1YITV

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yitV00
1VQ9V 1VQPV 4WF9V 3CMEV 3CCEV 3CCLV 1VQLV 1M90W 1QVFU 1Q82W 1QVGU 1YJWV 5DM6V 1KC8W 2QEXV 3CCSV 2OTJV 1KQSU 1K73W 1YJNV 2OTLV 1VQ4V 3G6EV 4WFAV 3CCRV 1VQOV 1YI2V 3CCUV 1R73A 1VQ6V 3CD6V 3CXCU 1VQ7V 1Q81W 1VQ8V 1VQNV 3I56V 1K9MW 1JJ2U 1K8AW 1YITV 3G71V 3CMAV 2D3OW 3OW2U 1Q7YW 1KD1W 3CC4V 1Q86W 3CCJV 1VQMV 1W2BU 1YJ9V 1NJIW 1VQKV 3I55V 3CCMV 3CPWU 1YIJV 1S72V 3G4SV 3CC7V 3CC2V 1N8RW 1M1KW 4WFBV 1VQ5V 3CCVV 2QA4V 1YHQV 3CCQV 4WCEV
chains in the Genus database with same CATH superfamily
3E8BA 3M8AA 3CCEV 3F5WC 1LUWA 3T4DA 5L3EA 5IYDO 4XDKA 2X0LA 4AI8A 2P67A 4DV7O 2P90A 2AZ2A 4P9OA 4WFHA 4D6TH 4JI6B 1R6TA 5JQGB 2N74A 2LQTA 2UU9O 1XILA 2QM4A 4FM2A 2QJ1A 1MG1A 1ZX3A 2WLIB 4DUYO 4X20A 1GM8A 2VQEB 4UVCA 4BIZA 1AJPA 4E2LA 4JYAO 1ROPA 1SETA 3KG2A 4B3RB 1K92A 3CXHF 4DRXB 1YJWV 1COWG 4X1IA 2OYQA 5EBLC 5JH7A 3FYEB 1N0JA 4GX0A 4IIJB 1D2DA 5EZYA 2PYJA 1IZ3A 5J9PC 4NVPA 3KCYA 2ARHA 3KCXA 3E86A 3X2QC 1NTMH 1P49A 4EFEA 4JZ2A 1I94B 2BOBC 5C8YA 5EC1C 2E74B 1MA1A 3ASNB 4BR6A 3LNNA 1DGSA 4LF7B 3F5TA 3E22A 4X9QA 2HG5C 3N2KB 3C3TA 4TUYB 1R1BA 3J7AU 1SZTA 4ASUG 3ASNC 4PELA 4KUMA 5KHJA 1XMQB 2HVJC 3K79A 5CA1A 5LOVA 1K73W 3D3QA 1I5YA 3SPJA 1Y6XA 3DGEA 5BY1A 4TV9A 1JPXA 4I9WA 1XDCA 1OCCB 2WAMA 1FKAO 1Y76B 1L1FA 3BHPA 3OR6C 3JD3A 1QU7A 2WLMA 2O57A 5H2FZ 3SJAC 3HKBA 3ZMTA 1MOFA 1IBKO 1YVWA 3RGBA 1MSDA 3EVKA 3SJBC 2NN4A 4WFAV 3ZRWB 3E8GA 2W6IG 3E83A 3IGAC 3K03A 5L3GA 3DXRB 4TSFG 4K3AA 4E4EA 4KL1A 2K9PA 5IJ9A 2YC0A 1GN4A 3ZBHA 2WLJA 1NQTA 5DN6G 2UUCO 2OIEA 4JTAB 1X59A 2RNBA 2QWOB 1YJNV 1XNRO 2W0FC 4I55A 1TUBA 2YIAA 4CS2A 4X66O 4U7OA 1KKDA 4J11A 1AI5A 2UXBB 1S76D 2Q7EA 3FAVB 3WG7C 5IY5B 1FXKC 3JARA 4A5UB 4H0LB 1F4MA 3RYHA 2XAQA 4PI0A 1FAFA 3VQYA 3QTCA 2M7WA 4X65B 3J80N 3B2EE 1VEWA 3ZN1A 1K3EA 4PDLA 1URFA 4X88A 1FFXA 4GCZA 1IBLB 5JJNB 3A2FA 4NXMO 3AG1B 4GX1A 4FLTA 3OTFA 3C3SA 1N34O 2RQ6A 3DTUB 1Q8IA 3P3PA 4UFZA 3P32A 4BW9A 4FFKA 2Z5UA 1H2MA 2XUMA 4WFEA 2BE3A 1D5AA 3H01A 3HKEA 4MTGA 1VQMV 1QQCA 1XOUA 5CBGA 3AG7A 1S72V 4EB6A 2BSKB 3GWKC 5JCOC 3LSUA 4TQDA 3K9SA 2AXTZ 4O4LA 2B5UA 3P30A 5EYPB 4LF4B 5JJJB 4QPJA 4GKKO 1F23A 1QCEA 1V9PA 4TQFA 2OT5A 1FXVA 1FFTB 1W0KG 1Q82W 4IYHA 2WPDG 4CS4A 1ENVA 5H5NA 2EZPA 5ITZB 2CGOA 2WLLA 5KHIA 3L9DA 1IXBA 3SPGA 1SQXH 4IGGA 2HEPA 5FPRA 3OMAB 3RWRD 3OTOB 4JI7O 1IVSA 4FM0A 5EK0A 5KX5A 4LF5B 1I08A 5GONB 3D36A 1XI1A 3CMEV 2F4VB 1QVGU 1KC8W 5IJ0A 1CPYA 3SYOA 3T1HO 3AEIA 2CTPA 4GT1A 2BTQB 3RFRA 1G6UA 2QTOA 1HNWO 1UJWB 1K7DA 1YCIA 3A0HZ 1AR5A 5K1XA 4YHHO 4DR2O 1WPXA 1VQ9V 4K0KB 2XT9A 4I50A 2UUAB 1OHHG 2X6AA 3BCCH 2B9ZA 3ZRVA 1H38A 3O65A 4UV8A 1H8EG 1SA0B 2GSMB 4IT5A 2DWEC 5BZBA 4MVRA 3CXCU 4YY3B 4JZGA 1VARA 4ZI7A 3DSQA 2JGUA 1YJ9V 4LH6A 1OCRB 3BAAA 3UCSC 1RPOA 4B3MB 1SQQH 4FPPA 3RBZA 1BQ0A 3QF7A 1WLEA 4QE9A 2HVKC 5C93A 1R6NA 3U11A 5J2UB 4EFBA 1XNQB 2Z0AA 3MHSC 3K5NA 4DUYB 2Y0PA 4PJ0Z 2IH1C 4TT3G 1M57C 4UCVA 3ASOB 1N4CA 3STLC 5LMNB 1F4NA 2ZM6B 4RUFA 5FL7G 3JD1A 3CRRA 4JYAB 5LHIA 1Q81W 1DF4A 4JI4O 4X62B 1L8DA 2Q8VA 1MSWD 3OAAG 3BA8A 3MD0A 3ASOC 4LFAB 4NB5A 2CH7B 1R3IC 2AGAA 1AJNA 4O4IA 2UUBO 1TAEA 3HKDB 2AZ0A 3BPZA 3JATA 3K0DA 4DK0A 2DQ3A 1BZKA 2JRIA 2ITCC 2RMKB 5LXTB 5J2TA 3LUTB 1GAXA 4O2BB 5H6RA 4UCOA 1B3QA 3OGCC 3OUSA 4LCUC 2EIJB 2BOCC 2AHYA 2CK3G 4OPHA 5KHKA 1FYJA 1Q6IA 4BW5A 2JJ2G 4Q6GA 3CB2A 4D7SA 1KKCA 3QVNA 3SPCA 1VQLV 2PUSA 3ZCCA 4I4TB 1PL4A 5GTHZ 2EIJC 4ZHQA 5LHHA 5TISZ 3M7MX 4NR1A 2KG7B 3BEHA 4JF3A 4CS3A 3ABMB 1TVKA 4ZBMA 4GKJO 4DV3O 1MZEA 4DR1B 3AG4B 5CMUA 1GM9A 2R72A 3BVOA 4TV8B 1WP7A 3JD0A 1AI7A 2ZIOA 1JJOA 2G38A 5L3DA 4FLWA 3JSNA 5EC2C 3T1YO 2FTKA 1IBKB 1N33B 1HNXO 4O4JB 3W7SA 4I0XB 1N8RW 2DE0X 2V7QG 3IJ4A 2HKOA 1SERA 2UXCO 3PJSK 1VQPV 4X1YB 4X89A 1MMMA 2HP8A 1PL0A 5K1PA 2UUCB 2CTQA 5IYZA 2LFSA 3OEHG 5LP6A 4DUZB 1XNRB 5D5QA 4DV5B 1KMIZ 4L87A 3JAMN 3ZIAG 1PKXA 3BABA 1GMGA 5KA5A 5EBWC 1GK9A 1Z2GA 4JI3B 3TK1A 5B1OA 2PYLA 1YDXA 1ZSPA 2ZIMA 1QLNA 4PA7A 3CCUV 2FMLA 2V4DA 4GX5A 2GUZA 1ZWIC 3AG2B 3CCJV 2HR3A 5L3BA 2Q0AA 2JDIG 4DXWA 1R3KC 4PA4A 3STZC 2P5OA 1B6QA 1YEWA 1YXBA 4UCTA 5AG2A 2VQFO 1MZFA 4NXMB 2HFEC 1H2LA 1EN5A 4QGPA 3TJTA 4LNUB 2Y69B 2YDEA 3AG2C 1NT2B 4GX2A 4MTXA 1ZUQA 3Q4HA 1Q86W 4JI1O 1IX9A 2QE7G 3LDEA 2ZR2A 1Q90D 2EIMB 4GYCB 1I7FA 3JAKB 3KZIZ 4KHPO 1WJZA 3H1HH 3ZMUA 1LUVA 2Y69C 3JALA 4FFBB 5KHGA 1Y4MA 2F23A 5FNVA 1NS1A 2EIMC 1YITV 3ZHTA 2XNDG 3T2MA 4FZ0A 3TXQA 2WWWA 5KAFZ 1SESA 1P7GA 4CBCA 3CRCA 3HB3B 3K04A 1FXHA 1Q3EA 3CCLV 4Z2WA 2QEXV 1SQBH 3ICXA 4ZOLA 1LNQA 3TETA 4GKKB 2EINB 2OTJV 4O4HA 2UXXA 5JQGA 3TGUH 2FL4A 4PA6A 2YUAA 2D3OW 2PGGA 1XUQA 2BCCH 4MTOA 2WLIA 3CC2V 2P4KA 2EINC 2JK5C 1VMGA 4UCSA 2UXNA 2OCCB 4AQYB 1NH2B 4DV0B 1CP9A 2Y4TA 5CN0A 1VQ6V 3LDCA 2P4VA 4HNAB 4X1IB 5IT9N 4BWAA 1PP9H 5B5EZ 4JAUA 3SJQC 2Q68A 2WLHA 4CC5A 4UB6Z 5EZYB 2OCCC 4QNHB 2IU3A 1HNWB 4IIJA 1WB8A 1DK1A 2YSUB 4B7EA 3L72H 4AHCA 2DW4A 4AILC 3I56V 4XDJA 4J7KA 3ETDA 2ZE5A 5LYJB 5BR8O 1M9NA 1K34A 4YIPA 3ZRXA 3ZX6A 1X4TA 3E22B 1RP3B 2DN9A 5KMGB 2JEXA 3OEEG 1GM7A 2CGNA 1FJGB 3NXSA 3N2KA 4JI2B 1Y74B 5CA1B 5LOVB 2QWRB 4TUYA 3ZRSA 3QNEA 4H13B 1PV0A 4TV9B 1AVMA 4GZRB 4ZIBA 3FFQA 4B3TO 4MVUA 2DWDC 2L35A 4MVQA 1S0VA 4OGQB 3OFNG 5BXZA 1J95A 3APOA 4ZKIA 1Y76A 4QJFB 1OCCC 1KB9F 5E1AC 2IBZH 2Y4UA 3CMAV 3K58A 2QGNA 2Q5ZA 1VIBA 4DV6O 2JS3A 5IWAB 1XHXA 1JA8A 3ZRWA 3QG5A 4LFBB 2QWQB 2UUBB 3A8TA 4DV4O 3VQXA 3F7VC 4EEQA 4IYIA 1EN4A 2ZQMA 3ZMZA 4LFCO 4YJ2A 1FXKA 4B7KA 4IHJA 2YIDA 1O9HA 4Z1MG 1CEZA 4I55B 1TUBB 4DV2O 3CCMV 4MTFA 2X6CA 2GV9A 1K33A 2H94A 3KKYA 2NNUA 1KP2A 3HKCA 1ZTEA 3IC7A 1THZA 2ZDIC 3JYCA 3P3NA 1ZLZA 3CCQV 3JARB 3G67A 2NR5A 4YJ3B 1IBMO 3CE2A 3CCSV 4J42A 1GTOA 2Q6AA 2UXDO 4TOIA 1U97A 5B3SB 4QE7A 5IY5C 2WLNA 3FD9A 4X64B 5LGUA 3LNMB 3R66A 2CTRA 4DO2A 3TXSA 2LFRA 2QA4V 5LA6B 3U10A 5B66Z 5CBFA 5B3SC 1N36B 4CH5A 2R9RB 3JSLA 4R6ZA 3B4SA 3WFVA 4GKJB 4DV3B 1DLBA 1QR8A 1W0JG 3AG1C 1E1QG 2XAFA 1GO3F 3RYIB 3RVZA 1BT8A 5JCOA 2YIBD 1BQZA 3G80A 1B04A 4NYKA 2ZR3A 3FB6C 4X1KB 1I5XA 3HKEB 1BE3H 1G8MA 1WA8A 3BRCA 4NTYA 3T1YB 2CDYA 1JX9A 4H44B 2HJDA 2EJRA 3W7TA 1M90W 1HNXB 4LF6O 2FB5A 3ETEA 1HW7A 2BSKA 4R8CA 3OMNB 1OCZB 3SYPA 4JV5B 3SJCC 4JI0O 2ZINA 4NKGB 2ODMA 3DC6A 3L70H 3CJHA 1JOYA 4J41A 3FB5C 1H2GA 4MW3A 2ITDC 4LWSB 3E2EA 4JI6O 2YS8A 2EX3A 5EYPA 3K5MA 4UUJC 4MVMA 4LH7A 1VF5B 5H9CA 2PY5A 3OUFA 1JJ2U 4UXNA 2Y48A 3ZJZA 1HP8A 2QM8A 3F7YC 2E5LB 2WA3A 3ZN0A 1BSMA 2WLLB 3K59A 3L71H 5JVDB 5ITZA 1S3JA 4U3FH 1GKFA 5KX5B 2K1EA 1AILA 4DW1A 2WA4A 4B3RO 3FX7A 1SKVA 3RYFB 2VQFB 5IJ0B 3OW2U 2YEVB 5LMUO 1RM1B 2HLDG 4JI8O 3OE7G 1SQFA 3NR7A 4LBEC 4F6RB 2V1DA 2AHZA 2BTQA 1B06A 4WFGA 2LP7A 1RM1C 4JAAA 4I50B 4KHPB 4DR6O 3D3IA 4TWKA 5B1NA 3LSSA 1G4YB 1VF6C 4ZI7B 5F2VO 2GHYA 1VQ5V 1YHQV 1NTZH 3I5DA 1NU1H 4DV7B 2EBOA 3ZHRA 5L3CA 1QVFU 4DYLA 1E1RG 4FK5C 3ZHQA 3FB8C 2UU9B 4MS2A 2IH3C 3BFRA 5HFLA 2QSAA 4CH3A 3JASB 2QWNB 1QLEB 4K35A 1OCRC 2QTSA 2VRZA 1TA8A 1XMOO 3CWBH 1XL4A 4HBNA 1S5HC 2GBOA 1QNMA 1WAZA 1EFRG 2AW9A 2XAHA 4FM1A 1ZL8A 1Z5WA 2ZNJA 4KP4A 1NR1A 2P06A 1NH2D 4DR5O 3QO5A 4FLUA 2R9AA 4P9PA 1M1KW 2ZXWB 3ABTA 5KUMA 3RYCB 2HHHO 3MHHC 2CH7A 1JR9A 2WSSG 1EN6A 3LSQA 4RQEA 3CHXA 1BHAA 2R70A 5A2QN 3HKDA 4O2AB 5J2TB 2ZXWC 4P30A 2QM7A 4R50A 1E79G 3CRAA 3ETGA 4JPRA 2Q9LA 4O2BA 5KHHA 2Q0OC 1PM9A 1BL8A 2ILMA 4X8AA 1J5EO 5BR8B 1JFFB 4DR4O 1AI4A 5JJEB 3OT7A 1P7BA 4MVZA 1H2KA 1ZAUA 2ZNIA 1V55B 4X65O 5GTIZ 2KSDA 4I4TA 2Q73A 2LW7A 2DYRB 2M6YA 1RSOB 1IBLO 3LDDA 4U3JB 3N2GB 2Q7HA 1EM1A 2KG7A 4JGSA 1VQOV 1H2SB 2OIGA 2W6JG 3CS5A 3CD6V 4B3TB 1XQ8A 3AK3A 1K9MW 4PDMA 3ABMC 4JAVA 1SF9A 1VQKV 2DYRC 1HR0O 5IYBO 5BMVB 3AG4C 3ZEDA 4TV8A 4F4LA 2XOKG 4DK1A 1K5QA 3CCVV 1KU9A 2PZSA 1FS0G 2A06H 5IE9A 2Z3YA 3H1JH 1OCOB 2ATKC 3A0RA 4UCUA 2XTAA 4UV9A 1ORQC 2ZKOA 3ML0A 3SPIA 1W2BU 3E8HA 4JYBA 4FLYA 3UM7A 4J7JA 3QO7A 5LP6B 1OJHA 4LFCB 3W7UA 4X66B 1H8HG 4YXWG 1OCOC 3UKMA 3U0ZA 4WBNA 1NVPB 1Z5VA 2R9IA 3FKSG 1Q7YW 2QWPB 5LP6C 4BIUA 4LF8O 3UO2A 4YIOA 1VF7A 1PNLA 4JI5O 4WFBV 3ZS8C 1UPGA 1D5NA 2FKXA 2LGQA 3OD4A 3JAWA 3OTOO 1N34B 1Y67A 1VQ7V 4LF5O 2F4VO 5CB4A 2DYSB 3AG3B 1TUEB 3J81N 1GN2A 2DJVA 4J7ZA 4KFMA 3Q4HB 4PDVA 3M99B 4LNUA 2OCHA 5CA0A 3ZMVA 2KKWA 4GUNA 1YZBA 3AG3C 3UT5B 3T1CA 3K06A 2IW5A 3H9VA 4GLXA 4EKWA 4K8XA 2JGDA 4FFBA 3B8NA 1EZJA 1F51A 2ETNA 4CH4A 4K8ZA 4PA9A 4JI0B 1SC5B 4H37A 1R3JC 3CEIA 1L0LH 1YI2V 1EBOA 4B3MO 4X20B 4ZOLB 4XBFA 4N21A 4O4HB 3B09A 1AP6A 1BGYH 4J9ZB 1AP5A 1XHZA 5JWPA 1XNQO 1QR9A 4RUEA 2Q7GA 2PF4E 4JI7B 3ZMSA 5LMNO 1T5EA 2ZM6O 3ZHVA 1PNMA 2ZE6A 2YI9A 2W0XA 1WPBA 4X62O 3K5OA 2VWKA 3G6BA 3R65A 5JH7B 4J9YB 4DRXA 3GB7C 3T1HB 3JD4A 1JQ0A 4FVMA 3B8MA 5FLXN 4W4LA 1RPRA 1M93A 4LFAO 4P2ZA 5LMUB 4HNAA 3MDSA 4JI8B 3IFXA 3X2QB 4JASA 1AR1B 4YHHB 4DR2B 1H2NA 1FD9A 4MSWC 1VP7A 1KYOF 4QIWF 5C8YB 2ADQB 1AI6A 4I7ZB 5LGTA 2P6JA 3L75H 2XAJA 4FMTA 4Q20A 2JEUA 4DR6B 5KUKA 3JD2A 1NR7A 1YTFB 3CSXA 2B1GA 2IJJA 4DR3O 4LF9O 3PN1A 5LYJA 1IXMA 2IJKA 4L8JA 2IJIA 1DF5A 4KXRA 2WLKA 1K4DC 3FB7C 5KMGA 2Q67A 3ABLB 1HNZO 4FIPC 1XMOB 1Y74A 1K4CC 1MABG 3HKBB 4DR1O 1JCHA 1XL6A 2QKCA 4JI4B 3B77A 3JCUZ 1HDJA 1N32O 1SRYA 3ABLC 3WU2Z 3G4SV 3O9OA 4JYYA 4RO2A 4DR5B 2MK3A 1GH6A 1U96A 1SZXA 5IJ9B 1N33O 2DOSA 1XEQA 3CX5F 3DXRA 3TCUA 3DC5A 3ZHSA 1VQNV 3VQVA 2HHHB 2CUGA 1KD1W 3CC4V 1OZ0A 1SQGA 1PD3A 1TGOA 2ZDIA 2ZE8A 3WG7B 4YJ2B 1FXKB 4IHJB 3BA9A 2N04A 5GW7A 3HKCB 4DUZO 1I0HA 4DV5O 4DR7O 2X6BA 3RYHB 2IJHA 1A32A 3FAVA 2YXLA 4LC1A 3FYIB 2ZT9B 1N0NA 4CH6A 4PI2A 3ETQA 1J5EB 4JI3O 1YSCA 4YJ3A 4DR4B 3K57A 4MVOA 4Z1VA 1AJQA 1FFXB 3OM3B 4G2KA 3UT5A 4J10A 5LGNA 4QPKA 2LGWA 4R7CA 5EIBD 5B1BB 3ABUA 5FPOA 2ADPA 1EZVH 4OXSA 1IURA 2A7WA 3SDLA 3E89A 3IAYA 4DV1O 4WFFA 1M4UA 3SGIA 4JYCA 1Q6UA 5EBMC 4LR3A 4PA3A 2CTWA 2RDCA 5LA6A 4HAMA 1WB7A 2DMXA 1P4RA 5B1BC 2EZOA 1JMKC 4B3SO 3H1KH 4WCEV 4UVBA 3E35A 4NXNO 4EB6B 1HR0B 1WA8B 3CP1A 3K0GA 4PV1B 4C7UA 3RYIA 1HWYA 4W4KA 4MW8A 1Q43A 3IC9A 4OX9O 4NTXA 2NLJC 2P22C 2BTOA 5L3FA 4X1KA 2UXCB 1US6A 4RWUA 4O4LB 4BIOA 3GVMA 4BAYA 2RN9A 1KBHA 2IU0A 1K5SA 2OWOA 1QHTA 4J80A 1F7YA 4JTDB 3CJHB 2ZE7A 1OCZC 3CYOA 2ZD9A 2DQ0A 1XBLA 2FYUH 1NVPD 2VQEO 2YXYA 3ABKB 4LWSA 4ABMA 2QDOA 2JJ1G 1AROP 1R3LC 3THOA 3S3WA 1AB3A 3K5LA 1SS3A 4FJCC 2H8PC 4LF8B 2HJFC 1CXZB 3VBBA 3H1LH 4PHZA 4JI5B 1XREA 1LR1A 4HZ3A 1R6KA 3ABKC 3B40A 3OR7C 3G71V 3D8CA 1PPJH 2F43G 1KP3A 5JVDA 4AQYO 5GONA 3A0BZ 4DV0O 2P7TC 3K3WA 3K9AA 4HYOA 3AK2A 5A9GA 3L74H 5H6QA 5KLVH 2X7RB 1O9GA 3D36C 4JI1B 2YXHA 3HPLC 3RYFA 4I9QA 3W7WA 2YEVA 3EHBB 3G6EV 3QO8A 3CCRV 5IYCO 1L0NH 1BS3A 2L6LA 1K8AW 1VF6A 4F6RA 1I94O 3I55V 3EFFK 2RCVA 2CAZC 3BY6A 3HR0A 4U7NA 1SA0A 2EIKB 4JTCB 3WB2A 4LF7O 2ZCEA 3GWOA 3WB0A 4FZ1A 1KQSU 5KAIZ 3N27A 2Q4PA 2XAGA 1S77D 4DW0A 2EULA 2KB1A 5E79Z 4RAIA 2LO1A 1BHBA 3RW0A 1XMQO 2EIKC 1M57B 4ICGA 1FJGO 1QBZA 5LHGA 4JI2O 1M5IA 5J2UA 2F95B 4CC6A 2QKSA 3JASA 2PTMA 5LL6Y 3W7XA 2OTLV 4FLZA 2E76B 1ZL8B 3WB1A 1QLEC 1NBMG 2JIZG 2A79B 2A9HA 3VOUA 4OPAA 1K97A 1DTOA 2CE4A 3CC7V 3SYAA 5D5PA 4FLVA 2N05A 2EILB 4O4IB 2A0LA 2H3OA 1W59A 5CBHA 4LP8A 4UVAA 3JATB 3T4ZA 1M56B 1GRJA 2XASA 5IWAO 1R73A 1Q6HA 1OV9A 2LW1A 4LFBO 2VWJA 1AR4A 2GDSA 3UO3A 2EILC 3RYCA 3CPWU 1YIJV 1SQVH 3UQ8A 3EXAA 4G28B 5LXTA 1S5JA 1M56C 4WF9V 2UXBO 3S3XA 4O2AA 4UB8Z 1IDSA 2A3QA 1YTFD 1VQ8V 1BCCH 3CRMA 3C90A 1NZ6A 1NJIW 2KQXA 4PDRA 2JVDA 4ZHQB 4DR3B 1SQPH 4LF9B 1FPOA 3RVYA 3SPHA 1JFFA 4PD4F 5KA6A 2PI5A 1MNGA 2F93B 4IL6Z 4X64O 1GN3A 1YF2A 4UCRA 5DM6V 1NKDA 1TVKB 4RQFA 4CZZA 1KECA 1PNKA 1JVMA 1V55C 4MT8A 2QKAA 2Y0IA 1HNZB 3SYCA 4N23A 5DEDA 3VQWA 4F6EA 1RSOA 2IM9A 5EIBC 1N36O 4U3JA 3N2GA 4G27B 1V54B 1N32B 3SYQA 2EJ7A 2YIBA 4XDLA 2E3CA 2YICA 4DV6B 1G1XB 3CRQA 4O4JA 3AK1A 3E8FA 5BMVA 4I0XA 2JS5A 3OMIB 5LBQA 1V54C 3JCZA 4X1YA 4DV4B 1BMFG 2B1IA 3APQA 1WN7A 2C2AA 5IYZB 4FLXA 2RJZA 4JV5O 4D7TA 2E75B 4DV2B 1P84F 5DECA 3K08A 4LF4O 1VQ4V 1S5LZ 5HFMA 3MAQA 1UFIA 2PI4A 1IBMB 4DR7B 4NTWA 4B08A 4WBNB 5IDJA 1KUQA 2UXDB 1Y66A 1NI8A 2GUZB 2YI8A 3ZHUA 2Q69A 1GN6A 1RFYA 2E5LO 2VS0A 2GTAA 2F1MA 4MVSA 3RN4A 3JAWB 2QR4A 3RT3C 2D2CB 1Q5OA 4DV1B 1WP8A 1WNSA 1NTKH 5CB4B 2MW2B 3SR2C 5B1AB 5CA0B 4B3SB 2DYSC 2F66C 3JAKA 3JALB 4K0KO 4NXNB 4H33A 2UUAO 3OGIB 5CA3A 2GTSA 2LJ2A 4LF6B 4I5SA 2XHBA 4OX9B 5FNVB 3L73H 3H1IH 4YY3O 5B1AC 2JGDB
chains in the Genus database with same CATH topology
3E8BA 3SPCA 3CCEV 1VQLV 3ZCCA 3F5WC 1S3JA 1GKFA 2EIJC 2K1EA 3T4DA 3TCUA 5L3EA 5LHHA 1VQNV 5IYDO 4XDKA 2X0LA 2P67A 2P90A 3OW2U 4P9OA 4WFHA 1KD1W 3CC4V 2YEVB 3BEHA 1OZ0A 4JF3A 1RM1B 2HLDG 3OE7G 1PD3A 3ABMB 2ZDIA 3WG7B 1FXKB 4LBEC 4ZBMA 3AG4B 1MG1A 5CMUA 2V1DA 2AHZA 2WLIB 5GW7A 1GM9A 1GM8A 2X6BA 4UVCA 3JD0A 1AI7A 2IJHA 4BIZA 4WFGA 2LP7A 1RM1C 1AJPA 4LC1A 5L3DA 3D3IA 5EC2C 4TWKA 5B1NA 3FYIB 3LSSA 4E2LA 2FTKA 1YSCA 1G4YB 1ROPA 3W7SA 4MVOA 1SETA 1N8RW 2V7QG 2GHYA 1AJQA 3KG2A 1K92A 3OM3B 4G2KA 1VQ5V 5LGNA 1YHQV 4QPKA 2HKOA 1SERA 4R7CA 3PJSK 2EBOA 1VQPV 5L3CA 1QVFU 5B1BB 3ABUA 1COWG 1YJWV 1E1RG 4FK5C 4OXSA 5EBLC 3FB8C 4X89A 3E89A 4MS2A 2IH3C 5HFLA 3FYEB 4WFFA 1PL0A 4GX0A 4JYCA 5EBMC 4PA3A 1QLEB 2LFSA 3OEHG 1OCRC 1XL4A 4HAMA 5J9PC 1S5HC 4L87A 3ZIAG 1PKXA 1EFRG 1P4RA 1GMGA 5B1BC 2EZOA 2XAHA 3E86A 3X2QC 5KA5A 4WCEV 4UVBA 3E35A 5EBWC 1GK9A 2BOBC 3TK1A 5B1OA 5EC1C 3CP1A 3K0GA 4KP4A 1HWYA 3ASNB 4MW8A 1NR1A 1QLNA 4PA7A 3CCUV 1NH2D 2NLJC 5L3FA 4GX5A 1ZWIC 3QO5A 3AG2B 3CCJV 2HR3A 5L3BA 4P9PA 2JDIG 4DXWA 1R3KC 4PA4A 3STZC 4BAYA 2HG5C 1M1KW 2ZXWB 1B6QA 3ABTA 5B1AC 1SZTA 5KUMA 3ASNC 4PELA 4KUMA 4ASUG 2HVJC 2IU0A 1K5SA 3MHHC 2HFEC 3K79A 1K73W 4JTDB 1I5YA 2WSSG 1OCZC 3CYOA 3DGEA 3LSQA 2Y69B 3AG2C 3SPJA 4RQEA 4GX2A 4MTXA 1BHAA 2ZD9A 2DQ0A 1JPXA 4I9WA 2ZXWC 4P30A 1Q86W 1OCCB 2QM7A 4R50A 2QE7G 3LDEA 1NVPD 2ZR2A 2WAMA 2EIMB 3ABKB 1E79G 2JJ1G 1L1FA 1AROP 1R3LC 3OR6C 3ETGA 3JD3A 4JPRA 2WLMA 3ZMUA 4FJCC 1BL8A 1MOFA 2Y69C 2H8PC 4X8AA 3ZMTA 2HJFC 3VBBA 4WFAV 1AI4A 3ZRWB 1P7BA 3E8GA 1Y4MA 4MVZA 4HZ3A 2W6IG 1R6KA 3E83A 2EIMC 3ABKC 1YITV 1V55B 2XNDG 3OR7C 3G71V 3IGAC 3K03A 5L3GA 2F43G 1KP3A 3T2MA 4TSFG 2WWWA 2P7TC 3K3WA 1SESA 3K9AA 4HYOA 4CBCA 3HB3B 2DYRB 2WLJA 5H6QA 1NQTA 5DN6G 3K04A 1FXHA 4JTAB 2X7RB 3CCLV 3LDDA 2QEXV 3HPLC 3TETA 1LNQA 2OTJV 2EINB 4JGSA 3W7WA 1YJNV 2YEVA 3EHBB 2W0FC 3G6EV 3QO8A 3CCRV 1VQOV 2W6JG 2UXXA 5IYCO 3CD6V 1K9MW 4U7OA 1K8AW 4PDMA 1KKDA 1AI5A 4PA6A 2D3OW 1S76D 3ABMC 3WG7C 5IY5B 1FXKC 4JAVA 4MTOA 3EFFK 2WLIA 2DYRC 3I55V 1VQKV 5IYBO 1F4MA 3CC2V 3BY6A 3AG4C 4F4LA 2XOKG 4U7NA 2XAQA 1K5QA 2EINC 3CCVV 2JK5C 1FS0G 2EIKB 4JTCB 2M7WA 2UXNA 3GWOA 2OCCB 1NH2B 1KQSU 2Z3YA 3ZN1A 1CP9A 1K3EA 1OCOB 2ATKC 3A0RA 4PDLA 5CN0A 1VQ6V 3LDCA 4UV9A 2XAGA 1S77D 1ORQC 4X88A 4GCZA 2KB1A 3ML0A 4RAIA 3SPIA 3RW0A 1BHBA 1W2BU 3E8HA 3AG1B 4GX1A 4JYBA 2EIKC 4JAUA 3SJQC 2Q68A 2WLHA 3UM7A 1M57B 2OCCC 3QO7A 3W7UA 1QBZA 5LHGA 4QNHB 2IU3A 1H8HG 3DTUB 4YXWG 2QKSA 1OCOC 2YSUB 3W7XA 2OTLV 3P32A 2DW4A 3UKMA 2Z5UA 1QLEC 4WFEA 3H01A 1NBMG 1NVPB 3I56V 2JIZG 2R9IA 2A79B 4XDJA 3FKSG 2A9HA 1Q7YW 4MTGA 1VQMV 3VOUA 3ETDA 4BIUA 1K97A 5CBGA 1DTOA 1M9NA 1K34A 1S72V 3CC7V 3SYAA 1PNLA 3ZRXA 4WFBV 2EILB 2A0LA 5CBHA 4LP8A 4UVAA 2JEXA 3T4ZA 3OEEG 1M56B 1GM7A 2XASA 1R73A 2B5UA 1VQ7V 3NXSA 3P30A 3ZRSA 3QNEA 2DYSB 3AG3B 1TUEB 2EILC 4QPJA 3CPWU 1F23A 1YIJV 1QCEA 2OT5A 4G28B 1FXVA 4KFMA 4PDVA 3M99B 1FFTB 1W0KG 2DWDC 1M56C 4MVUA 4MVQA 3ZMVA 4WF9V 1S0VA 1Q82W 3OFNG 1J95A 2WPDG 1YTFD 4ZKIA 1ENVA 3AG3C 2EZPA 3T1CA 4QJFB 1VQ8V 1OCCC 5E1AC 2WLLA 3K06A 2IW5A 3CMAV 3SPGA 4EKWA 1NJIW 4PDRA 3OMAB 3SPHA 3RVYA 5EK0A 5KA6A 2PI5A 3B8NA 1EZJA 3ZRWA 3D36A 1F51A 3CMEV 1QVGU 1KC8W 5DM6V 4PA9A 1NKDA 4H37A 1CPYA 1R3JC 3SYOA 4CZZA 4RQFA 1KECA 1PNKA 1JVMA 3AEIA 1V55C 4MT8A 1YI2V 1EBOA 4GT1A 3F7VC 3SYCA 4N23A 2ZQMA 3ZMZA 1FXKA 2QTOA 4Z1MG 1UJWB 4XBFA 1CEZA 1K7DA 4N21A 3CCMV 4MTFA 2X6CA 4J9ZB 1K33A 2H94A 2NNUA 1KP2A 1QR9A 3IC7A 1THZA 4RUEA 2ZDIC 3JYCA 1WPXA 1V54B 1VQ9V 3CCQV 3SYQA 1OHHG 2X6AA 3CCSV 3ZRVA 1H38A 1GTOA 4UV8A 1H8EG 4XDLA 3ZMSA 2Q6AA 2GSMB 2DWEC 1PNMA 5BZBA 4MVRA 3E8FA 3CXCU 5B3SB 4QE7A 5IY5C 2WLNA 5LGUA 3OMIB 5LBQA 3LNMB 1YJ9V 3R65A 1V54C 3JCZA 4J9YB 3GB7C 1OCRB 4DO2A 3JD4A 1JQ0A 1BMFG 2B1IA 1RPOA 3B8MA 4FPPA 2LFRA 2C2AA 2QA4V 1RPRA 3RBZA 4P2ZA 1WLEA 4QE9A 2HVKC 5CBFA 3IFXA 3X2QB 5C93A 5B3SC 4JASA 1R6NA 3K08A 2R9RB 1AR1B 1VQ4V 4R6ZA 3WFVA 5HFMA 4MSWC 3MHSC 1DLBA 4QIWF 2PI4A 1QR8A 1W0JG 3AG1C 1E1QG 2XAFA 1AI6A 1GO3F 2IH1C 4TT3G 1M57C 3RVZA 3ASOB 5LGTA 3STLC 2P6JA 2XAJA 4FMTA 4Q20A 2ZR3A 5IDJA 1Y66A 1F4NA 3FB6C 4RUFA 1I5XA 3JD1A 1G8MA 2JEUA 5FL7G 5KUKA 1JX9A 3JD2A 5LHIA 1Q81W 1DF4A 1NR7A 2EJRA 3W7TA 1M90W 1YTFB 2Q69A 2B1GA 2IJJA 3ETEA 1MSWD 3OAAG 3MD0A 4MVSA 3ASOC 4R8CA 1IXMA 2IJKA 3OMNB 2IJIA 1OCZB 3SYPA 1R3IC 1DF5A 1AJNA 2WLKA 1K4DC 3FB7C 2Q67A 3K0DA 3ABLB 4FIPC 1JOYA 3FB5C 2DQ3A 2ITCC 1H2GA 4MW3A 2ITDC 3E2EA 1K4CC 5B1AB 1MABG 3LUTB 4UUJC 4MVMA 5H6RA 5H9CA 2DYSC 3OUFA 1JJ2U 4UXNA 1JCHA 1XL6A 2Y48A 3OGCC 2EIJB 3B77A 2BOCC 3OUSA 4LCUC 2QM8A 2AHYA 2CK3G 4H33A 3ZJZA 5CA3A 1SRYA 3ABLC 3F7YC 4I5SA 3ZN0A 3G4SV 4BW5A 2JJ2G 2WLLB 4RO2A 2MK3A 4G27B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ9 V;  1VQP V;  4WF9 V;  3CME V;  3CCE V;  3CCL V;  1VQL V;  1M90 W;  1QVF U;  1Q82 W;  1QVG U;  1YJW V;  5DM6 V;  1KC8 W;  2QEX V;  3CCS V;  2OTJ V;  1KQS U;  1K73 W;  1YJN V;  2OTL V;  1VQ4 V;  3G6E V;  4WFA V;  3CCR V;  1VQO V;  1YI2 V;  3CCU V;  1R73 A;  1VQ6 V;  3CD6 V;  3CXC U;  1VQ7 V;  1Q81 W;  1VQ8 V;  1VQN V;  3I56 V;  1K9M W;  1JJ2 U;  1K8A W;  1YIT V;  3G71 V;  3CMA V;  2D3O W;  3OW2 U;  1Q7Y W;  1KD1 W;  3CC4 V;  1Q86 W;  3CCJ V;  1VQM V;  1W2B U;  1YJ9 V;  1NJI W;  1VQK V;  3I55 V;  3CCM V;  3CPW U;  1YIJ V;  1S72 V;  3G4S V;  3CC7 V;  3CC2 V;  1N8R W;  1M1K W;  4WFB V;  1VQ5 V;  3CCV V;  2QA4 V;  1YHQ V;  3CCQ V;  4WCE V; 
#chains in the Genus database with same CATH topology
 3E8B A;  3M8A A;  3CCE V;  3F5W C;  1LUW A;  3T4D A;  5L3E A;  5IYD O;  4XDK A;  2X0L A;  4AI8 A;  2P67 A;  4DV7 O;  2P90 A;  2AZ2 A;  4P9O A;  4WFH A;  4D6T H;  4JI6 B;  1R6T A;  5JQG B;  2N74 A;  2LQT A;  2UU9 O;  1XIL A;  2QM4 A;  4FM2 A;  2QJ1 A;  1MG1 A;  1ZX3 A;  2WLI B;  4DUY O;  4X20 A;  1GM8 A;  2VQE B;  4UVC A;  4BIZ A;  1AJP A;  4E2L A;  4JYA O;  1ROP A;  1SET A;  3KG2 A;  4B3R B;  1K92 A;  3CXH F;  4DRX B;  1YJW V;  1COW G;  4X1I A;  2OYQ A;  5EBL C;  5JH7 A;  3FYE B;  1N0J A;  4GX0 A;  4IIJ B;  1D2D A;  5EZY A;  2PYJ A;  1IZ3 A;  5J9P C;  4NVP A;  3KCY A;  2ARH A;  3KCX A;  3E86 A;  3X2Q C;  1NTM H;  1P49 A;  4EFE A;  4JZ2 A;  1I94 B;  2BOB C;  5C8Y A;  5EC1 C;  2E74 B;  1MA1 A;  3ASN B;  4BR6 A;  3LNN A;  1DGS A;  4LF7 B;  3F5T A;  3E22 A;  4X9Q A;  2HG5 C;  3N2K B;  3C3T A;  4TUY B;  1R1B A;  3J7A U;  1SZT A;  4ASU G;  3ASN C;  4PEL A;  4KUM A;  5KHJ A;  1XMQ B;  2HVJ C;  3K79 A;  5CA1 A;  5LOV A;  1K73 W;  3D3Q A;  1I5Y A;  3SPJ A;  1Y6X A;  3DGE A;  5BY1 A;  4TV9 A;  1JPX A;  4I9W A;  1XDC A;  1OCC B;  2WAM A;  1FKA O;  1Y76 B;  1L1F A;  3BHP A;  3OR6 C;  3JD3 A;  1QU7 A;  2WLM A;  2O57 A;  5H2F Z;  3SJA C;  3HKB A;  3ZMT A;  1MOF A;  1IBK O;  1YVW A;  3RGB A;  1MSD A;  3EVK A;  3SJB C;  2NN4 A;  4WFA V;  3ZRW B;  3E8G A;  2W6I G;  3E83 A;  3IGA C;  3K03 A;  5L3G A;  3DXR B;  4TSF G;  4K3A A;  4E4E A;  4KL1 A;  2K9P A;  5IJ9 A;  2YC0 A;  1GN4 A;  3ZBH A;  2WLJ A;  1NQT A;  5DN6 G;  2UUC O;  2OIE A;  4JTA B;  1X59 A;  2RNB A;  2QWO B;  1YJN V;  1XNR O;  2W0F C;  4I55 A;  1TUB A;  2YIA A;  4CS2 A;  4X66 O;  4U7O A;  1KKD A;  4J11 A;  1AI5 A;  2UXB B;  1S76 D;  2Q7E A;  3FAV B;  3WG7 C;  5IY5 B;  1FXK C;  3JAR A;  4A5U B;  4H0L B;  1F4M A;  3RYH A;  2XAQ A;  4PI0 A;  1FAF A;  3VQY A;  3QTC A;  2M7W A;  4X65 B;  3J80 N;  3B2E E;  1VEW A;  3ZN1 A;  1K3E A;  4PDL A;  1URF A;  4X88 A;  1FFX A;  4GCZ A;  1IBL B;  5JJN B;  3A2F A;  4NXM O;  3AG1 B;  4GX1 A;  4FLT A;  3OTF A;  3C3S A;  1N34 O;  2RQ6 A;  3DTU B;  1Q8I A;  3P3P A;  4UFZ A;  3P32 A;  4BW9 A;  4FFK A;  2Z5U A;  1H2M A;  2XUM A;  4WFE A;  2BE3 A;  1D5A A;  3H01 A;  3HKE A;  4MTG A;  1VQM V;  1QQC A;  1XOU A;  5CBG A;  3AG7 A;  1S72 V;  4EB6 A;  2BSK B;  3GWK C;  5JCO C;  3LSU A;  4TQD A;  3K9S A;  2AXT Z;  4O4L A;  2B5U A;  3P30 A;  5EYP B;  4LF4 B;  5JJJ B;  4QPJ A;  4GKK O;  1F23 A;  1QCE A;  1V9P A;  4TQF A;  2OT5 A;  1FXV A;  1FFT B;  1W0K G;  1Q82 W;  4IYH A;  2WPD G;  4CS4 A;  1ENV A;  5H5N A;  2EZP A;  5ITZ B;  2CGO A;  2WLL A;  5KHI A;  3L9D A;  1IXB A;  3SPG A;  1SQX H;  4IGG A;  2HEP A;  5FPR A;  3OMA B;  3RWR D;  3OTO B;  4JI7 O;  1IVS A;  4FM0 A;  5EK0 A;  5KX5 A;  4LF5 B;  1I08 A;  5GON B;  3D36 A;  1XI1 A;  3CME V;  2F4V B;  1QVG U;  1KC8 W;  5IJ0 A;  1CPY A;  3SYO A;  3T1H O;  3AEI A;  2CTP A;  4GT1 A;  2BTQ B;  3RFR A;  1G6U A;  2QTO A;  1HNW O;  1UJW B;  1K7D A;  1YCI A;  3A0H Z;  1AR5 A;  5K1X A;  4YHH O;  4DR2 O;  1WPX A;  1VQ9 V;  4K0K B;  2XT9 A;  4I50 A;  2UUA B;  1OHH G;  2X6A A;  3BCC H;  2B9Z A;  3ZRV A;  1H38 A;  3O65 A;  4UV8 A;  1H8E G;  1SA0 B;  2GSM B;  4IT5 A;  2DWE C;  5BZB A;  4MVR A;  3CXC U;  4YY3 B;  4JZG A;  1VAR A;  4ZI7 A;  3DSQ A;  2JGU A;  1YJ9 V;  4LH6 A;  1OCR B;  3BAA A;  3UCS C;  1RPO A;  4B3M B;  1SQQ H;  4FPP A;  3RBZ A;  1BQ0 A;  3QF7 A;  1WLE A;  4QE9 A;  2HVK C;  5C93 A;  1R6N A;  3U11 A;  5J2U B;  4EFB A;  1XNQ B;  2Z0A A;  3MHS C;  3K5N A;  4DUY B;  2Y0P A;  4PJ0 Z;  2IH1 C;  4TT3 G;  1M57 C;  4UCV A;  3ASO B;  1N4C A;  3STL C;  5LMN B;  1F4N A;  2ZM6 B;  4RUF A;  5FL7 G;  3JD1 A;  3CRR A;  4JYA B;  5LHI A;  1Q81 W;  1DF4 A;  4JI4 O;  4X62 B;  1L8D A;  2Q8V A;  1MSW D;  3OAA G;  3BA8 A;  3MD0 A;  3ASO C;  4LFA B;  4NB5 A;  2CH7 B;  1R3I C;  2AGA A;  1AJN A;  4O4I A;  2UUB O;  1TAE A;  3HKD B;  2AZ0 A;  3BPZ A;  3JAT A;  3K0D A;  4DK0 A;  2DQ3 A;  1BZK A;  2JRI A;  2ITC C;  2RMK B;  5LXT B;  5J2T A;  3LUT B;  1GAX A;  4O2B B;  5H6R A;  4UCO A;  1B3Q A;  3OGC C;  3OUS A;  4LCU C;  2EIJ B;  2BOC C;  2AHY A;  2CK3 G;  4OPH A;  5KHK A;  1FYJ A;  1Q6I A;  4BW5 A;  2JJ2 G;  4Q6G A;  3CB2 A;  4D7S A;  1KKC A;  3QVN A;  3SPC A;  1VQL V;  2PUS A;  3ZCC A;  4I4T B;  1PL4 A;  5GTH Z;  2EIJ C;  4ZHQ A;  5LHH A;  5TIS Z;  3M7M X;  4NR1 A;  2KG7 B;  3BEH A;  4JF3 A;  4CS3 A;  3ABM B;  1TVK A;  4ZBM A;  4GKJ O;  4DV3 O;  1MZE A;  4DR1 B;  3AG4 B;  5CMU A;  1GM9 A;  2R72 A;  3BVO A;  4TV8 B;  1WP7 A;  3JD0 A;  1AI7 A;  2ZIO A;  1JJO A;  2G38 A;  5L3D A;  4FLW A;  3JSN A;  5EC2 C;  3T1Y O;  2FTK A;  1IBK B;  1N33 B;  1HNX O;  4O4J B;  3W7S A;  4I0X B;  1N8R W;  2DE0 X;  2V7Q G;  3IJ4 A;  2HKO A;  1SER A;  2UXC O;  3PJS K;  1VQP V;  4X1Y B;  4X89 A;  1MMM A;  2HP8 A;  1PL0 A;  5K1P A;  2UUC B;  2CTQ A;  5IYZ A;  2LFS A;  3OEH G;  5LP6 A;  4DUZ B;  1XNR B;  5D5Q A;  4DV5 B;  1KMI Z;  4L87 A;  3JAM N;  3ZIA G;  1PKX A;  3BAB A;  1GMG A;  5KA5 A;  5EBW C;  1GK9 A;  1Z2G A;  4JI3 B;  3TK1 A;  5B1O A;  2PYL A;  1YDX A;  1ZSP A;  2ZIM A;  1QLN A;  4PA7 A;  3CCU V;  2FML A;  2V4D A;  4GX5 A;  2GUZ A;  1ZWI C;  3AG2 B;  3CCJ V;  2HR3 A;  5L3B A;  2Q0A A;  2JDI G;  4DXW A;  1R3K C;  4PA4 A;  3STZ C;  2P5O A;  1B6Q A;  1YEW A;  1YXB A;  4UCT A;  5AG2 A;  2VQF O;  1MZF A;  4NXM B;  2HFE C;  1H2L A;  1EN5 A;  4QGP A;  3TJT A;  4LNU B;  2Y69 B;  2YDE A;  3AG2 C;  1NT2 B;  4GX2 A;  4MTX A;  1ZUQ A;  3Q4H A;  1Q86 W;  4JI1 O;  1IX9 A;  2QE7 G;  3LDE A;  2ZR2 A;  1Q90 D;  2EIM B;  4GYC B;  1I7F A;  3JAK B;  3KZI Z;  4KHP O;  1WJZ A;  3H1H H;  3ZMU A;  1LUV A;  2Y69 C;  3JAL A;  4FFB B;  5KHG A;  1Y4M A;  2F23 A;  5FNV A;  1NS1 A;  2EIM C;  1YIT V;  3ZHT A;  2XND G;  3T2M A;  4FZ0 A;  3TXQ A;  2WWW A;  5KAF Z;  1SES A;  1P7G A;  4CBC A;  3CRC A;  3HB3 B;  3K04 A;  1FXH A;  1Q3E A;  3CCL V;  4Z2W A;  2QEX V;  1SQB H;  3ICX A;  4ZOL A;  1LNQ A;  3TET A;  4GKK B;  2EIN B;  2OTJ V;  4O4H A;  2UXX A;  5JQG A;  3TGU H;  2FL4 A;  4PA6 A;  2YUA A;  2D3O W;  2PGG A;  1XUQ A;  2BCC H;  4MTO A;  2WLI A;  3CC2 V;  2P4K A;  2EIN C;  2JK5 C;  1VMG A;  4UCS A;  2UXN A;  2OCC B;  4AQY B;  1NH2 B;  4DV0 B;  1CP9 A;  2Y4T A;  5CN0 A;  1VQ6 V;  3LDC A;  2P4V A;  4HNA B;  4X1I B;  5IT9 N;  4BWA A;  1PP9 H;  5B5E Z;  4JAU A;  3SJQ C;  2Q68 A;  2WLH A;  4CC5 A;  4UB6 Z;  5EZY B;  2OCC C;  4QNH B;  2IU3 A;  1HNW B;  4IIJ A;  1WB8 A;  1DK1 A;  2YSU B;  4B7E A;  3L72 H;  4AHC A;  2DW4 A;  4AIL C;  3I56 V;  4XDJ A;  4J7K A;  3ETD A;  2ZE5 A;  5LYJ B;  5BR8 O;  1M9N A;  1K34 A;  4YIP A;  3ZRX A;  3ZX6 A;  1X4T A;  3E22 B;  1RP3 B;  2DN9 A;  5KMG B;  2JEX A;  3OEE G;  1GM7 A;  2CGN A;  1FJG B;  3NXS A;  3N2K A;  4JI2 B;  1Y74 B;  5CA1 B;  5LOV B;  2QWR B;  4TUY A;  3ZRS A;  3QNE A;  4H13 B;  1PV0 A;  4TV9 B;  1AVM A;  4GZR B;  4ZIB A;  3FFQ A;  4B3T O;  4MVU A;  2DWD C;  2L35 A;  4MVQ A;  1S0V A;  4OGQ B;  3OFN G;  5BXZ A;  1J95 A;  3APO A;  4ZKI A;  1Y76 A;  4QJF B;  1OCC C;  1KB9 F;  5E1A C;  2IBZ H;  2Y4U A;  3CMA V;  3K58 A;  2QGN A;  2Q5Z A;  1VIB A;  4DV6 O;  2JS3 A;  5IWA B;  1XHX A;  1JA8 A;  3ZRW A;  3QG5 A;  4LFB B;  2QWQ B;  2UUB B;  3A8T A;  4DV4 O;  3VQX A;  3F7V C;  4EEQ A;  4IYI A;  1EN4 A;  2ZQM A;  3ZMZ A;  4LFC O;  4YJ2 A;  1FXK A;  4B7K A;  4IHJ A;  2YID A;  1O9H A;  4Z1M G;  1CEZ A;  4I55 B;  1TUB B;  4DV2 O;  3CCM V;  4MTF A;  2X6C A;  2GV9 A;  1K33 A;  2H94 A;  3KKY A;  2NNU A;  1KP2 A;  3HKC A;  1ZTE A;  3IC7 A;  1THZ A;  2ZDI C;  3JYC A;  3P3N A;  1ZLZ A;  3CCQ V;  3JAR B;  3G67 A;  2NR5 A;  4YJ3 B;  1IBM O;  3CE2 A;  3CCS V;  4J42 A;  1GTO A;  2Q6A A;  2UXD O;  4TOI A;  1U97 A;  5B3S B;  4QE7 A;  5IY5 C;  2WLN A;  3FD9 A;  4X64 B;  5LGU A;  3LNM B;  3R66 A;  2CTR A;  4DO2 A;  3TXS A;  2LFR A;  2QA4 V;  5LA6 B;  3U10 A;  5B66 Z;  5CBF A;  5B3S C;  1N36 B;  4CH5 A;  2R9R B;  3JSL A;  4R6Z A;  3B4S A;  3WFV A;  4GKJ B;  4DV3 B;  1DLB A;  1QR8 A;  1W0J G;  3AG1 C;  1E1Q G;  2XAF A;  1GO3 F;  3RYI B;  3RVZ A;  1BT8 A;  5JCO A;  2YIB D;  1BQZ A;  3G80 A;  1B04 A;  4NYK A;  2ZR3 A;  3FB6 C;  4X1K B;  1I5X A;  3HKE B;  1BE3 H;  1G8M A;  1WA8 A;  3BRC A;  4NTY A;  3T1Y B;  2CDY A;  1JX9 A;  4H44 B;  2HJD A;  2EJR A;  3W7T A;  1M90 W;  1HNX B;  4LF6 O;  2FB5 A;  3ETE A;  1HW7 A;  2BSK A;  4R8C A;  3OMN B;  1OCZ B;  3SYP A;  4JV5 B;  3SJC C;  4JI0 O;  2ZIN A;  4NKG B;  2ODM A;  3DC6 A;  3L70 H;  3CJH A;  1JOY A;  4J41 A;  3FB5 C;  1H2G A;  4MW3 A;  2ITD C;  4LWS B;  3E2E A;  4JI6 O;  2YS8 A;  2EX3 A;  5EYP A;  3K5M A;  4UUJ C;  4MVM A;  4LH7 A;  1VF5 B;  5H9C A;  2PY5 A;  3OUF A;  1JJ2 U;  4UXN A;  2Y48 A;  3ZJZ A;  1HP8 A;  2QM8 A;  3F7Y C;  2E5L B;  2WA3 A;  3ZN0 A;  1BSM A;  2WLL B;  3K59 A;  3L71 H;  5JVD B;  5ITZ A;  1S3J A;  4U3F H;  1GKF A;  5KX5 B;  2K1E A;  1AIL A;  4DW1 A;  2WA4 A;  4B3R O;  3FX7 A;  1SKV A;  3RYF B;  2VQF B;  5IJ0 B;  3OW2 U;  2YEV B;  5LMU O;  1RM1 B;  2HLD G;  4JI8 O;  3OE7 G;  1SQF A;  3NR7 A;  4LBE C;  4F6R B;  2V1D A;  2AHZ A;  2BTQ A;  1B06 A;  4WFG A;  2LP7 A;  1RM1 C;  4JAA A;  4I50 B;  4KHP B;  4DR6 O;  3D3I A;  4TWK A;  5B1N A;  3LSS A;  1G4Y B;  1VF6 C;  4ZI7 B;  5F2V O;  2GHY A;  1VQ5 V;  1YHQ V;  1NTZ H;  3I5D A;  1NU1 H;  4DV7 B;  2EBO A;  3ZHR A;  5L3C A;  1QVF U;  4DYL A;  1E1R G;  4FK5 C;  3ZHQ A;  3FB8 C;  2UU9 B;  4MS2 A;  2IH3 C;  3BFR A;  5HFL A;  2QSA A;  4CH3 A;  3JAS B;  2QWN B;  1QLE B;  4K35 A;  1OCR C;  2QTS A;  2VRZ A;  1TA8 A;  1XMO O;  3CWB H;  1XL4 A;  4HBN A;  1S5H C;  2GBO A;  1QNM A;  1WAZ A;  1EFR G;  2AW9 A;  2XAH A;  4FM1 A;  1ZL8 A;  1Z5W A;  2ZNJ A;  4KP4 A;  1NR1 A;  2P06 A;  1NH2 D;  4DR5 O;  3QO5 A;  4FLU A;  2R9A A;  4P9P A;  1M1K W;  2ZXW B;  3ABT A;  5KUM A;  3RYC B;  2HHH O;  3MHH C;  2CH7 A;  1JR9 A;  2WSS G;  1EN6 A;  3LSQ A;  4RQE A;  3CHX A;  1BHA A;  2R70 A;  5A2Q N;  3HKD A;  4O2A B;  5J2T B;  2ZXW C;  4P30 A;  2QM7 A;  4R50 A;  1E79 G;  3CRA A;  3ETG A;  4JPR A;  2Q9L A;  4O2B A;  5KHH A;  2Q0O C;  1PM9 A;  1BL8 A;  2ILM A;  4X8A A;  1J5E O;  5BR8 B;  1JFF B;  4DR4 O;  1AI4 A;  5JJE B;  3OT7 A;  1P7B A;  4MVZ A;  1H2K A;  1ZAU A;  2ZNI A;  1V55 B;  4X65 O;  5GTI Z;  2KSD A;  4I4T A;  2Q73 A;  2LW7 A;  2DYR B;  2M6Y A;  1RSO B;  1IBL O;  3LDD A;  4U3J B;  3N2G B;  2Q7H A;  1EM1 A;  2KG7 A;  4JGS A;  1VQO V;  1H2S B;  2OIG A;  2W6J G;  3CS5 A;  3CD6 V;  4B3T B;  1XQ8 A;  3AK3 A;  1K9M W;  4PDM A;  3ABM C;  4JAV A;  1SF9 A;  1VQK V;  2DYR C;  1HR0 O;  5IYB O;  5BMV B;  3AG4 C;  3ZED A;  4TV8 A;  4F4L A;  2XOK G;  4DK1 A;  1K5Q A;  3CCV V;  1KU9 A;  2PZS A;  1FS0 G;  2A06 H;  5IE9 A;  2Z3Y A;  3H1J H;  1OCO B;  2ATK C;  3A0R A;  4UCU A;  2XTA A;  4UV9 A;  1ORQ C;  2ZKO A;  3ML0 A;  3SPI A;  1W2B U;  3E8H A;  4JYB A;  4FLY A;  3UM7 A;  4J7J A;  3QO7 A;  5LP6 B;  1OJH A;  4LFC B;  3W7U A;  4X66 B;  1H8H G;  4YXW G;  1OCO C;  3UKM A;  3U0Z A;  4WBN A;  1NVP B;  1Z5V A;  2R9I A;  3FKS G;  1Q7Y W;  2QWP B;  5LP6 C;  4BIU A;  4LF8 O;  3UO2 A;  4YIO A;  1VF7 A;  1PNL A;  4JI5 O;  4WFB V;  3ZS8 C;  1UPG A;  1D5N A;  2FKX A;  2LGQ A;  3OD4 A;  3JAW A;  3OTO O;  1N34 B;  1Y67 A;  1VQ7 V;  4LF5 O;  2F4V O;  5CB4 A;  2DYS B;  3AG3 B;  1TUE B;  3J81 N;  1GN2 A;  2DJV A;  4J7Z A;  4KFM A;  3Q4H B;  4PDV A;  3M99 B;  4LNU A;  2OCH A;  5CA0 A;  3ZMV A;  2KKW A;  4GUN A;  1YZB A;  3AG3 C;  3UT5 B;  3T1C A;  3K06 A;  2IW5 A;  3H9V A;  4GLX A;  4EKW A;  4K8X A;  2JGD A;  4FFB A;  3B8N A;  1EZJ A;  1F51 A;  2ETN A;  4CH4 A;  4K8Z A;  4PA9 A;  4JI0 B;  1SC5 B;  4H37 A;  1R3J C;  3CEI A;  1L0L H;  1YI2 V;  1EBO A;  4B3M O;  4X20 B;  4ZOL B;  4XBF A;  4N21 A;  4O4H B;  3B09 A;  1AP6 A;  1BGY H;  4J9Z B;  1AP5 A;  1XHZ A;  5JWP A;  1XNQ O;  1QR9 A;  4RUE A;  2Q7G A;  2PF4 E;  4JI7 B;  3ZMS A;  5LMN O;  1T5E A;  2ZM6 O;  3ZHV A;  1PNM A;  2ZE6 A;  2YI9 A;  2W0X A;  1WPB A;  4X62 O;  3K5O A;  2VWK A;  3G6B A;  3R65 A;  5JH7 B;  4J9Y B;  4DRX A;  3GB7 C;  3T1H B;  3JD4 A;  1JQ0 A;  4FVM A;  3B8M A;  5FLX N;  4W4L A;  1RPR A;  1M93 A;  4LFA O;  4P2Z A;  5LMU B;  4HNA A;  3MDS A;  4JI8 B;  3IFX A;  3X2Q B;  4JAS A;  1AR1 B;  4YHH B;  4DR2 B;  1H2N A;  1FD9 A;  4MSW C;  1VP7 A;  1KYO F;  4QIW F;  5C8Y B;  2ADQ B;  1AI6 A;  4I7Z B;  5LGT A;  2P6J A;  3L75 H;  2XAJ A;  4FMT A;  4Q20 A;  2JEU A;  4DR6 B;  5KUK A;  3JD2 A;  1NR7 A;  1YTF B;  3CSX A;  2B1G A;  2IJJ A;  4DR3 O;  4LF9 O;  3PN1 A;  5LYJ A;  1IXM A;  2IJK A;  4L8J A;  2IJI A;  1DF5 A;  4KXR A;  2WLK A;  1K4D C;  3FB7 C;  5KMG A;  2Q67 A;  3ABL B;  1HNZ O;  4FIP C;  1XMO B;  1Y74 A;  1K4C C;  1MAB G;  3HKB B;  4DR1 O;  1JCH A;  1XL6 A;  2QKC A;  4JI4 B;  3B77 A;  3JCU Z;  1HDJ A;  1N32 O;  1SRY A;  3ABL C;  3WU2 Z;  3G4S V;  3O9O A;  4JYY A;  4RO2 A;  4DR5 B;  2MK3 A;  1GH6 A;  1U96 A;  1SZX A;  5IJ9 B;  1N33 O;  2DOS A;  1XEQ A;  3CX5 F;  3DXR A;  3TCU A;  3DC5 A;  3ZHS A;  1VQN V;  3VQV A;  2HHH B;  2CUG A;  1KD1 W;  3CC4 V;  1OZ0 A;  1SQG A;  1PD3 A;  1TGO A;  2ZDI A;  2ZE8 A;  3WG7 B;  4YJ2 B;  1FXK B;  4IHJ B;  3BA9 A;  2N04 A;  5GW7 A;  3HKC B;  4DUZ O;  1I0H A;  4DV5 O;  4DR7 O;  2X6B A;  3RYH B;  2IJH A;  1A32 A;  3FAV A;  2YXL A;  4LC1 A;  3FYI B;  2ZT9 B;  1N0N A;  4CH6 A;  4PI2 A;  3ETQ A;  1J5E B;  4JI3 O;  1YSC A;  4YJ3 A;  4DR4 B;  3K57 A;  4MVO A;  4Z1V A;  1AJQ A;  1FFX B;  3OM3 B;  4G2K A;  3UT5 A;  4J10 A;  5LGN A;  4QPK A;  2LGW A;  4R7C A;  5EIB D;  5B1B B;  3ABU A;  5FPO A;  2ADP A;  1EZV H;  4OXS A;  1IUR A;  2A7W A;  3SDL A;  3E89 A;  3IAY A;  4DV1 O;  4WFF A;  1M4U A;  3SGI A;  4JYC A;  1Q6U A;  5EBM C;  4LR3 A;  4PA3 A;  2CTW A;  2RDC A;  5LA6 A;  4HAM A;  1WB7 A;  2DMX A;  1P4R A;  5B1B C;  2EZO A;  1JMK C;  4B3S O;  3H1K H;  4WCE V;  4UVB A;  3E35 A;  4NXN O;  4EB6 B;  1HR0 B;  1WA8 B;  3CP1 A;  3K0G A;  4PV1 B;  4C7U A;  3RYI A;  1HWY A;  4W4K A;  4MW8 A;  1Q43 A;  3IC9 A;  4OX9 O;  4NTX A;  2NLJ C;  2P22 C;  2BTO A;  5L3F A;  4X1K A;  2UXC B;  1US6 A;  4RWU A;  4O4L B;  4BIO A;  3GVM A;  4BAY A;  2RN9 A;  1KBH A;  2IU0 A;  1K5S A;  2OWO A;  1QHT A;  4J80 A;  1F7Y A;  4JTD B;  3CJH B;  2ZE7 A;  1OCZ C;  3CYO A;  2ZD9 A;  2DQ0 A;  1XBL A;  2FYU H;  1NVP D;  2VQE O;  2YXY A;  3ABK B;  4LWS A;  4ABM A;  2QDO A;  2JJ1 G;  1ARO P;  1R3L C;  3THO A;  3S3W A;  1AB3 A;  3K5L A;  1SS3 A;  4FJC C;  2H8P C;  4LF8 B;  2HJF C;  1CXZ B;  3VBB A;  3H1L H;  4PHZ A;  4JI5 B;  1XRE A;  1LR1 A;  4HZ3 A;  1R6K A;  3ABK C;  3B40 A;  3OR7 C;  3G71 V;  3D8C A;  1PPJ H;  2F43 G;  1KP3 A;  5JVD A;  4AQY O;  5GON A;  3A0B Z;  4DV0 O;  2P7T C;  3K3W A;  3K9A A;  4HYO A;  3AK2 A;  5A9G A;  3L74 H;  5H6Q A;  5KLV H;  2X7R B;  1O9G A;  3D36 C;  4JI1 B;  2YXH A;  3HPL C;  3RYF A;  4I9Q A;  3W7W A;  2YEV A;  3EHB B;  3G6E V;  3QO8 A;  3CCR V;  5IYC O;  1L0N H;  1BS3 A;  2L6L A;  1K8A W;  1VF6 A;  4F6R A;  1I94 O;  3I55 V;  3EFF K;  2RCV A;  2CAZ C;  3BY6 A;  3HR0 A;  4U7N A;  1SA0 A;  2EIK B;  4JTC B;  3WB2 A;  4LF7 O;  2ZCE A;  3GWO A;  3WB0 A;  4FZ1 A;  1KQS U;  5KAI Z;  3N27 A;  2Q4P A;  2XAG A;  1S77 D;  4DW0 A;  2EUL A;  2KB1 A;  5E79 Z;  4RAI A;  2LO1 A;  1BHB A;  3RW0 A;  1XMQ O;  2EIK C;  1M57 B;  4ICG A;  1FJG O;  1QBZ A;  5LHG A;  4JI2 O;  1M5I A;  5J2U A;  2F95 B;  4CC6 A;  2QKS A;  3JAS A;  2PTM A;  5LL6 Y;  3W7X A;  2OTL V;  4FLZ A;  2E76 B;  1ZL8 B;  3WB1 A;  1QLE C;  1NBM G;  2JIZ G;  2A79 B;  2A9H A;  3VOU A;  4OPA A;  1K97 A;  1DTO A;  2CE4 A;  3CC7 V;  3SYA A;  5D5P A;  4FLV A;  2N05 A;  2EIL B;  4O4I B;  2A0L A;  2H3O A;  1W59 A;  5CBH A;  4LP8 A;  4UVA A;  3JAT B;  3T4Z A;  1M56 B;  1GRJ A;  2XAS A;  5IWA O;  1R73 A;  1Q6H A;  1OV9 A;  2LW1 A;  4LFB O;  2VWJ A;  1AR4 A;  2GDS A;  3UO3 A;  2EIL C;  3RYC A;  3CPW U;  1YIJ V;  1SQV H;  3UQ8 A;  3EXA A;  4G28 B;  5LXT A;  1S5J A;  1M56 C;  4WF9 V;  2UXB O;  3S3X A;  4O2A A;  4UB8 Z;  1IDS A;  2A3Q A;  1YTF D;  1VQ8 V;  1BCC H;  3CRM A;  3C90 A;  1NZ6 A;  1NJI W;  2KQX A;  4PDR A;  2JVD A;  4ZHQ B;  4DR3 B;  1SQP H;  4LF9 B;  1FPO A;  3RVY A;  3SPH A;  1JFF A;  4PD4 F;  5KA6 A;  2PI5 A;  1MNG A;  2F93 B;  4IL6 Z;  4X64 O;  1GN3 A;  1YF2 A;  4UCR A;  5DM6 V;  1NKD A;  1TVK B;  4RQF A;  4CZZ A;  1KEC A;  1PNK A;  1JVM A;  1V55 C;  4MT8 A;  2QKA A;  2Y0I A;  1HNZ B;  3SYC A;  4N23 A;  5DED A;  3VQW A;  4F6E A;  1RSO A;  2IM9 A;  5EIB C;  1N36 O;  4U3J A;  3N2G A;  4G27 B;  1V54 B;  1N32 B;  3SYQ A;  2EJ7 A;  2YIB A;  4XDL A;  2E3C A;  2YIC A;  4DV6 B;  1G1X B;  3CRQ A;  4O4J A;  3AK1 A;  3E8F A;  5BMV A;  4I0X A;  2JS5 A;  3OMI B;  5LBQ A;  1V54 C;  3JCZ A;  4X1Y A;  4DV4 B;  1BMF G;  2B1I A;  3APQ A;  1WN7 A;  2C2A A;  5IYZ B;  4FLX A;  2RJZ A;  4JV5 O;  4D7T A;  2E75 B;  4DV2 B;  1P84 F;  5DEC A;  3K08 A;  4LF4 O;  1VQ4 V;  1S5L Z;  5HFM A;  3MAQ A;  1UFI A;  2PI4 A;  1IBM B;  4DR7 B;  4NTW A;  4B08 A;  4WBN B;  5IDJ A;  1KUQ A;  2UXD B;  1Y66 A;  1NI8 A;  2GUZ B;  2YI8 A;  3ZHU A;  2Q69 A;  1GN6 A;  1RFY A;  2E5L O;  2VS0 A;  2GTA A;  2F1M A;  4MVS A;  3RN4 A;  3JAW B;  2QR4 A;  3RT3 C;  2D2C B;  1Q5O A;  4DV1 B;  1WP8 A;  1WNS A;  1NTK H;  5CB4 B;  2MW2 B;  3SR2 C;  5B1A B;  5CA0 B;  4B3S B;  2DYS C;  2F66 C;  3JAK A;  3JAL B;  4K0K O;  4NXN B;  4H33 A;  2UUA O;  3OGI B;  5CA3 A;  2GTS A;  2LJ2 A;  4LF6 B;  4I5S A;  2XHB A;  4OX9 B;  5FNV B;  3L73 H;  3H1I H;  4YY3 O;  5B1A C;  2JGD B; 
#chains in the Genus database with same CATH homology
 3E8B A;  3SPC A;  3CCE V;  1VQL V;  3ZCC A;  3F5W C;  1S3J A;  1GKF A;  2EIJ C;  2K1E A;  3T4D A;  3TCU A;  5L3E A;  5LHH A;  1VQN V;  5IYD O;  4XDK A;  2X0L A;  2P67 A;  2P90 A;  3OW2 U;  4P9O A;  4WFH A;  1KD1 W;  3CC4 V;  2YEV B;  3BEH A;  1OZ0 A;  4JF3 A;  1RM1 B;  2HLD G;  3OE7 G;  1PD3 A;  3ABM B;  2ZDI A;  3WG7 B;  1FXK B;  4LBE C;  4ZBM A;  3AG4 B;  1MG1 A;  5CMU A;  2V1D A;  2AHZ A;  2WLI B;  5GW7 A;  1GM9 A;  1GM8 A;  2X6B A;  4UVC A;  3JD0 A;  1AI7 A;  2IJH A;  4BIZ A;  4WFG A;  2LP7 A;  1RM1 C;  1AJP A;  4LC1 A;  5L3D A;  3D3I A;  5EC2 C;  4TWK A;  5B1N A;  3FYI B;  3LSS A;  4E2L A;  2FTK A;  1YSC A;  1G4Y B;  1ROP A;  3W7S A;  4MVO A;  1SET A;  1N8R W;  2V7Q G;  2GHY A;  1AJQ A;  3KG2 A;  1K92 A;  3OM3 B;  4G2K A;  1VQ5 V;  5LGN A;  1YHQ V;  4QPK A;  2HKO A;  1SER A;  4R7C A;  3PJS K;  2EBO A;  1VQP V;  5L3C A;  1QVF U;  5B1B B;  3ABU A;  1COW G;  1YJW V;  1E1R G;  4FK5 C;  4OXS A;  5EBL C;  3FB8 C;  4X89 A;  3E89 A;  4MS2 A;  2IH3 C;  5HFL A;  3FYE B;  4WFF A;  1PL0 A;  4GX0 A;  4JYC A;  5EBM C;  4PA3 A;  1QLE B;  2LFS A;  3OEH G;  1OCR C;  1XL4 A;  4HAM A;  5J9P C;  1S5H C;  4L87 A;  3ZIA G;  1PKX A;  1EFR G;  1P4R A;  1GMG A;  5B1B C;  2EZO A;  2XAH A;  3E86 A;  3X2Q C;  5KA5 A;  4WCE V;  4UVB A;  3E35 A;  5EBW C;  1GK9 A;  2BOB C;  3TK1 A;  5B1O A;  5EC1 C;  3CP1 A;  3K0G A;  4KP4 A;  1HWY A;  3ASN B;  4MW8 A;  1NR1 A;  1QLN A;  4PA7 A;  3CCU V;  1NH2 D;  2NLJ C;  5L3F A;  4GX5 A;  1ZWI C;  3QO5 A;  3AG2 B;  3CCJ V;  2HR3 A;  5L3B A;  4P9P A;  2JDI G;  4DXW A;  1R3K C;  4PA4 A;  3STZ C;  4BAY A;  2HG5 C;  1M1K W;  2ZXW B;  1B6Q A;  3ABT A;  5B1A C;  1SZT A;  5KUM A;  3ASN C;  4PEL A;  4KUM A;  4ASU G;  2HVJ C;  2IU0 A;  1K5S A;  3MHH C;  2HFE C;  3K79 A;  1K73 W;  4JTD B;  1I5Y A;  2WSS G;  1OCZ C;  3CYO A;  3DGE A;  3LSQ A;  2Y69 B;  3AG2 C;  3SPJ A;  4RQE A;  4GX2 A;  4MTX A;  1BHA A;  2ZD9 A;  2DQ0 A;  1JPX A;  4I9W A;  2ZXW C;  4P30 A;  1Q86 W;  1OCC B;  2QM7 A;  4R50 A;  2QE7 G;  3LDE A;  1NVP D;  2ZR2 A;  2WAM A;  2EIM B;  3ABK B;  1E79 G;  2JJ1 G;  1L1F A;  1ARO P;  1R3L C;  3OR6 C;  3ETG A;  3JD3 A;  4JPR A;  2WLM A;  3ZMU A;  4FJC C;  1BL8 A;  1MOF A;  2Y69 C;  2H8P C;  4X8A A;  3ZMT A;  2HJF C;  3VBB A;  4WFA V;  1AI4 A;  3ZRW B;  1P7B A;  3E8G A;  1Y4M A;  4MVZ A;  4HZ3 A;  2W6I G;  1R6K A;  3E83 A;  2EIM C;  3ABK C;  1YIT V;  1V55 B;  2XND G;  3OR7 C;  3G71 V;  3IGA C;  3K03 A;  5L3G A;  2F43 G;  1KP3 A;  3T2M A;  4TSF G;  2WWW A;  2P7T C;  3K3W A;  1SES A;  3K9A A;  4HYO A;  4CBC A;  3HB3 B;  2DYR B;  2WLJ A;  5H6Q A;  1NQT A;  5DN6 G;  3K04 A;  1FXH A;  4JTA B;  2X7R B;  3CCL V;  3LDD A;  2QEX V;  3HPL C;  3TET A;  1LNQ A;  2OTJ V;  2EIN B;  4JGS A;  3W7W A;  1YJN V;  2YEV A;  3EHB B;  2W0F C;  3G6E V;  3QO8 A;  3CCR V;  1VQO V;  2W6J G;  2UXX A;  5IYC O;  3CD6 V;  1K9M W;  4U7O A;  1K8A W;  4PDM A;  1KKD A;  1AI5 A;  4PA6 A;  2D3O W;  1S76 D;  3ABM C;  3WG7 C;  5IY5 B;  1FXK C;  4JAV A;  4MTO A;  3EFF K;  2WLI A;  2DYR C;  3I55 V;  1VQK V;  5IYB O;  1F4M A;  3CC2 V;  3BY6 A;  3AG4 C;  4F4L A;  2XOK G;  4U7N A;  2XAQ A;  1K5Q A;  2EIN C;  3CCV V;  2JK5 C;  1FS0 G;  2EIK B;  4JTC B;  2M7W A;  2UXN A;  3GWO A;  2OCC B;  1NH2 B;  1KQS U;  2Z3Y A;  3ZN1 A;  1CP9 A;  1K3E A;  1OCO B;  2ATK C;  3A0R A;  4PDL A;  5CN0 A;  1VQ6 V;  3LDC A;  4UV9 A;  2XAG A;  1S77 D;  1ORQ C;  4X88 A;  4GCZ A;  2KB1 A;  3ML0 A;  4RAI A;  3SPI A;  3RW0 A;  1BHB A;  1W2B U;  3E8H A;  3AG1 B;  4GX1 A;  4JYB A;  2EIK C;  4JAU A;  3SJQ C;  2Q68 A;  2WLH A;  3UM7 A;  1M57 B;  2OCC C;  3QO7 A;  3W7U A;  1QBZ A;  5LHG A;  4QNH B;  2IU3 A;  1H8H G;  3DTU B;  4YXW G;  2QKS A;  1OCO C;  2YSU B;  3W7X A;  2OTL V;  3P32 A;  2DW4 A;  3UKM A;  2Z5U A;  1QLE C;  4WFE A;  3H01 A;  1NBM G;  1NVP B;  3I56 V;  2JIZ G;  2R9I A;  2A79 B;  4XDJ A;  3FKS G;  2A9H A;  1Q7Y W;  4MTG A;  1VQM V;  3VOU A;  3ETD A;  4BIU A;  1K97 A;  5CBG A;  1DTO A;  1M9N A;  1K34 A;  1S72 V;  3CC7 V;  3SYA A;  1PNL A;  3ZRX A;  4WFB V;  2EIL B;  2A0L A;  5CBH A;  4LP8 A;  4UVA A;  2JEX A;  3T4Z A;  3OEE G;  1M56 B;  1GM7 A;  2XAS A;  1R73 A;  2B5U A;  1VQ7 V;  3NXS A;  3P30 A;  3ZRS A;  3QNE A;  2DYS B;  3AG3 B;  1TUE B;  2EIL C;  4QPJ A;  3CPW U;  1F23 A;  1YIJ V;  1QCE A;  2OT5 A;  4G28 B;  1FXV A;  4KFM A;  4PDV A;  3M99 B;  1FFT B;  1W0K G;  2DWD C;  1M56 C;  4MVU A;  4MVQ A;  3ZMV A;  4WF9 V;  1S0V A;  1Q82 W;  3OFN G;  1J95 A;  2WPD G;  1YTF D;  4ZKI A;  1ENV A;  3AG3 C;  2EZP A;  3T1C A;  4QJF B;  1VQ8 V;  1OCC C;  5E1A C;  2WLL A;  3K06 A;  2IW5 A;  3CMA V;  3SPG A;  4EKW A;  1NJI W;  4PDR A;  3OMA B;  3SPH A;  3RVY A;  5EK0 A;  5KA6 A;  2PI5 A;  3B8N A;  1EZJ A;  3ZRW A;  3D36 A;  1F51 A;  3CME V;  1QVG U;  1KC8 W;  5DM6 V;  4PA9 A;  1NKD A;  4H37 A;  1CPY A;  1R3J C;  3SYO A;  4CZZ A;  4RQF A;  1KEC A;  1PNK A;  1JVM A;  3AEI A;  1V55 C;  4MT8 A;  1YI2 V;  1EBO A;  4GT1 A;  3F7V C;  3SYC A;  4N23 A;  2ZQM A;  3ZMZ A;  1FXK A;  2QTO A;  4Z1M G;  1UJW B;  4XBF A;  1CEZ A;  1K7D A;  4N21 A;  3CCM V;  4MTF A;  2X6C A;  4J9Z B;  1K33 A;  2H94 A;  2NNU A;  1KP2 A;  1QR9 A;  3IC7 A;  1THZ A;  4RUE A;  2ZDI C;  3JYC A;  1WPX A;  1V54 B;  1VQ9 V;  3CCQ V;  3SYQ A;  1OHH G;  2X6A A;  3CCS V;  3ZRV A;  1H38 A;  1GTO A;  4UV8 A;  1H8E G;  4XDL A;  3ZMS A;  2Q6A A;  2GSM B;  2DWE C;  1PNM A;  5BZB A;  4MVR A;  3E8F A;  3CXC U;  5B3S B;  4QE7 A;  5IY5 C;  2WLN A;  5LGU A;  3OMI B;  5LBQ A;  3LNM B;  1YJ9 V;  3R65 A;  1V54 C;  3JCZ A;  4J9Y B;  3GB7 C;  1OCR B;  4DO2 A;  3JD4 A;  1JQ0 A;  1BMF G;  2B1I A;  1RPO A;  3B8M A;  4FPP A;  2LFR A;  2C2A A;  2QA4 V;  1RPR A;  3RBZ A;  4P2Z A;  1WLE A;  4QE9 A;  2HVK C;  5CBF A;  3IFX A;  3X2Q B;  5C93 A;  5B3S C;  4JAS A;  1R6N A;  3K08 A;  2R9R B;  1AR1 B;  1VQ4 V;  4R6Z A;  3WFV A;  5HFM A;  4MSW C;  3MHS C;  1DLB A;  4QIW F;  2PI4 A;  1QR8 A;  1W0J G;  3AG1 C;  1E1Q G;  2XAF A;  1AI6 A;  1GO3 F;  2IH1 C;  4TT3 G;  1M57 C;  3RVZ A;  3ASO B;  5LGT A;  3STL C;  2P6J A;  2XAJ A;  4FMT A;  4Q20 A;  2ZR3 A;  5IDJ A;  1Y66 A;  1F4N A;  3FB6 C;  4RUF A;  1I5X A;  3JD1 A;  1G8M A;  2JEU A;  5FL7 G;  5KUK A;  1JX9 A;  3JD2 A;  5LHI A;  1Q81 W;  1DF4 A;  1NR7 A;  2EJR A;  3W7T A;  1M90 W;  1YTF B;  2Q69 A;  2B1G A;  2IJJ A;  3ETE A;  1MSW D;  3OAA G;  3MD0 A;  4MVS A;  3ASO C;  4R8C A;  1IXM A;  2IJK A;  3OMN B;  2IJI A;  1OCZ B;  3SYP A;  1R3I C;  1DF5 A;  1AJN A;  2WLK A;  1K4D C;  3FB7 C;  2Q67 A;  3K0D A;  3ABL B;  4FIP C;  1JOY A;  3FB5 C;  2DQ3 A;  2ITC C;  1H2G A;  4MW3 A;  2ITD C;  3E2E A;  1K4C C;  5B1A B;  1MAB G;  3LUT B;  4UUJ C;  4MVM A;  5H6R A;  5H9C A;  2DYS C;  3OUF A;  1JJ2 U;  4UXN A;  1JCH A;  1XL6 A;  2Y48 A;  3OGC C;  2EIJ B;  3B77 A;  2BOC C;  3OUS A;  4LCU C;  2QM8 A;  2AHY A;  2CK3 G;  4H33 A;  3ZJZ A;  5CA3 A;  1SRY A;  3ABL C;  3F7Y C;  4I5S A;  3ZN0 A;  3G4S V;  4BW5 A;  2JJ2 G;  2WLL B;  4RO2 A;  2MK3 A;  4G27 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...