1YIWA

X-ray crystal structure of a chemically synthesized ubiquitin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
LQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title X-ray Crystal Structure of a Chemically Synthesized [D-Gln35]Ubiquitin
pubmed doi rcsb
molecule tags Structural protein
total genus 21
structure length 71
sequence length 71
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1yiwA00
3UQAA 1E8ZA 1WE6A 1UD7A 4K7UA 2C7MB 5D94A 4ASWC 2N1VA 4DWFA 1MG8A 4EEWA 2M0XA 1WH3A 3K9OB 3VH3B 2KTFA 1EUVB 4I6NB 3AU5A 2PJHA 3PHWB 4BOZB 4GMVA 1ISNA 1V5TA 2LRWA 2N7EA 1YD8U 5L83A 3ZIMA 4FHJA 2CHWA 1UBQA 2K39A 4FJYA 3VUYA 1L7YA 4FJZA 4EZJA 3PT2B 3DCGA 3RZWC 1I35A 2KN5A 4MGIE 3ZDTA 1WXVA 2BWES 2KC2A 2JZZA 1V86A 4W9FA 2XBBC 5AZGA 3MTNB 4TQ0A 1WGYA 3QC8B 4LJOB 4BKSA 4FLHA 3TMPB 4ICUA 2D2QA 2AYOB 3V6EB 3VH4B 2C60A 2KFKB 2LUEA 1WX9A 4OVVA 2JXXA 3ZW3A 4G50A 4EFOA 4F1SA 1H8CA 3OAWA 2LXAA 2ZJDA 4LJPB 3APDA 3KYCD 1XT9B 1Z5SB 2DYOA 1E5WA 2MSED 2D10A 4BOSC 3ZRCA 2G4DB 2Z0DB 1A5RA 5GMVA 1EF5A 4DHJB 4G11A 3M63B 3PLVA 4IM0A 3RD2A 2MQJA 2G4SA 3M95A 2JRHA 2LRUA 2K8CA 2LJ5A 3QCAA 2MP2A 3SU8X 3ZTDA 3PTFC 4EZKA 4ZRJA 4PS3A 2KANA 1AARA 1C1YB 2KX0A 3RYTA 2R2QA 1KLVA 2HJ8A 2N9EB 2PE9A 3K9PB 3KH0A 2BWFA 2MBEA 4GU2A 2DENB 3SD5A 1UZXB 4J6IA 4KIKB 3EECA 4WWPA 1Q1OA 1WY8A 1WM3A 4B6WA 5KHOA 2NPTB 4PS7A 5D7GA 2LZ6A 4BVUC 2GBJA 1WZ0A 1WXAA 4G0NB 1WGGA 4WAAA 4JIOU 3L0WB 4JGHB 2DX5B 3PRMB 4GDKB 2FIDA 3IVFA 4HCNB 1E8YA 3RZFA 5JHBA 2IZVB 1RLFA 3H6NA 2AWTA 4GDLB 2K8BA 4E74A 3B1LX 4AJWA 4A20A 5EDSA 2KJ6A 2KMAA 2OOBB 3T8MA 2IYDB 2BYVE 2GMIC 2ZPYA 4KDIC 2ZVOA 4CYEA 2GBNA 2GOWA 3JYUA 2DYBA 3ZNID 4F7ZA 4MSQB 4RM9A 1YIWA 1GG3A 4FJVB 2J0KA 2M1MA 3A9JB 1CMXB 1Q0WB 3X23A 1WI0A 4HCPB 3RCZA 2KFKA 2FNJB 4II2B 3AULA 5E6OA 1E7UA 2M8SA 2G3QB 2JUOA 3WAOA 4BFRA 1NBFC 2DZIA 1SE9A 3IG3A 3N32A 4M8NA 1WXMA 4TV3A 1LM8B 2KK8A 4MGKE 3U30A 2EKEC 3ZRFA 2DZMA 1Q5WB 3QQ8B 4PYZA 5DPWA 2KXJA 3OLMD 4LCDE 1GC6A 2BYFA 4BKTA 4EZLA 4GIVA 4KDLB 1QZEA 1UGMA 3DQVA 3P2BA 2O6VD 4XZ4A 2NBUA 3V6CB 3WA0A 3VXWA 1OEYJ 4W9JA 1RFAA 4KIKA 5J17A 3N3KB 2ZEQA 3HM3A 4MEMA 3SHQA 3UQBA 4YL8A 2JRIB 3DVGY 2NPTA 1ZGUB 3PPAA 4W9GA 2PPHA 2K1FA 3H1UA 3M3JA 4IM3A 4EUTA 1S1QB 3NY5A 1P0RA 4GDKA 3DBRI 3CSFA 3ECIA 3L13A 2PEAA 2KJHB 4NNJB 4W9HA 3H7PB 3QARA 2ZNVC 3QIJA 2L76A 4GDLA 4MGYE 2KLCA 2MWSB 1C3TA 2WWZA 2MRPA 2IBIB 4BBNC 4TKNA 2REXA 3QJZA 4GN1A 4JLCA 3W1SC 1KM7A 2DZKA 3NOBA 2BKRB 1WJNA 1Z2MA 4BBNF 3TL5A 4KV2A 4XX5A 2MBHA 4KZCA 3TJPA 2ASQA 5JH5C 2FUHB 2KDBA 2YLMA 4K1RB 3VVWB 4DHZE 1P98A 1WXSA 2DAFA 3AU4A 5CTRC 3KUDB 5DPRA 3ZKJC 2GBMA 1E8WA 3EFUA 4MSMB 1RAXA 4WWNA 3A9JA 2W9NA 2D11A 3B08A 4CHKA 2LXCA 2FCQA 5LLIA 2I1KA 2YVCA 3CSTA 3GOEA 4B95A 4LDTD 3L10B 2RD0A 3DVNU 3PZDA 2MBOA 1IP9A 2L05A 2L3ZA 3T9LA 2LGXA 2KC1A 1OGWA 2UWQA 3SDLC 3APCA 1SIFA 1TZ1A 2JWZA 1I42A 2N9PC 2FAZA 1D3ZA 2L7RA 2XEWA 3DVGX 3QK0A 4E71A 3H7SA 4IWQA 4HPMB 2EMSA 1WJ4A 3UIOB 3RT3B 2AL6A 4FN2A 2WDTB 2C7NB 2ZNVB 4II3B 1NDDA 2R2OA 1LFDA 5IAAC 1V2YA 1TTNA 2L0FA 2WYQA 4BKSD 3WANA 4M8MA 2L8JA 1UELA 1WMHB 3A1QB 4JL9A 1LXDA 3V61A 2CHZA 2KQ7A 3X0WA 2L0TA 2DHZA 1WGHA 2KFJA 3VHTC 5C1ZA 3KVFB 4MGZE 3ZNGC 3N30A 3VTUA 2MA9B 4W9IA 2KDIA 1RRBA 3VTVA 2KO3A 2KOXA 2KDFB 4MM3A 1GC7A 4FULA 4HPLB 4IG7B 4IC7B 3H7PA 3WIMA 1J0GA 2IY0B 3NHEB 4MH0E 4W9CA 4AP4C 4A3PA 1WE7A 3R66C 1V9JA 3TBLD 3VTWA 3ZO5B 2LWPA 1YX6B 3ALBA 2LASA 3I3TB 3UGBB 2M4NA 2GBRA 3UINB 4AOFA 2A5UA 2LI5A 4ZRKA 4B9KA 5DCNA 2J0MA 5DPSA 4K81A 2HE7A 1WGRA 2IO0B 2V1YA 2KDEB 2WX0A 1PQSA 3VQIA 3PREA 2O2VB 1V80A 3V62A 4ZDVA 3VFKA 1G6JA 3AI5A 1WRDB 3A4RA 3S2AA 1KOTA 3B0AA 2BKFA 2LD9A 4P7IA 2JZ3B 2N9XA 2BF8B 1X1MA 3PHXB 4GSWA 4I6PA 4DHZB 4NAWB 3NZSA 5L95C 3ZUNA 1VD2A 1WIAA 4NJ7A 3DVNV 3VUXA 4NQKE 3PGEA 3L16A 2LVQA 1E8XA 1WR6E 3DBLI 4HDOA 2HD5B 3LDZE 4I6LB 3W1YA 2LVOA 2J7QB 2OJRA 1S3SG 4AWJA 2KVRA 3KW5B 2C5LC 3KYDD 3L54A 4N9F4 2FCSA 1XD3B 1YX5B 3C0RB 4NPNA 1H4RA 4HVBA 3U8ZA 1E90A 4FA6A 2XK5B 4X57B 4KZ0A 2LGYA 3W1SA 1WMHA 3A1QA 4DXAB 1IYFA 3KUZA 4IM2A 4ICVA 3ML8A 2A4ZA 3A4SC 3O65B 4ZYNA 4ANVA 4MJSB 4K7WA 5D6JB 2KHWB 2KNBA 3A9KB 4DHJD 4WJQA 4K7SA 1UBIA 2J0JA 2ZVNA 1P1AA 4FADA 3BY4B 4WQOB 3R7RA 4GOCA 1ZKHA 5E6NA 3DBHI 4GXBA 4NJ6A 5G55A 2IO1B 2ZPNA 2DZJA 3IFWB 2KWVB 2NBVB 3Q3JA 1SGHA 3PS6A 1WGDA 2CR5A 3HHMA 1V81A 1WJ6A 3R7QA 1R4MI 2NR2A 2K6QA 3BINA 2FIFA 3A33B 1Y8RC 3CMMB 3D32A 3PVLA 4FHKA 2HTHA 2ZCBA 2NCNA 3PRPB 1UH6A 2K8HA 2O2VA 3JSVB 3R3MA 4GB9A 3AXCA 4BKGA 3UIPB 1YJ1A 3IBEA 2BYEA 1M94A 4HK2A 1WYWB 4ANWA 2PE6B 4W9EA 1J8CA 3QWZB 3RULA 2KTRB 1WF9A 3LJ3A 4NAWA 2KMCA 4NQLB 3NZUA 1JRUA 2Y5BB 3EHVA 1BT0A 4DBGA 3GZNI 1TGZB 2B3AA 2FCMA 2VRRB 3ZDMC 2KX3A 4IWOA 2O6VB 3M62B 3JW0X 4CO7A 2IY1B 2IO2B 4KVGB 4E3CA 3ZVVA 5AEKB 2JF5A 2CS4A 1WJUA 2N4FA 3OJ4B 2RSUA 4TQ1A 1K8RB 5JHAA 5LXIB 4G3XB 4W9LA 2RGFA 3NS8A 5IA7A 2GBKA 3WALA 3L17A 3MJWA 2UYZB 2MBBB 2XK5A 2CHXA 4F8CB 1WX8A 2WX1A 5CX3A 1EO6A 4IWPA 3OJ3A 4OVUA 3DBSA 3CF6E 2G45B 3DPDA 3ZTCA 4EOYA 3Q3FA 4DDGD 2MX2A 4HDQA 4MJSA 1WM2A 1V49A 4W9KA 3TCAA 2AL3A 1GUAB 3H9DA 2LGDA 1OTRB 3A9KA 2DAJA 2JPHA 5FR6A 4GGQA 5G2NA 1T0YA 2EMTA 2I1JA 2KLGA 2V3SA 1WZ3A 2ZZPB 1ZW7A 1VCBA 2DYMA 2JVCA 4W9DA 1WX7A 1R4NI 1F9JA 1L2NA 3EC8A 2AEHA 2C7HA 2KQSA 1OQYA 3UF8A 2D3GA 4MELA 3WAPA 4PS8A 2MBQA 3HM6X 3PLUA 2M17A 2KZRA 1E7VA 4FBJB 4JQWC 5D2MB 3VAWA 5BO4B 1P9DU 2NVUI 4LDTB 4WJNA 2IO3B 4WWOA 1GNUA 1V5OA 2QHOA 4MDKE 5JZEB 1KJTA 4KSKC 3JSVA 3L08A 3HIZA 4IW0A 5HKHA 4TUUA 1WFYA 2KJRA 5E6PA 1YQBA 1NI2A 3IHPC 4PYUA 2KTRA 1TBEA 5LXHA 3VDZA 2NBWB 5TR5A 3MHSD 2CU1A 2JY6A 3JVZX 4KSLC 3ONSA 1J19A 4WJOA 2O6VA 2KWCA 4URKA 2KD0A 4RMAA 4ZRIA 5AZHA 4HXDA 4WJPA 2Z59B 2L00B 3QHTA 1LQBA 2RR9A 4M0WB 1FXTB 2N7DA 3ENEA 3QAQA 1P3QU 2MLBA 3HK0A 3QA8A 4NY0A 3TIXA 4AUQC 4ANXA 2C9WB 3U7DA 3DDCB 4HLEA 2LVPA 2BGFA 3RUIB 3ZNZB 3ZNHB 2K25A 2K6DB 2Z0EB 4DDID 3DOWA 2ZCCA 2D07B 4HWIB 1HE8A 4DK5A 1V6EA 3PV1A 5KHQA 5J2RA 2KKCA 2MP2B 5DPTA 5AZFA 5CHVC 4AJYB 1XQQA 2N1WA 2V4LA 3ZLZA 1OEYA 3V60A 4A3OA 4ANUA 2MCNB 2NS5A 1U4AA 1WR1A 1GJZA 1EF1A 3WAMA 4EKUA 5CHFA 3PRZA 3APFA 5J18A 2CKHB 4XC2A 3QX1A 4RM8A 4IUMB 2BPSA 2MW5A 3PSEB 2JT4B 3ML9A 3KUCB 4HJKA 3VUWA 1IPGA 2KWUB 2FCNA 2RPQA 5CHWA 5C23A
chains in the Genus database with same CATH superfamily
3UQAA 4JPSA 1E8ZA 2C7MB 2K5PA 2N1VA 2W54A 4EEWA 1NENB 2M0XA 3VH3B 2KTFA 3AU5A 2NTTA 2DWQA 1YD8U 4FHJA 2CHWA 1UBQA 5BYSA 1BUIC 3T3OA 3VUYA 4EZJA 3RZWC 3Q8CA 1ZP0B 1N61A 4BKSA 4ICUA 2D2QA 2AYOB 3J9CA 4ARIA 2C60A 2WXRA 1HXYD 1H8CA 3OAWA 2LXAA 4WQMA 2MSED 3ZRCA 4LNKA 1A5RA 3MFGA 3QCAA 4M00A 2MP2A 2KANA 3RYTA 2KX0A 3ZJUA 3K9PB 3KH0A 1MHHE 2KMMA 5BMGA 5D7GA 2LZ6A 2PTLA 4BVUC 1C79A 2K22A 1WGGA 4JIOU 3L0WB 1AW7A 3DHHC 3IVFA 5JHBA 2IZVB 4GDLB 2K8BA 3B1LX 4AJWA 4XWWA 3T8MA 2WP9B 4YSYB 1NEKB 1K50A 2GBNA 3JYUA 4F7ZA 1GG3A 2J0KA 2PLPA 4KGTA 1WI0A 4C7YA 3AE2B 2FNJB 3AULA 5E6OA 1E7UA 2G3QB 1NBFC 1QOGA 1L0XB 3N32A 2CJOA 2QCZA 1QOAA 1LM8B 1XXGA 1SJHD 3LXFA 1UF0A 1DOYA 4PYZA 3C8YA 4C80A 1GC6A 4OZCA 2BYFA 4EZLA 2VH1A 2IGGA 4GIVA 4KDLB 3P2BA 3RNBC 1OEYJ 5J17A 3N3KB 2ZEQA 4NZLB 2NPTA 4W9GA 2K1FA 3H1UA 2N7JA 1S1QB 3RI7C 4MM3B 3CSFA 3L13A 3TEXA 2PEAA 1GB1A 4NNJB 3BYTB 3QARA 2ZNVC 3QIJA 4MGYE 2KLCA 2IBIB 1SE2A 4GN1A 4USAA 1FRRA 4NAMA 5AUIA 4KZCA 3TJPA 2KDBA 3VVWB 4K1RB 2WXPA 1QOBA 3ZKJC 2GBMA 3EFUA 4MSMB 4N58A 2D11A 2LXCA 2Q5WD 2YVCA 3GOEA 3L10B 3TEYA 1PGAA 3EFCA 2L05A 2KT7A 4KX6B 2UWQA 1I42A 1L4DB 1D3ZA 2FUG1 3DVGX 3QK0A 1RFKA 3FILA 2INDC 1NDDA 1TTNA 2WYQA 4M8MA 1XLOA 1D4BA 2DHZA 1WGHA 1C77A 4IOIE 1XEEA 3P1MA 4FXCA 2KOXA 2KDFB 4FULA 4US9A 1RYJA 3WIMA 3N9YC 4IC7B 3NHEB 4W9CA 4AP4C 1GB4A 1VLBA 2LASA 3UGBB 2GBRA 4XDCA 4ZRKA 2WS3B 1SJED 1JROA 1MVKA 5DPSA 2RMMA 2IO0B 3NG0A 4ZDVA 3VFKA 1HEZE 1WRDB 2D3BA 3A4RA 2ICIA 2JWUA 3IAM1 4JWSC 2BKFA 2LD9A 2JZ3B 4GSWA 3Q3NC 3ZUNA 3VUXA 2HJ1A 4NQKE 5EE1A 3DBLI 4I6LB 1T3QA 1WRIA 2OJRA 2NTSA 4AWJA 4N9F4 2PIAA 1XD3B 3N1YC 4HVBA 3TSSA 1YN5A 2NMQA 4RGOS 3SFDB 1QKZA 2QMTA 1WMHA 3A1QA 3DBHB 3SFEB 1L5PA 1YMHE 3A4SC 2N9LA 1CZPA 2B76B 2KHWB 4DHJD 1HZ6A 2E6XA 2OJWA 4FADA 3R7RA 2KN4A 4TMAB 5E6NA 3DBHI 3I57A 2IO1B 2ZPNA 1C76A 1V8CA 2DZJA 4PK1A 1SGHA 2CR5A 1WJ6A 3R7QA 1FPYA 1GOZA 4YWGG 1Y8RC 4FHKA 3DHGC 1TY2A 1HTQA 5HFYA 3IBEA 2BYEA 3BWUD 4HK2A 1WYWB 4W9EA 1EWCA 3NZ3A 2L52A 4NQLB 5C2TB 1SF0A 1BT0A 1TGZB 2B3AA 3M62B 5TSSA 3AE5B 2IY1B 1TS2A 1LO5D 2IO2B 3CWIA 5JXVA 2J52A 1K8RB 4M02A 1FCLA 4N59A 2RGFA 1ZXHA 2W82A 3P4QB 2UYZB 2XK5A 4F8CB 1J7CA 4XYCA 1ZE3D 1EO6A 4OVUA 4HDQA 1WM2A 2X8XX 4W9KA 3TCAA 2AL3A 3I5JC 3CIRB 1T0YA 2JU6X 2DYMA 1VCBA 2JVCA 1I7HA 3IT4B 1ET6A 1L2NA 2AEHA 5IO9A 3UF8A 3WAPA 3HM6X 4OHJA 4LTUA 2QC8A 2IO3B 1GNUA 1V5OA 3V05A 2QHOA 4MDKE 1KJTA 1TJEA 1TS5A 1E0ZA 4PYUA 1TBEA 3DWGC 1TS4A 2NBWB 2JY6A 3ONSA 4RGMA 4ZHOA 4CQNA 2Z59B 2RR9A 1FXTB 1V1PA 3ENEA 3TIXA 3HK0A 1IBXB 3DDCB 1FCCC 3MC9A 1L0VB 2BGFA 2MEKA 3RUIB 3ZNHB 2K6DB 2L83A 2Z0EB 2JYEA 2D07B 1PDXA 5CHVC 1L6VA 1VR9A 3BK2A 4AJYB 1XQQA 2N1WA 3ZLZA 4A55A 4M01A 2VH2A 2BB6A 4ZOHC 3QX1A 3AEBB 3BZDB 1F52A 2JT4B 1ZPSA 2LUMA 3VUWA 2LHEA 1IPGA 1V97A 2KWUB 5CHWA 1GPXA 1WE6A 4K7UA 1DGJA 1EUVB 4I6NB 3PHWB 4BOZB 2M56B 4GMVA 1ISNA 2Z8LA 3ZIMA 2J4XA 4FJYA 4DXGA 4FJZA 3ZDTA 3PO0A 1EWYC 1LGRA 5FK9C 5AZGA 4TQ0A 2JYTA 3QC8B 3V6EB 3VH4B 2KFKB 4OVVA 4G50A 3KYCD 2G4DB 4DHJB 4G11A 3RD2A 4DQOC 1WYGA 3AN1A 2LRUA 2K8CA 2LJ5A 5H8YE 3SU8X 3PTFC 2N9EB 2PE9A 4L1BA 5C3JB 2BWFA 1BMLC 4J6IA 2PVGC 1VDVA 2V3PA 4A90A 1WM3A 3MC8A 2J53A 5KHOA 4PS7A 3W5VB 1WZ0A 4G0NB 4WAAA 4JGHB 2WU5B 3PRMB 4GDKB 1KLUD 4HCNB 2CU3A 4E74A 1QQRA 2MHJA 2KJ6A 2ONQA 2OOBB 3ZQ4A 2BYVE 2GMIC 1C4CA 2DYBA 3KQ4A 2WGSA 4RM9A 1K52A 4FJVB 3EUB2 4YTPB 2M1MA 4BAXA 4RFBA 2M8SA 1SE9A 1WXMA 3U30A 2DZMA 3QQ8B 1K51A 3LB8C 4LCDE 2BS3B 3BK1A 1XO3A 1RWSA 2NBUA 3V6CB 3WA0A 4KGRA 2XN9C 1VZ8A 3HM3A 3UQBA 1ZGUB 2PPHA 2K0PA 2BBCA 4IM3A 4MH8A 3RN9C 1P0RA 2KJHB 3AB5A 4GDLA 2L76A 3B2GA 1C3TA 4BBNC 4TKNA 2REXA 3QJZA 4Q2JA 1I4QA 2BKRB 4AS1A 1Z2MA 4HPPA 4KV2A 2V9HA 4XX5A 2MBHA 2ASQA 2FUHB 2YLMA 2KVZA 1P98A 2DAFA 3BVMA 3KUDB 5G5HA 4UDUC 1RAXA 1SE3A 3B08A 1SXTA 4CHKA 4A9AA 1I4HA 2FCQA 5LLIA 2I1KA 3GB1A 4LDTD 3DVNU 3PZDA 3OG5A 3T9LA 5EE9A 2KC1A 1TZ1A 4KKJA 3H7SA 4IWQA 4HPMB 2EMSA 2WQYB 2AL6A 2WDTB 2R2OA 1LFDA 5IAAC 1KF6B 2QSDA 2GI9A 3WANA 2CHZA 5C1ZA 4MGZE 4RNAA 1V1OA 4WWMA 3N30A 1MJDA 3N1ZC 4MM3A 4P6VF 3W2DA 1F2RI 1GC7A 3NVVA 4HPLB 4IG7B 4P1CC 1J0GA 4A6QA 2L1AA 1WE7A 1IGCA 3I3TB 1XCTL 1KLGD 2A5UA 3IT6B 2V1YA 2KDEB 3GS2A 3VQIA 2WXKA 3V62A 1V80A 4MACA 1JMLA 5D3DA 3UI3A 1X1MA 4NAWB 5L95C 1UWMA 1SEBD 3DVNV 4S17A 1E6EB 2RPVA 2LVOA 3ZJTA 3L54A 1EU4A 5D3IB 2FCSA 3AE9B 3C0RB 2I2YA 3RMKC 3Q8BA 4RH6A 1E90A 1I4PA 4FA6A 2H88B 3RNCC 3KUZA 2A4ZA 2DBYA 3AM9A 4ZYNA 4MJSB 4OVZA 4D2KA 2KNBA 1I4GA 1P1AA 3BY4B 4GXBA 1AN8A 3IFWB 2NBVB 3Q3JA 1WGDA 1P7EA 1QT9A 4ZHPA 1VJKA 2NR2A 2FIFA 3A33B 3D32A 3GE8C 2NCNA 1D5XC 4URKA 4GB9A 3JSVB 4RF0A 4BKGA 1YN3A 4LK0M 2OEDA 1WF9A 2KMCA 3MC0B 2Y5BB 4DBGA 3ZDMC 2KX3A 4CO7A 1ROEA 1L6UA 3O13A 1FRDA 3ZVVA 5AEKB 1PYWD 1WJUA 2CS4A 3OJ4B 4L23A 5BYQA 4W9LA 3Q8AA 3WALA 3L17A 2W3SA 1R4NB 2WX1A 2D3AA 3OJ3A 4MT5A 3DBSA 2G45B 2KWDA 3ZTCA 4EOYA 1N6ZA 1UWXA 1V49A 5BYRA 1SBBB 2LGDA 2G1EA 2DAJA 2JPHA 5FR6A 2EMTA 2KLGA 2V3SA 3FKYA 1IGDA 2ON8A 1WX7A 1R4NI 1F9JA 1HTOA 2C7HA 2KQSA 1OQYA 2WXLA 2D3GA 1JWMD 2ZW1A 2MBQA 1MPEA 2BS4B 1E7VA 2KZRA 4FBJB 3VAWA 5D2MB 3MP9A 2NVUI 1F0ZA 4LDTB 5JZEB 4GLSC 3L08A 1WXQA 4JWUC 3HIZA 4IW0A 5HKHA 4TUUA 1TKEA 2KJRA 1NI2A 3IHPC 4O1NA 2WDRB 3VDZA 3MHSD 3P4SB 4KSLC 2KWCA 2KD0A 3Q6BA 2ZW0A 4M0WB 2INPE 1P3QU 2MLBA 1I4RA 2V3NA 2LVPA 3P42A 3DOWA 3N1XC 1HZ5A 4RGNA 1UNSA 1F77A 1V6EA 5KHQA 5DPTA 4XGAB 3NS1A 3DBRB 1OEYA 4A3OA 1U4AA 1UGJA 1WR1A 2AQ1B 5CHFA 3PRZA 2CKHB 4HKQA 4RM8A 4IUMB 3RNGC 3PSEB 3ML9A 2EELA 1FD6A 3GP7A 2JZPA 2RPQA 3ZXVA 5C23A 1DOXA 2WXJA 1SSNA 1MG8A 3KLSX 2LRWA 2N7EA 5L83A 1C9FA 2K39A 2BQQA 1L7YA 2D5GA 3AE6B 3VRAB 2KN5A 4MGIE 2AQ3B 2KC2A 1WGYA 4LJOB 1JWUD 4FLHA 3TMPB 1C78A 3ZW3A 4F1SA 1WX9A 1IBXA 2L32A 3FAHA 2WHIA 4LJPB 3APDA 3ZYYX 1Z5SB 2DYOA 1E5WA 2D10A 5FR3A 4WIPA 4P1BC 1XCQL 2D3CA 5GMVA 3VRBB 3M63B 3PLVA 2MQJA 1N63A 2G4SA 3M95A 2JRHA 3ZTDA 4ZRJA 3AECB 4PS3A 1PGBA 1OQRA 1KLVA 5EE3A 2Y5CA 1VZ7A 2MBEA 3SD5A 1SE4A 1UZXB 4KIKB 4ZRQA 3EECA 1F1HA 1Q1OA 4LNIA 1KH0A 4OZAA 4N6EB 2GBJA 2FIDA 1FFVA 4J3OD 2HDEA 2KACA 4JX1C 2KMAA 2IYDB 1YOVB 2QEJC 2ZPYA 4KDIC 5IKCM 1FM0D 4CYEA 2INNE 4MSQB 1YIWA 2QJLA 4YTMB 3A9JB 3I63C 4XE0A 1Q0WB 4HCPB 3RCZA 1KTKA 2KFKA 3P4RB 2RDGA 3HRDD 4BFRA 1CJEA 2DZIA 3IG3A 4M8NA 5FKAC 1FNUA 4MGKE 2QIEB 2EKEC 3ZRFA 4C4VB 2KXJA 3OLMD 1JCKB 4RGTA 2O6VD 4A8XC 4XZ4A 3VXWA 1FFUA 3Q2AC 4W9JA 1RFAA 4MEMA 1SB3C 4HRSA 2JRIB 3PPAA 3B2FA 3Q14C 1AYFA 3IXSA 4GDKA 4W9HA 3H7PB 1TY0A 4BZAA 2MRPA 3Q3OC 1KM7A 3VR8B 3GZNB 4OW0A 3U7ZA 3NVWA 2PW9A 5JH5C 2KQ4X 1E10A 4ACFA 1WXSA 5DPRA 1ZDVA 1E8WA 4WWNA 2W9NA 2GLSA 3CSTA 4B95A 2RD0A 1J7BA 1OGWA 2JSVX 3APCA 3EA6A 4S0RA 2N9PC 1FXIA 2L7RA 1JWBD 3KWVA 5BMIA 2V4IB 3UIOB 2VZKD 2TSSA 1QILA 2ZNVB 4C56C 2E3TA 2L0FA 4BKSD 3P4PB 5GXGB 1UELA 3X0WA 5J2RA 4JL9A 1LXDA 2L0TA 2KFJA 3KVFB 3ZNGC 4ARCA 2MA9B 4W9IA 2KDIA 1RRBA 3VTVA 2KO3A 3AEDB 2IY0B 3AH7A 1MFWA 1EU3A 3TBLD 1V9JA 3ZO5B 2LWPA 2M4NA 3AEAB 4AOFA 1Q10A 2BS2B 5BMHA 3AE4B 2FE8A 2HE7A 1WGRA 2WX0A 1PQSA 2O2VB 3AI5A 1T6BX 4DHZB 3NZSA 1VD2A 1WIAA 5HHDG 3PGEA 2V0GA 1WR6E 4HDOA 2HD5B 2IGHA 2J7QB 1QOFA 2KVRA 2DNFA 2C5LC 3KYDD 1ZDXA 4NPNA 1YX5B 1ET9A 1N62A 2FBWB 1OQQA 4LLGM 4X57B 2LGYA 2OHFA 3W1SA 4DXAB 3O65B 2WLBA 1J7AA 1NYRA 1YNTE 5D6JB 3A9KB 2BT6A 4WJQA 1D5MC 2ZVNA 2GRIA 4P16A 2QDFA 3ZJVA 1RM6C 1JWSD 4R3DA 3RFZB 1ZKHA 4NJ6A 5G55A 1WSPA 1PFDA 2KWVB 4DXFA 2BTEA 3PS6A 2WNMA 2SAKA 3NVYA 1V81A 3BINA 3CMMB 1L4ZB 4K3CA 2HTHA 1C4AA 1UH6A 3R3MA 3AXCA 2PKOA 3UIPB 1HA5A 1YJ1A 4WH4A 1M94A 2PE6B 1E7PB 3QWZB 2KTRB 4NAWA 4YT0B 3U52E 3NRZA 1JRUA 3NZUA 5E6JA 3EHVA 2FCMA 2VRRB 2QILA 4IWOA 2O6VB 4E3CA 2W3RA 2JF5A 3AEGB 1UUPA 4G3XB 2GBKA 4ITKA 3AV8A 2MBBB 2CHXA 1KFYB 5I4DA 3MJ5A 1FMAD 3DPDA 3Q3FA 4DDGD 2LEKA 2MX2A 4MJSA 3H9DA 1GUAB 1OTRB 5G2NA 1ZW7A 3V3XA 4W9DA 3GE3C 3EC8A 1MHXA 3RPFC 4MELA 4PS8A 4L2YA 1TS3A 3TEWA 3VR9B 4RF1A 5BO4B 4WJNA 4WWOA 3HUIA 4KSKC 3JSVA 4IDIA 5IP4D 4OZBA 4HKZE 3AEEB 1WFYA 5E6PA 4AQ7A 3HVZA 4JE3B 2CU1A 2VZKB 1J19A 3P63A 2WXIA 4HXDA 2L00B 1N5WA 4YTNB 2W55A 4AUQC 3U7DA 1K53A 3TUOA 1N60A 2ZCCA 2GB1A 1TIFA 4HWIB 2M0AA 4HJGE 3AE3B 3PV1A 2KKCA 2MP2B 1JWAD 1HQRD 1KRHA 5HG2A 3H8HA 3AEFB 4ANUA 2Y3AA 1EF1A 2K3UA 3WAMA 5J18A 4B0MA 2BPSA 2MW5A 4YSZB 3R2TA 1NVID 1XLQA 1YQ4B 2XNAC 2FCNA 2WXOA 1BXTA 3TEZA 1UD7A 5D94A 4ASWC 4DWFA 3L4PA 3DWMA 1WH3A 2WXMA 3K9OB 1YN4A 1FO4A 2PJHA 1V5TA 3PT2B 3DCGA 1I35A 1WXVA 4ZYSA 3ZGZA 2BWES 2JZZA 1V86A 4W9FA 2XBBC 3URYA 3MTNB 5IOIA 1TKGA 3ABVB 5IN7A 4M0WA 2LUEA 4EFOA 2JXXA 2K9XA 2ZJDA 1XT9B 1T0QC 4BOSC 3OWEB 2Z0DB 1EF5A 4H2AA 4IM0A 2BW2A 1QF6A 4EZKA 3E9SA 3B9JA 1A70A 1AARA 1C1YB 2M19A 2R2QA 2HJ8A 2MJDA 2RDBC 2WU2B 4KKIA 4GU2A 1Y56A 2DENB 2MJEA 4WWPA 1QLBB 1WY8A 4B6WA 2LJIA 2NPTB 1WXAA 2WXNA 2DX5B 1E8YA 3RZFA 1RLFA 3BYYB 3H6NA 2AWTA 4HROA 5EDSA 4A20A 3HVDA 4C00A 4LNFA 4XDDA 2ZVOA 1XLPA 1P7FA 2GOWA 3ZNID 3DBLB 1CMXB 2ACZB 2MJ3A 3X23A 4II2B 1I4XA 2JUOA 3WAOA 3RNAC 1FIQA 1JQ4A 2YEPF 4TV3A 2KK8A 4C7ZA 1FNWA 1Q5WB 1FNVA 5DPWA 3FILB 3ZXRA 4BKTA 1QZEA 1UGMA 3DQVA 3Q3MC 1MG4A 1PGXA 4KIKA 3SHQA 4YL8A 3DVGY 4REZA 1T0RC 2KYWA 3M3JA 3WCQA 4EUTA 1YJJA 3NY5A 3DBRI 4YXDB 2J42A 3ECIA 1CQVA 1YQ3B 2IJ0A 1F2RC 2DLBA 1MI0A 1NYQA 1DOIA 2MWSB 2LGIA 2WWZA 2YEPB 2INCC 1C4PA 3NUHB 1ENFA 4JLCA 3W1SC 2DZKA 3NOBA 3RNEC 1WJNA 4BBNF 3TL5A 5LNK1 1T0SC 4DHZE 3AU4A 5CTRC 4YSXB 1IUEA 1XF5L 2BVCA 3A9JA 4US8A 4B0EA 2I38A 5AUKA 1IP9A 2MBOA 2L3ZA 4WAFA 2LGXA 3SDLC 1SIFA 2JWZA 3C19A 2N9KA 4ZRPA 2FAZA 3NVZA 2XEWA 4E71A 4C4VA 1WJ4A 1ACCA 3RT3B 4FN2A 1CK1A 5MPOA 2C7NB 1JRPA 4II3B 2Y5PA 1FEHA 1STEA 3ETRA 1V2YA 2L8JA 1WMHB 2RDHA 3A1QB 2PVOD 3V61A 2BYTA 2KQ7A 3VHTC 2KAJA 5HI1A 2IPKD 3U2SC 1SIJA 3VTUA 3SR6A 3AE7B 2X38A 2WXQA 2IGDA 3KWLA 3H7PA 4MH0E 1B9RA 4A3PA 3R66C 3VTWA 2HTME 1YX6B 3ALBA 2WXGA 1R7SA 2WXFA 3UINB 2LI5A 1JALA 4B9KA 5DCNA 2J0MA 5G5GA 4K81A 1L0YB 1D5ZC 2KDMA 3PREA 1VRAB 1G6JA 4KGSA 3LYYA 5EE0A 3S2AA 1KOTA 3B0AA 1D6EC 4P7IA 2N9XA 2BF8B 3PHXB 1WGKA 4I6PA 4LNNA 2IDYA 4NJ7A 3L16A 2LVQA 1E8XA 3E56A 1T5XD 3RNFC 4PT5A 3LDZE 3PZ7A 3W1YA 1AWDA 1S3SG 3DHIC 3KW5B 3R8BA 3NJTA 1H4RA 1VZ6A 2LGSA 3U8ZA 5T8IA 2JXTA 2XK5B 4KZ0A 1B1ZA 1IYFA 4IM2A 4ICVA 3ML8A 2N0SB 4ANVA 4RCOA 3W9CB 1R4MB 4K7WA 1TT5B 4XWTA 4K7SA 1UBIA 2J0JA 4WQOB 4GOCA 1E9MA 3AE8B 3BVGA 1ZUD2 2LFIA 3R2IA 1ESFA 3U4EG 2BB5A 2AX5A 2JQRB 3HHMA 1R4MI 2K6QA 2UU7A 3BVZA 3PVLA 2ZCBA 3PRPB 2K8HA 2O2VA 3I9V1 1NI3A 2AQ2B 4ANWA 1J8CA 3RULA 1DYQA 3LJ3A 1ZXIA 3IAS1 1JW9D 3GZNI 2LMCA 3MHZA 3JW0X 4KVGB 4TSSA 1V1PB 2N4FA 5JHAA 4TQ1A 5LXIB 2RSUA 5IA7A 3NS8A 3MJWA 4NJCA 2R61A 1WWTA 3Q8FA 1N5XA 1WX8A 1XLNA 3PZ8A 5CX3A 4IWPA 3CF6E 4WURA 3AMZA 3Q8EA 2JX5A 1ZOYB 5H92C 4HEA1 3A9KA 1YJIA 4GGQA 1GAQB 2I1JA 1WZ3A 2ZZPB 3T3NA 3FC4A 1FXAA 2PMVA 3PLUA 2M17A 4JQWC 1P9DU 4LNOA 1TKYA 3EGRA 1YQBA 2KTRA 4K3BA 5LXHA 1TYGB 2WDVB 5TR5A 3JVZX 4WJOA 2O6VA 4QAYA 4RMAA 4ZRIA 5AZHA 3W5UB 2EKIA 4WJPA 3SEBA 3QHTA 1LQBA 3AE1B 4EE2A 3QAQA 2LHDA 2N7DA 2H89B 4IKGA 3QA8A 4NY0A 4ANXA 4HLEA 2C9WB 1EM7A 3ZNZB 2K25A 1PUTA 2SEBD 4DDID 3Q69A 1OFFA 1HE8A 4DK5A 5AZFA 2G9HD 2V4LA 3V60A 2MCNB 2WXHA 2NS5A 1GJZA 4EKUA 3APFA 3BIID 4XC2A 2CJNA 2WDQB 2MH7A 3KUCB 4HJKA 1M4VA 3N20C 1TZOA
chains in the Genus database with same CATH topology
3UQAA 1E8ZA 1WE6A 1UD7A 4K7UA 2C7MB 5D94A 4ASWC 2N1VA 4DWFA 1MG8A 4EEWA 2M0XA 1WH3A 3K9OB 3VH3B 2KTFA 1EUVB 4I6NB 3AU5A 2PJHA 3PHWB 4BOZB 4GMVA 1ISNA 1V5TA 2LRWA 2N7EA 1YD8U 5L83A 3ZIMA 4FHJA 2CHWA 1UBQA 2K39A 4FJYA 3VUYA 1L7YA 4FJZA 4EZJA 3PT2B 3DCGA 3RZWC 1I35A 2KN5A 4MGIE 3ZDTA 1WXVA 2BWES 2KC2A 2JZZA 1V86A 4W9FA 2XBBC 5AZGA 3MTNB 4TQ0A 1WGYA 3QC8B 4LJOB 4BKSA 4FLHA 3TMPB 4ICUA 2D2QA 2AYOB 3V6EB 3VH4B 2C60A 2KFKB 2LUEA 1WX9A 4OVVA 2JXXA 3ZW3A 4G50A 4EFOA 4F1SA 1H8CA 3OAWA 2LXAA 2ZJDA 4LJPB 3APDA 3KYCD 1XT9B 1Z5SB 2DYOA 1E5WA 2MSED 2D10A 4BOSC 3ZRCA 2G4DB 2Z0DB 1A5RA 5GMVA 1EF5A 4DHJB 4G11A 3M63B 3PLVA 4IM0A 3RD2A 2MQJA 2G4SA 3M95A 2JRHA 2LRUA 2K8CA 2LJ5A 3QCAA 2MP2A 3SU8X 3ZTDA 3PTFC 4EZKA 4ZRJA 4PS3A 2KANA 1AARA 1C1YB 2KX0A 3RYTA 2R2QA 1KLVA 2HJ8A 2N9EB 2PE9A 3K9PB 3KH0A 2BWFA 2MBEA 4GU2A 2DENB 3SD5A 1UZXB 4J6IA 4KIKB 3EECA 4WWPA 1Q1OA 1WY8A 1WM3A 4B6WA 5KHOA 2NPTB 4PS7A 5D7GA 2LZ6A 4BVUC 2GBJA 1WZ0A 1WXAA 4G0NB 1WGGA 4WAAA 4JIOU 3L0WB 4JGHB 2DX5B 3PRMB 4GDKB 2FIDA 3IVFA 4HCNB 1E8YA 3RZFA 5JHBA 2IZVB 1RLFA 3H6NA 2AWTA 4GDLB 2K8BA 4E74A 3B1LX 4AJWA 4A20A 5EDSA 2KJ6A 2KMAA 2OOBB 3T8MA 2IYDB 2BYVE 2GMIC 2ZPYA 4KDIC 2ZVOA 4CYEA 2GBNA 2GOWA 3JYUA 2DYBA 3ZNID 4F7ZA 4MSQB 4RM9A 1YIWA 1GG3A 4FJVB 2J0KA 2M1MA 3A9JB 1CMXB 1Q0WB 3X23A 1WI0A 4HCPB 3RCZA 2KFKA 2FNJB 4II2B 3AULA 5E6OA 1E7UA 2M8SA 2G3QB 2JUOA 3WAOA 4BFRA 1NBFC 2DZIA 1SE9A 3IG3A 3N32A 4M8NA 1WXMA 4TV3A 1LM8B 2KK8A 4MGKE 3U30A 2EKEC 3ZRFA 2DZMA 1Q5WB 3QQ8B 4PYZA 5DPWA 2KXJA 3OLMD 4LCDE 1GC6A 2BYFA 4BKTA 4EZLA 4GIVA 4KDLB 1QZEA 1UGMA 3DQVA 3P2BA 2O6VD 4XZ4A 2NBUA 3V6CB 3WA0A 3VXWA 1OEYJ 4W9JA 1RFAA 4KIKA 5J17A 3N3KB 2ZEQA 3HM3A 4MEMA 3SHQA 3UQBA 4YL8A 2JRIB 3DVGY 2NPTA 1ZGUB 3PPAA 4W9GA 2PPHA 2K1FA 3H1UA 3M3JA 4IM3A 4EUTA 1S1QB 3NY5A 1P0RA 4GDKA 3DBRI 3CSFA 3ECIA 3L13A 2PEAA 2KJHB 4NNJB 4W9HA 3H7PB 3QARA 2ZNVC 3QIJA 2L76A 4GDLA 4MGYE 2KLCA 2MWSB 1C3TA 2WWZA 2MRPA 2IBIB 4BBNC 4TKNA 2REXA 3QJZA 4GN1A 4JLCA 3W1SC 1KM7A 2DZKA 3NOBA 2BKRB 1WJNA 1Z2MA 4BBNF 3TL5A 4KV2A 4XX5A 2MBHA 4KZCA 3TJPA 2ASQA 5JH5C 2FUHB 2KDBA 2YLMA 4K1RB 3VVWB 4DHZE 1P98A 1WXSA 2DAFA 3AU4A 5CTRC 3KUDB 5DPRA 3ZKJC 2GBMA 1E8WA 3EFUA 4MSMB 1RAXA 4WWNA 3A9JA 2W9NA 2D11A 3B08A 4CHKA 2LXCA 2FCQA 5LLIA 2I1KA 2YVCA 3CSTA 3GOEA 4B95A 4LDTD 3L10B 2RD0A 3DVNU 3PZDA 2MBOA 1IP9A 2L05A 2L3ZA 3T9LA 2LGXA 2KC1A 1OGWA 2UWQA 3SDLC 3APCA 1SIFA 1TZ1A 2JWZA 1I42A 2N9PC 2FAZA 1D3ZA 2L7RA 2XEWA 3DVGX 3QK0A 4E71A 3H7SA 4IWQA 4HPMB 2EMSA 1WJ4A 3UIOB 3RT3B 2AL6A 4FN2A 2WDTB 2C7NB 2ZNVB 4II3B 1NDDA 2R2OA 1LFDA 5IAAC 1V2YA 1TTNA 2L0FA 2WYQA 4BKSD 3WANA 4M8MA 2L8JA 1UELA 1WMHB 3A1QB 4JL9A 1LXDA 3V61A 2CHZA 2KQ7A 3X0WA 2L0TA 2DHZA 1WGHA 2KFJA 3VHTC 5C1ZA 3KVFB 4MGZE 3ZNGC 3N30A 3VTUA 2MA9B 4W9IA 2KDIA 1RRBA 3VTVA 2KO3A 2KOXA 2KDFB 4MM3A 1GC7A 4FULA 4HPLB 4IG7B 4IC7B 3H7PA 3WIMA 1J0GA 2IY0B 3NHEB 4MH0E 4W9CA 4AP4C 4A3PA 1WE7A 3R66C 1V9JA 3TBLD 3VTWA 3ZO5B 2LWPA 1YX6B 3ALBA 2LASA 3I3TB 3UGBB 2M4NA 2GBRA 3UINB 4AOFA 2A5UA 2LI5A 4ZRKA 4B9KA 5DCNA 2J0MA 5DPSA 4K81A 2HE7A 1WGRA 2IO0B 2V1YA 2KDEB 2WX0A 1PQSA 3VQIA 3PREA 2O2VB 1V80A 3V62A 4ZDVA 3VFKA 1G6JA 3AI5A 1WRDB 3A4RA 3S2AA 1KOTA 3B0AA 2BKFA 2LD9A 4P7IA 2JZ3B 2N9XA 2BF8B 1X1MA 3PHXB 4GSWA 4I6PA 4DHZB 4NAWB 3NZSA 5L95C 3ZUNA 1VD2A 1WIAA 4NJ7A 3DVNV 3VUXA 4NQKE 3PGEA 3L16A 2LVQA 1E8XA 1WR6E 3DBLI 4HDOA 2HD5B 3LDZE 4I6LB 3W1YA 2LVOA 2J7QB 2OJRA 1S3SG 4AWJA 2KVRA 3KW5B 2C5LC 3KYDD 3L54A 4N9F4 2FCSA 1XD3B 1YX5B 3C0RB 4NPNA 1H4RA 4HVBA 3U8ZA 1E90A 4FA6A 2XK5B 4X57B 4KZ0A 2LGYA 3W1SA 1WMHA 3A1QA 4DXAB 1IYFA 3KUZA 4IM2A 4ICVA 3ML8A 2A4ZA 3A4SC 3O65B 4ZYNA 4ANVA 4MJSB 4K7WA 5D6JB 2KHWB 2KNBA 3A9KB 4DHJD 4WJQA 4K7SA 1UBIA 2J0JA 2ZVNA 1P1AA 4FADA 3BY4B 4WQOB 3R7RA 4GOCA 1ZKHA 5E6NA 3DBHI 4GXBA 4NJ6A 5G55A 2IO1B 2ZPNA 2DZJA 3IFWB 2KWVB 2NBVB 3Q3JA 1SGHA 3PS6A 1WGDA 2CR5A 3HHMA 1V81A 1WJ6A 3R7QA 1R4MI 2NR2A 2K6QA 3BINA 2FIFA 3A33B 1Y8RC 3CMMB 3D32A 3PVLA 4FHKA 2HTHA 2ZCBA 2NCNA 3PRPB 1UH6A 2K8HA 2O2VA 3JSVB 3R3MA 4GB9A 3AXCA 4BKGA 3UIPB 1YJ1A 3IBEA 2BYEA 1M94A 4HK2A 1WYWB 4ANWA 2PE6B 4W9EA 1J8CA 3QWZB 3RULA 2KTRB 1WF9A 3LJ3A 4NAWA 2KMCA 4NQLB 3NZUA 1JRUA 2Y5BB 3EHVA 1BT0A 4DBGA 3GZNI 1TGZB 2B3AA 2FCMA 2VRRB 3ZDMC 2KX3A 4IWOA 2O6VB 3M62B 3JW0X 4CO7A 2IY1B 2IO2B 4KVGB 4E3CA 3ZVVA 5AEKB 2JF5A 2CS4A 1WJUA 2N4FA 3OJ4B 2RSUA 4TQ1A 1K8RB 5JHAA 5LXIB 4G3XB 4W9LA 2RGFA 3NS8A 5IA7A 2GBKA 3WALA 3L17A 3MJWA 2UYZB 2MBBB 2XK5A 2CHXA 4F8CB 1WX8A 2WX1A 5CX3A 1EO6A 4IWPA 3OJ3A 4OVUA 3DBSA 3CF6E 2G45B 3DPDA 3ZTCA 4EOYA 3Q3FA 4DDGD 2MX2A 4HDQA 4MJSA 1WM2A 1V49A 4W9KA 3TCAA 2AL3A 1GUAB 3H9DA 2LGDA 1OTRB 3A9KA 2DAJA 2JPHA 5FR6A 4GGQA 5G2NA 1T0YA 2EMTA 2I1JA 2KLGA 2V3SA 1WZ3A 2ZZPB 1ZW7A 1VCBA 2DYMA 2JVCA 4W9DA 1WX7A 1R4NI 1F9JA 1L2NA 3EC8A 2AEHA 2C7HA 2KQSA 1OQYA 3UF8A 2D3GA 4MELA 3WAPA 4PS8A 2MBQA 3HM6X 3PLUA 2M17A 2KZRA 1E7VA 4FBJB 4JQWC 5D2MB 3VAWA 5BO4B 1P9DU 2NVUI 4LDTB 4WJNA 2IO3B 4WWOA 1GNUA 1V5OA 2QHOA 4MDKE 5JZEB 1KJTA 4KSKC 3JSVA 3L08A 3HIZA 4IW0A 5HKHA 4TUUA 1WFYA 2KJRA 5E6PA 1YQBA 1NI2A 3IHPC 4PYUA 2KTRA 1TBEA 5LXHA 3VDZA 2NBWB 5TR5A 3MHSD 2CU1A 2JY6A 3JVZX 4KSLC 3ONSA 1J19A 4WJOA 2O6VA 2KWCA 4URKA 2KD0A 4RMAA 4ZRIA 5AZHA 4HXDA 4WJPA 2Z59B 2L00B 3QHTA 1LQBA 2RR9A 4M0WB 1FXTB 2N7DA 3ENEA 3QAQA 1P3QU 2MLBA 3HK0A 3QA8A 4NY0A 3TIXA 4AUQC 4ANXA 2C9WB 3U7DA 3DDCB 4HLEA 2LVPA 2BGFA 3RUIB 3ZNZB 3ZNHB 2K25A 2K6DB 2Z0EB 4DDID 3DOWA 2ZCCA 2D07B 4HWIB 1HE8A 4DK5A 1V6EA 3PV1A 5KHQA 5J2RA 2KKCA 2MP2B 5DPTA 5AZFA 5CHVC 4AJYB 1XQQA 2N1WA 2V4LA 3ZLZA 1OEYA 3V60A 4A3OA 4ANUA 2MCNB 2NS5A 1U4AA 1WR1A 1GJZA 1EF1A 3WAMA 4EKUA 5CHFA 3PRZA 3APFA 5J18A 2CKHB 4XC2A 3QX1A 4RM8A 4IUMB 2BPSA 2MW5A 3PSEB 2JT4B 3ML9A 3KUCB 4HJKA 3VUWA 1IPGA 2KWUB 2FCNA 2RPQA 5CHWA 5C23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQA A;  1E8Z A;  1WE6 A;  1UD7 A;  4K7U A;  2C7M B;  5D94 A;  4ASW C;  2N1V A;  4DWF A;  1MG8 A;  4EEW A;  2M0X A;  1WH3 A;  3K9O B;  3VH3 B;  2KTF A;  1EUV B;  4I6N B;  3AU5 A;  2PJH A;  3PHW B;  4BOZ B;  4GMV A;  1ISN A;  1V5T A;  2LRW A;  2N7E A;  1YD8 U;  5L83 A;  3ZIM A;  4FHJ A;  2CHW A;  1UBQ A;  2K39 A;  4FJY A;  3VUY A;  1L7Y A;  4FJZ A;  4EZJ A;  3PT2 B;  3DCG A;  3RZW C;  1I35 A;  2KN5 A;  4MGI E;  3ZDT A;  1WXV A;  2BWE S;  2KC2 A;  2JZZ A;  1V86 A;  4W9F A;  2XBB C;  5AZG A;  3MTN B;  4TQ0 A;  1WGY A;  3QC8 B;  4LJO B;  4BKS A;  4FLH A;  3TMP B;  4ICU A;  2D2Q A;  2AYO B;  3V6E B;  3VH4 B;  2C60 A;  2KFK B;  2LUE A;  1WX9 A;  4OVV A;  2JXX A;  3ZW3 A;  4G50 A;  4EFO A;  4F1S A;  1H8C A;  3OAW A;  2LXA A;  2ZJD A;  4LJP B;  3APD A;  3KYC D;  1XT9 B;  1Z5S B;  2DYO A;  1E5W A;  2MSE D;  2D10 A;  4BOS C;  3ZRC A;  2G4D B;  2Z0D B;  1A5R A;  5GMV A;  1EF5 A;  4DHJ B;  4G11 A;  3M63 B;  3PLV A;  4IM0 A;  3RD2 A;  2MQJ A;  2G4S A;  3M95 A;  2JRH A;  2LRU A;  2K8C A;  2LJ5 A;  3QCA A;  2MP2 A;  3SU8 X;  3ZTD A;  3PTF C;  4EZK A;  4ZRJ A;  4PS3 A;  2KAN A;  1AAR A;  1C1Y B;  2KX0 A;  3RYT A;  2R2Q A;  1KLV A;  2HJ8 A;  2N9E B;  2PE9 A;  3K9P B;  3KH0 A;  2BWF A;  2MBE A;  4GU2 A;  2DEN B;  3SD5 A;  1UZX B;  4J6I A;  4KIK B;  3EEC A;  4WWP A;  1Q1O A;  1WY8 A;  1WM3 A;  4B6W A;  5KHO A;  2NPT B;  4PS7 A;  5D7G A;  2LZ6 A;  4BVU C;  2GBJ A;  1WZ0 A;  1WXA A;  4G0N B;  1WGG A;  4WAA A;  4JIO U;  3L0W B;  4JGH B;  2DX5 B;  3PRM B;  4GDK B;  2FID A;  3IVF A;  4HCN B;  1E8Y A;  3RZF A;  5JHB A;  2IZV B;  1RLF A;  3H6N A;  2AWT A;  4GDL B;  2K8B A;  4E74 A;  3B1L X;  4AJW A;  4A20 A;  5EDS A;  2KJ6 A;  2KMA A;  2OOB B;  3T8M A;  2IYD B;  2BYV E;  2GMI C;  2ZPY A;  4KDI C;  2ZVO A;  4CYE A;  2GBN A;  2GOW A;  3JYU A;  2DYB A;  3ZNI D;  4F7Z A;  4MSQ B;  4RM9 A;  1YIW A;  1GG3 A;  4FJV B;  2J0K A;  2M1M A;  3A9J B;  1CMX B;  1Q0W B;  3X23 A;  1WI0 A;  4HCP B;  3RCZ A;  2KFK A;  2FNJ B;  4II2 B;  3AUL A;  5E6O A;  1E7U A;  2M8S A;  2G3Q B;  2JUO A;  3WAO A;  4BFR A;  1NBF C;  2DZI A;  1SE9 A;  3IG3 A;  3N32 A;  4M8N A;  1WXM A;  4TV3 A;  1LM8 B;  2KK8 A;  4MGK E;  3U30 A;  2EKE C;  3ZRF A;  2DZM A;  1Q5W B;  3QQ8 B;  4PYZ A;  5DPW A;  2KXJ A;  3OLM D;  4LCD E;  1GC6 A;  2BYF A;  4BKT A;  4EZL A;  4GIV A;  4KDL B;  1QZE A;  1UGM A;  3DQV A;  3P2B A;  2O6V D;  4XZ4 A;  2NBU A;  3V6C B;  3WA0 A;  3VXW A;  1OEY J;  4W9J A;  1RFA A;  4KIK A;  5J17 A;  3N3K B;  2ZEQ A;  3HM3 A;  4MEM A;  3SHQ A;  3UQB A;  4YL8 A;  2JRI B;  3DVG Y;  2NPT A;  1ZGU B;  3PPA A;  4W9G A;  2PPH A;  2K1F A;  3H1U A;  3M3J A;  4IM3 A;  4EUT A;  1S1Q B;  3NY5 A;  1P0R A;  4GDK A;  3DBR I;  3CSF A;  3ECI A;  3L13 A;  2PEA A;  2KJH B;  4NNJ B;  4W9H A;  3H7P B;  3QAR A;  2ZNV C;  3QIJ A;  2L76 A;  4GDL A;  4MGY E;  2KLC A;  2MWS B;  1C3T A;  2WWZ A;  2MRP A;  2IBI B;  4BBN C;  4TKN A;  2REX A;  3QJZ A;  4GN1 A;  4JLC A;  3W1S C;  1KM7 A;  2DZK A;  3NOB A;  2BKR B;  1WJN A;  1Z2M A;  4BBN F;  3TL5 A;  4KV2 A;  4XX5 A;  2MBH A;  4KZC A;  3TJP A;  2ASQ A;  5JH5 C;  2FUH B;  2KDB A;  2YLM A;  4K1R B;  3VVW B;  4DHZ E;  1P98 A;  1WXS A;  2DAF A;  3AU4 A;  5CTR C;  3KUD B;  5DPR A;  3ZKJ C;  2GBM A;  1E8W A;  3EFU A;  4MSM B;  1RAX A;  4WWN A;  3A9J A;  2W9N A;  2D11 A;  3B08 A;  4CHK A;  2LXC A;  2FCQ A;  5LLI A;  2I1K A;  2YVC A;  3CST A;  3GOE A;  4B95 A;  4LDT D;  3L10 B;  2RD0 A;  3DVN U;  3PZD A;  2MBO A;  1IP9 A;  2L05 A;  2L3Z A;  3T9L A;  2LGX A;  2KC1 A;  1OGW A;  2UWQ A;  3SDL C;  3APC A;  1SIF A;  1TZ1 A;  2JWZ A;  1I42 A;  2N9P C;  2FAZ A;  1D3Z A;  2L7R A;  2XEW A;  3DVG X;  3QK0 A;  4E71 A;  3H7S A;  4IWQ A;  4HPM B;  2EMS A;  1WJ4 A;  3UIO B;  3RT3 B;  2AL6 A;  4FN2 A;  2WDT B;  2C7N B;  2ZNV B;  4II3 B;  1NDD A;  2R2O A;  1LFD A;  5IAA C;  1V2Y A;  1TTN A;  2L0F A;  2WYQ A;  4BKS D;  3WAN A;  4M8M A;  2L8J A;  1UEL A;  1WMH B;  3A1Q B;  4JL9 A;  1LXD A;  3V61 A;  2CHZ A;  2KQ7 A;  3X0W A;  2L0T A;  2DHZ A;  1WGH A;  2KFJ A;  3VHT C;  5C1Z A;  3KVF B;  4MGZ E;  3ZNG C;  3N30 A;  3VTU A;  2MA9 B;  4W9I A;  2KDI A;  1RRB A;  3VTV A;  2KO3 A;  2KOX A;  2KDF B;  4MM3 A;  1GC7 A;  4FUL A;  4HPL B;  4IG7 B;  4IC7 B;  3H7P A;  3WIM A;  1J0G A;  2IY0 B;  3NHE B;  4MH0 E;  4W9C A;  4AP4 C;  4A3P A;  1WE7 A;  3R66 C;  1V9J A;  3TBL D;  3VTW A;  3ZO5 B;  2LWP A;  1YX6 B;  3ALB A;  2LAS A;  3I3T B;  3UGB B;  2M4N A;  2GBR A;  3UIN B;  4AOF A;  2A5U A;  2LI5 A;  4ZRK A;  4B9K A;  5DCN A;  2J0M A;  5DPS A;  4K81 A;  2HE7 A;  1WGR A;  2IO0 B;  2V1Y A;  2KDE B;  2WX0 A;  1PQS A;  3VQI A;  3PRE A;  2O2V B;  1V80 A;  3V62 A;  4ZDV A;  3VFK A;  1G6J A;  3AI5 A;  1WRD B;  3A4R A;  3S2A A;  1KOT A;  3B0A A;  2BKF A;  2LD9 A;  4P7I A;  2JZ3 B;  2N9X A;  2BF8 B;  1X1M A;  3PHX B;  4GSW A;  4I6P A;  4DHZ B;  4NAW B;  3NZS A;  5L95 C;  3ZUN A;  1VD2 A;  1WIA A;  4NJ7 A;  3DVN V;  3VUX A;  4NQK E;  3PGE A;  3L16 A;  2LVQ A;  1E8X A;  1WR6 E;  3DBL I;  4HDO A;  2HD5 B;  3LDZ E;  4I6L B;  3W1Y A;  2LVO A;  2J7Q B;  2OJR A;  1S3S G;  4AWJ A;  2KVR A;  3KW5 B;  2C5L C;  3KYD D;  3L54 A;  4N9F 4;  2FCS A;  1XD3 B;  1YX5 B;  3C0R B;  4NPN A;  1H4R A;  4HVB A;  3U8Z A;  1E90 A;  4FA6 A;  2XK5 B;  4X57 B;  4KZ0 A;  2LGY A;  3W1S A;  1WMH A;  3A1Q A;  4DXA B;  1IYF A;  3KUZ A;  4IM2 A;  4ICV A;  3ML8 A;  2A4Z A;  3A4S C;  3O65 B;  4ZYN A;  4ANV A;  4MJS B;  4K7W A;  5D6J B;  2KHW B;  2KNB A;  3A9K B;  4DHJ D;  4WJQ A;  4K7S A;  1UBI A;  2J0J A;  2ZVN A;  1P1A A;  4FAD A;  3BY4 B;  4WQO B;  3R7R A;  4GOC A;  1ZKH A;  5E6N A;  3DBH I;  4GXB A;  4NJ6 A;  5G55 A;  2IO1 B;  2ZPN A;  2DZJ A;  3IFW B;  2KWV B;  2NBV B;  3Q3J A;  1SGH A;  3PS6 A;  1WGD A;  2CR5 A;  3HHM A;  1V81 A;  1WJ6 A;  3R7Q A;  1R4M I;  2NR2 A;  2K6Q A;  3BIN A;  2FIF A;  3A33 B;  1Y8R C;  3CMM B;  3D32 A;  3PVL A;  4FHK A;  2HTH A;  2ZCB A;  2NCN A;  3PRP B;  1UH6 A;  2K8H A;  2O2V A;  3JSV B;  3R3M A;  4GB9 A;  3AXC A;  4BKG A;  3UIP B;  1YJ1 A;  3IBE A;  2BYE A;  1M94 A;  4HK2 A;  1WYW B;  4ANW A;  2PE6 B;  4W9E A;  1J8C A;  3QWZ B;  3RUL A;  2KTR B;  1WF9 A;  3LJ3 A;  4NAW A;  2KMC A;  4NQL B;  3NZU A;  1JRU A;  2Y5B B;  3EHV A;  1BT0 A;  4DBG A;  3GZN I;  1TGZ B;  2B3A A;  2FCM A;  2VRR B;  3ZDM C;  2KX3 A;  4IWO A;  2O6V B;  3M62 B;  3JW0 X;  4CO7 A;  2IY1 B;  2IO2 B;  4KVG B;  4E3C A;  3ZVV A;  5AEK B;  2JF5 A;  2CS4 A;  1WJU A;  2N4F A;  3OJ4 B;  2RSU A;  4TQ1 A;  1K8R B;  5JHA A;  5LXI B;  4G3X B;  4W9L A;  2RGF A;  3NS8 A;  5IA7 A;  2GBK A;  3WAL A;  3L17 A;  3MJW A;  2UYZ B;  2MBB B;  2XK5 A;  2CHX A;  4F8C B;  1WX8 A;  2WX1 A;  5CX3 A;  1EO6 A;  4IWP A;  3OJ3 A;  4OVU A;  3DBS A;  3CF6 E;  2G45 B;  3DPD A;  3ZTC A;  4EOY A;  3Q3F A;  4DDG D;  2MX2 A;  4HDQ A;  4MJS A;  1WM2 A;  1V49 A;  4W9K A;  3TCA A;  2AL3 A;  1GUA B;  3H9D A;  2LGD A;  1OTR B;  3A9K A;  2DAJ A;  2JPH A;  5FR6 A;  4GGQ A;  5G2N A;  1T0Y A;  2EMT A;  2I1J A;  2KLG A;  2V3S A;  1WZ3 A;  2ZZP B;  1ZW7 A;  1VCB A;  2DYM A;  2JVC A;  4W9D A;  1WX7 A;  1R4N I;  1F9J A;  1L2N A;  3EC8 A;  2AEH A;  2C7H A;  2KQS A;  1OQY A;  3UF8 A;  2D3G A;  4MEL A;  3WAP A;  4PS8 A;  2MBQ A;  3HM6 X;  3PLU A;  2M17 A;  2KZR A;  1E7V A;  4FBJ B;  4JQW C;  5D2M B;  3VAW A;  5BO4 B;  1P9D U;  2NVU I;  4LDT B;  4WJN A;  2IO3 B;  4WWO A;  1GNU A;  1V5O A;  2QHO A;  4MDK E;  5JZE B;  1KJT A;  4KSK C;  3JSV A;  3L08 A;  3HIZ A;  4IW0 A;  5HKH A;  4TUU A;  1WFY A;  2KJR A;  5E6P A;  1YQB A;  1NI2 A;  3IHP C;  4PYU A;  2KTR A;  1TBE A;  5LXH A;  3VDZ A;  2NBW B;  5TR5 A;  3MHS D;  2CU1 A;  2JY6 A;  3JVZ X;  4KSL C;  3ONS A;  1J19 A;  4WJO A;  2O6V A;  2KWC A;  4URK A;  2KD0 A;  4RMA A;  4ZRI A;  5AZH A;  4HXD A;  4WJP A;  2Z59 B;  2L00 B;  3QHT A;  1LQB A;  2RR9 A;  4M0W B;  1FXT B;  2N7D A;  3ENE A;  3QAQ A;  1P3Q U;  2MLB A;  3HK0 A;  3QA8 A;  4NY0 A;  3TIX A;  4AUQ C;  4ANX A;  2C9W B;  3U7D A;  3DDC B;  4HLE A;  2LVP A;  2BGF A;  3RUI B;  3ZNZ B;  3ZNH B;  2K25 A;  2K6D B;  2Z0E B;  4DDI D;  3DOW A;  2ZCC A;  2D07 B;  4HWI B;  1HE8 A;  4DK5 A;  1V6E A;  3PV1 A;  5KHQ A;  5J2R A;  2KKC A;  2MP2 B;  5DPT A;  5AZF A;  5CHV C;  4AJY B;  1XQQ A;  2N1W A;  2V4L A;  3ZLZ A;  1OEY A;  3V60 A;  4A3O A;  4ANU A;  2MCN B;  2NS5 A;  1U4A A;  1WR1 A;  1GJZ A;  1EF1 A;  3WAM A;  4EKU A;  5CHF A;  3PRZ A;  3APF A;  5J18 A;  2CKH B;  4XC2 A;  3QX1 A;  4RM8 A;  4IUM B;  2BPS A;  2MW5 A;  3PSE B;  2JT4 B;  3ML9 A;  3KUC B;  4HJK A;  3VUW A;  1IPG A;  2KWU B;  2FCN A;  2RPQ A;  5CHW A;  5C23 A; 
#chains in the Genus database with same CATH topology
 3UQA A;  4JPS A;  1E8Z A;  2C7M B;  2K5P A;  2N1V A;  2W54 A;  4EEW A;  1NEN B;  2M0X A;  3VH3 B;  2KTF A;  3AU5 A;  2NTT A;  2DWQ A;  1YD8 U;  4FHJ A;  2CHW A;  1UBQ A;  5BYS A;  1BUI C;  3T3O A;  3VUY A;  4EZJ A;  3RZW C;  3Q8C A;  1ZP0 B;  1N61 A;  4BKS A;  4ICU A;  2D2Q A;  2AYO B;  3J9C A;  4ARI A;  2C60 A;  2WXR A;  1HXY D;  1H8C A;  3OAW A;  2LXA A;  4WQM A;  2MSE D;  3ZRC A;  4LNK A;  1A5R A;  3MFG A;  3QCA A;  4M00 A;  2MP2 A;  2KAN A;  3RYT A;  2KX0 A;  3ZJU A;  3K9P B;  3KH0 A;  1MHH E;  2KMM A;  5BMG A;  5D7G A;  2LZ6 A;  2PTL A;  4BVU C;  1C79 A;  2K22 A;  1WGG A;  4JIO U;  3L0W B;  1AW7 A;  3DHH C;  3IVF A;  5JHB A;  2IZV B;  4GDL B;  2K8B A;  3B1L X;  4AJW A;  4XWW A;  3T8M A;  2WP9 B;  4YSY B;  1NEK B;  1K50 A;  2GBN A;  3JYU A;  4F7Z A;  1GG3 A;  2J0K A;  2PLP A;  4KGT A;  1WI0 A;  4C7Y A;  3AE2 B;  2FNJ B;  3AUL A;  5E6O A;  1E7U A;  2G3Q B;  1NBF C;  1QOG A;  1L0X B;  3N32 A;  2CJO A;  2QCZ A;  1QOA A;  1LM8 B;  1XXG A;  1SJH D;  3LXF A;  1UF0 A;  1DOY A;  4PYZ A;  3C8Y A;  4C80 A;  1GC6 A;  4OZC A;  2BYF A;  4EZL A;  2VH1 A;  2IGG A;  4GIV A;  4KDL B;  3P2B A;  3RNB C;  1OEY J;  5J17 A;  3N3K B;  2ZEQ A;  4NZL B;  2NPT A;  4W9G A;  2K1F A;  3H1U A;  2N7J A;  1S1Q B;  3RI7 C;  4MM3 B;  3CSF A;  3L13 A;  3TEX A;  2PEA A;  1GB1 A;  4NNJ B;  3BYT B;  3QAR A;  2ZNV C;  3QIJ A;  4MGY E;  2KLC A;  2IBI B;  1SE2 A;  4GN1 A;  4USA A;  1FRR A;  4NAM A;  5AUI A;  4KZC A;  3TJP A;  2KDB A;  3VVW B;  4K1R B;  2WXP A;  1QOB A;  3ZKJ C;  2GBM A;  3EFU A;  4MSM B;  4N58 A;  2D11 A;  2LXC A;  2Q5W D;  2YVC A;  3GOE A;  3L10 B;  3TEY A;  1PGA A;  3EFC A;  2L05 A;  2KT7 A;  4KX6 B;  2UWQ A;  1I42 A;  1L4D B;  1D3Z A;  2FUG 1;  3DVG X;  3QK0 A;  1RFK A;  3FIL A;  2IND C;  1NDD A;  1TTN A;  2WYQ A;  4M8M A;  1XLO A;  1D4B A;  2DHZ A;  1WGH A;  1C77 A;  4IOI E;  1XEE A;  3P1M A;  4FXC A;  2KOX A;  2KDF B;  4FUL A;  4US9 A;  1RYJ A;  3WIM A;  3N9Y C;  4IC7 B;  3NHE B;  4W9C A;  4AP4 C;  1GB4 A;  1VLB A;  2LAS A;  3UGB B;  2GBR A;  4XDC A;  4ZRK A;  2WS3 B;  1SJE D;  1JRO A;  1MVK A;  5DPS A;  2RMM A;  2IO0 B;  3NG0 A;  4ZDV A;  3VFK A;  1HEZ E;  1WRD B;  2D3B A;  3A4R A;  2ICI A;  2JWU A;  3IAM 1;  4JWS C;  2BKF A;  2LD9 A;  2JZ3 B;  4GSW A;  3Q3N C;  3ZUN A;  3VUX A;  2HJ1 A;  4NQK E;  5EE1 A;  3DBL I;  4I6L B;  1T3Q A;  1WRI A;  2OJR A;  2NTS A;  4AWJ A;  4N9F 4;  2PIA A;  1XD3 B;  3N1Y C;  4HVB A;  3TSS A;  1YN5 A;  2NMQ A;  4RGO S;  3SFD B;  1QKZ A;  2QMT A;  1WMH A;  3A1Q A;  3DBH B;  3SFE B;  1L5P A;  1YMH E;  3A4S C;  2N9L A;  1CZP A;  2B76 B;  2KHW B;  4DHJ D;  1HZ6 A;  2E6X A;  2OJW A;  4FAD A;  3R7R A;  2KN4 A;  4TMA B;  5E6N A;  3DBH I;  3I57 A;  2IO1 B;  2ZPN A;  1C76 A;  1V8C A;  2DZJ A;  4PK1 A;  1SGH A;  2CR5 A;  1WJ6 A;  3R7Q A;  1FPY A;  1GOZ A;  4YWG G;  1Y8R C;  4FHK A;  3DHG C;  1TY2 A;  1HTQ A;  5HFY A;  3IBE A;  2BYE A;  3BWU D;  4HK2 A;  1WYW B;  4W9E A;  1EWC A;  3NZ3 A;  2L52 A;  4NQL B;  5C2T B;  1SF0 A;  1BT0 A;  1TGZ B;  2B3A A;  3M62 B;  5TSS A;  3AE5 B;  2IY1 B;  1TS2 A;  1LO5 D;  2IO2 B;  3CWI A;  5JXV A;  2J52 A;  1K8R B;  4M02 A;  1FCL A;  4N59 A;  2RGF A;  1ZXH A;  2W82 A;  3P4Q B;  2UYZ B;  2XK5 A;  4F8C B;  1J7C A;  4XYC A;  1ZE3 D;  1EO6 A;  4OVU A;  4HDQ A;  1WM2 A;  2X8X X;  4W9K A;  3TCA A;  2AL3 A;  3I5J C;  3CIR B;  1T0Y A;  2JU6 X;  2DYM A;  1VCB A;  2JVC A;  1I7H A;  3IT4 B;  1ET6 A;  1L2N A;  2AEH A;  5IO9 A;  3UF8 A;  3WAP A;  3HM6 X;  4OHJ A;  4LTU A;  2QC8 A;  2IO3 B;  1GNU A;  1V5O A;  3V05 A;  2QHO A;  4MDK E;  1KJT A;  1TJE A;  1TS5 A;  1E0Z A;  4PYU A;  1TBE A;  3DWG C;  1TS4 A;  2NBW B;  2JY6 A;  3ONS A;  4RGM A;  4ZHO A;  4CQN A;  2Z59 B;  2RR9 A;  1FXT B;  1V1P A;  3ENE A;  3TIX A;  3HK0 A;  1IBX B;  3DDC B;  1FCC C;  3MC9 A;  1L0V B;  2BGF A;  2MEK A;  3RUI B;  3ZNH B;  2K6D B;  2L83 A;  2Z0E B;  2JYE A;  2D07 B;  1PDX A;  5CHV C;  1L6V A;  1VR9 A;  3BK2 A;  4AJY B;  1XQQ A;  2N1W A;  3ZLZ A;  4A55 A;  4M01 A;  2VH2 A;  2BB6 A;  4ZOH C;  3QX1 A;  3AEB B;  3BZD B;  1F52 A;  2JT4 B;  1ZPS A;  2LUM A;  3VUW A;  2LHE A;  1IPG A;  1V97 A;  2KWU B;  5CHW A;  1GPX A;  1WE6 A;  4K7U A;  1DGJ A;  1EUV B;  4I6N B;  3PHW B;  4BOZ B;  2M56 B;  4GMV A;  1ISN A;  2Z8L A;  3ZIM A;  2J4X A;  4FJY A;  4DXG A;  4FJZ A;  3ZDT A;  3PO0 A;  1EWY C;  1LGR A;  5FK9 C;  5AZG A;  4TQ0 A;  2JYT A;  3QC8 B;  3V6E B;  3VH4 B;  2KFK B;  4OVV A;  4G50 A;  3KYC D;  2G4D B;  4DHJ B;  4G11 A;  3RD2 A;  4DQO C;  1WYG A;  3AN1 A;  2LRU A;  2K8C A;  2LJ5 A;  5H8Y E;  3SU8 X;  3PTF C;  2N9E B;  2PE9 A;  4L1B A;  5C3J B;  2BWF A;  1BML C;  4J6I A;  2PVG C;  1VDV A;  2V3P A;  4A90 A;  1WM3 A;  3MC8 A;  2J53 A;  5KHO A;  4PS7 A;  3W5V B;  1WZ0 A;  4G0N B;  4WAA A;  4JGH B;  2WU5 B;  3PRM B;  4GDK B;  1KLU D;  4HCN B;  2CU3 A;  4E74 A;  1QQR A;  2MHJ A;  2KJ6 A;  2ONQ A;  2OOB B;  3ZQ4 A;  2BYV E;  2GMI C;  1C4C A;  2DYB A;  3KQ4 A;  2WGS A;  4RM9 A;  1K52 A;  4FJV B;  3EUB 2;  4YTP B;  2M1M A;  4BAX A;  4RFB A;  2M8S A;  1SE9 A;  1WXM A;  3U30 A;  2DZM A;  3QQ8 B;  1K51 A;  3LB8 C;  4LCD E;  2BS3 B;  3BK1 A;  1XO3 A;  1RWS A;  2NBU A;  3V6C B;  3WA0 A;  4KGR A;  2XN9 C;  1VZ8 A;  3HM3 A;  3UQB A;  1ZGU B;  2PPH A;  2K0P A;  2BBC A;  4IM3 A;  4MH8 A;  3RN9 C;  1P0R A;  2KJH B;  3AB5 A;  4GDL A;  2L76 A;  3B2G A;  1C3T A;  4BBN C;  4TKN A;  2REX A;  3QJZ A;  4Q2J A;  1I4Q A;  2BKR B;  4AS1 A;  1Z2M A;  4HPP A;  4KV2 A;  2V9H A;  4XX5 A;  2MBH A;  2ASQ A;  2FUH B;  2YLM A;  2KVZ A;  1P98 A;  2DAF A;  3BVM A;  3KUD B;  5G5H A;  4UDU C;  1RAX A;  1SE3 A;  3B08 A;  1SXT A;  4CHK A;  4A9A A;  1I4H A;  2FCQ A;  5LLI A;  2I1K A;  3GB1 A;  4LDT D;  3DVN U;  3PZD A;  3OG5 A;  3T9L A;  5EE9 A;  2KC1 A;  1TZ1 A;  4KKJ A;  3H7S A;  4IWQ A;  4HPM B;  2EMS A;  2WQY B;  2AL6 A;  2WDT B;  2R2O A;  1LFD A;  5IAA C;  1KF6 B;  2QSD A;  2GI9 A;  3WAN A;  2CHZ A;  5C1Z A;  4MGZ E;  4RNA A;  1V1O A;  4WWM A;  3N30 A;  1MJD A;  3N1Z C;  4MM3 A;  4P6V F;  3W2D A;  1F2R I;  1GC7 A;  3NVV A;  4HPL B;  4IG7 B;  4P1C C;  1J0G A;  4A6Q A;  2L1A A;  1WE7 A;  1IGC A;  3I3T B;  1XCT L;  1KLG D;  2A5U A;  3IT6 B;  2V1Y A;  2KDE B;  3GS2 A;  3VQI A;  2WXK A;  3V62 A;  1V80 A;  4MAC A;  1JML A;  5D3D A;  3UI3 A;  1X1M A;  4NAW B;  5L95 C;  1UWM A;  1SEB D;  3DVN V;  4S17 A;  1E6E B;  2RPV A;  2LVO A;  3ZJT A;  3L54 A;  1EU4 A;  5D3I B;  2FCS A;  3AE9 B;  3C0R B;  2I2Y A;  3RMK C;  3Q8B A;  4RH6 A;  1E90 A;  1I4P A;  4FA6 A;  2H88 B;  3RNC C;  3KUZ A;  2A4Z A;  2DBY A;  3AM9 A;  4ZYN A;  4MJS B;  4OVZ A;  4D2K A;  2KNB A;  1I4G A;  1P1A A;  3BY4 B;  4GXB A;  1AN8 A;  3IFW B;  2NBV B;  3Q3J A;  1WGD A;  1P7E A;  1QT9 A;  4ZHP A;  1VJK A;  2NR2 A;  2FIF A;  3A33 B;  3D32 A;  3GE8 C;  2NCN A;  1D5X C;  4URK A;  4GB9 A;  3JSV B;  4RF0 A;  4BKG A;  1YN3 A;  4LK0 M;  2OED A;  1WF9 A;  2KMC A;  3MC0 B;  2Y5B B;  4DBG A;  3ZDM C;  2KX3 A;  4CO7 A;  1ROE A;  1L6U A;  3O13 A;  1FRD A;  3ZVV A;  5AEK B;  1PYW D;  1WJU A;  2CS4 A;  3OJ4 B;  4L23 A;  5BYQ A;  4W9L A;  3Q8A A;  3WAL A;  3L17 A;  2W3S A;  1R4N B;  2WX1 A;  2D3A A;  3OJ3 A;  4MT5 A;  3DBS A;  2G45 B;  2KWD A;  3ZTC A;  4EOY A;  1N6Z A;  1UWX A;  1V49 A;  5BYR A;  1SBB B;  2LGD A;  2G1E A;  2DAJ A;  2JPH A;  5FR6 A;  2EMT A;  2KLG A;  2V3S A;  3FKY A;  1IGD A;  2ON8 A;  1WX7 A;  1R4N I;  1F9J A;  1HTO A;  2C7H A;  2KQS A;  1OQY A;  2WXL A;  2D3G A;  1JWM D;  2ZW1 A;  2MBQ A;  1MPE A;  2BS4 B;  1E7V A;  2KZR A;  4FBJ B;  3VAW A;  5D2M B;  3MP9 A;  2NVU I;  1F0Z A;  4LDT B;  5JZE B;  4GLS C;  3L08 A;  1WXQ A;  4JWU C;  3HIZ A;  4IW0 A;  5HKH A;  4TUU A;  1TKE A;  2KJR A;  1NI2 A;  3IHP C;  4O1N A;  2WDR B;  3VDZ A;  3MHS D;  3P4S B;  4KSL C;  2KWC A;  2KD0 A;  3Q6B A;  2ZW0 A;  4M0W B;  2INP E;  1P3Q U;  2MLB A;  1I4R A;  2V3N A;  2LVP A;  3P42 A;  3DOW A;  3N1X C;  1HZ5 A;  4RGN A;  1UNS A;  1F77 A;  1V6E A;  5KHQ A;  5DPT A;  4XGA B;  3NS1 A;  3DBR B;  1OEY A;  4A3O A;  1U4A A;  1UGJ A;  1WR1 A;  2AQ1 B;  5CHF A;  3PRZ A;  2CKH B;  4HKQ A;  4RM8 A;  4IUM B;  3RNG C;  3PSE B;  3ML9 A;  2EEL A;  1FD6 A;  3GP7 A;  2JZP A;  2RPQ A;  3ZXV A;  5C23 A;  1DOX A;  2WXJ A;  1SSN A;  1MG8 A;  3KLS X;  2LRW A;  2N7E A;  5L83 A;  1C9F A;  2K39 A;  2BQQ A;  1L7Y A;  2D5G A;  3AE6 B;  3VRA B;  2KN5 A;  4MGI E;  2AQ3 B;  2KC2 A;  1WGY A;  4LJO B;  1JWU D;  4FLH A;  3TMP B;  1C78 A;  3ZW3 A;  4F1S A;  1WX9 A;  1IBX A;  2L32 A;  3FAH A;  2WHI A;  4LJP B;  3APD A;  3ZYY X;  1Z5S B;  2DYO A;  1E5W A;  2D10 A;  5FR3 A;  4WIP A;  4P1B C;  1XCQ L;  2D3C A;  5GMV A;  3VRB B;  3M63 B;  3PLV A;  2MQJ A;  1N63 A;  2G4S A;  3M95 A;  2JRH A;  3ZTD A;  4ZRJ A;  3AEC B;  4PS3 A;  1PGB A;  1OQR A;  1KLV A;  5EE3 A;  2Y5C A;  1VZ7 A;  2MBE A;  3SD5 A;  1SE4 A;  1UZX B;  4KIK B;  4ZRQ A;  3EEC A;  1F1H A;  1Q1O A;  4LNI A;  1KH0 A;  4OZA A;  4N6E B;  2GBJ A;  2FID A;  1FFV A;  4J3O D;  2HDE A;  2KAC A;  4JX1 C;  2KMA A;  2IYD B;  1YOV B;  2QEJ C;  2ZPY A;  4KDI C;  5IKC M;  1FM0 D;  4CYE A;  2INN E;  4MSQ B;  1YIW A;  2QJL A;  4YTM B;  3A9J B;  3I63 C;  4XE0 A;  1Q0W B;  4HCP B;  3RCZ A;  1KTK A;  2KFK A;  3P4R B;  2RDG A;  3HRD D;  4BFR A;  1CJE A;  2DZI A;  3IG3 A;  4M8N A;  5FKA C;  1FNU A;  4MGK E;  2QIE B;  2EKE C;  3ZRF A;  4C4V B;  2KXJ A;  3OLM D;  1JCK B;  4RGT A;  2O6V D;  4A8X C;  4XZ4 A;  3VXW A;  1FFU A;  3Q2A C;  4W9J A;  1RFA A;  4MEM A;  1SB3 C;  4HRS A;  2JRI B;  3PPA A;  3B2F A;  3Q14 C;  1AYF A;  3IXS A;  4GDK A;  4W9H A;  3H7P B;  1TY0 A;  4BZA A;  2MRP A;  3Q3O C;  1KM7 A;  3VR8 B;  3GZN B;  4OW0 A;  3U7Z A;  3NVW A;  2PW9 A;  5JH5 C;  2KQ4 X;  1E10 A;  4ACF A;  1WXS A;  5DPR A;  1ZDV A;  1E8W A;  4WWN A;  2W9N A;  2GLS A;  3CST A;  4B95 A;  2RD0 A;  1J7B A;  1OGW A;  2JSV X;  3APC A;  3EA6 A;  4S0R A;  2N9P C;  1FXI A;  2L7R A;  1JWB D;  3KWV A;  5BMI A;  2V4I B;  3UIO B;  2VZK D;  2TSS A;  1QIL A;  2ZNV B;  4C56 C;  2E3T A;  2L0F A;  4BKS D;  3P4P B;  5GXG B;  1UEL A;  3X0W A;  5J2R A;  4JL9 A;  1LXD A;  2L0T A;  2KFJ A;  3KVF B;  3ZNG C;  4ARC A;  2MA9 B;  4W9I A;  2KDI A;  1RRB A;  3VTV A;  2KO3 A;  3AED B;  2IY0 B;  3AH7 A;  1MFW A;  1EU3 A;  3TBL D;  1V9J A;  3ZO5 B;  2LWP A;  2M4N A;  3AEA B;  4AOF A;  1Q10 A;  2BS2 B;  5BMH A;  3AE4 B;  2FE8 A;  2HE7 A;  1WGR A;  2WX0 A;  1PQS A;  2O2V B;  3AI5 A;  1T6B X;  4DHZ B;  3NZS A;  1VD2 A;  1WIA A;  5HHD G;  3PGE A;  2V0G A;  1WR6 E;  4HDO A;  2HD5 B;  2IGH A;  2J7Q B;  1QOF A;  2KVR A;  2DNF A;  2C5L C;  3KYD D;  1ZDX A;  4NPN A;  1YX5 B;  1ET9 A;  1N62 A;  2FBW B;  1OQQ A;  4LLG M;  4X57 B;  2LGY A;  2OHF A;  3W1S A;  4DXA B;  3O65 B;  2WLB A;  1J7A A;  1NYR A;  1YNT E;  5D6J B;  3A9K B;  2BT6 A;  4WJQ A;  1D5M C;  2ZVN A;  2GRI A;  4P16 A;  2QDF A;  3ZJV A;  1RM6 C;  1JWS D;  4R3D A;  3RFZ B;  1ZKH A;  4NJ6 A;  5G55 A;  1WSP A;  1PFD A;  2KWV B;  4DXF A;  2BTE A;  3PS6 A;  2WNM A;  2SAK A;  3NVY A;  1V81 A;  3BIN A;  3CMM B;  1L4Z B;  4K3C A;  2HTH A;  1C4A A;  1UH6 A;  3R3M A;  3AXC A;  2PKO A;  3UIP B;  1HA5 A;  1YJ1 A;  4WH4 A;  1M94 A;  2PE6 B;  1E7P B;  3QWZ B;  2KTR B;  4NAW A;  4YT0 B;  3U52 E;  3NRZ A;  1JRU A;  3NZU A;  5E6J A;  3EHV A;  2FCM A;  2VRR B;  2QIL A;  4IWO A;  2O6V B;  4E3C A;  2W3R A;  2JF5 A;  3AEG B;  1UUP A;  4G3X B;  2GBK A;  4ITK A;  3AV8 A;  2MBB B;  2CHX A;  1KFY B;  5I4D A;  3MJ5 A;  1FMA D;  3DPD A;  3Q3F A;  4DDG D;  2LEK A;  2MX2 A;  4MJS A;  3H9D A;  1GUA B;  1OTR B;  5G2N A;  1ZW7 A;  3V3X A;  4W9D A;  3GE3 C;  3EC8 A;  1MHX A;  3RPF C;  4MEL A;  4PS8 A;  4L2Y A;  1TS3 A;  3TEW A;  3VR9 B;  4RF1 A;  5BO4 B;  4WJN A;  4WWO A;  3HUI A;  4KSK C;  3JSV A;  4IDI A;  5IP4 D;  4OZB A;  4HKZ E;  3AEE B;  1WFY A;  5E6P A;  4AQ7 A;  3HVZ A;  4JE3 B;  2CU1 A;  2VZK B;  1J19 A;  3P63 A;  2WXI A;  4HXD A;  2L00 B;  1N5W A;  4YTN B;  2W55 A;  4AUQ C;  3U7D A;  1K53 A;  3TUO A;  1N60 A;  2ZCC A;  2GB1 A;  1TIF A;  4HWI B;  2M0A A;  4HJG E;  3AE3 B;  3PV1 A;  2KKC A;  2MP2 B;  1JWA D;  1HQR D;  1KRH A;  5HG2 A;  3H8H A;  3AEF B;  4ANU A;  2Y3A A;  1EF1 A;  2K3U A;  3WAM A;  5J18 A;  4B0M A;  2BPS A;  2MW5 A;  4YSZ B;  3R2T A;  1NVI D;  1XLQ A;  1YQ4 B;  2XNA C;  2FCN A;  2WXO A;  1BXT A;  3TEZ A;  1UD7 A;  5D94 A;  4ASW C;  4DWF A;  3L4P A;  3DWM A;  1WH3 A;  2WXM A;  3K9O B;  1YN4 A;  1FO4 A;  2PJH A;  1V5T A;  3PT2 B;  3DCG A;  1I35 A;  1WXV A;  4ZYS A;  3ZGZ A;  2BWE S;  2JZZ A;  1V86 A;  4W9F A;  2XBB C;  3URY A;  3MTN B;  5IOI A;  1TKG A;  3ABV B;  5IN7 A;  4M0W A;  2LUE A;  4EFO A;  2JXX A;  2K9X A;  2ZJD A;  1XT9 B;  1T0Q C;  4BOS C;  3OWE B;  2Z0D B;  1EF5 A;  4H2A A;  4IM0 A;  2BW2 A;  1QF6 A;  4EZK A;  3E9S A;  3B9J A;  1A70 A;  1AAR A;  1C1Y B;  2M19 A;  2R2Q A;  2HJ8 A;  2MJD A;  2RDB C;  2WU2 B;  4KKI A;  4GU2 A;  1Y56 A;  2DEN B;  2MJE A;  4WWP A;  1QLB B;  1WY8 A;  4B6W A;  2LJI A;  2NPT B;  1WXA A;  2WXN A;  2DX5 B;  1E8Y A;  3RZF A;  1RLF A;  3BYY B;  3H6N A;  2AWT A;  4HRO A;  5EDS A;  4A20 A;  3HVD A;  4C00 A;  4LNF A;  4XDD A;  2ZVO A;  1XLP A;  1P7F A;  2GOW A;  3ZNI D;  3DBL B;  1CMX B;  2ACZ B;  2MJ3 A;  3X23 A;  4II2 B;  1I4X A;  2JUO A;  3WAO A;  3RNA C;  1FIQ A;  1JQ4 A;  2YEP F;  4TV3 A;  2KK8 A;  4C7Z A;  1FNW A;  1Q5W B;  1FNV A;  5DPW A;  3FIL B;  3ZXR A;  4BKT A;  1QZE A;  1UGM A;  3DQV A;  3Q3M C;  1MG4 A;  1PGX A;  4KIK A;  3SHQ A;  4YL8 A;  3DVG Y;  4REZ A;  1T0R C;  2KYW A;  3M3J A;  3WCQ A;  4EUT A;  1YJJ A;  3NY5 A;  3DBR I;  4YXD B;  2J42 A;  3ECI A;  1CQV A;  1YQ3 B;  2IJ0 A;  1F2R C;  2DLB A;  1MI0 A;  1NYQ A;  1DOI A;  2MWS B;  2LGI A;  2WWZ A;  2YEP B;  2INC C;  1C4P A;  3NUH B;  1ENF A;  4JLC A;  3W1S C;  2DZK A;  3NOB A;  3RNE C;  1WJN A;  4BBN F;  3TL5 A;  5LNK 1;  1T0S C;  4DHZ E;  3AU4 A;  5CTR C;  4YSX B;  1IUE A;  1XF5 L;  2BVC A;  3A9J A;  4US8 A;  4B0E A;  2I38 A;  5AUK A;  1IP9 A;  2MBO A;  2L3Z A;  4WAF A;  2LGX A;  3SDL C;  1SIF A;  2JWZ A;  3C19 A;  2N9K A;  4ZRP A;  2FAZ A;  3NVZ A;  2XEW A;  4E71 A;  4C4V A;  1WJ4 A;  1ACC A;  3RT3 B;  4FN2 A;  1CK1 A;  5MPO A;  2C7N B;  1JRP A;  4II3 B;  2Y5P A;  1FEH A;  1STE A;  3ETR A;  1V2Y A;  2L8J A;  1WMH B;  2RDH A;  3A1Q B;  2PVO D;  3V61 A;  2BYT A;  2KQ7 A;  3VHT C;  2KAJ A;  5HI1 A;  2IPK D;  3U2S C;  1SIJ A;  3VTU A;  3SR6 A;  3AE7 B;  2X38 A;  2WXQ A;  2IGD A;  3KWL A;  3H7P A;  4MH0 E;  1B9R A;  4A3P A;  3R66 C;  3VTW A;  2HTM E;  1YX6 B;  3ALB A;  2WXG A;  1R7S A;  2WXF A;  3UIN B;  2LI5 A;  1JAL A;  4B9K A;  5DCN A;  2J0M A;  5G5G A;  4K81 A;  1L0Y B;  1D5Z C;  2KDM A;  3PRE A;  1VRA B;  1G6J A;  4KGS A;  3LYY A;  5EE0 A;  3S2A A;  1KOT A;  3B0A A;  1D6E C;  4P7I A;  2N9X A;  2BF8 B;  3PHX B;  1WGK A;  4I6P A;  4LNN A;  2IDY A;  4NJ7 A;  3L16 A;  2LVQ A;  1E8X A;  3E56 A;  1T5X D;  3RNF C;  4PT5 A;  3LDZ E;  3PZ7 A;  3W1Y A;  1AWD A;  1S3S G;  3DHI C;  3KW5 B;  3R8B A;  3NJT A;  1H4R A;  1VZ6 A;  2LGS A;  3U8Z A;  5T8I A;  2JXT A;  2XK5 B;  4KZ0 A;  1B1Z A;  1IYF A;  4IM2 A;  4ICV A;  3ML8 A;  2N0S B;  4ANV A;  4RCO A;  3W9C B;  1R4M B;  4K7W A;  1TT5 B;  4XWT A;  4K7S A;  1UBI A;  2J0J A;  4WQO B;  4GOC A;  1E9M A;  3AE8 B;  3BVG A;  1ZUD 2;  2LFI A;  3R2I A;  1ESF A;  3U4E G;  2BB5 A;  2AX5 A;  2JQR B;  3HHM A;  1R4M I;  2K6Q A;  2UU7 A;  3BVZ A;  3PVL A;  2ZCB A;  3PRP B;  2K8H A;  2O2V A;  3I9V 1;  1NI3 A;  2AQ2 B;  4ANW A;  1J8C A;  3RUL A;  1DYQ A;  3LJ3 A;  1ZXI A;  3IAS 1;  1JW9 D;  3GZN I;  2LMC A;  3MHZ A;  3JW0 X;  4KVG B;  4TSS A;  1V1P B;  2N4F A;  5JHA A;  4TQ1 A;  5LXI B;  2RSU A;  5IA7 A;  3NS8 A;  3MJW A;  4NJC A;  2R61 A;  1WWT A;  3Q8F A;  1N5X A;  1WX8 A;  1XLN A;  3PZ8 A;  5CX3 A;  4IWP A;  3CF6 E;  4WUR A;  3AMZ A;  3Q8E A;  2JX5 A;  1ZOY B;  5H92 C;  4HEA 1;  3A9K A;  1YJI A;  4GGQ A;  1GAQ B;  2I1J A;  1WZ3 A;  2ZZP B;  3T3N A;  3FC4 A;  1FXA A;  2PMV A;  3PLU A;  2M17 A;  4JQW C;  1P9D U;  4LNO A;  1TKY A;  3EGR A;  1YQB A;  2KTR A;  4K3B A;  5LXH A;  1TYG B;  2WDV B;  5TR5 A;  3JVZ X;  4WJO A;  2O6V A;  4QAY A;  4RMA A;  4ZRI A;  5AZH A;  3W5U B;  2EKI A;  4WJP A;  3SEB A;  3QHT A;  1LQB A;  3AE1 B;  4EE2 A;  3QAQ A;  2LHD A;  2N7D A;  2H89 B;  4IKG A;  3QA8 A;  4NY0 A;  4ANX A;  4HLE A;  2C9W B;  1EM7 A;  3ZNZ B;  2K25 A;  1PUT A;  2SEB D;  4DDI D;  3Q69 A;  1OFF A;  1HE8 A;  4DK5 A;  5AZF A;  2G9H D;  2V4L A;  3V60 A;  2MCN B;  2WXH A;  2NS5 A;  1GJZ A;  4EKU A;  3APF A;  3BII D;  4XC2 A;  2CJN A;  2WDQ B;  2MH7 A;  3KUC B;  4HJK A;  1M4V A;  3N20 C;  1TZO A; 
#chains in the Genus database with same CATH homology
 3UQA A;  1E8Z A;  1WE6 A;  1UD7 A;  4K7U A;  2C7M B;  5D94 A;  4ASW C;  2N1V A;  4DWF A;  1MG8 A;  4EEW A;  2M0X A;  1WH3 A;  3K9O B;  3VH3 B;  2KTF A;  1EUV B;  4I6N B;  3AU5 A;  2PJH A;  3PHW B;  4BOZ B;  4GMV A;  1ISN A;  1V5T A;  2LRW A;  2N7E A;  1YD8 U;  5L83 A;  3ZIM A;  4FHJ A;  2CHW A;  1UBQ A;  2K39 A;  4FJY A;  3VUY A;  1L7Y A;  4FJZ A;  4EZJ A;  3PT2 B;  3DCG A;  3RZW C;  1I35 A;  2KN5 A;  4MGI E;  3ZDT A;  1WXV A;  2BWE S;  2KC2 A;  2JZZ A;  1V86 A;  4W9F A;  2XBB C;  5AZG A;  3MTN B;  4TQ0 A;  1WGY A;  3QC8 B;  4LJO B;  4BKS A;  4FLH A;  3TMP B;  4ICU A;  2D2Q A;  2AYO B;  3V6E B;  3VH4 B;  2C60 A;  2KFK B;  2LUE A;  1WX9 A;  4OVV A;  2JXX A;  3ZW3 A;  4G50 A;  4EFO A;  4F1S A;  1H8C A;  3OAW A;  2LXA A;  2ZJD A;  4LJP B;  3APD A;  3KYC D;  1XT9 B;  1Z5S B;  2DYO A;  1E5W A;  2MSE D;  2D10 A;  4BOS C;  3ZRC A;  2G4D B;  2Z0D B;  1A5R A;  5GMV A;  1EF5 A;  4DHJ B;  4G11 A;  3M63 B;  3PLV A;  4IM0 A;  3RD2 A;  2MQJ A;  2G4S A;  3M95 A;  2JRH A;  2LRU A;  2K8C A;  2LJ5 A;  3QCA A;  2MP2 A;  3SU8 X;  3ZTD A;  3PTF C;  4EZK A;  4ZRJ A;  4PS3 A;  2KAN A;  1AAR A;  1C1Y B;  2KX0 A;  3RYT A;  2R2Q A;  1KLV A;  2HJ8 A;  2N9E B;  2PE9 A;  3K9P B;  3KH0 A;  2BWF A;  2MBE A;  4GU2 A;  2DEN B;  3SD5 A;  1UZX B;  4J6I A;  4KIK B;  3EEC A;  4WWP A;  1Q1O A;  1WY8 A;  1WM3 A;  4B6W A;  5KHO A;  2NPT B;  4PS7 A;  5D7G A;  2LZ6 A;  4BVU C;  2GBJ A;  1WZ0 A;  1WXA A;  4G0N B;  1WGG A;  4WAA A;  4JIO U;  3L0W B;  4JGH B;  2DX5 B;  3PRM B;  4GDK B;  2FID A;  3IVF A;  4HCN B;  1E8Y A;  3RZF A;  5JHB A;  2IZV B;  1RLF A;  3H6N A;  2AWT A;  4GDL B;  2K8B A;  4E74 A;  3B1L X;  4AJW A;  4A20 A;  5EDS A;  2KJ6 A;  2KMA A;  2OOB B;  3T8M A;  2IYD B;  2BYV E;  2GMI C;  2ZPY A;  4KDI C;  2ZVO A;  4CYE A;  2GBN A;  2GOW A;  3JYU A;  2DYB A;  3ZNI D;  4F7Z A;  4MSQ B;  4RM9 A;  1YIW A;  1GG3 A;  4FJV B;  2J0K A;  2M1M A;  3A9J B;  1CMX B;  1Q0W B;  3X23 A;  1WI0 A;  4HCP B;  3RCZ A;  2KFK A;  2FNJ B;  4II2 B;  3AUL A;  5E6O A;  1E7U A;  2M8S A;  2G3Q B;  2JUO A;  3WAO A;  4BFR A;  1NBF C;  2DZI A;  1SE9 A;  3IG3 A;  3N32 A;  4M8N A;  1WXM A;  4TV3 A;  1LM8 B;  2KK8 A;  4MGK E;  3U30 A;  2EKE C;  3ZRF A;  2DZM A;  1Q5W B;  3QQ8 B;  4PYZ A;  5DPW A;  2KXJ A;  3OLM D;  4LCD E;  1GC6 A;  2BYF A;  4BKT A;  4EZL A;  4GIV A;  4KDL B;  1QZE A;  1UGM A;  3DQV A;  3P2B A;  2O6V D;  4XZ4 A;  2NBU A;  3V6C B;  3WA0 A;  3VXW A;  1OEY J;  4W9J A;  1RFA A;  4KIK A;  5J17 A;  3N3K B;  2ZEQ A;  3HM3 A;  4MEM A;  3SHQ A;  3UQB A;  4YL8 A;  2JRI B;  3DVG Y;  2NPT A;  1ZGU B;  3PPA A;  4W9G A;  2PPH A;  2K1F A;  3H1U A;  3M3J A;  4IM3 A;  4EUT A;  1S1Q B;  3NY5 A;  1P0R A;  4GDK A;  3DBR I;  3CSF A;  3ECI A;  3L13 A;  2PEA A;  2KJH B;  4NNJ B;  4W9H A;  3H7P B;  3QAR A;  2ZNV C;  3QIJ A;  2L76 A;  4GDL A;  4MGY E;  2KLC A;  2MWS B;  1C3T A;  2WWZ A;  2MRP A;  2IBI B;  4BBN C;  4TKN A;  2REX A;  3QJZ A;  4GN1 A;  4JLC A;  3W1S C;  1KM7 A;  2DZK A;  3NOB A;  2BKR B;  1WJN A;  1Z2M A;  4BBN F;  3TL5 A;  4KV2 A;  4XX5 A;  2MBH A;  4KZC A;  3TJP A;  2ASQ A;  5JH5 C;  2FUH B;  2KDB A;  2YLM A;  4K1R B;  3VVW B;  4DHZ E;  1P98 A;  1WXS A;  2DAF A;  3AU4 A;  5CTR C;  3KUD B;  5DPR A;  3ZKJ C;  2GBM A;  1E8W A;  3EFU A;  4MSM B;  1RAX A;  4WWN A;  3A9J A;  2W9N A;  2D11 A;  3B08 A;  4CHK A;  2LXC A;  2FCQ A;  5LLI A;  2I1K A;  2YVC A;  3CST A;  3GOE A;  4B95 A;  4LDT D;  3L10 B;  2RD0 A;  3DVN U;  3PZD A;  2MBO A;  1IP9 A;  2L05 A;  2L3Z A;  3T9L A;  2LGX A;  2KC1 A;  1OGW A;  2UWQ A;  3SDL C;  3APC A;  1SIF A;  1TZ1 A;  2JWZ A;  1I42 A;  2N9P C;  2FAZ A;  1D3Z A;  2L7R A;  2XEW A;  3DVG X;  3QK0 A;  4E71 A;  3H7S A;  4IWQ A;  4HPM B;  2EMS A;  1WJ4 A;  3UIO B;  3RT3 B;  2AL6 A;  4FN2 A;  2WDT B;  2C7N B;  2ZNV B;  4II3 B;  1NDD A;  2R2O A;  1LFD A;  5IAA C;  1V2Y A;  1TTN A;  2L0F A;  2WYQ A;  4BKS D;  3WAN A;  4M8M A;  2L8J A;  1UEL A;  1WMH B;  3A1Q B;  4JL9 A;  1LXD A;  3V61 A;  2CHZ A;  2KQ7 A;  3X0W A;  2L0T A;  2DHZ A;  1WGH A;  2KFJ A;  3VHT C;  5C1Z A;  3KVF B;  4MGZ E;  3ZNG C;  3N30 A;  3VTU A;  2MA9 B;  4W9I A;  2KDI A;  1RRB A;  3VTV A;  2KO3 A;  2KOX A;  2KDF B;  4MM3 A;  1GC7 A;  4FUL A;  4HPL B;  4IG7 B;  4IC7 B;  3H7P A;  3WIM A;  1J0G A;  2IY0 B;  3NHE B;  4MH0 E;  4W9C A;  4AP4 C;  4A3P A;  1WE7 A;  3R66 C;  1V9J A;  3TBL D;  3VTW A;  3ZO5 B;  2LWP A;  1YX6 B;  3ALB A;  2LAS A;  3I3T B;  3UGB B;  2M4N A;  2GBR A;  3UIN B;  4AOF A;  2A5U A;  2LI5 A;  4ZRK A;  4B9K A;  5DCN A;  2J0M A;  5DPS A;  4K81 A;  2HE7 A;  1WGR A;  2IO0 B;  2V1Y A;  2KDE B;  2WX0 A;  1PQS A;  3VQI A;  3PRE A;  2O2V B;  1V80 A;  3V62 A;  4ZDV A;  3VFK A;  1G6J A;  3AI5 A;  1WRD B;  3A4R A;  3S2A A;  1KOT A;  3B0A A;  2BKF A;  2LD9 A;  4P7I A;  2JZ3 B;  2N9X A;  2BF8 B;  1X1M A;  3PHX B;  4GSW A;  4I6P A;  4DHZ B;  4NAW B;  3NZS A;  5L95 C;  3ZUN A;  1VD2 A;  1WIA A;  4NJ7 A;  3DVN V;  3VUX A;  4NQK E;  3PGE A;  3L16 A;  2LVQ A;  1E8X A;  1WR6 E;  3DBL I;  4HDO A;  2HD5 B;  3LDZ E;  4I6L B;  3W1Y A;  2LVO A;  2J7Q B;  2OJR A;  1S3S G;  4AWJ A;  2KVR A;  3KW5 B;  2C5L C;  3KYD D;  3L54 A;  4N9F 4;  2FCS A;  1XD3 B;  1YX5 B;  3C0R B;  4NPN A;  1H4R A;  4HVB A;  3U8Z A;  1E90 A;  4FA6 A;  2XK5 B;  4X57 B;  4KZ0 A;  2LGY A;  3W1S A;  1WMH A;  3A1Q A;  4DXA B;  1IYF A;  3KUZ A;  4IM2 A;  4ICV A;  3ML8 A;  2A4Z A;  3A4S C;  3O65 B;  4ZYN A;  4ANV A;  4MJS B;  4K7W A;  5D6J B;  2KHW B;  2KNB A;  3A9K B;  4DHJ D;  4WJQ A;  4K7S A;  1UBI A;  2J0J A;  2ZVN A;  1P1A A;  4FAD A;  3BY4 B;  4WQO B;  3R7R A;  4GOC A;  1ZKH A;  5E6N A;  3DBH I;  4GXB A;  4NJ6 A;  5G55 A;  2IO1 B;  2ZPN A;  2DZJ A;  3IFW B;  2KWV B;  2NBV B;  3Q3J A;  1SGH A;  3PS6 A;  1WGD A;  2CR5 A;  3HHM A;  1V81 A;  1WJ6 A;  3R7Q A;  1R4M I;  2NR2 A;  2K6Q A;  3BIN A;  2FIF A;  3A33 B;  1Y8R C;  3CMM B;  3D32 A;  3PVL A;  4FHK A;  2HTH A;  2ZCB A;  2NCN A;  3PRP B;  1UH6 A;  2K8H A;  2O2V A;  3JSV B;  3R3M A;  4GB9 A;  3AXC A;  4BKG A;  3UIP B;  1YJ1 A;  3IBE A;  2BYE A;  1M94 A;  4HK2 A;  1WYW B;  4ANW A;  2PE6 B;  4W9E A;  1J8C A;  3QWZ B;  3RUL A;  2KTR B;  1WF9 A;  3LJ3 A;  4NAW A;  2KMC A;  4NQL B;  3NZU A;  1JRU A;  2Y5B B;  3EHV A;  1BT0 A;  4DBG A;  3GZN I;  1TGZ B;  2B3A A;  2FCM A;  2VRR B;  3ZDM C;  2KX3 A;  4IWO A;  2O6V B;  3M62 B;  3JW0 X;  4CO7 A;  2IY1 B;  2IO2 B;  4KVG B;  4E3C A;  3ZVV A;  5AEK B;  2JF5 A;  2CS4 A;  1WJU A;  2N4F A;  3OJ4 B;  2RSU A;  4TQ1 A;  1K8R B;  5JHA A;  5LXI B;  4G3X B;  4W9L A;  2RGF A;  3NS8 A;  5IA7 A;  2GBK A;  3WAL A;  3L17 A;  3MJW A;  2UYZ B;  2MBB B;  2XK5 A;  2CHX A;  4F8C B;  1WX8 A;  2WX1 A;  5CX3 A;  1EO6 A;  4IWP A;  3OJ3 A;  4OVU A;  3DBS A;  3CF6 E;  2G45 B;  3DPD A;  3ZTC A;  4EOY A;  3Q3F A;  4DDG D;  2MX2 A;  4HDQ A;  4MJS A;  1WM2 A;  1V49 A;  4W9K A;  3TCA A;  2AL3 A;  1GUA B;  3H9D A;  2LGD A;  1OTR B;  3A9K A;  2DAJ A;  2JPH A;  5FR6 A;  4GGQ A;  5G2N A;  1T0Y A;  2EMT A;  2I1J A;  2KLG A;  2V3S A;  1WZ3 A;  2ZZP B;  1ZW7 A;  1VCB A;  2DYM A;  2JVC A;  4W9D A;  1WX7 A;  1R4N I;  1F9J A;  1L2N A;  3EC8 A;  2AEH A;  2C7H A;  2KQS A;  1OQY A;  3UF8 A;  2D3G A;  4MEL A;  3WAP A;  4PS8 A;  2MBQ A;  3HM6 X;  3PLU A;  2M17 A;  2KZR A;  1E7V A;  4FBJ B;  4JQW C;  5D2M B;  3VAW A;  5BO4 B;  1P9D U;  2NVU I;  4LDT B;  4WJN A;  2IO3 B;  4WWO A;  1GNU A;  1V5O A;  2QHO A;  4MDK E;  5JZE B;  1KJT A;  4KSK C;  3JSV A;  3L08 A;  3HIZ A;  4IW0 A;  5HKH A;  4TUU A;  1WFY A;  2KJR A;  5E6P A;  1YQB A;  1NI2 A;  3IHP C;  4PYU A;  2KTR A;  1TBE A;  5LXH A;  3VDZ A;  2NBW B;  5TR5 A;  3MHS D;  2CU1 A;  2JY6 A;  3JVZ X;  4KSL C;  3ONS A;  1J19 A;  4WJO A;  2O6V A;  2KWC A;  4URK A;  2KD0 A;  4RMA A;  4ZRI A;  5AZH A;  4HXD A;  4WJP A;  2Z59 B;  2L00 B;  3QHT A;  1LQB A;  2RR9 A;  4M0W B;  1FXT B;  2N7D A;  3ENE A;  3QAQ A;  1P3Q U;  2MLB A;  3HK0 A;  3QA8 A;  4NY0 A;  3TIX A;  4AUQ C;  4ANX A;  2C9W B;  3U7D A;  3DDC B;  4HLE A;  2LVP A;  2BGF A;  3RUI B;  3ZNZ B;  3ZNH B;  2K25 A;  2K6D B;  2Z0E B;  4DDI D;  3DOW A;  2ZCC A;  2D07 B;  4HWI B;  1HE8 A;  4DK5 A;  1V6E A;  3PV1 A;  5KHQ A;  5J2R A;  2KKC A;  2MP2 B;  5DPT A;  5AZF A;  5CHV C;  4AJY B;  1XQQ A;  2N1W A;  2V4L A;  3ZLZ A;  1OEY A;  3V60 A;  4A3O A;  4ANU A;  2MCN B;  2NS5 A;  1U4A A;  1WR1 A;  1GJZ A;  1EF1 A;  3WAM A;  4EKU A;  5CHF A;  3PRZ A;  3APF A;  5J18 A;  2CKH B;  4XC2 A;  3QX1 A;  4RM8 A;  4IUM B;  2BPS A;  2MW5 A;  3PSE B;  2JT4 B;  3ML9 A;  3KUC B;  4HJK A;  3VUW A;  1IPG A;  2KWU B;  2FCN A;  2RPQ A;  5CHW A;  5C23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...