TC 1V6LA 2B42B 1GZWB 1CAVA 1W6NB 2DCZA 2G9FA 4JRAA 1C5HA 2DF7A 1B35A 4Q4X3 2XVKA 4IV1A 1VIWB 1VRH2 3AKQA 2RJLA 2BNMA 3M3IA 5L7OB 4UW3A 5FREA 1V6NA 3KT1A 1AR92 1MVQA 5JPMB 2WZPP 2HWC1 1ZA4A 4FPGA 1RUOA 3ZN4A 1O3RA 2P3IA 2ZGOA 2X5IA 2P2KA 2WNVA 3QH7A 1UF2C 1ENRA 2ZJCA 4YM3A 4N90A 3BODA 1ND3C 2GALA 2CWMA 1NLSA 1Q8VA 1YFXA 2BNNA 3MF6A 3U11A 1SFYA 4HANA 2P17A 2GMMA 4P5HA 2VXRA 4OVEA 4PBPA 4QPGA 2WNUB 1C4RA 1VBE3 3AFKA 4QPGB 4B4RA 5GLUA 2JKBA 2CTVA 4LULA 1FOD1 4XFBA 5CB7A 1R083 3VZNA 2GZWA 3LGRA 2XBO3 4R8HA 1CESA 2GNTA 4K7JA 5L19A 2ZGMA 2RMU3 5JZGB 1O5LA 2FMDA 5DUXA 3A0NA 5FLIA 1VAKA 3L2HA 5CG9A 2EALA 3LWCA 1HW5A 1D4M2 1MEC2 2OZ6A 3RMYA 5I93A 3KM5A 3CLPA 1AYM2 3ZXJA 5ABJB 3I54A 1DQ2A 4QD2A 4BMBA 1PO12 3THTA 1Z0HA 4LLOA 4LBQA 2JXAA 2R16A 3B5LB 1VBB2 1A3KA 1S0GA 4EN6B 2YHJA 1PO22 2ARBA 4NPRA 1R092 4A7YA 1OSGA 1R091 4FAGA 5GM0A 5T54A 2C0ZA 4WBBA 4HK9A 4HT1T 1G9DA 4WM7B 4PLMA 1POV3 5FMOL 3EHKA 3ZXGA 1DG6A 1AL23 1HRV2 2JECA 1FV3A 1Y3TA 4NR1A 2OVUA 1K5MC 4URTA 1DGRA 3UKTA 2I07B 4FT8A 1ZYBA 3N7MA 3WINE 4IEOA 2PHDA 1QJU1 1VBB1 4JQRA 1D0GA 3GZUC 1ENSA 4L8QA 1G8WA 1ZVFA 4TWTA 1YIFA 3HD8B 3CNAA 1BKZA 2XHKA 3EBRA 3T1MA 4N43A 4KWLA 4HVOA 1IHMA 4QQOA 2WNEA 4FOVA 1AHSA 1H8TA 2QJVA 3VBHB 3SMHA 4LBQD 2HWD2 1X50A 3VHPA 3O0XA 3MLJA 4C91A 3NKTA 3C2UA 4HFSA 2QFEA 3RYRA 3SXWA 4R4XA 4BM8A 3MICA 5JI9A 1DF0A 2PAEA 4JGYB 4IETA 1DQ1A 2VNRA 3MFAA 4V1PA 1CAUB 3TBDA 3OTFA 3B93A 2VVFA 3RJRA 1DQ5A 3QBQA 2X5IC 4MXVA 4TSVA 3FFZA 3PMSA 4G9SB 2DVDA 1EYBA 1V6MA 5D8AB 5D8AA 2BQPA 5FQ0B 1H1MA 1LTEA 4N7IA 3URFA 1HV0A 1ND3A 1VBA3 4GKYA 1QY4A 3H3UA 3ECQA 3MIEA 3PLQA 5GZEA 4CEWA 5LK7B 5GLZA 1OI6A 1LOAA 4AGVA 2BYVE 3ZFFC 2H6CA 2RS11 4QPIB 1URXA 4G3YC 4AXOA 3B9IA 1OOPB 4D7YA 5AC91 2WT2A 2ZMNA 4HL0A 1BEV1 4YVSB 2R071 2Z69A 4XJ8A 4Y1UA 2PLV2 1CX4A 4AVTA 5K0UB 1BYHA 4YRDA 1KJLA 1SLAA 1ENQA 4JDNA 4K40A 1PGW2 2B8MA 1UD1A 3R4SA 4GQ7A 2MHFA 2ZGSA 1RUF1 1LJ7A 1MQTA 4Q4W1 1NY71 5AVAA