1YITV

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yitV00
1W2BU 3CXCU 1Q7YW 1K8AW 3CCLV 1Q82W 2QA4V 1N8RW 1R73A 3I56V 1VQLV 1VQ4V 3CCJV 1VQOV 1S72V 1VQ6V 1VQ9V 1YJNV 1VQ8V 1YJWV 3G4SV 1Q81W 3CCMV 1KD1W 2OTLV 3CCEV 3CCVV 1VQKV 1YI2V 4WF9V 1KC8W 3G71V 5DM6V 1M1KW 1M90W 1Q86W 1NJIW 1VQMV 1YHQV 1YITV 3CMEV 3CPWU 3CMAV 1VQ7V 4WFBV 2OTJV 3OW2U 1YJ9V 3CCSV 2D3OW 1K9MW 1VQ5V 3CC7V 3G6EV 1QVGU 3CCUV 3CC2V 1JJ2U 1KQSU 3I55V 3CD6V 1QVFU 3CCQV 4WCEV 1YIJV 1VQPV 2QEXV 4WFAV 3CCRV 1K73W 1VQNV 3CC4V
chains in the Genus database with same CATH superfamily
4O4JB 4FLYA 4JYCA 4JI8O 5ITZA 1OV9A 2ZINA 4HZ3A 4DRXB 4DV2O 1XMOO 4O4JA 4BW5A 5LA6B 1YHQV 4D7SA 5KMGB 2D3OW 1O9GA 4DRXA 1QVGU 3T1CA 5JQGB 1K4CC 2YEVA 4ZKIA 2ZR3A 2VWJA 3CCQV 4DV5B 1VQPV 1YF2A 1IBKO 3SYQA 5LA6A 4BW9A 4PI0A 3K06A 5KMGA 4O2AB 2BSKA 3E8FA 3K5NA 2GUZB 4DW1A 1GM7A 3RFRA 4UCSA 1EN5A 2DMXA 1MZFA 5L3CA 2HKOA 1S3JA 4O2AA 2HVKC 3H1KH 1IZ3A 1M93A 4FMTA 4LFAO 1TUEB 4O4LA 1GK9A 2GUZA 3UO2A 2EIMB 2CTPA 2WLIA 2X7RB 3RYFA 1XL4A 2YDEA 2V1DA 3TETA 1F51A 5KX5B 4CBCA 2X6BA 3S3WA 2AHYA 3UKMA 5JCOA 4QGPA 1GRJA 3AG1C 1WN7A 4LR3A 2YXLA 2IU0A 3TXSA 2IJKA 3ASNB 4GZRB 4TQFA 4JI5O 5J2TA 3T4DA 4TQDA 3N2GA 2W0XA 3LSSA 4H33A 4B3RB 4NTXA 4P9OA 3ZRSA 2DYRC 1ZSPA 3ZCCA 2EIKB 4GYCB 4ZHQA 2CTWA 2GV9A 4J11A 5C93A 1TAEA 2EILC 1L1FA 3QG5A 1XL6A 3B8MA 2QE7G 5H2FZ 3NXSA 3WB2A 3KCYA 4U7NA 4DR6B 2PI5A 3FD9A 1FXVA 3CP1A 1AI4A 1XI1A 4ZOLB 4DV4B 4FLWA 2DWEC 5BZBA 4RQFA 2B1IA 2MK3A 2WWWA 2OIGA 4RUEA 5LXTB 5TISZ 3KG2A 1YEWA 2QM7A 4PA3A 2MW2B 1AR1B 1JPXA 4LH6A 3SJBC 5LXTA 5KAFZ 3OE7G 3FX7A 2QJ1A 2RN9A 4X89A 2E5LB 4QPJA 3LNMB 3C90A 3E8HA 1QLEC 1P4RA 2XASA 5J2UB 2QA4V 1HNZB 3ZEDA 3JARB 4JI7B 3G4SV 4NXMB 4X66B 5J2UA 1Q8IA 1AJQA 4JZ2A 3JARA 3HKBB 2DW4A 4UV8A 4DV5O 2EIJB 5E1AC 3Q4HB 1GM8A 4YHHB 1UPGA 3IGAC 4J7KA 1NQTA 1VQLV 3K58A 1PL0A 1WA8A 2CGNA 3Q4HA 3ASOC 4PDLA 5EYPB 1VQ7V 3SPGA 4LFCB 2R9RB 1HDJA 1IURA 4NXNB 4TSFG 4XBFA 4QE7A 2Z0AA 3JALB 1WP7A 4FLZA 4PA9A 5EYPA 4RWUA 1N4CA 4PV1B 2YIAA 1LR1A 1JA8A 3C3TA 1XILA 5FPOA 3JALA 2IJJA 3OUSA 1OCZB 1XQ8A 1TUBA 4KHPB 1X59A 2VQFB 5EK0A 2EZOA 3EVKA 1Q3EA 4X20B 1JJ2U 3L71H 2AXTZ 1KP3A 3CSXA 2P06A 4LNUB 3SR2C 4JTAB 2IH3C 2KQXA 3TCUA 3VQWA 4OPHA 2ETNA 3RYIA 1KKCA 2EULA 3BY6A 3LSUA 4B3RO 5HFLA 1K5QA 1B06A 2L35A 4RQEA 1DF4A 2Q9LA 5IE9A 1K7DA 1HW7A 2XHBA 4JF3A 1J95A 4JAAA 2OTJV 4JTDB 2P90A 3EXAA 3SYPA 4DO2A 5JJNB 1NTKH 4CS2A 1I94B 3MHSC 5BY1A 3FYEB 2JJ1G 3CCRV 2DE0X 3LDDA 3AEIA 2N74A 4DV3B 2LFSA 1KBHA 1MOFA 4B3MO 1Q81W 1OCCC 4DR6O 4X62B 2HHHB 2OCCB 3EFFK 3CPWU 2ZDIC 2HR3A 4DV4O 4GX5A 1QVFU 5H9CA 4J80A 2E76B 5CA3A 4JZGA 4BIOA 3JAWB 4PDMA 2PZSA 2ZCEA 1QBZA 2ITCC 5EBLC 2CGOA 4HNAB 3D3IA 1US6A 1XREA 1JJOA 2JVDA 3CCSV 3CC7V 2CK3G 2YIBD 2R9IA 2GTSA 3MD0A 1HNZO 2XOKG 4JI7O 1I0HA 2LP7A 4NXMO 1BL8A 1ENVA 4IIJB 4Z2WA 4X66O 4JI0B 1WJZA 2Y69B 1PD3A 1QLNA 5JWPA 3CRRA 2OWOA 3CC2V 1PV0A 3E8GA 1PM9A 3ZBHA 4YHHO 4U3JB 3JCZA 3RWRD 1W2BU 1YXBA 2N04A 1IVSA 1FXKA 2HLDG 5C8YB 1YVWA 4U3JA 1YI2V 3CEIA 1P7GA 1EZJA 3QVNA 2XUMA 1SZTA 1A32A 2NNUA 4LFCO 5C8YA 3ZMZA 3JYCA 1GN2A 3MAQA 3E86A 3I5DA 1SQGA 1AB3A 2B9ZA 4PDRA 1SKVA 4J41A 4RUFA 3LDCA 4MVZA 5KHHA 2P4VA 1XMQO 3F7VC 1COWG 3ZS8C 3AG4C 3N2KA 3SYCA 4MW8A 4KHPO 2VQFO 5LGTA 4BWAA 1Q6IA 4I50B 3ABLC 4GKKB 3K9AA 5JCOC 3E35A 2UXNA 4I55B 2WA4A 3T2MA 4I50A 4TV8A 3RVZA 4J9YB 2JS5A 3X2QC 4BIZA 3H1IH 1GMGA 2FB5A 4I55A 2RCVA 4PJ0Z 4I9QA 2XAHA 3JD1A 1YDXA 1R3LC 1D5AA 4O4HA 2UXBO 4DV3O 3OD4A 3UCSC 1NBMG 3GWOA 2CDYA 1VARA 3KKYA 4PA6A 5CA0B 4X62O 2LJ2A 2F93B 3H1LH 3AG7A 2HHHO 1GN4A 1EN6A 1M56B 3FYIB 5KLVH 4FLTA 1BCCH 1MA1A 1YTFD 5KAIZ 5D5QA 2UXXA 2Q7EA 1IX9A 3GWKC 1Y76A 2Q67A 5B5EZ 4W4KA 5JH7B 3R65A 4J10A 4K35A 3IFXA 4J9ZB 1DLBA 2YICA 4O2BB 4YJ2B 5H5NA 2YI8A 4JYAO 2JGUA 1I08A 4LF5O 1Q43A 4GX2A 1XBLA 5B3SB 1XNRB 5EC1C 2QM8A 2YIDA 1I5YA 5HFMA 3K0GA 2C2AA 2E75B 1V55B 4MT8A 2EZPA 3K5MA 1L8DA 3ABMB 1FFXA 2ZE6A 1WP8A 3CRQA 3CC4V 4JI5B 2O57A 2LW7A 1PNKA 3RBZA 4F4LA 4QE9A 4JI0O 1J5EB 1Y66A 3JATB 3AK1A 4DUYB 2DJVA 3W7TA 4UXNA 3ZHSA 5KHKA 3AG3C 1SQXH 3JATA 4MVSA 3L70H 1SQQH 3CCLV 3ZHTA 1O9HA 2EINC 2XAFA 4IHJB 4CH4A 2DYSC 2Q5ZA 4Q20A 1GN6A 3L72H 1SC5B 2P6JA 4GCZA 2BTOA 3SJAC 2IH1C 3TK1A 4IHJA 2YSUB 3D3QA 3CD6V 2EIJC 1SQBH 1VEWA 1FD9A 5K1XA 2F66C 1K8AW 1DGSA 4QPKA 4L87A 1R73A 2YIBA 3K0DA 1OCRC 1WLEA 1E79G 1YJNV 3K79A 1OCOB 3NR7A 2OTLV 3LSQA 4NVPA 3CB2A 3QO8A 1K92A 2L6LA 1BQ0A 4FZ1A 3PJSK 2XAJA 3ABKB 1TVKB 4K8XA 1NT2B 3ZHUA 4NR1A 4JAUA 3OTFA 1B04A 2QWQB 1RPRA 4FJCC 5EIBD 1AJPA 1D2DA 3PN1A 4F6EA 2RNBA 1VQ4V 1H2NA 2Z5UA 1TVKA 3ZMVA 2JGDA 1XHXA 2X6AA 4UVCA 2IJIA 4LF8B 5BR8B 2EJRA 3JCUZ 1SQFA 1MSWD 3HKEB 4HAMA 2QWRB 1R3IC 3HKEA 5JQGA 2GSMB 1XUQA 4TUYB 3RYHB 1N0NA 1TA8A 3BRCA 2HJFC 3AK3A 2H3OA 1FYJA 1V54C 5LHIA 3OR7C 2P7TC 2VRZA 2WLJA 3RYHA 2QKSA 3ZMUA 1CXZB 4B3SB 4DR5B 1NS1A 1Y67A 3J7AU 2ADQB 3QTCA 4E4EA 4IL6Z 5H6RA 1R3JC 2NN4A 4X88A 1XNRO 3G71V 1RPOA 1NTZH 4P9PA 3CMEV 4LF6B 3AG2C 1YCIA 2KG7B 1ZL8B 1E1RG 3ABTA 4AILC 5KX5A 4LP8A 1JMKC 1SERA 2Q0OC 1R6TA 3OEEG 3B2EE 4UCRA 3B40A 3ZRXA 2W0FC 3ZRVA 1J5EO 3K04A 1YTFB 5LP6C 4DUYO 2BOCC 4FM2A 3UM7A 1OHHG 4LWSB 5FPRA 3W7WA 4RO2A 1WNSA 1AI6A 3WG7C 2LQTA 2ZXWC 1NI8A 3RYCB 5L3EA 2HP8A 2QTOA 4LWSA 2P67A 2PTMA 1D5NA 3K08A 1R1BA 1Z5VA 4B3MB 3O9OA 4OGQB 4TWKA 2CUGA 4GT1A 3M7MX 3RYCA 4WFBV 4MVMA 1FXKC 2ARHA 4KXRA 3J81N 5CBFA 4K3AA 3ZIAG 4H44B 1JFFB 2P22C 2QWPB 3CS5A 2RMKB 2UUCO 1K3EA 2D2CB 4ZOLA 1RM1C 3M99B 2HJDA 4OPAA 1XNQO 1H8HG 1JFFA 4ABMA 3ZN1A 1M57C 5B1BB 4C7UA 3BHPA 4HBNA 1PNMA 3I55V 1BHBA 1ZTEA 2R70A 1QHTA 4ICGA 4DR3B 1GKFA 2DWDC 1MZEA 4CH5A 1M1KW 4JV5B 4LF8O 4AHCA 5BR8O 3P32A 1R6NA 1UJWB 3K59A 1NH2D 4KFMA 5B1OA 1BMFG 5IYCO 2QM4A 3OAAG 2QEXV 1XDCA 3KZIZ 4PELA 2F23A 5CB4B 3HKBA 1BHAA 1VQ8V 2WAMA 2RQ6A 2QKAA 2PUSA 3LNNA 5LHHA 2WLKA 3HPLC 1URFA 5CB4A 2P5OA 4QJFB 5KHIA 2ODMA 4JI4B 5B1AC 1IDSA 2WPDG 4B3SO 4DR5O 2F95B 1ZWIC 1QU7A 3BAAA 1XMQB 5LYJB 2A06H 3CCEV 1KC8W 3ZMSA 4ZI7B 4FLVA 4LF6O 3RW0A 1F7YA 4CZZA 2QWNB 2NR5A 3KCXA 5LYJA 2PGGA 4I0XB 1K73W 1VQNV 4J42A 4ZI7A 2ZKOA 2FL4A 2ITDC 1BZKA 4X20A 4PA7A 2ATKC 1EN4A 4I0XA 1FPOA 4JPRA 4LNUA 2A3QA 4DV0B 4JI1B 3HB3B 4CH6A 3U11A 3QO7A 4JAVA 4UV9A 4P30A 5LMUB 1N0JA 3QF7A 1UFIA 3J80N 3OMAB 1FKAO 5B66Z 2UXBB 1Q6UA 2LGQA 2RDCA 3L74H 3TXQA 3DGEA 4JI6B 4EKWA 2DQ0A 4YIOA 3CCVV 4D6TH 4LF7B 4DK0A 4J7JA 3CXHF 4BR6A 2BCCH 3E83A 4GX1A 4XDKA 1N32B 1LUVA 1JX9A 3ETEA 3SDLA 3FB5C 4TOIA 1EZVH 2K1EA 4JYAB 2ZNJA 4LF5B 3JAWA 1CEZA 2Y4TA 5LOVB 2PI4A 3CE2A 3M8AA 3SGIA 4HNAA 2YS8A 3G67A 1KB9F 4JI3B 4QIWF 5LOVA 3STZC 3G80A 4DR3O 3RGBA 2H8PC 1NZ6A 4LCUC 1N36B 4I7ZB 4MS2A 1OCOC 2DYRB 4JV5O 5AG2A 4U3FH 3FKSG 4DR7B 3DC5A 4WFGA 1IXMA 4BIUA 2EILB 4IIJA 4WCEV 4B7EA 4WFAV 3B77A 2ZIOA 4KL1A 4PD4F 4CC6A 3DXRB 1Q82W 3CX5F 2PY5A 1ORQC 3IJ4A 3OT7A 5IYZB 3DXRA 1MMMA 3ZHVA 1H2MA 1KP2A 4JI4O 3JAMN 4FIPC 3ZMTA 4X64B 1OZ0A 4I5SA 5IYBO 1SQPH 1R3KC 2IJHA 4MVQA 1LUWA 1AR5A 3UT5B 4NYKA 5LGUA 1NH2B 1LNQA 3GB7C 3C3SA 1IBMB 3D36A 3FFQA 1MABG 5EZYB 3CRCA 1QLEB 2EIMC 1F23A 4LF9B 4E2LA 5JJEB 2IBZH 2QGNA 5EZYA 4DV0O 2AZ0A 4JI1O 1GTOA 4UCVA 3FB6C 3CHXA 3H1JH 3L9DA 3DSQA 3E22B 2H94A 3WB1A 5LMUO 4YY3B 3ASNC 2AW9A 1H2SB 5LMNB 3S3XA 1NVPB 1RFYA 3H9VA 2EJ7A 4DR2B 5CA1B 3E22A 2E3CA 4JI6O 1YJWV 1EM1A 4NTYA 3ASOB 3ZHQA 4LF7O 5JVDB 3OUFA 3WB0A 5CA1A 2EIKC 4RAIA 1VQ5V 2BTQB 3K5LA 5CA0A 2YXHA 3L75H 2X0LA 1RP3B 2B5UA 1N32O 3OGIB 1N8RW 2PF4E 2BTQA 1N33B 1VQ9V 4JTCB 2WLMA 3AK2A 3VOUA 3T1HB 5JH7A 4ZIBA 4GX0A 1M4UA 4DR1B 3JASB 1WB8A 2JIZG 4O2BA 4YJ2A 5IDJA 4IT5A 4H13B 4JI3O 4WBNB 3JASA 1PP9H 1N36O 3BEHA 2UXDB 1VF5B 4G27B 2E74B 4TV9B 5KUKA 2KB1A 1PKXA 3ZN0A 4DR7O 3H1HH 1DK1A 1Z2GA 2ZR2A 1AI5A 3MHHC 3HKDB 1YZBA 1YIJV 3CRMA 4I9WA 1F4MA 1GN3A 3JAKB 3THOA 4I4TB 3JSLA 2UUAB 3T1YB 3K3WA 2P4KA 1OCCB 3GVMA 4GKJB 2N05A 2XT9A 3BA8A 3P3NA 5DM6V 4IYIA 4I4TA 5F2VO 1I5XA 3JD3A 3ZJZA 1PPJH 5EC2C 1RSOB 4OXSA 5EBWC 2Q4PA 4MSWC 4X64O 2ZDIA 4O4IB 2W6JG 5A9GA 4LBEC 1K5SA 4H0LB 2UUCB 1KUQA 1KD1W 2R9AA 3BCCH 5KUMA 1BQZA 2FYUH 1JVMA 1NJIW 1XNQB 4F6RB 1IBMO 1QR9A 4X9QA 2Y0IA 3OMIB 1K34A 4R7CA 3OEHG 3ZHRA 4LF9O 1G8MA 4F6RA 1AI7A 1NR7A 2EBOA 5GW7A 4GUNA 2WLHA 2PYJA 2UU9B 2R72A 5H6QA 1OCZC 4LC1A 4B08A 1G1XB 3CMAV 4MTGA 2ZE8A 3CJHB 4GLXA 4YY3O 5LMNO 3FB8C 2BOBC 4DYLA 3SJCC 4DUZB 4DR2O 3RT3C 1R6KA 3I56V 3CJHA 3DC6A 1S72V 2YEVB 2IM9A 4B3TO 3P30A 3UO3A 4B7KA 5IT9N 2CTRA 4FFBB 1Q86W 3OGCC 4H37A 3EHBB 1W0JG 4YJ3B 2BSKB 5L3FA 3CCUV 2F1MA 2ZIMA 5CMUA 1V9PA 4DV1B 4FFBA 4UCTA 3WU2Z 1SQVH 2CTQA 4KP4A 1HR0B 4TUYA 3BPZA 4G28B 2Y0PA 1CP9A 4YJ3A 1GM9A 4EB6B 1I7FA 3CCJV 4O4LB 1N33O 3BVOA 2ILMA 3AG4B 3A0RA 2WLIB 4PI2A 3SYAA 3T1HO 1FAFA 3RYFB 2OCCC 4DR1O 3IC7A 4EB6A 4ASUG 1U96A 2JK5C 3ABLB 3TJTA 3P3PA 2LO1A 4MTFA 2XAGA 3OMNB 4MW3A 2YUAA 2KG7A 1ZL8A 1VQ6V 2UXDO 5LGNA 4LFBO 2M6YA 5J2TB 2OIEA 3X2QB 3VQVA 2QKCA 1S77D 1SA0B 3N2GB 1S5LZ 3FAVB 3IAYA 2FTKA 2KKWA 4K0KB 3L73H 4LF4B 4OX9B 2VS0A 3UQ8A 1NKDA 3ML0A 4JYYA 2VQEB 3OFNG 4X1KB 1SA0A 2W6IG 3FAVA 4ZHQB 2WSSG 3T1YO 2UUAO 1K97A 2YI9A 4GKJO 4JYBA 2Y4UA 4X1KA 5KHGA 3K03A 1BE3H 2Y69C 5BXZA 3U0ZA 3BABA 1AP5A 4UVAA 1KQSU 1ZX3A 3A8TA 1U97A 1NU1H 1Q5OA 4UFZA 1QCEA 3B8NA 3CWBH 3FB7C 5L3DA 2WLLB 1HNWB 1SF9A 1VQOV 2XNDG 2AGAA 1KYOF 4NKGB 2YXYA 5KHJA 2K9PA 1N34B 1VMGA 2HFEC 1VQMV 2WLLA 1P7BA 1FXHA 4ZBMA 3CYOA 4Q6GA 3T4ZA 4L8JA 2CAZC 3A0HZ 5JJJB 4DV6B 1VF7A 3D36C 2UU9O 4UVBA 2F4VB 3SJQC 1DF5A 4AQYB 4DR4B 1AVMA 2PYLA 4U7OA 1AR4A 2XAQA 4WFFA 2Q6AA 3OR6C 2ADPA 3ZX6A 2Q7HA 3AG3B 3N27A 4CH3A 4FM1A 3CXCU 4DUZO 5CN0A 4MTOA 1X4TA 2EINB 2DYSB 3HKCB 1P49A 5L3GA 1GO3F 4YIPA 1JR9A 1L0LH 2RJZA 2UXCB 3RN4A 3W7UA 5CBHA 1WA8B 3HKCA 5LBQA 4DV1O 4PHZA 1HR0O 2CH7B 3TGUH 2QSAA 3D8CA 2ZM6B 4X1IB 1OCRB 4DV7B 1NVPD 2A79B 2CH7A 3R66A 4CS3A 4FM0A 4X1IA 5KA5A 1M56C 5IY5B 3H01A 3BFRA 4R50A 1VIBA 2JS3A 1K4DC 4WFEA 1HWYA 1F4NA 2VWKA 1SESA 1TUBB 1AJNA 2JJ2G 2F43G 3A0BZ 3K9SA 5LHGA 4D7TA 1VF6A 4XDJA 2LGWA 2HVJC 5FLXN 5B3SC 2OT5A 1MSDA 2BE3A 1V55C 3RYIB 3G6EV 4K0KO 4LF4O 4OX9O 2EX3A 3VQXA 1Z5WA 2VQEO 3ABMC 1HP8A 4FVMA 4R6ZA 4NTWA 5LL6Y 4UCUA 1H2KA 2GDSA 4JI2B 3OTOB 2IU3A 2ZQMA 4R8CA 4XDLA 3B4SA 2OCHA 2DOSA 3OM3B 3W7XA 5GONB 1V54B 3VBBA 4UUJC 4Z1VA 4KUMA 5GTIZ 4W4LA 4X65B 3LUTB 2GHYA 1FS0G 1HNWO 2M7WA 5GONA 1WAZA 1HNXB 1GAXA 2HEPA 3LDEA 1N34O 1T5EA 4CS4A 3AG2B 4AI8A 3AG1B 3O65A 4DK1A 2Q69A 1MG1A 3HR0A 2AHZA 1Y74B 1KU9A 3SPIA 1PL4A 4DV6O 3RVYA 5BMVB 2F4VO 1AROP 3U10A 1KMIZ 1Y74A 4AQYO 1ZAUA 4DR4O 5LP6B 2E5LO 2Q8VA 5BMVA 4PDVA 3F5WC 2G38A 1K33A 3ABKC 2WLNA 3CRAA 5FNVB 2XTAA 1NR1A 3QNEA 5LP6A 3WG7B 2ZXWB 2UUBB 1S5JA 5K1PA 3IC9A 5FNVA 2QWOB 3JD4A 2UXCO 3VQYA 1FXKB 2LW1A 4J7ZA 4G2KA 4MVRA 1OJHA 5IYDO 4DW0A 5CBGA 2V4DA 5IYZA 2ZE5A 2ZM6O 3A2FA 2X6CA 2ZNIA 4DV7O 2QR4A 1RM1B 4FZ0A 1Q6HA 1M90W 1M57B 1EBOA 2JRIA 5B1NA 1IBLB 1SETA 4NXNO 5IWAB 1Y6XA 1BT8A 1AILA 4HYOA 2Q73A 3N2KB 1SRYA 3UT5A 5IJ0B 1XHZA 2OYQA 4WFHA 1Q7YW 2B1GA 3W7SA 3ETDA 5E79Z 2FMLA 1MNGA 2QDOA 2NLJC 5IJ0A 1NTMH 1AP6A 5DEDA 4WF9V 1BGYH 5IJ9B 4CC5A 1ROPA 4EEQA 4Z1MG 3OW2U 4MTXA 4TV8B 1JOYA 4FK5C 1Y4MA 3BA9A 4UCOA 3E2EA 1H2LA 1YITV 4FFKA 1FJGB 5IJ9A 2JEXA 5DN6G 4JI8B 4JI2O 2ZT9B 3OTOO 4DV2B 1G4YB 1XMOB 2Q68A 4MVOA 3SPCA 4X1YB 4B3TB 4O4HB 1PNLA 2A9HA 5J9PC 1WB7A 1M9NA 2JDIG 1WPBA 1I94O 1KKDA 4YXWG 1H2GA 1YSCA 2YC0A 3JSNA 4JGSA 5B1AB 3SYOA 4X65O 1S76D 4X1YA 1FFTB 4IYHA 5JVDA 1IBKB 1H38A 5A2QN 4K8ZA 1HNXO 1Y76B 2IW5A 1M5IA 5GTHZ 4FLXA 4A5UB 1XOUA 2LFRA 2DN9A 4LFAB 3G6BA 3SPJA 2GTAA 4P2ZA 1JCHA 2V7QG 2ZE7A 4QNHB 1ZLZA 4FPPA 4NB5A 1FFXB 3DTUB 1DTOA 1VQKV 4LFBB 4WBNA 1XEQA 1JQ0A 5D5PA 1CPYA 5L3BA 5B1BC 2A0LA 1K9MW 2ZD9A 4PA4A 1H8EG 2AZ2A 4TV9A 3JD2A 3APOA 1B3QA 2WA3A 2UUBO 1QQCA 4N23A 3E89A 1E1QG 3E8BA 3JD0A 3HKDA 3ABUA 3CCMV 1VP7A 1L0NH 1IXBA 4FLUA 1SS3A 2GBOA 1KECA 1S0VA 3JAKA 1WPXA 2Q0AA 1BS3A 1YJ9V 2QTSA 4MVUA 3F5TA 4N21A 3APQA 2A7WA 3WFVA 2CE4A 4LH7A 1EFRG 5EBMC 1SZXA 3ICXA 3K57A 1B6QA 1W0KG 1QNMA 1RSOA 4BAYA 3B09A 2Z3YA 4DXWA 2FKXA 1BSMA 1G6UA 2JEUA 4UB6Z 4O4IA 1IBLO 3STLC 3F7YC 5IWAO 1Q90D 3ETGA 1W59A 3ZRWB 1QR8A 4TT3G 4EFBA 3QO5A 1ZUQA 5EIBC 4EFEA 1TGOA 1P84F 2Y48A 5FL7G 5KA6A 4IGGA 3ZRWA 3MDSA 3ETQA 1S5HC 2DQ3A 4X8AA 3K5OA 5DECA 5IY5C 3SPHA 1GH6A 5ITZB 4GKKO 2HG5C 2KSDA 1VF6C 2JGDB 2Q7GA 4UB8Z 4JASA 1FJGO 1THZA
chains in the Genus database with same CATH topology
4JYCA 1JX9A 1NBMG 3ETEA 3GWOA 4HZ3A 3FB5C 2K1EA 4UVBA 4PA6A 3SJQC 1DF5A 4U7OA 1M56B 3FYIB 1YTFD 2XAQA 4WFFA 4BW5A 1YHQV 1CEZA 2Q6AA 3OR6C 2D3OW 2PI4A 2UXXA 1QVGU 3AG3B 3T1CA 3CCQV 1K4CC 2YEVA 4ZKIA 2Q67A 2ZR3A 1VQPV 3CXCU 3SYQA 3R65A 4QIWF 3STZC 3K06A 5CN0A 3IFXA 4MTOA 4WFBV 4J9ZB 2EINB 1DLBA 3E8FA 2DYSB 2H8PC 4LCUC 1GM7A 4MS2A 5L3GA 1GO3F 1OCOC 4GX2A 2DYRB 5B3SB 5L3CA 5EC1C 2QM8A 3FKSG 2HKOA 1S3JA 1I5YA 2HVKC 5HFMA 3K0GA 2C2AA 1IXMA 4WFGA 1V55B 4FMTA 4MT8A 3W7UA 1TUEB 2EZPA 5CBHA 1GK9A 5LBQA 4BIUA 2EILB 2EIMB 4WCEV 3ABMB 4WFAV 2WLIA 2X7RB 3B77A 3CC4V 1Q82W 1XL4A 1OCRB 1PNKA 1ORQC 2V1DA 3RBZA 3TETA 1NVPD 1F51A 4F4LA 4CBCA 2X6BA 4QE9A 1Y66A 2A79B 2AHYA 3UKMA 5KA5A 1M56C 5IY5B 3H01A 4R50A 3AG1C 2OTJV 3W7TA 4UXNA 2IU0A 2IJKA 3ASNB 1KP2A 1K4DC 4WFEA 3AG3C 4FIPC 3ZMTA 1HWYA 1F4NA 4MVSA 1OZ0A 4I5SA 1SESA 3T4DA 3CCLV 1AJNA 2JJ2G 2F43G 5LHGA 5IYBO 3LSSA 2EINC 2XAFA 4XDJA 1R3KC 2IJHA 2DYSC 4MVQA 4Q20A 4H33A 2HVJC 4P9OA 3ZRSA 2P6JA 2DYRC 5B3SC 2OT5A 4GCZA 5LGUA 3ZCCA 1NH2B 1LNQA 2EIKB 3GB7C 3D36A 2IH1C 3TK1A 1V55C 2YSUB 3G6EV 1MABG 3CD6V 5C93A 1QLEB 2EIJC 2EILC 2EIMC 1F23A 3ABMC 1L1FA 1XL6A 4E2LA 3B8MA 1K8AW 4QPKA 2QE7G 4L87A 4R6ZA 1R73A 3K0DA 3NXSA 1OCRC 1WLEA 1E79G 1YJNV 4U7NA 3K79A 1OCOB 2IU3A 2OTLV 2ZQMA 3LSQA 4R8CA 4XDLA 2PI5A 1GTOA 3QO8A 3OM3B 3FB6C 1K92A 1FXVA 3W7XA 3PJSK 2XAJA 3CP1A 1AI4A 3ABKB 1V54B 2H94A 3VBBA 4UUJC 4KUMA 4JAUA 2DWEC 3ASNC 1RPRA 5BZBA 3LUTB 4RQFA 4FJCC 2B1IA 2GHYA 2MK3A 1FS0G 2WWWA 1AJPA 4RUEA 1NVPB 2M7WA 1VQ4V 2Z5UA 3ZMVA 1YJWV 3KG2A 2X6AA 4UVCA 3ASOB 2QM7A 4PA3A 3LDEA 2IJIA 1AR1B 1JPXA 3OUFA 3AG2B 2EIKC 2EJRA 4RAIA 3OE7G 3AG1B 4X89A 1VQ5V 2Q69A 4QPJA 1MG1A 3LNMB 3E8HA 1MSWD 1QLEC 2AHZA 1P4RA 2X0LA 2XASA 2B5UA 3SPIA 4HAMA 2QA4V 1R3IC 1N8RW 3RVYA 1VQ9V 3G4SV 1AROP 4JTCB 2WLMA 2GSMB 3VOUA 1AJQA 4GX0A 2HJFC 4PDVA 2DW4A 3F5WC 2JIZG 4UV8A 1K33A 5IDJA 3ABKC 2WLNA 1V54C 1NR1A 2EIJB 3QNEA 5E1AC 5LHIA 3OR7C 2P7TC 1GM8A 2WLJA 3IGAC 2QKSA 3WG7B 3ZMUA 2ZXWB 1NQTA 1VQLV 1PL0A 3BEHA 5H6RA 1R3JC 4G27B 3ASOC 4X88A 2KB1A 5KUKA 1PKXA 3ZN0A 3G71V 4PDLA 1RPOA 3JD4A 4P9PA 3CMEV 1VQ7V 3AG2C 3SPGA 1FXKB 1E1RG 2ZR2A 1AI5A 3ABTA 2R9RB 3MHHC 4TSFG 4G2KA 4XBFA 4LP8A 4MVRA 4QE7A 1YIJV 5IYDO 4I9WA 1F4MA 1SERA 5CBGA 3OEEG 4PA9A 2X6CA 3ZRXA 2W0FC 3K3WA 3ZRVA 1RM1B 1OCCB 3K04A 1YTFB 2IJJA 3OUSA 1OCZB 1M90W 5DM6V 1M57B 1EBOA 2BOCC 1I5XA 3JD3A 5EK0A 5B1NA 3ZJZA 1SETA 3UM7A 1OHHG 2EZOA 5EC2C 1JJ2U 4XDKA 4OXSA 4HYOA 1KP3A 5EBWC 4MSWC 3W7WA 1SRYA 4RO2A 4WFHA 4JTAB 2IH3C 1Q7YW 2B1GA 3TCUA 3W7SA 2ZDIA 1AI6A 3ETDA 3WG7C 2W6JG 2ZXWC 5L3EA 2QTOA 4LBEC 2P67A 3BY6A 1K5SA 3K08A 1K5QA 2NLJC 5HFLA 4RQEA 1KD1W 1DF4A 5KUMA 4TWKA 4WF9V 4GT1A 1JVMA 1NJIW 1K7DA 1QR9A 1ROPA 4Z1MG 4JF3A 1J95A 3OMIB 1K34A 4JTDB 4MVMA 4R7CA 4MTXA 2P90A 3OEHG 3SYPA 1FXKC 3OW2U 4FK5C 4DO2A 1JOYA 1Y4MA 3MHSC 3E2EA 3FYEB 2JJ1G 5CBFA 3CCRV 1YITV 1G8MA 3ZIAG 3LDDA 3AEIA 1AI7A 2JEXA 5DN6G 2LFSA 1NR7A 2EBOA 5GW7A 1MOFA 2WLHA 1K3EA 1RM1C 1Q81W 1OCCC 3M99B 1G4YB 2Q68A 4MVOA 1H8HG 5H6QA 3SPCA 1OCZC 2OCCB 4LC1A 1PNLA 3ZN1A 1M57C 2A9HA 3EFFK 5B1BB 5J9PC 3CPWU 3CMAV 2ZDIC 1M9NA 2JDIG 2HR3A 4MTGA 1KKDA 4YXWG 1H2GA 1PNMA 1YSCA 4JGSA 3I55V 4GX5A 5B1AB 5H9CA 3SYOA 1QVFU 1BHBA 1S76D 5CA3A 3FB8C 1FFTB 2BOBC 1H38A 4PDMA 1QBZA 1R6KA 3I56V 2ITCC 1GKFA 5EBLC 2DWDC 1S72V 3D3IA 2YEVB 2IW5A 3P30A 1M1KW 1Q86W 3OGCC 3P32A 4H37A 1R6NA 3EHBB 1UJWB 1W0JG 2LFRA 3CCSV 1NH2D 3CC7V 2CK3G 4KFMA 5B1OA 5L3FA 5CMUA 3CCUV 1BMFG 3SPJA 2R9IA 5IYCO 3OAAG 2QEXV 4P2ZA 1JCHA 2V7QG 4KP4A 3MD0A 4G28B 4PELA 2XOKG 1CP9A 4QNHB 1GM9A 4FPPA 3CCJV 1BHAA 2LP7A 1VQ8V 3AG4B 2WAMA 1BL8A 1ENVA 3A0RA 3DTUB 1DTOA 2WLIB 1VQKV 3SYAA 5LHHA 2Y69B 1JQ0A 1PD3A 2OCCC 1CPYA 3IC7A 2WLKA 3HPLC 5B1BC 5L3BA 1QLNA 4ASUG 4QJFB 2A0LA 1K9MW 2JK5C 2ZD9A 3ABLB 3CC2V 4PA4A 3E8GA 1H8EG 5B1AC 3JD2A 3JCZA 1W2BU 2WPDG 4MTFA 2XAGA 4N23A 3OMNB 1ZWIC 3E89A 4MW3A 1FXKA 2HLDG 1E1QG 1VQ6V 3E8BA 3JD0A 3ABUA 5LGNA 3CCMV 3X2QB 3CCEV 1YI2V 1KC8W 3ZMSA 1EZJA 1KECA 1S0VA 1SZTA 1S77D 2NNUA 3RW0A 1WPXA 4CZZA 1YJ9V 2FTKA 4MVUA 3ZMZA 4N21A 3JYCA 1NKDA 3WFVA 3ML0A 1K73W 1VQNV 3E86A 3OFNG 4PDRA 4RUFA 1EFRG 2W6IG 5EBMC 3LDCA 4MVZA 2WSSG 1K97A 2ITDC 1B6QA 1W0KG 1COWG 3F7VC 4PA7A 4BAYA 2ATKC 3AG4C 4JYBA 2Z3YA 4DXWA 4JPRA 3SYCA 4MW8A 3HB3B 3K03A 2JEUA 2Y69C 5LGTA 3STLC 3F7YC 3QO7A 4JAVA 3ETGA 4UV9A 3ZRWB 3ABLC 4P30A 4UVAA 1QR8A 4TT3G 1KQSU 3QO5A 3K9AA 1QCEA 2Y48A 3OMAB 3B8NA 3FB7C 5L3DA 5FL7G 3E35A 2UXNA 2WLLB 5KA6A 3T2MA 3ZRWA 3DGEA 1VQOV 2XNDG 3RVZA 1S5HC 4J9YB 2DQ0A 2DQ3A 4EKWA 4X8AA 3CCVV 3X2QC 4BIZA 2HFEC 5IY5C 1VQMV 2WLLA 1GMGA 3SPHA 1P7BA 1FXHA 4ZBMA 3CYOA 2HG5C 4JASA 2XAHA 3JD1A 3E83A 3T4ZA 4GX1A 1R3LC 1THZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B U;  3CXC U;  1Q7Y W;  1K8A W;  3CCL V;  1Q82 W;  2QA4 V;  1N8R W;  1R73 A;  3I56 V;  1VQL V;  1VQ4 V;  3CCJ V;  1VQO V;  1S72 V;  1VQ6 V;  1VQ9 V;  1YJN V;  1VQ8 V;  1YJW V;  3G4S V;  1Q81 W;  3CCM V;  1KD1 W;  2OTL V;  3CCE V;  3CCV V;  1VQK V;  1YI2 V;  4WF9 V;  1KC8 W;  3G71 V;  5DM6 V;  1M1K W;  1M90 W;  1Q86 W;  1NJI W;  1VQM V;  1YHQ V;  1YIT V;  3CME V;  3CPW U;  3CMA V;  1VQ7 V;  4WFB V;  2OTJ V;  3OW2 U;  1YJ9 V;  3CCS V;  2D3O W;  1K9M W;  1VQ5 V;  3CC7 V;  3G6E V;  1QVG U;  3CCU V;  3CC2 V;  1JJ2 U;  1KQS U;  3I55 V;  3CD6 V;  1QVF U;  3CCQ V;  4WCE V;  1YIJ V;  1VQP V;  2QEX V;  4WFA V;  3CCR V;  1K73 W;  1VQN V;  3CC4 V; 
#chains in the Genus database with same CATH topology
 4O4J B;  4FLY A;  4JYC A;  4JI8 O;  5ITZ A;  1OV9 A;  2ZIN A;  4HZ3 A;  4DRX B;  4DV2 O;  1XMO O;  4O4J A;  4BW5 A;  5LA6 B;  1YHQ V;  4D7S A;  5KMG B;  2D3O W;  1O9G A;  4DRX A;  1QVG U;  3T1C A;  5JQG B;  1K4C C;  2YEV A;  4ZKI A;  2ZR3 A;  2VWJ A;  3CCQ V;  4DV5 B;  1VQP V;  1YF2 A;  1IBK O;  3SYQ A;  5LA6 A;  4BW9 A;  4PI0 A;  3K06 A;  5KMG A;  4O2A B;  2BSK A;  3E8F A;  3K5N A;  2GUZ B;  4DW1 A;  1GM7 A;  3RFR A;  4UCS A;  1EN5 A;  2DMX A;  1MZF A;  5L3C A;  2HKO A;  1S3J A;  4O2A A;  2HVK C;  3H1K H;  1IZ3 A;  1M93 A;  4FMT A;  4LFA O;  1TUE B;  4O4L A;  1GK9 A;  2GUZ A;  3UO2 A;  2EIM B;  2CTP A;  2WLI A;  2X7R B;  3RYF A;  1XL4 A;  2YDE A;  2V1D A;  3TET A;  1F51 A;  5KX5 B;  4CBC A;  2X6B A;  3S3W A;  2AHY A;  3UKM A;  5JCO A;  4QGP A;  1GRJ A;  3AG1 C;  1WN7 A;  4LR3 A;  2YXL A;  2IU0 A;  3TXS A;  2IJK A;  3ASN B;  4GZR B;  4TQF A;  4JI5 O;  5J2T A;  3T4D A;  4TQD A;  3N2G A;  2W0X A;  3LSS A;  4H33 A;  4B3R B;  4NTX A;  4P9O A;  3ZRS A;  2DYR C;  1ZSP A;  3ZCC A;  2EIK B;  4GYC B;  4ZHQ A;  2CTW A;  2GV9 A;  4J11 A;  5C93 A;  1TAE A;  2EIL C;  1L1F A;  3QG5 A;  1XL6 A;  3B8M A;  2QE7 G;  5H2F Z;  3NXS A;  3WB2 A;  3KCY A;  4U7N A;  4DR6 B;  2PI5 A;  3FD9 A;  1FXV A;  3CP1 A;  1AI4 A;  1XI1 A;  4ZOL B;  4DV4 B;  4FLW A;  2DWE C;  5BZB A;  4RQF A;  2B1I A;  2MK3 A;  2WWW A;  2OIG A;  4RUE A;  5LXT B;  5TIS Z;  3KG2 A;  1YEW A;  2QM7 A;  4PA3 A;  2MW2 B;  1AR1 B;  1JPX A;  4LH6 A;  3SJB C;  5LXT A;  5KAF Z;  3OE7 G;  3FX7 A;  2QJ1 A;  2RN9 A;  4X89 A;  2E5L B;  4QPJ A;  3LNM B;  3C90 A;  3E8H A;  1QLE C;  1P4R A;  2XAS A;  5J2U B;  2QA4 V;  1HNZ B;  3ZED A;  3JAR B;  4JI7 B;  3G4S V;  4NXM B;  4X66 B;  5J2U A;  1Q8I A;  1AJQ A;  4JZ2 A;  3JAR A;  3HKB B;  2DW4 A;  4UV8 A;  4DV5 O;  2EIJ B;  5E1A C;  3Q4H B;  1GM8 A;  4YHH B;  1UPG A;  3IGA C;  4J7K A;  1NQT A;  1VQL V;  3K58 A;  1PL0 A;  1WA8 A;  2CGN A;  3Q4H A;  3ASO C;  4PDL A;  5EYP B;  1VQ7 V;  3SPG A;  4LFC B;  2R9R B;  1HDJ A;  1IUR A;  4NXN B;  4TSF G;  4XBF A;  4QE7 A;  2Z0A A;  3JAL B;  1WP7 A;  4FLZ A;  4PA9 A;  5EYP A;  4RWU A;  1N4C A;  4PV1 B;  2YIA A;  1LR1 A;  1JA8 A;  3C3T A;  1XIL A;  5FPO A;  3JAL A;  2IJJ A;  3OUS A;  1OCZ B;  1XQ8 A;  1TUB A;  4KHP B;  1X59 A;  2VQF B;  5EK0 A;  2EZO A;  3EVK A;  1Q3E A;  4X20 B;  1JJ2 U;  3L71 H;  2AXT Z;  1KP3 A;  3CSX A;  2P06 A;  4LNU B;  3SR2 C;  4JTA B;  2IH3 C;  2KQX A;  3TCU A;  3VQW A;  4OPH A;  2ETN A;  3RYI A;  1KKC A;  2EUL A;  3BY6 A;  3LSU A;  4B3R O;  5HFL A;  1K5Q A;  1B06 A;  2L35 A;  4RQE A;  1DF4 A;  2Q9L A;  5IE9 A;  1K7D A;  1HW7 A;  2XHB A;  4JF3 A;  1J95 A;  4JAA A;  2OTJ V;  4JTD B;  2P90 A;  3EXA A;  3SYP A;  4DO2 A;  5JJN B;  1NTK H;  4CS2 A;  1I94 B;  3MHS C;  5BY1 A;  3FYE B;  2JJ1 G;  3CCR V;  2DE0 X;  3LDD A;  3AEI A;  2N74 A;  4DV3 B;  2LFS A;  1KBH A;  1MOF A;  4B3M O;  1Q81 W;  1OCC C;  4DR6 O;  4X62 B;  2HHH B;  2OCC B;  3EFF K;  3CPW U;  2ZDI C;  2HR3 A;  4DV4 O;  4GX5 A;  1QVF U;  5H9C A;  4J80 A;  2E76 B;  5CA3 A;  4JZG A;  4BIO A;  3JAW B;  4PDM A;  2PZS A;  2ZCE A;  1QBZ A;  2ITC C;  5EBL C;  2CGO A;  4HNA B;  3D3I A;  1US6 A;  1XRE A;  1JJO A;  2JVD A;  3CCS V;  3CC7 V;  2CK3 G;  2YIB D;  2R9I A;  2GTS A;  3MD0 A;  1HNZ O;  2XOK G;  4JI7 O;  1I0H A;  2LP7 A;  4NXM O;  1BL8 A;  1ENV A;  4IIJ B;  4Z2W A;  4X66 O;  4JI0 B;  1WJZ A;  2Y69 B;  1PD3 A;  1QLN A;  5JWP A;  3CRR A;  2OWO A;  3CC2 V;  1PV0 A;  3E8G A;  1PM9 A;  3ZBH A;  4YHH O;  4U3J B;  3JCZ A;  3RWR D;  1W2B U;  1YXB A;  2N04 A;  1IVS A;  1FXK A;  2HLD G;  5C8Y B;  1YVW A;  4U3J A;  1YI2 V;  3CEI A;  1P7G A;  1EZJ A;  3QVN A;  2XUM A;  1SZT A;  1A32 A;  2NNU A;  4LFC O;  5C8Y A;  3ZMZ A;  3JYC A;  1GN2 A;  3MAQ A;  3E86 A;  3I5D A;  1SQG A;  1AB3 A;  2B9Z A;  4PDR A;  1SKV A;  4J41 A;  4RUF A;  3LDC A;  4MVZ A;  5KHH A;  2P4V A;  1XMQ O;  3F7V C;  1COW G;  3ZS8 C;  3AG4 C;  3N2K A;  3SYC A;  4MW8 A;  4KHP O;  2VQF O;  5LGT A;  4BWA A;  1Q6I A;  4I50 B;  3ABL C;  4GKK B;  3K9A A;  5JCO C;  3E35 A;  2UXN A;  4I55 B;  2WA4 A;  3T2M A;  4I50 A;  4TV8 A;  3RVZ A;  4J9Y B;  2JS5 A;  3X2Q C;  4BIZ A;  3H1I H;  1GMG A;  2FB5 A;  4I55 A;  2RCV A;  4PJ0 Z;  4I9Q A;  2XAH A;  3JD1 A;  1YDX A;  1R3L C;  1D5A A;  4O4H A;  2UXB O;  4DV3 O;  3OD4 A;  3UCS C;  1NBM G;  3GWO A;  2CDY A;  1VAR A;  3KKY A;  4PA6 A;  5CA0 B;  4X62 O;  2LJ2 A;  2F93 B;  3H1L H;  3AG7 A;  2HHH O;  1GN4 A;  1EN6 A;  1M56 B;  3FYI B;  5KLV H;  4FLT A;  1BCC H;  1MA1 A;  1YTF D;  5KAI Z;  5D5Q A;  2UXX A;  2Q7E A;  1IX9 A;  3GWK C;  1Y76 A;  2Q67 A;  5B5E Z;  4W4K A;  5JH7 B;  3R65 A;  4J10 A;  4K35 A;  3IFX A;  4J9Z B;  1DLB A;  2YIC A;  4O2B B;  4YJ2 B;  5H5N A;  2YI8 A;  4JYA O;  2JGU A;  1I08 A;  4LF5 O;  1Q43 A;  4GX2 A;  1XBL A;  5B3S B;  1XNR B;  5EC1 C;  2QM8 A;  2YID A;  1I5Y A;  5HFM A;  3K0G A;  2C2A A;  2E75 B;  1V55 B;  4MT8 A;  2EZP A;  3K5M A;  1L8D A;  3ABM B;  1FFX A;  2ZE6 A;  1WP8 A;  3CRQ A;  3CC4 V;  4JI5 B;  2O57 A;  2LW7 A;  1PNK A;  3RBZ A;  4F4L A;  4QE9 A;  4JI0 O;  1J5E B;  1Y66 A;  3JAT B;  3AK1 A;  4DUY B;  2DJV A;  3W7T A;  4UXN A;  3ZHS A;  5KHK A;  3AG3 C;  1SQX H;  3JAT A;  4MVS A;  3L70 H;  1SQQ H;  3CCL V;  3ZHT A;  1O9H A;  2EIN C;  2XAF A;  4IHJ B;  4CH4 A;  2DYS C;  2Q5Z A;  4Q20 A;  1GN6 A;  3L72 H;  1SC5 B;  2P6J A;  4GCZ A;  2BTO A;  3SJA C;  2IH1 C;  3TK1 A;  4IHJ A;  2YSU B;  3D3Q A;  3CD6 V;  2EIJ C;  1SQB H;  1VEW A;  1FD9 A;  5K1X A;  2F66 C;  1K8A W;  1DGS A;  4QPK A;  4L87 A;  1R73 A;  2YIB A;  3K0D A;  1OCR C;  1WLE A;  1E79 G;  1YJN V;  3K79 A;  1OCO B;  3NR7 A;  2OTL V;  3LSQ A;  4NVP A;  3CB2 A;  3QO8 A;  1K92 A;  2L6L A;  1BQ0 A;  4FZ1 A;  3PJS K;  2XAJ A;  3ABK B;  1TVK B;  4K8X A;  1NT2 B;  3ZHU A;  4NR1 A;  4JAU A;  3OTF A;  1B04 A;  2QWQ B;  1RPR A;  4FJC C;  5EIB D;  1AJP A;  1D2D A;  3PN1 A;  4F6E A;  2RNB A;  1VQ4 V;  1H2N A;  2Z5U A;  1TVK A;  3ZMV A;  2JGD A;  1XHX A;  2X6A A;  4UVC A;  2IJI A;  4LF8 B;  5BR8 B;  2EJR A;  3JCU Z;  1SQF A;  1MSW D;  3HKE B;  4HAM A;  2QWR B;  1R3I C;  3HKE A;  5JQG A;  2GSM B;  1XUQ A;  4TUY B;  3RYH B;  1N0N A;  1TA8 A;  3BRC A;  2HJF C;  3AK3 A;  2H3O A;  1FYJ A;  1V54 C;  5LHI A;  3OR7 C;  2P7T C;  2VRZ A;  2WLJ A;  3RYH A;  2QKS A;  3ZMU A;  1CXZ B;  4B3S B;  4DR5 B;  1NS1 A;  1Y67 A;  3J7A U;  2ADQ B;  3QTC A;  4E4E A;  4IL6 Z;  5H6R A;  1R3J C;  2NN4 A;  4X88 A;  1XNR O;  3G71 V;  1RPO A;  1NTZ H;  4P9P A;  3CME V;  4LF6 B;  3AG2 C;  1YCI A;  2KG7 B;  1ZL8 B;  1E1R G;  3ABT A;  4AIL C;  5KX5 A;  4LP8 A;  1JMK C;  1SER A;  2Q0O C;  1R6T A;  3OEE G;  3B2E E;  4UCR A;  3B40 A;  3ZRX A;  2W0F C;  3ZRV A;  1J5E O;  3K04 A;  1YTF B;  5LP6 C;  4DUY O;  2BOC C;  4FM2 A;  3UM7 A;  1OHH G;  4LWS B;  5FPR A;  3W7W A;  4RO2 A;  1WNS A;  1AI6 A;  3WG7 C;  2LQT A;  2ZXW C;  1NI8 A;  3RYC B;  5L3E A;  2HP8 A;  2QTO A;  4LWS A;  2P67 A;  2PTM A;  1D5N A;  3K08 A;  1R1B A;  1Z5V A;  4B3M B;  3O9O A;  4OGQ B;  4TWK A;  2CUG A;  4GT1 A;  3M7M X;  3RYC A;  4WFB V;  4MVM A;  1FXK C;  2ARH A;  4KXR A;  3J81 N;  5CBF A;  4K3A A;  3ZIA G;  4H44 B;  1JFF B;  2P22 C;  2QWP B;  3CS5 A;  2RMK B;  2UUC O;  1K3E A;  2D2C B;  4ZOL A;  1RM1 C;  3M99 B;  2HJD A;  4OPA A;  1XNQ O;  1H8H G;  1JFF A;  4ABM A;  3ZN1 A;  1M57 C;  5B1B B;  4C7U A;  3BHP A;  4HBN A;  1PNM A;  3I55 V;  1BHB A;  1ZTE A;  2R70 A;  1QHT A;  4ICG A;  4DR3 B;  1GKF A;  2DWD C;  1MZE A;  4CH5 A;  1M1K W;  4JV5 B;  4LF8 O;  4AHC A;  5BR8 O;  3P32 A;  1R6N A;  1UJW B;  3K59 A;  1NH2 D;  4KFM A;  5B1O A;  1BMF G;  5IYC O;  2QM4 A;  3OAA G;  2QEX V;  1XDC A;  3KZI Z;  4PEL A;  2F23 A;  5CB4 B;  3HKB A;  1BHA A;  1VQ8 V;  2WAM A;  2RQ6 A;  2QKA A;  2PUS A;  3LNN A;  5LHH A;  2WLK A;  3HPL C;  1URF A;  5CB4 A;  2P5O A;  4QJF B;  5KHI A;  2ODM A;  4JI4 B;  5B1A C;  1IDS A;  2WPD G;  4B3S O;  4DR5 O;  2F95 B;  1ZWI C;  1QU7 A;  3BAA A;  1XMQ B;  5LYJ B;  2A06 H;  3CCE V;  1KC8 W;  3ZMS A;  4ZI7 B;  4FLV A;  4LF6 O;  3RW0 A;  1F7Y A;  4CZZ A;  2QWN B;  2NR5 A;  3KCX A;  5LYJ A;  2PGG A;  4I0X B;  1K73 W;  1VQN V;  4J42 A;  4ZI7 A;  2ZKO A;  2FL4 A;  2ITD C;  1BZK A;  4X20 A;  4PA7 A;  2ATK C;  1EN4 A;  4I0X A;  1FPO A;  4JPR A;  4LNU A;  2A3Q A;  4DV0 B;  4JI1 B;  3HB3 B;  4CH6 A;  3U11 A;  3QO7 A;  4JAV A;  4UV9 A;  4P30 A;  5LMU B;  1N0J A;  3QF7 A;  1UFI A;  3J80 N;  3OMA B;  1FKA O;  5B66 Z;  2UXB B;  1Q6U A;  2LGQ A;  2RDC A;  3L74 H;  3TXQ A;  3DGE A;  4JI6 B;  4EKW A;  2DQ0 A;  4YIO A;  3CCV V;  4D6T H;  4LF7 B;  4DK0 A;  4J7J A;  3CXH F;  4BR6 A;  2BCC H;  3E83 A;  4GX1 A;  4XDK A;  1N32 B;  1LUV A;  1JX9 A;  3ETE A;  3SDL A;  3FB5 C;  4TOI A;  1EZV H;  2K1E A;  4JYA B;  2ZNJ A;  4LF5 B;  3JAW A;  1CEZ A;  2Y4T A;  5LOV B;  2PI4 A;  3CE2 A;  3M8A A;  3SGI A;  4HNA A;  2YS8 A;  3G67 A;  1KB9 F;  4JI3 B;  4QIW F;  5LOV A;  3STZ C;  3G80 A;  4DR3 O;  3RGB A;  2H8P C;  1NZ6 A;  4LCU C;  1N36 B;  4I7Z B;  4MS2 A;  1OCO C;  2DYR B;  4JV5 O;  5AG2 A;  4U3F H;  3FKS G;  4DR7 B;  3DC5 A;  4WFG A;  1IXM A;  4BIU A;  2EIL B;  4IIJ A;  4WCE V;  4B7E A;  4WFA V;  3B77 A;  2ZIO A;  4KL1 A;  4PD4 F;  4CC6 A;  3DXR B;  1Q82 W;  3CX5 F;  2PY5 A;  1ORQ C;  3IJ4 A;  3OT7 A;  5IYZ B;  3DXR A;  1MMM A;  3ZHV A;  1H2M A;  1KP2 A;  4JI4 O;  3JAM N;  4FIP C;  3ZMT A;  4X64 B;  1OZ0 A;  4I5S A;  5IYB O;  1SQP H;  1R3K C;  2IJH A;  4MVQ A;  1LUW A;  1AR5 A;  3UT5 B;  4NYK A;  5LGU A;  1NH2 B;  1LNQ A;  3GB7 C;  3C3S A;  1IBM B;  3D36 A;  3FFQ A;  1MAB G;  5EZY B;  3CRC A;  1QLE B;  2EIM C;  1F23 A;  4LF9 B;  4E2L A;  5JJE B;  2IBZ H;  2QGN A;  5EZY A;  4DV0 O;  2AZ0 A;  4JI1 O;  1GTO A;  4UCV A;  3FB6 C;  3CHX A;  3H1J H;  3L9D A;  3DSQ A;  3E22 B;  2H94 A;  3WB1 A;  5LMU O;  4YY3 B;  3ASN C;  2AW9 A;  1H2S B;  5LMN B;  3S3X A;  1NVP B;  1RFY A;  3H9V A;  2EJ7 A;  4DR2 B;  5CA1 B;  3E22 A;  2E3C A;  4JI6 O;  1YJW V;  1EM1 A;  4NTY A;  3ASO B;  3ZHQ A;  4LF7 O;  5JVD B;  3OUF A;  3WB0 A;  5CA1 A;  2EIK C;  4RAI A;  1VQ5 V;  2BTQ B;  3K5L A;  5CA0 A;  2YXH A;  3L75 H;  2X0L A;  1RP3 B;  2B5U A;  1N32 O;  3OGI B;  1N8R W;  2PF4 E;  2BTQ A;  1N33 B;  1VQ9 V;  4JTC B;  2WLM A;  3AK2 A;  3VOU A;  3T1H B;  5JH7 A;  4ZIB A;  4GX0 A;  1M4U A;  4DR1 B;  3JAS B;  1WB8 A;  2JIZ G;  4O2B A;  4YJ2 A;  5IDJ A;  4IT5 A;  4H13 B;  4JI3 O;  4WBN B;  3JAS A;  1PP9 H;  1N36 O;  3BEH A;  2UXD B;  1VF5 B;  4G27 B;  2E74 B;  4TV9 B;  5KUK A;  2KB1 A;  1PKX A;  3ZN0 A;  4DR7 O;  3H1H H;  1DK1 A;  1Z2G A;  2ZR2 A;  1AI5 A;  3MHH C;  3HKD B;  1YZB A;  1YIJ V;  3CRM A;  4I9W A;  1F4M A;  1GN3 A;  3JAK B;  3THO A;  4I4T B;  3JSL A;  2UUA B;  3T1Y B;  3K3W A;  2P4K A;  1OCC B;  3GVM A;  4GKJ B;  2N05 A;  2XT9 A;  3BA8 A;  3P3N A;  5DM6 V;  4IYI A;  4I4T A;  5F2V O;  1I5X A;  3JD3 A;  3ZJZ A;  1PPJ H;  5EC2 C;  1RSO B;  4OXS A;  5EBW C;  2Q4P A;  4MSW C;  4X64 O;  2ZDI A;  4O4I B;  2W6J G;  5A9G A;  4LBE C;  1K5S A;  4H0L B;  2UUC B;  1KUQ A;  1KD1 W;  2R9A A;  3BCC H;  5KUM A;  1BQZ A;  2FYU H;  1JVM A;  1NJI W;  1XNQ B;  4F6R B;  1IBM O;  1QR9 A;  4X9Q A;  2Y0I A;  3OMI B;  1K34 A;  4R7C A;  3OEH G;  3ZHR A;  4LF9 O;  1G8M A;  4F6R A;  1AI7 A;  1NR7 A;  2EBO A;  5GW7 A;  4GUN A;  2WLH A;  2PYJ A;  2UU9 B;  2R72 A;  5H6Q A;  1OCZ C;  4LC1 A;  4B08 A;  1G1X B;  3CMA V;  4MTG A;  2ZE8 A;  3CJH B;  4GLX A;  4YY3 O;  5LMN O;  3FB8 C;  2BOB C;  4DYL A;  3SJC C;  4DUZ B;  4DR2 O;  3RT3 C;  1R6K A;  3I56 V;  3CJH A;  3DC6 A;  1S72 V;  2YEV B;  2IM9 A;  4B3T O;  3P30 A;  3UO3 A;  4B7K A;  5IT9 N;  2CTR A;  4FFB B;  1Q86 W;  3OGC C;  4H37 A;  3EHB B;  1W0J G;  4YJ3 B;  2BSK B;  5L3F A;  3CCU V;  2F1M A;  2ZIM A;  5CMU A;  1V9P A;  4DV1 B;  4FFB A;  4UCT A;  3WU2 Z;  1SQV H;  2CTQ A;  4KP4 A;  1HR0 B;  4TUY A;  3BPZ A;  4G28 B;  2Y0P A;  1CP9 A;  4YJ3 A;  1GM9 A;  4EB6 B;  1I7F A;  3CCJ V;  4O4L B;  1N33 O;  3BVO A;  2ILM A;  3AG4 B;  3A0R A;  2WLI B;  4PI2 A;  3SYA A;  3T1H O;  1FAF A;  3RYF B;  2OCC C;  4DR1 O;  3IC7 A;  4EB6 A;  4ASU G;  1U96 A;  2JK5 C;  3ABL B;  3TJT A;  3P3P A;  2LO1 A;  4MTF A;  2XAG A;  3OMN B;  4MW3 A;  2YUA A;  2KG7 A;  1ZL8 A;  1VQ6 V;  2UXD O;  5LGN A;  4LFB O;  2M6Y A;  5J2T B;  2OIE A;  3X2Q B;  3VQV A;  2QKC A;  1S77 D;  1SA0 B;  3N2G B;  1S5L Z;  3FAV B;  3IAY A;  2FTK A;  2KKW A;  4K0K B;  3L73 H;  4LF4 B;  4OX9 B;  2VS0 A;  3UQ8 A;  1NKD A;  3ML0 A;  4JYY A;  2VQE B;  3OFN G;  4X1K B;  1SA0 A;  2W6I G;  3FAV A;  4ZHQ B;  2WSS G;  3T1Y O;  2UUA O;  1K97 A;  2YI9 A;  4GKJ O;  4JYB A;  2Y4U A;  4X1K A;  5KHG A;  3K03 A;  1BE3 H;  2Y69 C;  5BXZ A;  3U0Z A;  3BAB A;  1AP5 A;  4UVA A;  1KQS U;  1ZX3 A;  3A8T A;  1U97 A;  1NU1 H;  1Q5O A;  4UFZ A;  1QCE A;  3B8N A;  3CWB H;  3FB7 C;  5L3D A;  2WLL B;  1HNW B;  1SF9 A;  1VQO V;  2XND G;  2AGA A;  1KYO F;  4NKG B;  2YXY A;  5KHJ A;  2K9P A;  1N34 B;  1VMG A;  2HFE C;  1VQM V;  2WLL A;  1P7B A;  1FXH A;  4ZBM A;  3CYO A;  4Q6G A;  3T4Z A;  4L8J A;  2CAZ C;  3A0H Z;  5JJJ B;  4DV6 B;  1VF7 A;  3D36 C;  2UU9 O;  4UVB A;  2F4V B;  3SJQ C;  1DF5 A;  4AQY B;  4DR4 B;  1AVM A;  2PYL A;  4U7O A;  1AR4 A;  2XAQ A;  4WFF A;  2Q6A A;  3OR6 C;  2ADP A;  3ZX6 A;  2Q7H A;  3AG3 B;  3N27 A;  4CH3 A;  4FM1 A;  3CXC U;  4DUZ O;  5CN0 A;  4MTO A;  1X4T A;  2EIN B;  2DYS B;  3HKC B;  1P49 A;  5L3G A;  1GO3 F;  4YIP A;  1JR9 A;  1L0L H;  2RJZ A;  2UXC B;  3RN4 A;  3W7U A;  5CBH A;  1WA8 B;  3HKC A;  5LBQ A;  4DV1 O;  4PHZ A;  1HR0 O;  2CH7 B;  3TGU H;  2QSA A;  3D8C A;  2ZM6 B;  4X1I B;  1OCR B;  4DV7 B;  1NVP D;  2A79 B;  2CH7 A;  3R66 A;  4CS3 A;  4FM0 A;  4X1I A;  5KA5 A;  1M56 C;  5IY5 B;  3H01 A;  3BFR A;  4R50 A;  1VIB A;  2JS3 A;  1K4D C;  4WFE A;  1HWY A;  1F4N A;  2VWK A;  1SES A;  1TUB B;  1AJN A;  2JJ2 G;  2F43 G;  3A0B Z;  3K9S A;  5LHG A;  4D7T A;  1VF6 A;  4XDJ A;  2LGW A;  2HVJ C;  5FLX N;  5B3S C;  2OT5 A;  1MSD A;  2BE3 A;  1V55 C;  3RYI B;  3G6E V;  4K0K O;  4LF4 O;  4OX9 O;  2EX3 A;  3VQX A;  1Z5W A;  2VQE O;  3ABM C;  1HP8 A;  4FVM A;  4R6Z A;  4NTW A;  5LL6 Y;  4UCU A;  1H2K A;  2GDS A;  4JI2 B;  3OTO B;  2IU3 A;  2ZQM A;  4R8C A;  4XDL A;  3B4S A;  2OCH A;  2DOS A;  3OM3 B;  3W7X A;  5GON B;  1V54 B;  3VBB A;  4UUJ C;  4Z1V A;  4KUM A;  5GTI Z;  4W4L A;  4X65 B;  3LUT B;  2GHY A;  1FS0 G;  1HNW O;  2M7W A;  5GON A;  1WAZ A;  1HNX B;  1GAX A;  2HEP A;  3LDE A;  1N34 O;  1T5E A;  4CS4 A;  3AG2 B;  4AI8 A;  3AG1 B;  3O65 A;  4DK1 A;  2Q69 A;  1MG1 A;  3HR0 A;  2AHZ A;  1Y74 B;  1KU9 A;  3SPI A;  1PL4 A;  4DV6 O;  3RVY A;  5BMV B;  2F4V O;  1ARO P;  3U10 A;  1KMI Z;  1Y74 A;  4AQY O;  1ZAU A;  4DR4 O;  5LP6 B;  2E5L O;  2Q8V A;  5BMV A;  4PDV A;  3F5W C;  2G38 A;  1K33 A;  3ABK C;  2WLN A;  3CRA A;  5FNV B;  2XTA A;  1NR1 A;  3QNE A;  5LP6 A;  3WG7 B;  2ZXW B;  2UUB B;  1S5J A;  5K1P A;  3IC9 A;  5FNV A;  2QWO B;  3JD4 A;  2UXC O;  3VQY A;  1FXK B;  2LW1 A;  4J7Z A;  4G2K A;  4MVR A;  1OJH A;  5IYD O;  4DW0 A;  5CBG A;  2V4D A;  5IYZ A;  2ZE5 A;  2ZM6 O;  3A2F A;  2X6C A;  2ZNI A;  4DV7 O;  2QR4 A;  1RM1 B;  4FZ0 A;  1Q6H A;  1M90 W;  1M57 B;  1EBO A;  2JRI A;  5B1N A;  1IBL B;  1SET A;  4NXN O;  5IWA B;  1Y6X A;  1BT8 A;  1AIL A;  4HYO A;  2Q73 A;  3N2K B;  1SRY A;  3UT5 A;  5IJ0 B;  1XHZ A;  2OYQ A;  4WFH A;  1Q7Y W;  2B1G A;  3W7S A;  3ETD A;  5E79 Z;  2FML A;  1MNG A;  2QDO A;  2NLJ C;  5IJ0 A;  1NTM H;  1AP6 A;  5DED A;  4WF9 V;  1BGY H;  5IJ9 B;  4CC5 A;  1ROP A;  4EEQ A;  4Z1M G;  3OW2 U;  4MTX A;  4TV8 B;  1JOY A;  4FK5 C;  1Y4M A;  3BA9 A;  4UCO A;  3E2E A;  1H2L A;  1YIT V;  4FFK A;  1FJG B;  5IJ9 A;  2JEX A;  5DN6 G;  4JI8 B;  4JI2 O;  2ZT9 B;  3OTO O;  4DV2 B;  1G4Y B;  1XMO B;  2Q68 A;  4MVO A;  3SPC A;  4X1Y B;  4B3T B;  4O4H B;  1PNL A;  2A9H A;  5J9P C;  1WB7 A;  1M9N A;  2JDI G;  1WPB A;  1I94 O;  1KKD A;  4YXW G;  1H2G A;  1YSC A;  2YC0 A;  3JSN A;  4JGS A;  5B1A B;  3SYO A;  4X65 O;  1S76 D;  4X1Y A;  1FFT B;  4IYH A;  5JVD A;  1IBK B;  1H38 A;  5A2Q N;  4K8Z A;  1HNX O;  1Y76 B;  2IW5 A;  1M5I A;  5GTH Z;  4FLX A;  4A5U B;  1XOU A;  2LFR A;  2DN9 A;  4LFA B;  3G6B A;  3SPJ A;  2GTA A;  4P2Z A;  1JCH A;  2V7Q G;  2ZE7 A;  4QNH B;  1ZLZ A;  4FPP A;  4NB5 A;  1FFX B;  3DTU B;  1DTO A;  1VQK V;  4LFB B;  4WBN A;  1XEQ A;  1JQ0 A;  5D5P A;  1CPY A;  5L3B A;  5B1B C;  2A0L A;  1K9M W;  2ZD9 A;  4PA4 A;  1H8E G;  2AZ2 A;  4TV9 A;  3JD2 A;  3APO A;  1B3Q A;  2WA3 A;  2UUB O;  1QQC A;  4N23 A;  3E89 A;  1E1Q G;  3E8B A;  3JD0 A;  3HKD A;  3ABU A;  3CCM V;  1VP7 A;  1L0N H;  1IXB A;  4FLU A;  1SS3 A;  2GBO A;  1KEC A;  1S0V A;  3JAK A;  1WPX A;  2Q0A A;  1BS3 A;  1YJ9 V;  2QTS A;  4MVU A;  3F5T A;  4N21 A;  3APQ A;  2A7W A;  3WFV A;  2CE4 A;  4LH7 A;  1EFR G;  5EBM C;  1SZX A;  3ICX A;  3K57 A;  1B6Q A;  1W0K G;  1QNM A;  1RSO A;  4BAY A;  3B09 A;  2Z3Y A;  4DXW A;  2FKX A;  1BSM A;  1G6U A;  2JEU A;  4UB6 Z;  4O4I A;  1IBL O;  3STL C;  3F7Y C;  5IWA O;  1Q90 D;  3ETG A;  1W59 A;  3ZRW B;  1QR8 A;  4TT3 G;  4EFB A;  3QO5 A;  1ZUQ A;  5EIB C;  4EFE A;  1TGO A;  1P84 F;  2Y48 A;  5FL7 G;  5KA6 A;  4IGG A;  3ZRW A;  3MDS A;  3ETQ A;  1S5H C;  2DQ3 A;  4X8A A;  3K5O A;  5DEC A;  5IY5 C;  3SPH A;  1GH6 A;  5ITZ B;  4GKK O;  2HG5 C;  2KSD A;  1VF6 C;  2JGD B;  2Q7G A;  4UB8 Z;  4JAS A;  1FJG O;  1THZ A; 
#chains in the Genus database with same CATH homology
 4JYC A;  1JX9 A;  1NBM G;  3ETE A;  3GWO A;  4HZ3 A;  3FB5 C;  2K1E A;  4UVB A;  4PA6 A;  3SJQ C;  1DF5 A;  4U7O A;  1M56 B;  3FYI B;  1YTF D;  2XAQ A;  4WFF A;  4BW5 A;  1YHQ V;  1CEZ A;  2Q6A A;  3OR6 C;  2D3O W;  2PI4 A;  2UXX A;  1QVG U;  3AG3 B;  3T1C A;  3CCQ V;  1K4C C;  2YEV A;  4ZKI A;  2Q67 A;  2ZR3 A;  1VQP V;  3CXC U;  3SYQ A;  3R65 A;  4QIW F;  3STZ C;  3K06 A;  5CN0 A;  3IFX A;  4MTO A;  4WFB V;  4J9Z B;  2EIN B;  1DLB A;  3E8F A;  2DYS B;  2H8P C;  4LCU C;  1GM7 A;  4MS2 A;  5L3G A;  1GO3 F;  1OCO C;  4GX2 A;  2DYR B;  5B3S B;  5L3C A;  5EC1 C;  2QM8 A;  3FKS G;  2HKO A;  1S3J A;  1I5Y A;  2HVK C;  5HFM A;  3K0G A;  2C2A A;  1IXM A;  4WFG A;  1V55 B;  4FMT A;  4MT8 A;  3W7U A;  1TUE B;  2EZP A;  5CBH A;  1GK9 A;  5LBQ A;  4BIU A;  2EIL B;  2EIM B;  4WCE V;  3ABM B;  4WFA V;  2WLI A;  2X7R B;  3B77 A;  3CC4 V;  1Q82 W;  1XL4 A;  1OCR B;  1PNK A;  1ORQ C;  2V1D A;  3RBZ A;  3TET A;  1NVP D;  1F51 A;  4F4L A;  4CBC A;  2X6B A;  4QE9 A;  1Y66 A;  2A79 B;  2AHY A;  3UKM A;  5KA5 A;  1M56 C;  5IY5 B;  3H01 A;  4R50 A;  3AG1 C;  2OTJ V;  3W7T A;  4UXN A;  2IU0 A;  2IJK A;  3ASN B;  1KP2 A;  1K4D C;  4WFE A;  3AG3 C;  4FIP C;  3ZMT A;  1HWY A;  1F4N A;  4MVS A;  1OZ0 A;  4I5S A;  1SES A;  3T4D A;  3CCL V;  1AJN A;  2JJ2 G;  2F43 G;  5LHG A;  5IYB O;  3LSS A;  2EIN C;  2XAF A;  4XDJ A;  1R3K C;  2IJH A;  2DYS C;  4MVQ A;  4Q20 A;  4H33 A;  2HVJ C;  4P9O A;  3ZRS A;  2P6J A;  2DYR C;  5B3S C;  2OT5 A;  4GCZ A;  5LGU A;  3ZCC A;  1NH2 B;  1LNQ A;  2EIK B;  3GB7 C;  3D36 A;  2IH1 C;  3TK1 A;  1V55 C;  2YSU B;  3G6E V;  1MAB G;  3CD6 V;  5C93 A;  1QLE B;  2EIJ C;  2EIL C;  2EIM C;  1F23 A;  3ABM C;  1L1F A;  1XL6 A;  4E2L A;  3B8M A;  1K8A W;  4QPK A;  2QE7 G;  4L87 A;  4R6Z A;  1R73 A;  3K0D A;  3NXS A;  1OCR C;  1WLE A;  1E79 G;  1YJN V;  4U7N A;  3K79 A;  1OCO B;  2IU3 A;  2OTL V;  2ZQM A;  3LSQ A;  4R8C A;  4XDL A;  2PI5 A;  1GTO A;  3QO8 A;  3OM3 B;  3FB6 C;  1K92 A;  1FXV A;  3W7X A;  3PJS K;  2XAJ A;  3CP1 A;  1AI4 A;  3ABK B;  1V54 B;  2H94 A;  3VBB A;  4UUJ C;  4KUM A;  4JAU A;  2DWE C;  3ASN C;  1RPR A;  5BZB A;  3LUT B;  4RQF A;  4FJC C;  2B1I A;  2GHY A;  2MK3 A;  1FS0 G;  2WWW A;  1AJP A;  4RUE A;  1NVP B;  2M7W A;  1VQ4 V;  2Z5U A;  3ZMV A;  1YJW V;  3KG2 A;  2X6A A;  4UVC A;  3ASO B;  2QM7 A;  4PA3 A;  3LDE A;  2IJI A;  1AR1 B;  1JPX A;  3OUF A;  3AG2 B;  2EIK C;  2EJR A;  4RAI A;  3OE7 G;  3AG1 B;  4X89 A;  1VQ5 V;  2Q69 A;  4QPJ A;  1MG1 A;  3LNM B;  3E8H A;  1MSW D;  1QLE C;  2AHZ A;  1P4R A;  2X0L A;  2XAS A;  2B5U A;  3SPI A;  4HAM A;  2QA4 V;  1R3I C;  1N8R W;  3RVY A;  1VQ9 V;  3G4S V;  1ARO P;  4JTC B;  2WLM A;  2GSM B;  3VOU A;  1AJQ A;  4GX0 A;  2HJF C;  4PDV A;  2DW4 A;  3F5W C;  2JIZ G;  4UV8 A;  1K33 A;  5IDJ A;  3ABK C;  2WLN A;  1V54 C;  1NR1 A;  2EIJ B;  3QNE A;  5E1A C;  5LHI A;  3OR7 C;  2P7T C;  1GM8 A;  2WLJ A;  3IGA C;  2QKS A;  3WG7 B;  3ZMU A;  2ZXW B;  1NQT A;  1VQL V;  1PL0 A;  3BEH A;  5H6R A;  1R3J C;  4G27 B;  3ASO C;  4X88 A;  2KB1 A;  5KUK A;  1PKX A;  3ZN0 A;  3G71 V;  4PDL A;  1RPO A;  3JD4 A;  4P9P A;  3CME V;  1VQ7 V;  3AG2 C;  3SPG A;  1FXK B;  1E1R G;  2ZR2 A;  1AI5 A;  3ABT A;  2R9R B;  3MHH C;  4TSF G;  4G2K A;  4XBF A;  4LP8 A;  4MVR A;  4QE7 A;  1YIJ V;  5IYD O;  4I9W A;  1F4M A;  1SER A;  5CBG A;  3OEE G;  4PA9 A;  2X6C A;  3ZRX A;  2W0F C;  3K3W A;  3ZRV A;  1RM1 B;  1OCC B;  3K04 A;  1YTF B;  2IJJ A;  3OUS A;  1OCZ B;  1M90 W;  5DM6 V;  1M57 B;  1EBO A;  2BOC C;  1I5X A;  3JD3 A;  5EK0 A;  5B1N A;  3ZJZ A;  1SET A;  3UM7 A;  1OHH G;  2EZO A;  5EC2 C;  1JJ2 U;  4XDK A;  4OXS A;  4HYO A;  1KP3 A;  5EBW C;  4MSW C;  3W7W A;  1SRY A;  4RO2 A;  4WFH A;  4JTA B;  2IH3 C;  1Q7Y W;  2B1G A;  3TCU A;  3W7S A;  2ZDI A;  1AI6 A;  3ETD A;  3WG7 C;  2W6J G;  2ZXW C;  5L3E A;  2QTO A;  4LBE C;  2P67 A;  3BY6 A;  1K5S A;  3K08 A;  1K5Q A;  2NLJ C;  5HFL A;  4RQE A;  1KD1 W;  1DF4 A;  5KUM A;  4TWK A;  4WF9 V;  4GT1 A;  1JVM A;  1NJI W;  1K7D A;  1QR9 A;  1ROP A;  4Z1M G;  4JF3 A;  1J95 A;  3OMI B;  1K34 A;  4JTD B;  4MVM A;  4R7C A;  4MTX A;  2P90 A;  3OEH G;  3SYP A;  1FXK C;  3OW2 U;  4FK5 C;  4DO2 A;  1JOY A;  1Y4M A;  3MHS C;  3E2E A;  3FYE B;  2JJ1 G;  5CBF A;  3CCR V;  1YIT V;  1G8M A;  3ZIA G;  3LDD A;  3AEI A;  1AI7 A;  2JEX A;  5DN6 G;  2LFS A;  1NR7 A;  2EBO A;  5GW7 A;  1MOF A;  2WLH A;  1K3E A;  1RM1 C;  1Q81 W;  1OCC C;  3M99 B;  1G4Y B;  2Q68 A;  4MVO A;  1H8H G;  5H6Q A;  3SPC A;  1OCZ C;  2OCC B;  4LC1 A;  1PNL A;  3ZN1 A;  1M57 C;  2A9H A;  3EFF K;  5B1B B;  5J9P C;  3CPW U;  3CMA V;  2ZDI C;  1M9N A;  2JDI G;  2HR3 A;  4MTG A;  1KKD A;  4YXW G;  1H2G A;  1PNM A;  1YSC A;  4JGS A;  3I55 V;  4GX5 A;  5B1A B;  5H9C A;  3SYO A;  1QVF U;  1BHB A;  1S76 D;  5CA3 A;  3FB8 C;  1FFT B;  2BOB C;  1H38 A;  4PDM A;  1QBZ A;  1R6K A;  3I56 V;  2ITC C;  1GKF A;  5EBL C;  2DWD C;  1S72 V;  3D3I A;  2YEV B;  2IW5 A;  3P30 A;  1M1K W;  1Q86 W;  3OGC C;  3P32 A;  4H37 A;  1R6N A;  3EHB B;  1UJW B;  1W0J G;  2LFR A;  3CCS V;  1NH2 D;  3CC7 V;  2CK3 G;  4KFM A;  5B1O A;  5L3F A;  5CMU A;  3CCU V;  1BMF G;  3SPJ A;  2R9I A;  5IYC O;  3OAA G;  2QEX V;  4P2Z A;  1JCH A;  2V7Q G;  4KP4 A;  3MD0 A;  4G28 B;  4PEL A;  2XOK G;  1CP9 A;  4QNH B;  1GM9 A;  4FPP A;  3CCJ V;  1BHA A;  2LP7 A;  1VQ8 V;  3AG4 B;  2WAM A;  1BL8 A;  1ENV A;  3A0R A;  3DTU B;  1DTO A;  2WLI B;  1VQK V;  3SYA A;  5LHH A;  2Y69 B;  1JQ0 A;  1PD3 A;  2OCC C;  1CPY A;  3IC7 A;  2WLK A;  3HPL C;  5B1B C;  5L3B A;  1QLN A;  4ASU G;  4QJF B;  2A0L A;  1K9M W;  2JK5 C;  2ZD9 A;  3ABL B;  3CC2 V;  4PA4 A;  3E8G A;  1H8E G;  5B1A C;  3JD2 A;  3JCZ A;  1W2B U;  2WPD G;  4MTF A;  2XAG A;  4N23 A;  3OMN B;  1ZWI C;  3E89 A;  4MW3 A;  1FXK A;  2HLD G;  1E1Q G;  1VQ6 V;  3E8B A;  3JD0 A;  3ABU A;  5LGN A;  3CCM V;  3X2Q B;  3CCE V;  1YI2 V;  1KC8 W;  3ZMS A;  1EZJ A;  1KEC A;  1S0V A;  1SZT A;  1S77 D;  2NNU A;  3RW0 A;  1WPX A;  4CZZ A;  1YJ9 V;  2FTK A;  4MVU A;  3ZMZ A;  4N21 A;  3JYC A;  1NKD A;  3WFV A;  3ML0 A;  1K73 W;  1VQN V;  3E86 A;  3OFN G;  4PDR A;  4RUF A;  1EFR G;  2W6I G;  5EBM C;  3LDC A;  4MVZ A;  2WSS G;  1K97 A;  2ITD C;  1B6Q A;  1W0K G;  1COW G;  3F7V C;  4PA7 A;  4BAY A;  2ATK C;  3AG4 C;  4JYB A;  2Z3Y A;  4DXW A;  4JPR A;  3SYC A;  4MW8 A;  3HB3 B;  3K03 A;  2JEU A;  2Y69 C;  5LGT A;  3STL C;  3F7Y C;  3QO7 A;  4JAV A;  3ETG A;  4UV9 A;  3ZRW B;  3ABL C;  4P30 A;  4UVA A;  1QR8 A;  4TT3 G;  1KQS U;  3QO5 A;  3K9A A;  1QCE A;  2Y48 A;  3OMA B;  3B8N A;  3FB7 C;  5L3D A;  5FL7 G;  3E35 A;  2UXN A;  2WLL B;  5KA6 A;  3T2M A;  3ZRW A;  3DGE A;  1VQO V;  2XND G;  3RVZ A;  1S5H C;  4J9Y B;  2DQ0 A;  2DQ3 A;  4EKW A;  4X8A A;  3CCV V;  3X2Q C;  4BIZ A;  2HFE C;  5IY5 C;  1VQM V;  2WLL A;  1GMG A;  3SPH A;  1P7B A;  1FXH A;  4ZBM A;  3CYO A;  2HG5 C;  4JAS A;  2XAH A;  3JD1 A;  3E83 A;  3T4Z A;  4GX1 A;  1R3L C;  1THZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...