1YITH

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
171
structure length
160
Chain Sequence
b'KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 160
sequence length 171
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 1yitH00
5H1SO 4IO9J 3G6EH 5AN9F 4WFNJ 3CMEH 2PA2A 1VQPH 3CCJH 1VQ7H 1W2BH 2QEXH 4IOCJ 1VQMH 5GADN 1Q82J 1S72H 3I56H 1VQ4H 1M1KJ 1VQLH 1M90J 1VQKH 4UY8M 3DLLJ 3CCEH 3PIOJ 1K8AJ 4IOAJ 3OW2H 1YJWH 2ZJPJ 1NJIJ 3I55H 2OTLH 1Y69K 1QVFH 1KC8J 5HL7J 3CC7H 5JVHJ 5JVGJ 2ZJQJ 3CCVH 4WFAJ 4U67J 1N8RJ 3CCMH 5MLCO 5DM6J 4WCEJ 3G4SH 1YI2H 5GAEN 3CPWH 3CD6H 2OTJH 1Q7YJ 1VQOH 1K73J 5GAGN 3CXCH 1Q81J 1K9MJ 3CC4H 3CCQH 5GAHN 4WF9J 1Q86J 3CCSH 3CCRH 1KQSH 2QA4H 3CC2H 1YITH 1YIJH 3CF5J 3CCUH 2ZJRJ 4WFBJ 3G71H 3CMAH 1VQ8H 1YHQH 1YJNH 5DM7J 1VQNH 1WKIA 3CCLH 1JJ2H 1VQ9H 1VQ5H 1KD1J 3J7ZM 1YJ9H 3PIPJ 1VQ6H 1QVGH
chains in the Genus database with same CATH superfamily
1VDVA 3EUB4 4X46A 5H1SO 4IO9J 3G6EH 1YTDA 5AN9F 4WFNJ 3CMEH 5AYXA 3NVVC 2PA2A 5HUOA 2DSJA 2I14A 2OMDA 2E3TA 1SIJA 1VLBA 1VQPH 1RM6A 2J0FA 1FO4A 1VQ7H 3CCJH 1W2BH 3GNNA 2QEXH 4IOCJ 1VQMH 1FFUB 2B7PA 1YTEA 5EP8A 5GADN 1Q82J 3BIIE 3FAHA 2TPTA 4GA6A 2WK5A 3SR6C 1QPOA 3I56H 1S72H 1VQ4H 1M1KJ 1VQLH 2Q5WE 3ETRC 1M90J 1VQKH 4UY8M 3DLLJ 3CCEH 3PIOJ 1K8AJ 1QPNA 3OW2H 1YJWH 4YYYA 4C80A 4IOAJ 4LHMA 2JBMA 2WK6A 3WNZA 2ZJPJ 2W3SB 1NJIJ 3WO1A 3L4PA 2W3RB 4EAFA 4GA5A 4USAA 3I55H 2OTLH 3C2EA 3TQVA 1Y69K 1QVFH 1KC8J 5HL7J 1N62B 2W55B 4ZOHA 4C7YA 1QPQA 3CC7H 1OTPA 2B7QA 4XR5A 5JVGJ 5JVHJ 2ZJQJ 3CCVH 1FFVB 1QPRA 3RPFA 4WFAJ 4U67J 1N8RJ 1ZXIB 3CCMH 4US9A 5MLCO 5DM6J 1JRPB 3L0GA 4WCEJ 3AN1A 1FIQC 1BRWA 3G4SH 1SB3A 3WO0A 1YI2H 4C7ZA 5MPOC 4US8A 1DGJA 5GAEN 3CPWH 3CD6H 2OTJH 2B7NA 5EY3A 1Q7YJ 1QAPA 3H5QA 1VQOH 1K73J 3C2RA 5GAGN 3NRZC 5AYYA 3CXCH 1Q81J 3C2VA 1K9MJ 1X1OA 1AZYA 3CC4H 4GA4A 3PAJA 4EADA 1JROB 1NVJA 1N63B 1O4UA 3CCQH 4YEKA 5GAHN 4WF9J 1Q86J 3CCSH 3CCRH 1KQSH 2I1OA 2QA4H 3CC2H 1YITH 1YIJH 3CCUH 3CF5J 1N5WB 1WYGA 2ZJRJ 2W54B 1UOUA 4WFBJ 3G71H 3CMAH 1VQ8H 3B9JC 3AMZA 1YHQH 1YTKA 3FC4A 1YJNH 4KWWA 5AYZA 1FMAE 5DM7J 1N60B 5HULA 1NVIE 3C2OA 1VQNH 2QIEA 1WKIA 3C2FA 3NVZC 3CCLH 3VMMA 1JJ2H 3NS1C 1VQ9H 3NVYC 1N61B 3NVWC 1N5XA 4I9AA 5HUPA 3AM9A 1VQ5H 1KD1J 2WP4A 3J7ZM 1YJ9H 3PIPJ 1FM0E 1V97A 4AP8A 1VQ6H 4KWVA 1QVGH
chains in the Genus database with same CATH topology
5H1SO 4IO9J 3G6EH 5AN9F 4WFNJ 3CMEH 2PA2A 1VQPH 3CCJH 1VQ7H 1W2BH 2QEXH 4IOCJ 1VQMH 5GADN 1Q82J 1S72H 3I56H 1VQ4H 1M1KJ 1VQLH 1M90J 1VQKH 4UY8M 3DLLJ 3CCEH 3PIOJ 1K8AJ 4IOAJ 3OW2H 1YJWH 2ZJPJ 1NJIJ 3I55H 2OTLH 1Y69K 1QVFH 1KC8J 5HL7J 3CC7H 5JVHJ 5JVGJ 2ZJQJ 3CCVH 4WFAJ 4U67J 1N8RJ 3CCMH 5MLCO 5DM6J 4WCEJ 3G4SH 1YI2H 5GAEN 3CPWH 3CD6H 2OTJH 1Q7YJ 1VQOH 1K73J 5GAGN 3CXCH 1Q81J 1K9MJ 3CC4H 3CCQH 5GAHN 4WF9J 1Q86J 3CCSH 3CCRH 1KQSH 2QA4H 3CC2H 1YITH 1YIJH 3CF5J 3CCUH 2ZJRJ 4WFBJ 3G71H 3CMAH 1VQ8H 1YHQH 1YJNH 5DM7J 1VQNH 1WKIA 3CCLH 1JJ2H 1VQ9H 1VQ5H 1KD1J 3J7ZM 1YJ9H 3PIPJ 1VQ6H 1QVGH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H1S O;  4IO9 J;  3G6E H;  5AN9 F;  4WFN J;  3CME H;  2PA2 A;  1VQP H;  3CCJ H;  1VQ7 H;  1W2B H;  2QEX H;  4IOC J;  1VQM H;  5GAD N;  1Q82 J;  1S72 H;  3I56 H;  1VQ4 H;  1M1K J;  1VQL H;  1M90 J;  1VQK H;  4UY8 M;  3DLL J;  3CCE H;  3PIO J;  1K8A J;  4IOA J;  3OW2 H;  1YJW H;  2ZJP J;  1NJI J;  3I55 H;  2OTL H;  1Y69 K;  1QVF H;  1KC8 J;  5HL7 J;  3CC7 H;  5JVH J;  5JVG J;  2ZJQ J;  3CCV H;  4WFA J;  4U67 J;  1N8R J;  3CCM H;  5MLC O;  5DM6 J;  4WCE J;  3G4S H;  1YI2 H;  5GAE N;  3CPW H;  3CD6 H;  2OTJ H;  1Q7Y J;  1VQO H;  1K73 J;  5GAG N;  3CXC H;  1Q81 J;  1K9M J;  3CC4 H;  3CCQ H;  5GAH N;  4WF9 J;  1Q86 J;  3CCS H;  3CCR H;  1KQS H;  2QA4 H;  3CC2 H;  1YIT H;  1YIJ H;  3CF5 J;  3CCU H;  2ZJR J;  4WFB J;  3G71 H;  3CMA H;  1VQ8 H;  1YHQ H;  1YJN H;  5DM7 J;  1VQN H;  1WKI A;  3CCL H;  1JJ2 H;  1VQ9 H;  1VQ5 H;  1KD1 J;  3J7Z M;  1YJ9 H;  3PIP J;  1VQ6 H;  1QVG H; 
#chains in the Genus database with same CATH topology
 1VDV A;  3EUB 4;  4X46 A;  5H1S O;  4IO9 J;  3G6E H;  1YTD A;  5AN9 F;  4WFN J;  3CME H;  5AYX A;  3NVV C;  2PA2 A;  5HUO A;  2DSJ A;  2I14 A;  2OMD A;  2E3T A;  1SIJ A;  1VLB A;  1VQP H;  1RM6 A;  2J0F A;  1FO4 A;  1VQ7 H;  3CCJ H;  1W2B H;  3GNN A;  2QEX H;  4IOC J;  1VQM H;  1FFU B;  2B7P A;  1YTE A;  5EP8 A;  5GAD N;  1Q82 J;  3BII E;  3FAH A;  2TPT A;  4GA6 A;  2WK5 A;  3SR6 C;  1QPO A;  3I56 H;  1S72 H;  1VQ4 H;  1M1K J;  1VQL H;  2Q5W E;  3ETR C;  1M90 J;  1VQK H;  4UY8 M;  3DLL J;  3CCE H;  3PIO J;  1K8A J;  1QPN A;  3OW2 H;  1YJW H;  4YYY A;  4C80 A;  4IOA J;  4LHM A;  2JBM A;  2WK6 A;  3WNZ A;  2ZJP J;  2W3S B;  1NJI J;  3WO1 A;  3L4P A;  2W3R B;  4EAF A;  4GA5 A;  4USA A;  3I55 H;  2OTL H;  3C2E A;  3TQV A;  1Y69 K;  1QVF H;  1KC8 J;  5HL7 J;  1N62 B;  2W55 B;  4ZOH A;  4C7Y A;  1QPQ A;  3CC7 H;  1OTP A;  2B7Q A;  4XR5 A;  5JVG J;  5JVH J;  2ZJQ J;  3CCV H;  1FFV B;  1QPR A;  3RPF A;  4WFA J;  4U67 J;  1N8R J;  1ZXI B;  3CCM H;  4US9 A;  5MLC O;  5DM6 J;  1JRP B;  3L0G A;  4WCE J;  3AN1 A;  1FIQ C;  1BRW A;  3G4S H;  1SB3 A;  3WO0 A;  1YI2 H;  4C7Z A;  5MPO C;  4US8 A;  1DGJ A;  5GAE N;  3CPW H;  3CD6 H;  2OTJ H;  2B7N A;  5EY3 A;  1Q7Y J;  1QAP A;  3H5Q A;  1VQO H;  1K73 J;  3C2R A;  5GAG N;  3NRZ C;  5AYY A;  3CXC H;  1Q81 J;  3C2V A;  1K9M J;  1X1O A;  1AZY A;  3CC4 H;  4GA4 A;  3PAJ A;  4EAD A;  1JRO B;  1NVJ A;  1N63 B;  1O4U A;  3CCQ H;  4YEK A;  5GAH N;  4WF9 J;  1Q86 J;  3CCS H;  3CCR H;  1KQS H;  2I1O A;  2QA4 H;  3CC2 H;  1YIT H;  1YIJ H;  3CCU H;  3CF5 J;  1N5W B;  1WYG A;  2ZJR J;  2W54 B;  1UOU A;  4WFB J;  3G71 H;  3CMA H;  1VQ8 H;  3B9J C;  3AMZ A;  1YHQ H;  1YTK A;  3FC4 A;  1YJN H;  4KWW A;  5AYZ A;  1FMA E;  5DM7 J;  1N60 B;  5HUL A;  1NVI E;  3C2O A;  1VQN H;  2QIE A;  1WKI A;  3C2F A;  3NVZ C;  3CCL H;  3VMM A;  1JJ2 H;  3NS1 C;  1VQ9 H;  3NVY C;  1N61 B;  3NVW C;  1N5X A;  4I9A A;  5HUP A;  3AM9 A;  1VQ5 H;  1KD1 J;  2WP4 A;  3J7Z M;  1YJ9 H;  3PIP J;  1FM0 E;  1V97 A;  4AP8 A;  1VQ6 H;  4KWV A;  1QVG H; 
#chains in the Genus database with same CATH homology
 5H1S O;  4IO9 J;  3G6E H;  5AN9 F;  4WFN J;  3CME H;  2PA2 A;  1VQP H;  3CCJ H;  1VQ7 H;  1W2B H;  2QEX H;  4IOC J;  1VQM H;  5GAD N;  1Q82 J;  1S72 H;  3I56 H;  1VQ4 H;  1M1K J;  1VQL H;  1M90 J;  1VQK H;  4UY8 M;  3DLL J;  3CCE H;  3PIO J;  1K8A J;  4IOA J;  3OW2 H;  1YJW H;  2ZJP J;  1NJI J;  3I55 H;  2OTL H;  1Y69 K;  1QVF H;  1KC8 J;  5HL7 J;  3CC7 H;  5JVH J;  5JVG J;  2ZJQ J;  3CCV H;  4WFA J;  4U67 J;  1N8R J;  3CCM H;  5MLC O;  5DM6 J;  4WCE J;  3G4S H;  1YI2 H;  5GAE N;  3CPW H;  3CD6 H;  2OTJ H;  1Q7Y J;  1VQO H;  1K73 J;  5GAG N;  3CXC H;  1Q81 J;  1K9M J;  3CC4 H;  3CCQ H;  5GAH N;  4WF9 J;  1Q86 J;  3CCS H;  3CCR H;  1KQS H;  2QA4 H;  3CC2 H;  1YIT H;  1YIJ H;  3CF5 J;  3CCU H;  2ZJR J;  4WFB J;  3G71 H;  3CMA H;  1VQ8 H;  1YHQ H;  1YJN H;  5DM7 J;  1VQN H;  1WKI A;  3CCL H;  1JJ2 H;  1VQ9 H;  1VQ5 H;  1KD1 J;  3J7Z M;  1YJ9 H;  3PIP J;  1VQ6 H;  1QVG H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...