1YITV

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yitV00
2QA4V 1YHQV 1K8AW 3CC4V 1VQLV 3G71V 3CD6V 1YJNV 1NJIW 1VQ6V 1Q82W 3CMAV 1QVGU 3CMEV 1YJ9V 1M90W 1YJWV 3CCVV 1KD1W 1VQ5V 1W2BU 1VQ9V 3OW2U 1JJ2U 3CXCU 1VQOV 1Q7YW 3CCJV 3CCLV 3CCSV 4WFBV 1VQNV 5DM6V 3CPWU 1N8RW 3CCEV 4WCEV 4WFAV 1R73A 1VQ4V 2OTJV 1KQSU 2QEXV 1Q81W 2OTLV 3CCUV 4WF9V 3CC7V 1VQPV 1YITV 1QVFU 3G4SV 1M1KW 1VQ7V 3G6EV 3I56V 3CCMV 1VQKV 3CC2V 1VQ8V 1Q86W 3I55V 1VQMV 1K73W 1YI2V 1YIJV 1KC8W 3CCQV 1K9MW 1S72V 3CCRV 2D3OW
chains in the Genus database with same CATH superfamily
4DV6O 3FKSG 4KXRA 4X65O 2B5UA 3A8TA 2YSUB 3CCVV 1JFFA 1AR1B 1VMGA 4J9ZB 1YTFB 3ZRWB 3CSXA 5KUMA 1IBKO 3N2KA 1K4CC 4J41A 1SC5B 4J7JA 1GKFA 4FZ0A 3E83A 1F23A 1N34B 1AJPA 3NR7A 3SYQA 1HP8A 1MMMA 3D3IA 4O4IB 2ZE7A 3Q4HA 4RAIA 3LNNA 5LGTA 1Q6IA 1THZA 1Q90D 3JAKA 1VIBA 3T1CA 3AG7A 4DYLA 2EULA 1TUEB 1ZL8A 3BFRA 2NR5A 3K9SA 4TSFG 1WP7A 3CCQV 3SYCA 1PPJH 4N21A 2DYSB 1QQCA 5BMVB 2XUMA 2JEUA 1R3LC 2UUBO 1OCRB 2QTOA 4HBNA 3SR2C 3SYAA 1VQNV 1AI4A 2DYSC 4UVCA 1KQSU 2P4VA 1ZUQA 2R72A 1OCRC 2MK3A 4WFGA 1RPRA 3DXRA 4O4LA 1SQBH 3BAAA 3IC7A 3J81N 5KX5A 3G80A 3OW2U 3ABUA 1H8EG 3TXSA 3OUFA 5H6RA 3T1YO 4DK0A 3B09A 3F5WC 3K0DA 3C3SA 2ZXWB 4NTXA 2HLDG 4BIOA 3DGEA 5LHGA 2ZE8A 2QJ1A 2X0LA 1XNRO 3K3WA 3F7YC 1NT2B 3VQYA 5L3GA 2ZXWC 1I94O 3CMAV 3GWOA 1GTOA 2JS3A 4B3TB 1MZEA 4JAUA 3IAYA 4QGPA 1FKAO 2GHYA 5F2VO 2UU9O 1UFIA 2QE7G 1N32B 2VQFB 4PDMA 3RYIB 1SQVH 1S0VA 2C2AA 4JI6B 4DR6B 5JJJB 3N2GA 4JV5O 1X4TA 3ZHRA 4TT3G 2DWEC 1KP2A 4NTWA 2N74A 5GONA 3JD1A 3RW0A 3K58A 1NR1A 1HR0O 2QTSA 4R6ZA 5B5EZ 2WLJA 4WF9V 1XREA 3G67A 4JI7O 3BPZA 3K57A 1IVSA 3CC2V 1Y76A 1B06A 5EBLC 3G6BA 4PA3A 4P9PA 3RFRA 1WPBA 3VBBA 3HKEA 1M56B 1VF6A 5LP6B 4DR2B 4JI5B 1L8DA 1QU7A 2H8PC 3FB5C 4X1YA 2XTAA 2CDYA 4JI1O 1AI7A 3H1IH 4WBNB 5CN0A 2K9PA 1M56C 1FFTB 5LP6C 3FAVB 3N2KB 2ZINA 2YIAA 4LF5B 1S72V 2QWRB 2LFSA 2ZDIA 3E8GA 3Q4HB 2VQEO 5CA1A 4RQFA 5BXZA 1BE3H 1V9PA 1ZAUA 3I55V 4FM2A 3D36C 2HFEC 3ABKB 3OT7A 1UJWB 3MD0A 2Y48A 3RYHB 5KLVH 2EJ7A 4YY3O 3ABKC 1K5QA 3B40A 1XI1A 2X6BA 1Y4MA 1KBHA 3J80N 1OHHG 2ZCEA 2Q67A 2QWQB 1BHAA 1Q5OA 4MVMA 4U3FH 2IBZH 2N05A 3E35A 2YC0A 1AJQA 3HKBB 5JVDA 2ZE5A 3GWKC 4B08A 1XHZA 2UUCB 3WU2Z 2EJRA 4X89A 1K92A 3DXRB 4O4LB 5KMGA 4MTFA 4E2LA 1S77D 3ZMUA 4DUZO 4I50A 1M4UA 4TV8A 4UCUA 5AG2A 5JH7B 4QPKA 1JR9A 1M5IA 1Q8IA 3ETGA 4BW5A 4TUYB 4LF9B 1SZXA 1PNLA 3TGUH 4DV3O 3QNEA 2GTSA 4ZI7B 4X64O 4FK5C 3JATA 4E4EA 1OZ0A 3CE2A 2PI5A 3CCMV 3L74H 1XQ8A 3E22A 3RYCA 3CCRV 3E8FA 3RBZA 2A3QA 5BY1A 4X65B 2HHHO 3A0RA 4LF7O 1YJWV 2XAGA 3N2GB 1AILA 2G38A 3WB2A 4JYYA 2RJZA 4PELA 1PP9H 4LF6O 3DC5A 5GONB 2R9RB 4Q20A 1DF5A 3LUTB 3U11A 1YITV 3JSLA 2GSMB 4J10A 4LFBO 3DC6A 3E8BA 1NI8A 4MTOA 2Q68A 3N27A 1N36O 1NTKH 2BSKA 2NLJC 3L9DA 3BABA 1OJHA 1OV9A 3HKEB 3ZS8C 4FJCC 3AG1B 1H2LA 4NXMB 4IT5A 4OXSA 1JJOA 4LF4O 5HFLA 4NR1A 4PD4F 2KB1A 3B8MA 4LBEC 4JPRA 1PL4A 3AG1C 1SS3A 1E1QG 3CC4V 1QNMA 4K8XA 1H2NA 4G2KA 2Q0OC 2UUBB 5DN6G 4AQYB 3PN1A 3TETA 4NVPA 4O2BB 1MOFA 2PY5A 3H1KH 1COWG 3ZN1A 3MHSC 3LNMB 5JWPA 2ZDIC 2HJFC 1URFA 2YEVA 5IT9N 2RN9A 1YF2A 5LXTA 2PYLA 5EBMC 2HKOA 5FNVB 2DYRB 4WFBV 4O4HB 2AGAA 2PGGA 1R73A 3T1YB 4CC6A 3P32A 4IHJB 3ZN0A 1JQ0A 2JRIA 1NU1H 2DYRC 1V55B 1XNRB 1I5XA 2QDOA 3CX5F 2IU0A 3QO5A 2V1DA 3A0HZ 4LFAO 2KG7B 1S76D 4JI0O 3ZRWA 4TQDA 1F7YA 1I94B 4F6RA 5J2UA 1LR1A 3STLC 1V55C 2Q69A 3L71H 5JVDB 1VQOV 4DR7O 5H6QA 2XAHA 4DV7O 3DTUB 2QM7A 4U3JB 4GX5A 1HWYA 4L8JA 2BTQB 2D3OW 2P90A 4CH3A 1XNQO 1L0NH 2DWDC 1W59A 2FTKA 2E75B 1M90W 5HFMA 3ZMZA 5H9CA 3JASB 1HR0B 4GKKO 4B3SO 2P67A 1J5EB 5DECA 4YJ2B 5J2TA 4JI7B 3OE7G 3SJBC 3G6EV 5BMVA 4J9YB 4DV4B 1DTOA 2CUGA 5IWAO 3IGAC 4I9QA 3SPJA 4DR4B 5C8YB 1EZJA 4LF8B 3WB0A 4OGQB 5B66Z 4C7UA 4JASA 3RYCB 3SJAC 2M7WA 4N23A 4JYCA 2YI8A 1K5SA 5LMNO 4DR3O 2L35A 3W7WA 4TWKA 2CH7A 1L0LH 4RUFA 1O9GA 1I5YA 1FFXB 5EYPA 1H2SB 1IBLB 2BOCC 2GDSA 1Z2GA 4CH6A 1PL0A 3OMAB 1IDSA 3VQVA 1US6A 3ZX6A 2UXBO 2BSKB 1WA8A 4X9QA 1Y67A 2VQEB 2P7TC 3ZHQA 3VQXA 1MNGA 5EZYA 4PV1B 2RCVA 3K9AA 4UUJC 4ABMA 4NTYA 4JI4O 1Q43A 4YHHO 2ZQMA 2K1EA 1SQGA 1MG1A 3AK1A 3ASOB 2NN4A 3E86A 1W2BU 1MSWD 3T1HO 4GX0A 1S5HC 1E79G 2W0XA 1YDXA 4J7KA 4PA7A 4DV0O 1VF5B 2DE0X 4X20B 4DR5O 3ASOC 2CK3G 4I55B 3CRMA 4GCZA 3L75H 4I5SA 3U10A 4CH4A 1VQLV 1HNWO 1ORQC 1CPYA 1JA8A 4X62B 1QR8A 4FLVA 2DJVA 3R66A 2ZM6O 5LOVA 2Y69B 2W6JG 3NXSA 2QWNB 4BIZA 3CRCA 3E89A 4KHPO 4OX9O 2JVDA 4PA6A 2Y69C 1YIJV 5CB4B 3AK3A 2OCCB 5LP6A 4B3MO 4WBNA 2EIJB 4IGGA 3SGIA 3IFXA 4HYOA 2OCCC 2B1IA 3K59A 3FAVA 3D8CA 5J2UB 4X64B 4P9OA 4F6RB 2ZIMA 2ZR2A 4FMTA 3CRQA 2WLIB 3HKDB 1JVMA 2EIJC 5KHIA 1TAEA 4L87A 1VP7A 2YXHA 1GM9A 4X8AA 5LHIA 3ABMB 1SQFA 4LF7B 3ETDA 3D36A 3K5LA 2OIGA 2B9ZA 4K8ZA 5CBHA 4LH6A 2YS8A 4DV5B 1EZVH 5JCOA 2P06A 1SKVA 3UM7A 4LF6B 2UXXA 3ABMC 3LSQA 5KAIZ 2PYJA 4DV2B 4JYBA 1CEZA 5IYZB 5J2TB 1U96A 2HVKC 4B7KA 1WN7A 3RYHA 4FIPC 4KP4A 2ODMA 1DLBA 4X1IB 4B7EA 2JGDA 2GV9A 4EKWA 4UCSA 1PNMA 3R65A 4YJ3A 1WB8A 3B4SA 4P2ZA 3HKBA 2CGNA 2Y0IA 4MT8A 1NTMH 5IYDO 5IY5B 1OCZB 2ZR3A 2CH7B 1IBMB 2E3CA 1R3IC 1QBZA 3ZMSA 4I0XA 2UXCO 3STZC 2LGWA 5EYPB 1OCOB 2DW4A 3MAQA 5IY5C 2IJKA 5JH7A 2F66C 2Z5UA 1ZTEA 1OCZC 4LNUB 3MHHC 4O4JB 1WA8B 1OCOC 4TUYA 5EZYB 3WB1A 3T4DA 1L1FA 4ZI7A 2F1MA 2E74B 4JF3A 3CCJV 4K0KO 3I5DA 4RWUA 3ZRSA 2XAJA 4U7OA 1GMGA 3SPGA 3EHBB 3CRAA 1NBMG 2A7WA 4MVSA 1BGYH 2JEXA 1QR9A 3F5TA 1AP6A 1EN5A 5B1NA 3ZBHA 3TXQA 3DSQA 2CTWA 1B6QA 1YSCA 2PF4E 1GRJA 2FMLA 3A2FA 5KHGA 1HNZB 3IC9A 2CGOA 5LOVB 3F7VC 3ZIAG 3K5NA 4H37A 3S3WA 5IJ9B 3EXAA 3OAAG 1LNQA 4K35A 4WFEA 4JI2O 2WA3A 2WPDG 4J11A 5CMUA 5CA3A 4YIOA 3BY6A 1DGSA 3OUSA 1N8RW 3CCEV 2QKSA 4GKKB 2A06H 1AJNA 1K7DA 3SYOA 4BW9A 2Q0AA 1AP5A 1P7GA 2CE4A 2Q7GA 3W7SA 1Q86W 1ROPA 3OFNG 3K0GA 3QO7A 4WFHA 3CYOA 4DK1A 4G27B 3OM3B 2JS5A 3ABLB 1P84F 3FX7A 4JTCB 2OWOA 1G4YB 4O2BA 2W0FC 3OTOO 1K3EA 2OT5A 2X6AA 3ABLC 5EBWC 5LMNB 4QJFB 4U7NA 2XOKG 3UKMA 4GZRB 1XMOB 1BCCH 3CRRA 2Q8VA 4LWSB 3K5OA 5FNVA 4UFZA 4O4HA 1K34A 1K33A 5JCOC 4IHJA 4JZGA 3BA8A 1EN6A 2OCHA 5CBFA 2VWKA 4UVAA 4PDRA 2QEXV 3FYIB 2JGDB 1Z5VA 1QCEA 2JIZG 4ZKIA 2CTPA 2KG7A 1O9HA 1NZ6A 4YJ3B 4QIWF 4JI4B 4UCOA 3JD2A 4Q6GA 4YHHB 3CMEV 5DEDA 2BCCH 3PJSK 5H2FZ 1FS0G 1KU9A 3FB8C 5BR8O 2H94A 4U3JA 4EFEA 2IH1C 5LA6B 3KKYA 4I0XB 3KZIZ 2BTQA 3K08A 1N0NA 1S5JA 4UCRA 1VQKV 4NXNO 4BWAA 3H1JH 3ZHTA 1SETA 2YUAA 2JJ2G 3CJHB 3JASA 2VS0A 4H13B 3OGCC 1P4RA 1XBLA 2ADQB 4YJ2A 4KL1A 1NS1A 2ZM6B 3JALB 2WAMA 2AXTZ 1AR4A 5LGUA 4YIPA 3HKCA 4J7ZA 4D7TA 3E2EA 4JI8B 4OX9B 4J42A 2A9HA 4DV1O 5C8YA 5KA5A 2BE3A 3ZCCA 1GO3F 4P30A 1ZWIC 4DV6B 1R3JC 3EVKA 1VQ9V 1TVKA 1NKDA 1BZKA 3UCSC 3W7TA 2GBOA 1IBKB 4A5UB 1NVPD 1FFXA 3L73H 1IZ3A 1KECA 2KKWA 1TUBB 3CEIA 4AILC 3K03A 2DQ3A 4ZOLA 5CA0B 1ZSPA 2HP8A 2HR3A 4X66O 1SF9A 2GUZB 3K04A 1M9NA 1F4MA 3C90A 2F95B 5K1PA 1PV0A 5B3SB 4LP8A 4FFKA 3W7UA 1F51A 1G8MA 5L3EA 4EEQA 5B3SC 1KKCA 1Y74A 4HAMA 1H2MA 2RQ6A 4X20A 2E5LO 4W4KA 4I55A 2CTQA 5H5NA 1S5LZ 2PTMA 4I4TB 2LGQA 2DN9A 1YEWA 3E8HA 1I08A 1Q3EA 5D5PA 4LFCO 1IX9A 1EN4A 4KUMA 3WFVA 1Q82W 2D2CB 2ARHA 4PJ0Z 1GAXA 5E79Z 1NVPB 2Z3YA 5CB4A 1HNXO 2YICA 1QLEB 4MTXA 4PDLA 4GX1A 4TOIA 1YCIA 1B04A 5KHHA 3ETEA 1QLEC 5IYBO 2Z0AA 1Q7YW 2QR4A 3VOUA 3CCLV 1A32A 2WLIA 1WPXA 1XUQA 3AG3B 3HKDA 2IJJA 4LCUC 1N32O 3FB7C 4BAYA 2UU9B 1SA0A 3AG3C 3LDDA 4JV5B 2GTAA 4J80A 4D7SA 5IJ0B 3T4ZA 2EBOA 5IYZA 1DF4A 1M1KW 2Q6AA 4MVZA 3P3NA 5LBQA 3QO8A 3HKCB 2AW9A 3KCXA 4X1IA 4RO2A 4DR2O 4JI2B 1BHBA 5KUKA 1WLEA 3J7AU 3LDEA 3BCCH 2EILB 3OR7C 4H44B 2EX3A 2XNDG 4MVRA 4JI1B 1TVKB 2LW1A 1BQ0A 4B3RO 4FLUA 2N04A 3G4SV 4FM0A 4LF5O 1KB9F 4FLWA 1QHTA 5B1OA 2F43G 3L70H 2EILC 3ICXA 2LJ2A 2FL4A 1D5NA 4O2AB 1PNKA 4HNAB 2QM4A 1U97A 4LNUA 1FJGO 4ZOLB 1XDCA 4O4JA 3BHPA 4DW1A 3OTOB 2HG5C 1QVFU 5LGNA 2EZPA 4QPJA 1YHQV 4F6EA 3ETQA 2WSSG 4PA4A 1LUWA 2AHZA 4XDLA 4EB6A 3GB7C 4CS2A 2IJHA 1Y74B 1LUVA 4YY3B 3APOA 1BQZA 2YDEA 2IJIA 3ZMTA 1IXBA 3APQA 1I7FA 3EFFK 1RPOA 4IYHA 1AVMA 3JCUZ 3OEHG 1K8AW 2WWWA 5LYJA 3T2MA 5DM6V 3CPWU 2IU3A 5BR8B 3RT3C 3ZRXA 4XBFA 4QE7A 4DUZB 1VQPV 5IJ9A 4GX2A 2EINB 4RQEA 4NXNB 3SPCA 2ZKOA 1R1BA 4JI3O 3QF7A 4CC5A 1MZFA 5J9PC 3QG5A 5KA6A 1UPGA 2QKCA 3U0ZA 2LO1A 2EINC 4ASUG 2ZD9A 1XMQO 4DV3B 2ETNA 4UB8Z 2YIBA 2EIMB 2ZE6A 1VEWA 2FKXA 4GYCB 2DMXA 2B1GA 4XDJA 1JPXA 2EIMC 2WLLA 1RSOB 3JAWB 2ZIOA 5BZBA 2O57A 3ML0A 2LQTA 1SA0B 3K5MA 4UCVA 3RGBA 4QNHB 1AROP 2IM9A 2HHHB 4MS2A 1N33O 2P6JA 4DXWA 2Y4UA 3AG2B 2UXNA 4MSWC 5LMUO 1PM9A 5KHKA 1XHXA 3SPIA 3ZHUA 4LWSA 5D5QA 5L3DA 4LFBB 2NNUA 3FFQA 4MW3A 1FXKA 3AG2C 2BOBC 2M6YA 4UB6Z 1N36B 5A9GA 1MA1A 4X66B 1VQ5V 3C3TA 2XAFA 5EC1C 4NXMO 2WLHA 2XHBA 1ENVA 1JX9A 2X7RB 4K3AA 1WNSA 2EIKB 4LF4B 1YI2V 4DR1O 2IW5A 2F4VO 1KKDA 4H0LB 1FXVA 1VQ6V 1RP3B 2YXLA 2EIKC 4AQYO 5LA6A 1S3JA 5FPRA 3RVYA 1H8HG 3ZEDA 2E5LB 1ZLZA 1VQ4V 5KAFZ 2HJDA 1SRYA 4NB5A 2WLMA 3CJHA 4FFBA 3H1LH 4LFCB 2YIBD 4GT1A 3THOA 2P22C 4GUNA 1K4DC 2VWJA 3UT5A 1XILA 3KCYA 5GTIZ 4G28B 4ZHQA 3JALA 1SERA 3M7MX 2R70A 1GN6A 3WG7B 3ABTA 2L6LA 3BRCA 2KQXA 2F93B 1AR5A 1WP8A 1XOUA 4EB6B 4PA9A 1AB3A 2EZOA 1CP9A 3WG7C 4DUYO 1HNXB 1KC8W 2JDIG 2YXYA 1NR7A 3RVZA 2OIEA 4LFAB 5GW7A 3M8AA 3GVMA 4XDKA 1YXBA 3G71V 3CD6V 4JI0B 3JAMN 2UUAO 4ICGA 4DR7B 1WB7A 5LYJB 4DV7B 1TUBA 1NTZH 1Q81W 2ZNIA 3RN4A 5K1XA 5CA0A 3CS5A 3I56V 3FB6C 1RM1B 2KSDA 1FD9A 1SESA 2GUZA 3B77A 1EBOA 3JCZA 3JARB 3RYFA 1XNQB 2ATKC 2Y4TA 1RM1C 2QSAA 3D3QA 2AZ2A 5KHJA 1J5EO 1SQQH 4B3SB 3JYCA 4DV4O 1TA8A 1VQMV 1BL8A 4JYAO 5IYCO 4DR4O 1GN3A 5IWAB 4LF8O 1Y6XA 4I4TA 2WLLB 4DO2A 1JJ2U 2PI4A 2JJ1G 2VRZA 3CCSV 2ZT9B 2P5OA 1JFFB 4WFFA 2Q5ZA 4CBCA 2PZSA 4B3RB 2QWPB 3A0BZ 1AI5A 5ITZA 4DR3B 1PD3A 1H2KA 3LDCA 1BS3A 4YXWG 3BVOA 1IBLO 1TGOA 4MVOA 3FYEB 3UO3A 1FYJA 4DRXA 1JOYA 1FXKB 2QKAA 1SQXH 5EC2C 1FJGB 3JD3A 4GLXA 2UXBB 2ZNJA 3OR6C 5TISZ 1XEQA 3JAKB 2XT9A 4ZIBA 4KFMA 1KUQA 3HPLC 4UV8A 4FLZA 1FXKC 1MABG 1ZL8B 3OMIB 4FLTA 4R50A 4PDVA 2ITCC 5JJEB 4OPAA 1SQPH 1CXZB 2F23A 3O65A 3H01A 2YI9A 3O9OA 3UQ8A 4GKJO 3T1HB 3ZRVA 3AK2A 4UXNA 4DV0B 1D2DA 1GM7A 4DR5B 4CS4A 1NQTA 3IJ4A 4JZ2A 3TCUA 1PKXA 3AEIA 3K06A 5LHHA 5IJ0A 5B1BB 4IL6Z 3SJCC 2FB5A 4X62O 2HEPA 3CHXA 3JD4A 4FFBB 2CAZC 4CH5A 3TJTA 1HNWB 4UVBA 1D5AA 2JGUA 2Q73A 3UT5B 5B1BC 4WCEV 4ZHQB 4TQFA 3CP1A 1QLNA 5KX5B 5E1AC 4D6TH 2UXDO 2XASA 2IH3C 4MTGA 4FZ1A 4CS3A 1VQ7V 1GK9A 4KHPB 3ZJZA 5EIBD 4IIJA 5C93A 3W7XA 2AHYA 4JI3B 1YJNV 1NJIW 4B3MB 1QVGU 3ZMVA 1Q6HA 1YJ9V 3SDLA 4HZ3A 4LC1A 5LL6Y 1W0JG 1XMQB 5A2QN 2QM8A 2R9IA 2OTJV 4TV9A 3CC7V 1N34O 5EK0A 3K79A 4R7CA 2WA4A 3MDSA 4O2AA 3OTFA 3ZHVA 1XL4A 1H2GA 1GN2A 4HNAA 2RDCA 1KYOF 3OEEG 3OMNB 2WLKA 2DQ0A 3H1HH 5JQGA 5L3BA 1OCCB 1BSMA 2ITDC 3CXCU 4DV5O 2FYUH 3BEHA 3RYFB 1N33B 5IDJA 3P30A 2BTOA 4FVMA 3CCUV 5LMUB 4DV2O 3OGIB 1OCCC 4W4LA 2A79B 4RUEA 1EFRG 4FLXA 1V54B 1K9MW 1JMKC 3QVNA 4UV9A 1Y76B 2AZ0A 4CZZA 1I0HA 5FPOA 1V54C 4MW8A 4X1KA 2H3OA 2LFRA 4X1YB 4JGSA 3ASNB 2Q4PA 1VF6C 4DR1B 2F4VB 4H33A 4MVQA 1IBMO 5ITZB 1G1XB 1N0JA 5EIBC 1B3QA 1M57B 4Z1VA 4FM1A 2CTRA 3ASNC 4EFBA 4I9WA 2UXCB 4DRXB 1K97A 4JTDB 3TK1A 3LSSA 1HDJA 4ZBMA 2W6IG 1M57C 4FPPA 1GN4A 5CA1B 1T5EA 2V4DA 2LP7A 1K73W 1FAFA 2QA4V 2PUSA 1J95A 1GM8A 1RFYA 2DOSA 2Q7HA 4B3TO 1BMFG 2X6CA 2OYQA 4K0KB 1W0KG 2XAQA 1R6KA 2VQFO 1RSOA 3JAWA 4JI6O 4DR6O 4DUYB 1Q6UA 3B2EE 1R6TA 1DK1A 1AI6A 4R8CA 1M93A 4MVUA 1WAZA 4FLYA 1KD1W 1Y66A 3CWBH 2JK5C 3SJQC 2UUAB 3L72H 3FD9A 1HNZO 4O4IA 5KMGB 3OD4A 4OPHA 4I50B 1VQ8V 2P4KA 5FL7G 4TV8B 5CBGA 1YVWA 3CXHF 1EM1A 3LSUA 4UCTA 1F4NA 2E76B 4JI5O 5L3FA 3VQWA 1VARA 1R3KC 4IIJB 4WFAV 4NYKA 3B8NA 2HVJC 4X88A 3X2QB 5B1AB 3JATB 4TV9B 4JYAB 1P7BA 1WJZA 1VF7A 2YIDA 3JD0A 5IE9A 1HW7A 3M99B 3CB2A 3E22B 3X2QC 5B1AC 2MW2B 4LR3A 2ADPA 5L3CA 1G6UA 3ZHSA 4JAAA 4NKGB 3SYPA 3AG4B 4PI2A 4I7ZB 5JQGB 3BA9A 4QE9A 3JSNA 3QTCA 1XMOO 4F4LA 1ZX3A 2QGNA 1NH2D 3AG4C 1H38A 2Q7EA 1GH6A 4PHZA 1XL6A 3HR0A 1P49A 2A0LA 4AI8A 3KG2A 4JAVA 1YTFD 4DW0A 5JJNB 3RWRD 4X1KB 1SZTA 2R9AA 1JCHA 2UUCO 3S3XA 5GTHZ 1KMIZ 4JTAB 4PI0A 3UO2A 3RYIA 2LW7A 4IYIA 4GKJB 1R6NA 1BT8A 4BIUA 1Z5WA 1FPOA 3JARA 4Z1MG 1MSDA 3P3PA 2QWOB 1YZBA 1N4CA 2WLNA 4LF9O 2Q9LA 2Y0PA 2ILMA 4LH7A 1E1RG 2V7QG 1IURA 2YEVB 5LXTB 1IXMA 3HB3B 4Z2WA 4JI8O 5FLXN 2OTLV 2RNBA 2UXDB 3H9VA 2RMKB 3SPHA 1KP3A 1NH2B 4BR6A 4AHCA 1FXHA 1X59A 4DV1B
chains in the Genus database with same CATH topology
2P90A 3B77A 1EBOA 3JCZA 3ZCCA 1GO3F 4P30A 1ZWIC 3FKSG 2DWDC 2B5UA 2ATKC 2YSUB 1R3JC 2FTKA 1M90W 3CCVV 5HFMA 1VQ9V 3ZMZA 1RM1C 1NKDA 5H9CA 1AR1B 4J9ZB 1YTFB 3ZRWB 5KUMA 3W7TA 1K4CC 1GKFA 2P67A 3E83A 1NVPD 1F23A 3JYCA 3OE7G 3G6EV 1AJPA 1KECA 3SYQA 1VQMV 4J9YB 1BL8A 3D3IA 1DTOA 5IYCO 4RAIA 3K03A 2DQ3A 3IGAC 3SPJA 5LGTA 2HR3A 1EZJA 1THZA 2WLLB 3K04A 4JASA 3T1CA 1M9NA 4DO2A 2M7WA 1JJ2U 1F4MA 2JJ1G 2PI4A 3CCSV 1TUEB 4N23A 4WFFA 4JYCA 1K5SA 4CBCA 5B3SB 3W7WA 4LP8A 1AI5A 4TWKA 3W7UA 1PD3A 3LDCA 4TSFG 4YXWG 1F51A 4RUFA 3CCQV 1I5YA 3SYCA 1G8MA 2DYSB 4N21A 4MVOA 3FYEB 5L3EA 2BOCC 1JOYA 5B3SC 1PL0A 2JEUA 3OMAB 4HAMA 1R3LC 1OCRB 2QTOA 1FXKB 3SYAA 5EC2C 1VQNV 3JD3A 1AI4A 3OR6C 2DYSC 2P7TC 4UVCA 4KFMA 1KQSU 3HPLC 1OCRC 2MK3A 4UV8A 3E8HA 1FXKC 1MABG 3OMIB 4WFGA 3K9AA 1RPRA 4UUJC 4R50A 4PDVA 2ITCC 4KUMA 3WFVA 2ZQMA 3IC7A 2K1EA 1MG1A 3ASOB 1Q82W 3E86A 1W2BU 1MSWD 3OW2U 3ABUA 1H8EG 3H01A 4GX0A 3OUFA 5H6RA 1S5HC 1E79G 3F5WC 4PA7A 3K0DA 3ZRVA 1NVPB 2ZXWB 2HLDG 3ASOC 2CK3G 2Z3YA 4UXNA 1GM7A 3DGEA 5LHGA 2X0LA 1QLEB 4MTXA 1NQTA 4PDLA 3K3WA 4GX1A 3F7YC 3TCUA 4GCZA 1PKXA 3AEIA 3K06A 5L3GA 2ZXWC 5B1BB 5LHHA 4I5SA 1VQLV 1ORQC 1CPYA 3JD4A 3CMAV 1QR8A 1QLEC 3ETEA 3GWOA 5IYBO 4UVBA 1GTOA 1Q7YW 3VOUA 3CCLV 2WLIA 4JAUA 1WPXA 3AG3B 2Y69B 5B1BC 2W6JG 4WCEV 2IJJA 3NXSA 1QLNA 3CP1A 2GHYA 4BIZA 5E1AC 3E89A 4LCUC 2XASA 2QE7G 2IH3C 3FB7C 4MTGA 4BAYA 1VQ7V 1GK9A 4PDMA 3ZJZA 4PA6A 1S0VA 2C2AA 3AG3C 2Y69C 1YIJV 2OCCB 3LDDA 5C93A 4TT3G 3W7XA 2DWEC 1KP2A 2AHYA 1YJNV 1NJIW 1QVGU 3ZMVA 1YJ9V 3JD1A 4HZ3A 3RW0A 2EIJB 3IFXA 4HYOA 1NR1A 4LC1A 3T4ZA 1W0JG 2OCCC 2B1IA 2EBOA 2QM8A 2R9IA 4R6ZA 4P9OA 2OTJV 2ZR2A 2WLJA 1DF4A 4FMTA 4WF9V 3CC7V 2WLIB 5EK0A 1M1KW 1JVMA 2EIJC 2Q6AA 4MVZA 3K79A 4R7CA 3CC2V 5EBLC 3QO8A 5LBQA 4PA3A 4L87A 1XL4A 4P9PA 1H2GA 3VBBA 1GM9A 4RO2A 4X8AA 5LHIA 1BHBA 3ABMB 3OEEG 1M56B 3OMNB 2WLKA 2DQ0A 5L3BA 3ETDA 1OCCB 2ITDC 2H8PC 3D36A 3CXCU 3FB5C 5KUKA 1WLEA 5CBHA 3BEHA 3LDEA 5IDJA 1AI7A 3P30A 5CN0A 3UM7A 2EILB 3OR7C 4MVRA 2XNDG 3CCUV 2UXXA 3ABMC 1M56C 1FFTB 3G4SV 3LSQA 1OCCC 2A79B 4RUEA 4JYBA 1EFRG 5B1OA 2F43G 1CEZA 1V54B 1K9MW 1S72V 2EILC 2HVKC 4UV9A 2LFSA 2ZDIA 4FIPC 4KP4A 3E8GA 1PNKA 1DLBA 4CZZA 1V54C 4MW8A 4EKWA 1PNMA 3R65A 4RQFA 2LFRA 4P2ZA 2HG5C 1QVFU 4JGSA 5LGNA 2EZPA 3ASNB 4QPJA 3I55V 4MT8A 1YHQV 5IYDO 5IY5B 4H33A 2HFEC 4MVQA 3ABKB 2WSSG 1OCZB 2ZR3A 4PA4A 1M57B 1R3IC 1QBZA 3ASNC 3ZMSA 3STZC 2AHZA 4XDLA 1UJWB 3MD0A 4I9WA 1OCOB 2DW4A 2Y48A 3GB7C 2IJHA 5IY5C 1K97A 4JTDB 2IJKA 3TK1A 2Z5UA 3ABKC 1K5QA 3LSSA 1OCZC 2X6BA 4ZBMA 1Y4MA 2W6IG 1M57C 4FPPA 1OHHG 3MHHC 2Q67A 3ZMTA 2IJIA 1BHAA 2LP7A 1OCOC 4MVMA 1K73W 3EFFK 3E35A 1AJQA 1RPOA 2QA4V 3OEHG 1K8AW 1J95A 2EJRA 3T4DA 2WWWA 1L1FA 4X89A 1GM8A 1K92A 4JF3A 3CCJV 1BMFG 3T2MA 2X6CA 4MTFA 5DM6V 4E2LA 3CPWU 2IU3A 1S77D 3ZMUA 3ZRSA 2XAJA 4U7OA 1W0KG 4XBFA 2XAQA 4QE7A 1R6KA 3ZRXA 1VQPV 1GMGA 4GX2A 3SPGA 2EINB 3EHBB 4QPKA 1NBMG 4MVSA 4RQEA 3SPCA 3ETGA 1AI6A 2JEXA 4BW5A 1QR9A 4R8CA 5J9PC 4MVUA 5B1NA 5KA6A 2EINC 1Y66A 1KD1W 1PNLA 4ASUG 2JK5C 2ZD9A 3SJQC 1B6QA 1YSCA 3QNEA 2EIMB 4FK5C 1OZ0A 2B1GA 2PI5A 3CCMV 3F7VC 4XDJA 1VQ8V 1JPXA 3ZIAG 4H37A 2EIMC 5FL7G 2WLLA 5CBGA 3CCRV 3OAAG 3E8FA 3RBZA 1LNQA 4WFEA 5BZBA 2WPDG 3ML0A 1F4NA 5CMUA 3A0RA 4QNHB 1YJWV 5CA3A 1AROP 2XAGA 5L3FA 3BY6A 1R3KC 4MS2A 2P6JA 3OUSA 4DXWA 1N8RW 3CCEV 2QKSA 4WFAV 4PELA 3B8NA 3AG2B 1AJNA 2R9RB 2UXNA 4MSWC 4Q20A 1K7DA 1DF5A 2HVJC 3LUTB 4X88A 3SYOA 1YITV 3SPIA 2GSMB 3X2QB 5B1AB 3E8BA 3W7SA 1Q86W 4MTOA 1ROPA 5L3DA 3OFNG 2NNUA 4MW3A 2Q68A 3K0GA 1P7BA 1FXKA 3AG2C 3JD0A 2NLJC 2BOBC 3QO7A 3M99B 4WFHA 3CYOA 4G27B 3OM3B 3X2QC 5B1AC 3ABLB 1VQ5V 4JTCB 5EC1C 1G4YB 2XAFA 5L3CA 4FJCC 2W0FC 2WLHA 3AG1B 1ENVA 3SYPA 3AG4B 1K3EA 2OT5A 4OXSA 1JX9A 2X6AA 3ABLC 5EBWC 5HFLA 2X7RB 4QE9A 2EIKB 4U7NA 2KB1A 3B8MA 4QJFB 4LBEC 4JPRA 4F4LA 1YI2V 2XOKG 2IW5A 3AG1C 3UKMA 1NH2D 3AG4C 1KKDA 1H38A 1E1QG 3CC4V 1XL6A 1FXVA 1VQ6V 1K34A 1K33A 2EIKC 4G2KA 5DN6G 2A0LA 1S3JA 3RVYA 1H8HG 3KG2A 3TETA 1VQ4V 5CBFA 4JAVA 4UVAA 1YTFD 4PDRA 2QEXV 3FYIB 1QCEA 2JIZG 4ZKIA 1SRYA 1MOFA 2WLMA 1SZTA 1COWG 3ZN1A 3MHSC 1JCHA 4QIWF 3LNMB 2ZDIC 2HJFC 4GT1A 1K4DC 2YEVA 3JD2A 4G28B 4JTAB 5EBMC 3CMEV 2HKOA 1SERA 3PJSK 3WG7B 3ABTA 2DYRB 4WFBV 1FS0G 3FB8C 1R73A 2H94A 1R6NA 2IH1C 4BIUA 3P32A 3ZN0A 1JQ0A 4PA9A 3K08A 2EZOA 1CP9A 4Z1MG 3WG7C 2DYRC 1VQKV 1V55B 1I5XA 1KC8W 2JDIG 2IU0A 3QO5A 2V1DA 1SETA 1NR7A 1S76D 3RVZA 2JJ2G 3ZRWA 5GW7A 2WLNA 4XDKA 3G71V 3CD6V 3STLC 1E1RG 3OGCC 1P4RA 1V55C 2Q69A 2V7QG 2YEVB 1VQOV 5H6QA 2XAHA 1IXMA 3DTUB 2WAMA 3HB3B 2QM7A 5LGUA 1Q81W 2OTLV 3E2EA 3SPHA 1KP3A 4GX5A 3I56V 1NH2B 1HWYA 3FB6C 2A9HA 1RM1B 1FXHA 5KA5A 1SESA 2D3OW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 V;  1YHQ V;  1K8A W;  3CC4 V;  1VQL V;  3G71 V;  3CD6 V;  1YJN V;  1NJI W;  1VQ6 V;  1Q82 W;  3CMA V;  1QVG U;  3CME V;  1YJ9 V;  1M90 W;  1YJW V;  3CCV V;  1KD1 W;  1VQ5 V;  1W2B U;  1VQ9 V;  3OW2 U;  1JJ2 U;  3CXC U;  1VQO V;  1Q7Y W;  3CCJ V;  3CCL V;  3CCS V;  4WFB V;  1VQN V;  5DM6 V;  3CPW U;  1N8R W;  3CCE V;  4WCE V;  4WFA V;  1R73 A;  1VQ4 V;  2OTJ V;  1KQS U;  2QEX V;  1Q81 W;  2OTL V;  3CCU V;  4WF9 V;  3CC7 V;  1VQP V;  1YIT V;  1QVF U;  3G4S V;  1M1K W;  1VQ7 V;  3G6E V;  3I56 V;  3CCM V;  1VQK V;  3CC2 V;  1VQ8 V;  1Q86 W;  3I55 V;  1VQM V;  1K73 W;  1YI2 V;  1YIJ V;  1KC8 W;  3CCQ V;  1K9M W;  1S72 V;  3CCR V;  2D3O W; 
#chains in the Genus database with same CATH topology
 4DV6 O;  3FKS G;  4KXR A;  4X65 O;  2B5U A;  3A8T A;  2YSU B;  3CCV V;  1JFF A;  1AR1 B;  1VMG A;  4J9Z B;  1YTF B;  3ZRW B;  3CSX A;  5KUM A;  1IBK O;  3N2K A;  1K4C C;  4J41 A;  1SC5 B;  4J7J A;  1GKF A;  4FZ0 A;  3E83 A;  1F23 A;  1N34 B;  1AJP A;  3NR7 A;  3SYQ A;  1HP8 A;  1MMM A;  3D3I A;  4O4I B;  2ZE7 A;  3Q4H A;  4RAI A;  3LNN A;  5LGT A;  1Q6I A;  1THZ A;  1Q90 D;  3JAK A;  1VIB A;  3T1C A;  3AG7 A;  4DYL A;  2EUL A;  1TUE B;  1ZL8 A;  3BFR A;  2NR5 A;  3K9S A;  4TSF G;  1WP7 A;  3CCQ V;  3SYC A;  1PPJ H;  4N21 A;  2DYS B;  1QQC A;  5BMV B;  2XUM A;  2JEU A;  1R3L C;  2UUB O;  1OCR B;  2QTO A;  4HBN A;  3SR2 C;  3SYA A;  1VQN V;  1AI4 A;  2DYS C;  4UVC A;  1KQS U;  2P4V A;  1ZUQ A;  2R72 A;  1OCR C;  2MK3 A;  4WFG A;  1RPR A;  3DXR A;  4O4L A;  1SQB H;  3BAA A;  3IC7 A;  3J81 N;  5KX5 A;  3G80 A;  3OW2 U;  3ABU A;  1H8E G;  3TXS A;  3OUF A;  5H6R A;  3T1Y O;  4DK0 A;  3B09 A;  3F5W C;  3K0D A;  3C3S A;  2ZXW B;  4NTX A;  2HLD G;  4BIO A;  3DGE A;  5LHG A;  2ZE8 A;  2QJ1 A;  2X0L A;  1XNR O;  3K3W A;  3F7Y C;  1NT2 B;  3VQY A;  5L3G A;  2ZXW C;  1I94 O;  3CMA V;  3GWO A;  1GTO A;  2JS3 A;  4B3T B;  1MZE A;  4JAU A;  3IAY A;  4QGP A;  1FKA O;  2GHY A;  5F2V O;  2UU9 O;  1UFI A;  2QE7 G;  1N32 B;  2VQF B;  4PDM A;  3RYI B;  1SQV H;  1S0V A;  2C2A A;  4JI6 B;  4DR6 B;  5JJJ B;  3N2G A;  4JV5 O;  1X4T A;  3ZHR A;  4TT3 G;  2DWE C;  1KP2 A;  4NTW A;  2N74 A;  5GON A;  3JD1 A;  3RW0 A;  3K58 A;  1NR1 A;  1HR0 O;  2QTS A;  4R6Z A;  5B5E Z;  2WLJ A;  4WF9 V;  1XRE A;  3G67 A;  4JI7 O;  3BPZ A;  3K57 A;  1IVS A;  3CC2 V;  1Y76 A;  1B06 A;  5EBL C;  3G6B A;  4PA3 A;  4P9P A;  3RFR A;  1WPB A;  3VBB A;  3HKE A;  1M56 B;  1VF6 A;  5LP6 B;  4DR2 B;  4JI5 B;  1L8D A;  1QU7 A;  2H8P C;  3FB5 C;  4X1Y A;  2XTA A;  2CDY A;  4JI1 O;  1AI7 A;  3H1I H;  4WBN B;  5CN0 A;  2K9P A;  1M56 C;  1FFT B;  5LP6 C;  3FAV B;  3N2K B;  2ZIN A;  2YIA A;  4LF5 B;  1S72 V;  2QWR B;  2LFS A;  2ZDI A;  3E8G A;  3Q4H B;  2VQE O;  5CA1 A;  4RQF A;  5BXZ A;  1BE3 H;  1V9P A;  1ZAU A;  3I55 V;  4FM2 A;  3D36 C;  2HFE C;  3ABK B;  3OT7 A;  1UJW B;  3MD0 A;  2Y48 A;  3RYH B;  5KLV H;  2EJ7 A;  4YY3 O;  3ABK C;  1K5Q A;  3B40 A;  1XI1 A;  2X6B A;  1Y4M A;  1KBH A;  3J80 N;  1OHH G;  2ZCE A;  2Q67 A;  2QWQ B;  1BHA A;  1Q5O A;  4MVM A;  4U3F H;  2IBZ H;  2N05 A;  3E35 A;  2YC0 A;  1AJQ A;  3HKB B;  5JVD A;  2ZE5 A;  3GWK C;  4B08 A;  1XHZ A;  2UUC B;  3WU2 Z;  2EJR A;  4X89 A;  1K92 A;  3DXR B;  4O4L B;  5KMG A;  4MTF A;  4E2L A;  1S77 D;  3ZMU A;  4DUZ O;  4I50 A;  1M4U A;  4TV8 A;  4UCU A;  5AG2 A;  5JH7 B;  4QPK A;  1JR9 A;  1M5I A;  1Q8I A;  3ETG A;  4BW5 A;  4TUY B;  4LF9 B;  1SZX A;  1PNL A;  3TGU H;  4DV3 O;  3QNE A;  2GTS A;  4ZI7 B;  4X64 O;  4FK5 C;  3JAT A;  4E4E A;  1OZ0 A;  3CE2 A;  2PI5 A;  3CCM V;  3L74 H;  1XQ8 A;  3E22 A;  3RYC A;  3CCR V;  3E8F A;  3RBZ A;  2A3Q A;  5BY1 A;  4X65 B;  2HHH O;  3A0R A;  4LF7 O;  1YJW V;  2XAG A;  3N2G B;  1AIL A;  2G38 A;  3WB2 A;  4JYY A;  2RJZ A;  4PEL A;  1PP9 H;  4LF6 O;  3DC5 A;  5GON B;  2R9R B;  4Q20 A;  1DF5 A;  3LUT B;  3U11 A;  1YIT V;  3JSL A;  2GSM B;  4J10 A;  4LFB O;  3DC6 A;  3E8B A;  1NI8 A;  4MTO A;  2Q68 A;  3N27 A;  1N36 O;  1NTK H;  2BSK A;  2NLJ C;  3L9D A;  3BAB A;  1OJH A;  1OV9 A;  3HKE B;  3ZS8 C;  4FJC C;  3AG1 B;  1H2L A;  4NXM B;  4IT5 A;  4OXS A;  1JJO A;  4LF4 O;  5HFL A;  4NR1 A;  4PD4 F;  2KB1 A;  3B8M A;  4LBE C;  4JPR A;  1PL4 A;  3AG1 C;  1SS3 A;  1E1Q G;  3CC4 V;  1QNM A;  4K8X A;  1H2N A;  4G2K A;  2Q0O C;  2UUB B;  5DN6 G;  4AQY B;  3PN1 A;  3TET A;  4NVP A;  4O2B B;  1MOF A;  2PY5 A;  3H1K H;  1COW G;  3ZN1 A;  3MHS C;  3LNM B;  5JWP A;  2ZDI C;  2HJF C;  1URF A;  2YEV A;  5IT9 N;  2RN9 A;  1YF2 A;  5LXT A;  2PYL A;  5EBM C;  2HKO A;  5FNV B;  2DYR B;  4WFB V;  4O4H B;  2AGA A;  2PGG A;  1R73 A;  3T1Y B;  4CC6 A;  3P32 A;  4IHJ B;  3ZN0 A;  1JQ0 A;  2JRI A;  1NU1 H;  2DYR C;  1V55 B;  1XNR B;  1I5X A;  2QDO A;  3CX5 F;  2IU0 A;  3QO5 A;  2V1D A;  3A0H Z;  4LFA O;  2KG7 B;  1S76 D;  4JI0 O;  3ZRW A;  4TQD A;  1F7Y A;  1I94 B;  4F6R A;  5J2U A;  1LR1 A;  3STL C;  1V55 C;  2Q69 A;  3L71 H;  5JVD B;  1VQO V;  4DR7 O;  5H6Q A;  2XAH A;  4DV7 O;  3DTU B;  2QM7 A;  4U3J B;  4GX5 A;  1HWY A;  4L8J A;  2BTQ B;  2D3O W;  2P90 A;  4CH3 A;  1XNQ O;  1L0N H;  2DWD C;  1W59 A;  2FTK A;  2E75 B;  1M90 W;  5HFM A;  3ZMZ A;  5H9C A;  3JAS B;  1HR0 B;  4GKK O;  4B3S O;  2P67 A;  1J5E B;  5DEC A;  4YJ2 B;  5J2T A;  4JI7 B;  3OE7 G;  3SJB C;  3G6E V;  5BMV A;  4J9Y B;  4DV4 B;  1DTO A;  2CUG A;  5IWA O;  3IGA C;  4I9Q A;  3SPJ A;  4DR4 B;  5C8Y B;  1EZJ A;  4LF8 B;  3WB0 A;  4OGQ B;  5B66 Z;  4C7U A;  4JAS A;  3RYC B;  3SJA C;  2M7W A;  4N23 A;  4JYC A;  2YI8 A;  1K5S A;  5LMN O;  4DR3 O;  2L35 A;  3W7W A;  4TWK A;  2CH7 A;  1L0L H;  4RUF A;  1O9G A;  1I5Y A;  1FFX B;  5EYP A;  1H2S B;  1IBL B;  2BOC C;  2GDS A;  1Z2G A;  4CH6 A;  1PL0 A;  3OMA B;  1IDS A;  3VQV A;  1US6 A;  3ZX6 A;  2UXB O;  2BSK B;  1WA8 A;  4X9Q A;  1Y67 A;  2VQE B;  2P7T C;  3ZHQ A;  3VQX A;  1MNG A;  5EZY A;  4PV1 B;  2RCV A;  3K9A A;  4UUJ C;  4ABM A;  4NTY A;  4JI4 O;  1Q43 A;  4YHH O;  2ZQM A;  2K1E A;  1SQG A;  1MG1 A;  3AK1 A;  3ASO B;  2NN4 A;  3E86 A;  1W2B U;  1MSW D;  3T1H O;  4GX0 A;  1S5H C;  1E79 G;  2W0X A;  1YDX A;  4J7K A;  4PA7 A;  4DV0 O;  1VF5 B;  2DE0 X;  4X20 B;  4DR5 O;  3ASO C;  2CK3 G;  4I55 B;  3CRM A;  4GCZ A;  3L75 H;  4I5S A;  3U10 A;  4CH4 A;  1VQL V;  1HNW O;  1ORQ C;  1CPY A;  1JA8 A;  4X62 B;  1QR8 A;  4FLV A;  2DJV A;  3R66 A;  2ZM6 O;  5LOV A;  2Y69 B;  2W6J G;  3NXS A;  2QWN B;  4BIZ A;  3CRC A;  3E89 A;  4KHP O;  4OX9 O;  2JVD A;  4PA6 A;  2Y69 C;  1YIJ V;  5CB4 B;  3AK3 A;  2OCC B;  5LP6 A;  4B3M O;  4WBN A;  2EIJ B;  4IGG A;  3SGI A;  3IFX A;  4HYO A;  2OCC C;  2B1I A;  3K59 A;  3FAV A;  3D8C A;  5J2U B;  4X64 B;  4P9O A;  4F6R B;  2ZIM A;  2ZR2 A;  4FMT A;  3CRQ A;  2WLI B;  3HKD B;  1JVM A;  2EIJ C;  5KHI A;  1TAE A;  4L87 A;  1VP7 A;  2YXH A;  1GM9 A;  4X8A A;  5LHI A;  3ABM B;  1SQF A;  4LF7 B;  3ETD A;  3D36 A;  3K5L A;  2OIG A;  2B9Z A;  4K8Z A;  5CBH A;  4LH6 A;  2YS8 A;  4DV5 B;  1EZV H;  5JCO A;  2P06 A;  1SKV A;  3UM7 A;  4LF6 B;  2UXX A;  3ABM C;  3LSQ A;  5KAI Z;  2PYJ A;  4DV2 B;  4JYB A;  1CEZ A;  5IYZ B;  5J2T B;  1U96 A;  2HVK C;  4B7K A;  1WN7 A;  3RYH A;  4FIP C;  4KP4 A;  2ODM A;  1DLB A;  4X1I B;  4B7E A;  2JGD A;  2GV9 A;  4EKW A;  4UCS A;  1PNM A;  3R65 A;  4YJ3 A;  1WB8 A;  3B4S A;  4P2Z A;  3HKB A;  2CGN A;  2Y0I A;  4MT8 A;  1NTM H;  5IYD O;  5IY5 B;  1OCZ B;  2ZR3 A;  2CH7 B;  1IBM B;  2E3C A;  1R3I C;  1QBZ A;  3ZMS A;  4I0X A;  2UXC O;  3STZ C;  2LGW A;  5EYP B;  1OCO B;  2DW4 A;  3MAQ A;  5IY5 C;  2IJK A;  5JH7 A;  2F66 C;  2Z5U A;  1ZTE A;  1OCZ C;  4LNU B;  3MHH C;  4O4J B;  1WA8 B;  1OCO C;  4TUY A;  5EZY B;  3WB1 A;  3T4D A;  1L1F A;  4ZI7 A;  2F1M A;  2E74 B;  4JF3 A;  3CCJ V;  4K0K O;  3I5D A;  4RWU A;  3ZRS A;  2XAJ A;  4U7O A;  1GMG A;  3SPG A;  3EHB B;  3CRA A;  1NBM G;  2A7W A;  4MVS A;  1BGY H;  2JEX A;  1QR9 A;  3F5T A;  1AP6 A;  1EN5 A;  5B1N A;  3ZBH A;  3TXQ A;  3DSQ A;  2CTW A;  1B6Q A;  1YSC A;  2PF4 E;  1GRJ A;  2FML A;  3A2F A;  5KHG A;  1HNZ B;  3IC9 A;  2CGO A;  5LOV B;  3F7V C;  3ZIA G;  3K5N A;  4H37 A;  3S3W A;  5IJ9 B;  3EXA A;  3OAA G;  1LNQ A;  4K35 A;  4WFE A;  4JI2 O;  2WA3 A;  2WPD G;  4J11 A;  5CMU A;  5CA3 A;  4YIO A;  3BY6 A;  1DGS A;  3OUS A;  1N8R W;  3CCE V;  2QKS A;  4GKK B;  2A06 H;  1AJN A;  1K7D A;  3SYO A;  4BW9 A;  2Q0A A;  1AP5 A;  1P7G A;  2CE4 A;  2Q7G A;  3W7S A;  1Q86 W;  1ROP A;  3OFN G;  3K0G A;  3QO7 A;  4WFH A;  3CYO A;  4DK1 A;  4G27 B;  3OM3 B;  2JS5 A;  3ABL B;  1P84 F;  3FX7 A;  4JTC B;  2OWO A;  1G4Y B;  4O2B A;  2W0F C;  3OTO O;  1K3E A;  2OT5 A;  2X6A A;  3ABL C;  5EBW C;  5LMN B;  4QJF B;  4U7N A;  2XOK G;  3UKM A;  4GZR B;  1XMO B;  1BCC H;  3CRR A;  2Q8V A;  4LWS B;  3K5O A;  5FNV A;  4UFZ A;  4O4H A;  1K34 A;  1K33 A;  5JCO C;  4IHJ A;  4JZG A;  3BA8 A;  1EN6 A;  2OCH A;  5CBF A;  2VWK A;  4UVA A;  4PDR A;  2QEX V;  3FYI B;  2JGD B;  1Z5V A;  1QCE A;  2JIZ G;  4ZKI A;  2CTP A;  2KG7 A;  1O9H A;  1NZ6 A;  4YJ3 B;  4QIW F;  4JI4 B;  4UCO A;  3JD2 A;  4Q6G A;  4YHH B;  3CME V;  5DED A;  2BCC H;  3PJS K;  5H2F Z;  1FS0 G;  1KU9 A;  3FB8 C;  5BR8 O;  2H94 A;  4U3J A;  4EFE A;  2IH1 C;  5LA6 B;  3KKY A;  4I0X B;  3KZI Z;  2BTQ A;  3K08 A;  1N0N A;  1S5J A;  4UCR A;  1VQK V;  4NXN O;  4BWA A;  3H1J H;  3ZHT A;  1SET A;  2YUA A;  2JJ2 G;  3CJH B;  3JAS A;  2VS0 A;  4H13 B;  3OGC C;  1P4R A;  1XBL A;  2ADQ B;  4YJ2 A;  4KL1 A;  1NS1 A;  2ZM6 B;  3JAL B;  2WAM A;  2AXT Z;  1AR4 A;  5LGU A;  4YIP A;  3HKC A;  4J7Z A;  4D7T A;  3E2E A;  4JI8 B;  4OX9 B;  4J42 A;  2A9H A;  4DV1 O;  5C8Y A;  5KA5 A;  2BE3 A;  3ZCC A;  1GO3 F;  4P30 A;  1ZWI C;  4DV6 B;  1R3J C;  3EVK A;  1VQ9 V;  1TVK A;  1NKD A;  1BZK A;  3UCS C;  3W7T A;  2GBO A;  1IBK B;  4A5U B;  1NVP D;  1FFX A;  3L73 H;  1IZ3 A;  1KEC A;  2KKW A;  1TUB B;  3CEI A;  4AIL C;  3K03 A;  2DQ3 A;  4ZOL A;  5CA0 B;  1ZSP A;  2HP8 A;  2HR3 A;  4X66 O;  1SF9 A;  2GUZ B;  3K04 A;  1M9N A;  1F4M A;  3C90 A;  2F95 B;  5K1P A;  1PV0 A;  5B3S B;  4LP8 A;  4FFK A;  3W7U A;  1F51 A;  1G8M A;  5L3E A;  4EEQ A;  5B3S C;  1KKC A;  1Y74 A;  4HAM A;  1H2M A;  2RQ6 A;  4X20 A;  2E5L O;  4W4K A;  4I55 A;  2CTQ A;  5H5N A;  1S5L Z;  2PTM A;  4I4T B;  2LGQ A;  2DN9 A;  1YEW A;  3E8H A;  1I08 A;  1Q3E A;  5D5P A;  4LFC O;  1IX9 A;  1EN4 A;  4KUM A;  3WFV A;  1Q82 W;  2D2C B;  2ARH A;  4PJ0 Z;  1GAX A;  5E79 Z;  1NVP B;  2Z3Y A;  5CB4 A;  1HNX O;  2YIC A;  1QLE B;  4MTX A;  4PDL A;  4GX1 A;  4TOI A;  1YCI A;  1B04 A;  5KHH A;  3ETE A;  1QLE C;  5IYB O;  2Z0A A;  1Q7Y W;  2QR4 A;  3VOU A;  3CCL V;  1A32 A;  2WLI A;  1WPX A;  1XUQ A;  3AG3 B;  3HKD A;  2IJJ A;  4LCU C;  1N32 O;  3FB7 C;  4BAY A;  2UU9 B;  1SA0 A;  3AG3 C;  3LDD A;  4JV5 B;  2GTA A;  4J80 A;  4D7S A;  5IJ0 B;  3T4Z A;  2EBO A;  5IYZ A;  1DF4 A;  1M1K W;  2Q6A A;  4MVZ A;  3P3N A;  5LBQ A;  3QO8 A;  3HKC B;  2AW9 A;  3KCX A;  4X1I A;  4RO2 A;  4DR2 O;  4JI2 B;  1BHB A;  5KUK A;  1WLE A;  3J7A U;  3LDE A;  3BCC H;  2EIL B;  3OR7 C;  4H44 B;  2EX3 A;  2XND G;  4MVR A;  4JI1 B;  1TVK B;  2LW1 A;  1BQ0 A;  4B3R O;  4FLU A;  2N04 A;  3G4S V;  4FM0 A;  4LF5 O;  1KB9 F;  4FLW A;  1QHT A;  5B1O A;  2F43 G;  3L70 H;  2EIL C;  3ICX A;  2LJ2 A;  2FL4 A;  1D5N A;  4O2A B;  1PNK A;  4HNA B;  2QM4 A;  1U97 A;  4LNU A;  1FJG O;  4ZOL B;  1XDC A;  4O4J A;  3BHP A;  4DW1 A;  3OTO B;  2HG5 C;  1QVF U;  5LGN A;  2EZP A;  4QPJ A;  1YHQ V;  4F6E A;  3ETQ A;  2WSS G;  4PA4 A;  1LUW A;  2AHZ A;  4XDL A;  4EB6 A;  3GB7 C;  4CS2 A;  2IJH A;  1Y74 B;  1LUV A;  4YY3 B;  3APO A;  1BQZ A;  2YDE A;  2IJI A;  3ZMT A;  1IXB A;  3APQ A;  1I7F A;  3EFF K;  1RPO A;  4IYH A;  1AVM A;  3JCU Z;  3OEH G;  1K8A W;  2WWW A;  5LYJ A;  3T2M A;  5DM6 V;  3CPW U;  2IU3 A;  5BR8 B;  3RT3 C;  3ZRX A;  4XBF A;  4QE7 A;  4DUZ B;  1VQP V;  5IJ9 A;  4GX2 A;  2EIN B;  4RQE A;  4NXN B;  3SPC A;  2ZKO A;  1R1B A;  4JI3 O;  3QF7 A;  4CC5 A;  1MZF A;  5J9P C;  3QG5 A;  5KA6 A;  1UPG A;  2QKC A;  3U0Z A;  2LO1 A;  2EIN C;  4ASU G;  2ZD9 A;  1XMQ O;  4DV3 B;  2ETN A;  4UB8 Z;  2YIB A;  2EIM B;  2ZE6 A;  1VEW A;  2FKX A;  4GYC B;  2DMX A;  2B1G A;  4XDJ A;  1JPX A;  2EIM C;  2WLL A;  1RSO B;  3JAW B;  2ZIO A;  5BZB A;  2O57 A;  3ML0 A;  2LQT A;  1SA0 B;  3K5M A;  4UCV A;  3RGB A;  4QNH B;  1ARO P;  2IM9 A;  2HHH B;  4MS2 A;  1N33 O;  2P6J A;  4DXW A;  2Y4U A;  3AG2 B;  2UXN A;  4MSW C;  5LMU O;  1PM9 A;  5KHK A;  1XHX A;  3SPI A;  3ZHU A;  4LWS A;  5D5Q A;  5L3D A;  4LFB B;  2NNU A;  3FFQ A;  4MW3 A;  1FXK A;  3AG2 C;  2BOB C;  2M6Y A;  4UB6 Z;  1N36 B;  5A9G A;  1MA1 A;  4X66 B;  1VQ5 V;  3C3T A;  2XAF A;  5EC1 C;  4NXM O;  2WLH A;  2XHB A;  1ENV A;  1JX9 A;  2X7R B;  4K3A A;  1WNS A;  2EIK B;  4LF4 B;  1YI2 V;  4DR1 O;  2IW5 A;  2F4V O;  1KKD A;  4H0L B;  1FXV A;  1VQ6 V;  1RP3 B;  2YXL A;  2EIK C;  4AQY O;  5LA6 A;  1S3J A;  5FPR A;  3RVY A;  1H8H G;  3ZED A;  2E5L B;  1ZLZ A;  1VQ4 V;  5KAF Z;  2HJD A;  1SRY A;  4NB5 A;  2WLM A;  3CJH A;  4FFB A;  3H1L H;  4LFC B;  2YIB D;  4GT1 A;  3THO A;  2P22 C;  4GUN A;  1K4D C;  2VWJ A;  3UT5 A;  1XIL A;  3KCY A;  5GTI Z;  4G28 B;  4ZHQ A;  3JAL A;  1SER A;  3M7M X;  2R70 A;  1GN6 A;  3WG7 B;  3ABT A;  2L6L A;  3BRC A;  2KQX A;  2F93 B;  1AR5 A;  1WP8 A;  1XOU A;  4EB6 B;  4PA9 A;  1AB3 A;  2EZO A;  1CP9 A;  3WG7 C;  4DUY O;  1HNX B;  1KC8 W;  2JDI G;  2YXY A;  1NR7 A;  3RVZ A;  2OIE A;  4LFA B;  5GW7 A;  3M8A A;  3GVM A;  4XDK A;  1YXB A;  3G71 V;  3CD6 V;  4JI0 B;  3JAM N;  2UUA O;  4ICG A;  4DR7 B;  1WB7 A;  5LYJ B;  4DV7 B;  1TUB A;  1NTZ H;  1Q81 W;  2ZNI A;  3RN4 A;  5K1X A;  5CA0 A;  3CS5 A;  3I56 V;  3FB6 C;  1RM1 B;  2KSD A;  1FD9 A;  1SES A;  2GUZ A;  3B77 A;  1EBO A;  3JCZ A;  3JAR B;  3RYF A;  1XNQ B;  2ATK C;  2Y4T A;  1RM1 C;  2QSA A;  3D3Q A;  2AZ2 A;  5KHJ A;  1J5E O;  1SQQ H;  4B3S B;  3JYC A;  4DV4 O;  1TA8 A;  1VQM V;  1BL8 A;  4JYA O;  5IYC O;  4DR4 O;  1GN3 A;  5IWA B;  4LF8 O;  1Y6X A;  4I4T A;  2WLL B;  4DO2 A;  1JJ2 U;  2PI4 A;  2JJ1 G;  2VRZ A;  3CCS V;  2ZT9 B;  2P5O A;  1JFF B;  4WFF A;  2Q5Z A;  4CBC A;  2PZS A;  4B3R B;  2QWP B;  3A0B Z;  1AI5 A;  5ITZ A;  4DR3 B;  1PD3 A;  1H2K A;  3LDC A;  1BS3 A;  4YXW G;  3BVO A;  1IBL O;  1TGO A;  4MVO A;  3FYE B;  3UO3 A;  1FYJ A;  4DRX A;  1JOY A;  1FXK B;  2QKA A;  1SQX H;  5EC2 C;  1FJG B;  3JD3 A;  4GLX A;  2UXB B;  2ZNJ A;  3OR6 C;  5TIS Z;  1XEQ A;  3JAK B;  2XT9 A;  4ZIB A;  4KFM A;  1KUQ A;  3HPL C;  4UV8 A;  4FLZ A;  1FXK C;  1MAB G;  1ZL8 B;  3OMI B;  4FLT A;  4R50 A;  4PDV A;  2ITC C;  5JJE B;  4OPA A;  1SQP H;  1CXZ B;  2F23 A;  3O65 A;  3H01 A;  2YI9 A;  3O9O A;  3UQ8 A;  4GKJ O;  3T1H B;  3ZRV A;  3AK2 A;  4UXN A;  4DV0 B;  1D2D A;  1GM7 A;  4DR5 B;  4CS4 A;  1NQT A;  3IJ4 A;  4JZ2 A;  3TCU A;  1PKX A;  3AEI A;  3K06 A;  5LHH A;  5IJ0 A;  5B1B B;  4IL6 Z;  3SJC C;  2FB5 A;  4X62 O;  2HEP A;  3CHX A;  3JD4 A;  4FFB B;  2CAZ C;  4CH5 A;  3TJT A;  1HNW B;  4UVB A;  1D5A A;  2JGU A;  2Q73 A;  3UT5 B;  5B1B C;  4WCE V;  4ZHQ B;  4TQF A;  3CP1 A;  1QLN A;  5KX5 B;  5E1A C;  4D6T H;  2UXD O;  2XAS A;  2IH3 C;  4MTG A;  4FZ1 A;  4CS3 A;  1VQ7 V;  1GK9 A;  4KHP B;  3ZJZ A;  5EIB D;  4IIJ A;  5C93 A;  3W7X A;  2AHY A;  4JI3 B;  1YJN V;  1NJI W;  4B3M B;  1QVG U;  3ZMV A;  1Q6H A;  1YJ9 V;  3SDL A;  4HZ3 A;  4LC1 A;  5LL6 Y;  1W0J G;  1XMQ B;  5A2Q N;  2QM8 A;  2R9I A;  2OTJ V;  4TV9 A;  3CC7 V;  1N34 O;  5EK0 A;  3K79 A;  4R7C A;  2WA4 A;  3MDS A;  4O2A A;  3OTF A;  3ZHV A;  1XL4 A;  1H2G A;  1GN2 A;  4HNA A;  2RDC A;  1KYO F;  3OEE G;  3OMN B;  2WLK A;  2DQ0 A;  3H1H H;  5JQG A;  5L3B A;  1OCC B;  1BSM A;  2ITD C;  3CXC U;  4DV5 O;  2FYU H;  3BEH A;  3RYF B;  1N33 B;  5IDJ A;  3P30 A;  2BTO A;  4FVM A;  3CCU V;  5LMU B;  4DV2 O;  3OGI B;  1OCC C;  4W4L A;  2A79 B;  4RUE A;  1EFR G;  4FLX A;  1V54 B;  1K9M W;  1JMK C;  3QVN A;  4UV9 A;  1Y76 B;  2AZ0 A;  4CZZ A;  1I0H A;  5FPO A;  1V54 C;  4MW8 A;  4X1K A;  2H3O A;  2LFR A;  4X1Y B;  4JGS A;  3ASN B;  2Q4P A;  1VF6 C;  4DR1 B;  2F4V B;  4H33 A;  4MVQ A;  1IBM O;  5ITZ B;  1G1X B;  1N0J A;  5EIB C;  1B3Q A;  1M57 B;  4Z1V A;  4FM1 A;  2CTR A;  3ASN C;  4EFB A;  4I9W A;  2UXC B;  4DRX B;  1K97 A;  4JTD B;  3TK1 A;  3LSS A;  1HDJ A;  4ZBM A;  2W6I G;  1M57 C;  4FPP A;  1GN4 A;  5CA1 B;  1T5E A;  2V4D A;  2LP7 A;  1K73 W;  1FAF A;  2QA4 V;  2PUS A;  1J95 A;  1GM8 A;  1RFY A;  2DOS A;  2Q7H A;  4B3T O;  1BMF G;  2X6C A;  2OYQ A;  4K0K B;  1W0K G;  2XAQ A;  1R6K A;  2VQF O;  1RSO A;  3JAW A;  4JI6 O;  4DR6 O;  4DUY B;  1Q6U A;  3B2E E;  1R6T A;  1DK1 A;  1AI6 A;  4R8C A;  1M93 A;  4MVU A;  1WAZ A;  4FLY A;  1KD1 W;  1Y66 A;  3CWB H;  2JK5 C;  3SJQ C;  2UUA B;  3L72 H;  3FD9 A;  1HNZ O;  4O4I A;  5KMG B;  3OD4 A;  4OPH A;  4I50 B;  1VQ8 V;  2P4K A;  5FL7 G;  4TV8 B;  5CBG A;  1YVW A;  3CXH F;  1EM1 A;  3LSU A;  4UCT A;  1F4N A;  2E76 B;  4JI5 O;  5L3F A;  3VQW A;  1VAR A;  1R3K C;  4IIJ B;  4WFA V;  4NYK A;  3B8N A;  2HVJ C;  4X88 A;  3X2Q B;  5B1A B;  3JAT B;  4TV9 B;  4JYA B;  1P7B A;  1WJZ A;  1VF7 A;  2YID A;  3JD0 A;  5IE9 A;  1HW7 A;  3M99 B;  3CB2 A;  3E22 B;  3X2Q C;  5B1A C;  2MW2 B;  4LR3 A;  2ADP A;  5L3C A;  1G6U A;  3ZHS A;  4JAA A;  4NKG B;  3SYP A;  3AG4 B;  4PI2 A;  4I7Z B;  5JQG B;  3BA9 A;  4QE9 A;  3JSN A;  3QTC A;  1XMO O;  4F4L A;  1ZX3 A;  2QGN A;  1NH2 D;  3AG4 C;  1H38 A;  2Q7E A;  1GH6 A;  4PHZ A;  1XL6 A;  3HR0 A;  1P49 A;  2A0L A;  4AI8 A;  3KG2 A;  4JAV A;  1YTF D;  4DW0 A;  5JJN B;  3RWR D;  4X1K B;  1SZT A;  2R9A A;  1JCH A;  2UUC O;  3S3X A;  5GTH Z;  1KMI Z;  4JTA B;  4PI0 A;  3UO2 A;  3RYI A;  2LW7 A;  4IYI A;  4GKJ B;  1R6N A;  1BT8 A;  4BIU A;  1Z5W A;  1FPO A;  3JAR A;  4Z1M G;  1MSD A;  3P3P A;  2QWO B;  1YZB A;  1N4C A;  2WLN A;  4LF9 O;  2Q9L A;  2Y0P A;  2ILM A;  4LH7 A;  1E1R G;  2V7Q G;  1IUR A;  2YEV B;  5LXT B;  1IXM A;  3HB3 B;  4Z2W A;  4JI8 O;  5FLX N;  2OTL V;  2RNB A;  2UXD B;  3H9V A;  2RMK B;  3SPH A;  1KP3 A;  1NH2 B;  4BR6 A;  4AHC A;  1FXH A;  1X59 A;  4DV1 B; 
#chains in the Genus database with same CATH homology
 2P90 A;  3B77 A;  1EBO A;  3JCZ A;  3ZCC A;  1GO3 F;  4P30 A;  1ZWI C;  3FKS G;  2DWD C;  2B5U A;  2ATK C;  2YSU B;  1R3J C;  2FTK A;  1M90 W;  3CCV V;  5HFM A;  1VQ9 V;  3ZMZ A;  1RM1 C;  1NKD A;  5H9C A;  1AR1 B;  4J9Z B;  1YTF B;  3ZRW B;  5KUM A;  3W7T A;  1K4C C;  1GKF A;  2P67 A;  3E83 A;  1NVP D;  1F23 A;  3JYC A;  3OE7 G;  3G6E V;  1AJP A;  1KEC A;  3SYQ A;  1VQM V;  4J9Y B;  1BL8 A;  3D3I A;  1DTO A;  5IYC O;  4RAI A;  3K03 A;  2DQ3 A;  3IGA C;  3SPJ A;  5LGT A;  2HR3 A;  1EZJ A;  1THZ A;  2WLL B;  3K04 A;  4JAS A;  3T1C A;  1M9N A;  4DO2 A;  2M7W A;  1JJ2 U;  1F4M A;  2JJ1 G;  2PI4 A;  3CCS V;  1TUE B;  4N23 A;  4WFF A;  4JYC A;  1K5S A;  4CBC A;  5B3S B;  3W7W A;  4LP8 A;  1AI5 A;  4TWK A;  3W7U A;  1PD3 A;  3LDC A;  4TSF G;  4YXW G;  1F51 A;  4RUF A;  3CCQ V;  1I5Y A;  3SYC A;  1G8M A;  2DYS B;  4N21 A;  4MVO A;  3FYE B;  5L3E A;  2BOC C;  1JOY A;  5B3S C;  1PL0 A;  2JEU A;  3OMA B;  4HAM A;  1R3L C;  1OCR B;  2QTO A;  1FXK B;  3SYA A;  5EC2 C;  1VQN V;  3JD3 A;  1AI4 A;  3OR6 C;  2DYS C;  2P7T C;  4UVC A;  4KFM A;  1KQS U;  3HPL C;  1OCR C;  2MK3 A;  4UV8 A;  3E8H A;  1FXK C;  1MAB G;  3OMI B;  4WFG A;  3K9A A;  1RPR A;  4UUJ C;  4R50 A;  4PDV A;  2ITC C;  4KUM A;  3WFV A;  2ZQM A;  3IC7 A;  2K1E A;  1MG1 A;  3ASO B;  1Q82 W;  3E86 A;  1W2B U;  1MSW D;  3OW2 U;  3ABU A;  1H8E G;  3H01 A;  4GX0 A;  3OUF A;  5H6R A;  1S5H C;  1E79 G;  3F5W C;  4PA7 A;  3K0D A;  3ZRV A;  1NVP B;  2ZXW B;  2HLD G;  3ASO C;  2CK3 G;  2Z3Y A;  4UXN A;  1GM7 A;  3DGE A;  5LHG A;  2X0L A;  1QLE B;  4MTX A;  1NQT A;  4PDL A;  3K3W A;  4GX1 A;  3F7Y C;  3TCU A;  4GCZ A;  1PKX A;  3AEI A;  3K06 A;  5L3G A;  2ZXW C;  5B1B B;  5LHH A;  4I5S A;  1VQL V;  1ORQ C;  1CPY A;  3JD4 A;  3CMA V;  1QR8 A;  1QLE C;  3ETE A;  3GWO A;  5IYB O;  4UVB A;  1GTO A;  1Q7Y W;  3VOU A;  3CCL V;  2WLI A;  4JAU A;  1WPX A;  3AG3 B;  2Y69 B;  5B1B C;  2W6J G;  4WCE V;  2IJJ A;  3NXS A;  1QLN A;  3CP1 A;  2GHY A;  4BIZ A;  5E1A C;  3E89 A;  4LCU C;  2XAS A;  2QE7 G;  2IH3 C;  3FB7 C;  4MTG A;  4BAY A;  1VQ7 V;  1GK9 A;  4PDM A;  3ZJZ A;  4PA6 A;  1S0V A;  2C2A A;  3AG3 C;  2Y69 C;  1YIJ V;  2OCC B;  3LDD A;  5C93 A;  4TT3 G;  3W7X A;  2DWE C;  1KP2 A;  2AHY A;  1YJN V;  1NJI W;  1QVG U;  3ZMV A;  1YJ9 V;  3JD1 A;  4HZ3 A;  3RW0 A;  2EIJ B;  3IFX A;  4HYO A;  1NR1 A;  4LC1 A;  3T4Z A;  1W0J G;  2OCC C;  2B1I A;  2EBO A;  2QM8 A;  2R9I A;  4R6Z A;  4P9O A;  2OTJ V;  2ZR2 A;  2WLJ A;  1DF4 A;  4FMT A;  4WF9 V;  3CC7 V;  2WLI B;  5EK0 A;  1M1K W;  1JVM A;  2EIJ C;  2Q6A A;  4MVZ A;  3K79 A;  4R7C A;  3CC2 V;  5EBL C;  3QO8 A;  5LBQ A;  4PA3 A;  4L87 A;  1XL4 A;  4P9P A;  1H2G A;  3VBB A;  1GM9 A;  4RO2 A;  4X8A A;  5LHI A;  1BHB A;  3ABM B;  3OEE G;  1M56 B;  3OMN B;  2WLK A;  2DQ0 A;  5L3B A;  3ETD A;  1OCC B;  2ITD C;  2H8P C;  3D36 A;  3CXC U;  3FB5 C;  5KUK A;  1WLE A;  5CBH A;  3BEH A;  3LDE A;  5IDJ A;  1AI7 A;  3P30 A;  5CN0 A;  3UM7 A;  2EIL B;  3OR7 C;  4MVR A;  2XND G;  3CCU V;  2UXX A;  3ABM C;  1M56 C;  1FFT B;  3G4S V;  3LSQ A;  1OCC C;  2A79 B;  4RUE A;  4JYB A;  1EFR G;  5B1O A;  2F43 G;  1CEZ A;  1V54 B;  1K9M W;  1S72 V;  2EIL C;  2HVK C;  4UV9 A;  2LFS A;  2ZDI A;  4FIP C;  4KP4 A;  3E8G A;  1PNK A;  1DLB A;  4CZZ A;  1V54 C;  4MW8 A;  4EKW A;  1PNM A;  3R65 A;  4RQF A;  2LFR A;  4P2Z A;  2HG5 C;  1QVF U;  4JGS A;  5LGN A;  2EZP A;  3ASN B;  4QPJ A;  3I55 V;  4MT8 A;  1YHQ V;  5IYD O;  5IY5 B;  4H33 A;  2HFE C;  4MVQ A;  3ABK B;  2WSS G;  1OCZ B;  2ZR3 A;  4PA4 A;  1M57 B;  1R3I C;  1QBZ A;  3ASN C;  3ZMS A;  3STZ C;  2AHZ A;  4XDL A;  1UJW B;  3MD0 A;  4I9W A;  1OCO B;  2DW4 A;  2Y48 A;  3GB7 C;  2IJH A;  5IY5 C;  1K97 A;  4JTD B;  2IJK A;  3TK1 A;  2Z5U A;  3ABK C;  1K5Q A;  3LSS A;  1OCZ C;  2X6B A;  4ZBM A;  1Y4M A;  2W6I G;  1M57 C;  4FPP A;  1OHH G;  3MHH C;  2Q67 A;  3ZMT A;  2IJI A;  1BHA A;  2LP7 A;  1OCO C;  4MVM A;  1K73 W;  3EFF K;  3E35 A;  1AJQ A;  1RPO A;  2QA4 V;  3OEH G;  1K8A W;  1J95 A;  2EJR A;  3T4D A;  2WWW A;  1L1F A;  4X89 A;  1GM8 A;  1K92 A;  4JF3 A;  3CCJ V;  1BMF G;  3T2M A;  2X6C A;  4MTF A;  5DM6 V;  4E2L A;  3CPW U;  2IU3 A;  1S77 D;  3ZMU A;  3ZRS A;  2XAJ A;  4U7O A;  1W0K G;  4XBF A;  2XAQ A;  4QE7 A;  1R6K A;  3ZRX A;  1VQP V;  1GMG A;  4GX2 A;  3SPG A;  2EIN B;  3EHB B;  4QPK A;  1NBM G;  4MVS A;  4RQE A;  3SPC A;  3ETG A;  1AI6 A;  2JEX A;  4BW5 A;  1QR9 A;  4R8C A;  5J9P C;  4MVU A;  5B1N A;  5KA6 A;  2EIN C;  1Y66 A;  1KD1 W;  1PNL A;  4ASU G;  2JK5 C;  2ZD9 A;  3SJQ C;  1B6Q A;  1YSC A;  3QNE A;  2EIM B;  4FK5 C;  1OZ0 A;  2B1G A;  2PI5 A;  3CCM V;  3F7V C;  4XDJ A;  1VQ8 V;  1JPX A;  3ZIA G;  4H37 A;  2EIM C;  5FL7 G;  2WLL A;  5CBG A;  3CCR V;  3OAA G;  3E8F A;  3RBZ A;  1LNQ A;  4WFE A;  5BZB A;  2WPD G;  3ML0 A;  1F4N A;  5CMU A;  3A0R A;  4QNH B;  1YJW V;  5CA3 A;  1ARO P;  2XAG A;  5L3F A;  3BY6 A;  1R3K C;  4MS2 A;  2P6J A;  3OUS A;  4DXW A;  1N8R W;  3CCE V;  2QKS A;  4WFA V;  4PEL A;  3B8N A;  3AG2 B;  1AJN A;  2R9R B;  2UXN A;  4MSW C;  4Q20 A;  1K7D A;  1DF5 A;  2HVJ C;  3LUT B;  4X88 A;  3SYO A;  1YIT V;  3SPI A;  2GSM B;  3X2Q B;  5B1A B;  3E8B A;  3W7S A;  1Q86 W;  4MTO A;  1ROP A;  5L3D A;  3OFN G;  2NNU A;  4MW3 A;  2Q68 A;  3K0G A;  1P7B A;  1FXK A;  3AG2 C;  3JD0 A;  2NLJ C;  2BOB C;  3QO7 A;  3M99 B;  4WFH A;  3CYO A;  4G27 B;  3OM3 B;  3X2Q C;  5B1A C;  3ABL B;  1VQ5 V;  4JTC B;  5EC1 C;  1G4Y B;  2XAF A;  5L3C A;  4FJC C;  2W0F C;  2WLH A;  3AG1 B;  1ENV A;  3SYP A;  3AG4 B;  1K3E A;  2OT5 A;  4OXS A;  1JX9 A;  2X6A A;  3ABL C;  5EBW C;  5HFL A;  2X7R B;  4QE9 A;  2EIK B;  4U7N A;  2KB1 A;  3B8M A;  4QJF B;  4LBE C;  4JPR A;  4F4L A;  1YI2 V;  2XOK G;  2IW5 A;  3AG1 C;  3UKM A;  1NH2 D;  3AG4 C;  1KKD A;  1H38 A;  1E1Q G;  3CC4 V;  1XL6 A;  1FXV A;  1VQ6 V;  1K34 A;  1K33 A;  2EIK C;  4G2K A;  5DN6 G;  2A0L A;  1S3J A;  3RVY A;  1H8H G;  3KG2 A;  3TET A;  1VQ4 V;  5CBF A;  4JAV A;  4UVA A;  1YTF D;  4PDR A;  2QEX V;  3FYI B;  1QCE A;  2JIZ G;  4ZKI A;  1SRY A;  1MOF A;  2WLM A;  1SZT A;  1COW G;  3ZN1 A;  3MHS C;  1JCH A;  4QIW F;  3LNM B;  2ZDI C;  2HJF C;  4GT1 A;  1K4D C;  2YEV A;  3JD2 A;  4G28 B;  4JTA B;  5EBM C;  3CME V;  2HKO A;  1SER A;  3PJS K;  3WG7 B;  3ABT A;  2DYR B;  4WFB V;  1FS0 G;  3FB8 C;  1R73 A;  2H94 A;  1R6N A;  2IH1 C;  4BIU A;  3P32 A;  3ZN0 A;  1JQ0 A;  4PA9 A;  3K08 A;  2EZO A;  1CP9 A;  4Z1M G;  3WG7 C;  2DYR C;  1VQK V;  1V55 B;  1I5X A;  1KC8 W;  2JDI G;  2IU0 A;  3QO5 A;  2V1D A;  1SET A;  1NR7 A;  1S76 D;  3RVZ A;  2JJ2 G;  3ZRW A;  5GW7 A;  2WLN A;  4XDK A;  3G71 V;  3CD6 V;  3STL C;  1E1R G;  3OGC C;  1P4R A;  1V55 C;  2Q69 A;  2V7Q G;  2YEV B;  1VQO V;  5H6Q A;  2XAH A;  1IXM A;  3DTU B;  2WAM A;  3HB3 B;  2QM7 A;  5LGU A;  1Q81 W;  2OTL V;  3E2E A;  3SPH A;  1KP3 A;  4GX5 A;  3I56 V;  1NH2 B;  1HWY A;  3FB6 C;  2A9H A;  1RM1 B;  1FXH A;  5KA5 A;  1SES A;  2D3O W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...