1YIWA

X-ray crystal structure of a chemically synthesized ubiquitin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
b'LQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title X-ray Crystal Structure of a Chemically Synthesized [D-Gln35]Ubiquitin
pubmed doi rcsb
molecule tags Structural protein
total genus 21
structure length 71
sequence length 71
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1yiwA00
2GBNA 1H8CA 4HJKA 2GOWA 4JQWC 4GOCA 5G2NA 4W9IA 1WE7A 2KQ7A 3C0RB 3VUXA 1WGDA 3H7PB 2LRUA 3O65B 1I35A 2L05A 1H4RA 1K8RB 1YD8U 4LDTD 4AJWA 5L95C 4ZDVA 2L0TA 1Q0WB 3M62B 2FIFA 2KMAA 3RYTA 3DDCB 4JL9A 4K7UA 2JZZA 1GG3A 3K9OB 2MBEA 4FJZA 3UIPB 2JZ3B 5LXHA 2AEHA 4GMVA 1GC6A 4II3B 2KDFB 1E8ZA 2HTHA 2DZIA 2N9PC 4GDLA 2VRRB 4DHJB 2JT4B 1TGZB 4P7IA 2NCNA 3P2BA 4ANVA 2L8JA 3V60A 2KFKB 4IUMB 2A5UA 2DZJA 2LGDA 2YLMA 1C1YB 3B08A 3ZUNA 2L7RA 1WR1A 2Y5BB 3DPDA 4FULA 4HK2A 4NNJB 1WIAA 4MELA 2PE9A 2ZPYA 5E6OA 5DPWA 2N1WA 1WY8A 1WXSA 4W9EA 1WXMA 4WQOB 4HWIB 1QZEA 5IAAC 1F9JA 4MM3A 4ICUA 4K81A 1WXAA 2K39A 2MCNB 2NBWB 3UQAA 3W1SC 2WWZA 2KWUB 1IPGA 3T8MA 3V61A 3UINB 2KWCA 3Q3FA 1WZ0A 1EUVB 2C5LC 2RSUA 4MSMB 2ZCCA 4NAWA 3ZNGC 4NAWB 1NBFC 4HXDA 4W9HA 3RT3B 3PT2B 3NS8A 3BY4B 4EZJA 1WJ4A 2C9WB 5BO4B 3R7QA 2KN5A 3AXCA 4DHZB 2GMIC 3MHSD 3PZDA 4KVGB 1WYWB 3AU5A 2FIDA 4GN1A 2IZVB 3WAOA 1SE9A 1WRDB 2C7HA 2KQSA 5J2RA 3KUCB 3K9PB 1T0YA 1E8WA 2ZNVC 3ZTCA 4FBJB 5G55A 2HE7A 3OJ4B 4LDTB 4CO7A 3A4SC 1WGGA 3PSEB 3PREA 3SU8X 3EC8A 1WX8A 4MGZE 1OEYA 2C7MB 1WR6E 2QHOA 3WANA 1WZ3A 1WM2A 1EF1A 2L00B 5AEKB 5TR5A 4TQ0A 2D2QA 2LJ5A 2M8SA 4ANXA 1LXDA 1J19A 3KVFB 4MJSB 3V6EB 1D3ZA 3VXWA 3A9KA 2UWQA 4LCDE 1YX6B 3A9KB 2D11A 5GMVA 2KX0A 4GB9A 2JWZA 2RPQA 3ML8A 1E7UA 2CR5A 2I1KA 3L08A 1S1QB 2KWVB 4KSKC 4BKTA 2O6VA 4A20A 3L13A 5CTRC 2N7DA 2BGFA 3NHEB 2O2VB 3TL5A 2N9XA 2BWES 2UYZB 2IO1B 3JYUA 1XQQA 4B6WA 2KC1A 5E6NA 3APFA 2B3AA 4W9FA 4M8NA 1IP9A 1V2YA 2KLCA 3EECA 1WFYA 4M0WB 2ZPNA 3HIZA 3Q3JA 4EKUA 3EFUA 4MGKE 2MSED 5CHWA 4YL8A 2MX2A 3KH0A 2HD5B 1P98A 4E71A 1YJ1A 4KDLB 2CHWA 3RULA 2MBBB 1WMHA 2EKEC 3IHPC 3PRZA 4I6PA 2PJHA 5IA7A 3TMPB 2IO2B 2KJHB 2LRWA 3N30A 1E90A 2LD9A 2D10A 1AARA 2M1MA 4A3PA 4FHKA 3DBLI 3WA0A 4NQLB 3A1QA 4B95A 2M4NA 3ZRFA 1OTRB 5AZHA 1UGMA 1P9DU 5JH5C 4WJPA 1M94A 2KTFA 2LASA 4F7ZA 1UELA 2FCMA 4HLEA 2FCNA 2MP2B 3QJZA 4K7SA 5KHOA 3VAWA 4GDKB 3U30A 4WWPA 3QAQA 2KNBA 4BKGA 3PPAA 4E74A 3H7PA 4GXBA 2ZCBA 2L3ZA 5D2MB 2NBVB 4W9LA 5LXIB 3R3MA 2LI5A 3OJ3A 2G45B 5JHBA 2BKFA 5L83A 3PS6A 2G4DB 3X23A 2BYFA 3T9LA 4LJOB 4AP4C 1RLFA 1R4MI 2KKCA 4KDIC 1LM8B 3GOEA 4PYZA 4DWFA 2KZRA 2IO0B 4IM2A 1UBIA 2KJ6A 5CX3A 4DHZE 2K8HA 3DVGX 4EUTA 2KFKA 3DCGA 4IM0A 3RD2A 3VTUA 2PE6B 2AWTA 2DX5B 4DXAB 4X57B 3TJPA 2FUHB 2KMCA 4WAAA 3N3KB 1V80A 4PYUA 2V4LA 1WGHA 1Z5SB 4AWJA 3OLMD 2MBOA 2ASQA 2EMTA 3H9DA 1R4NI 2IBIB 3QA8A 4BBNC 3JW0X 2LGXA 1UZXB 3IFWB 3DVNV 4EOYA 2DZKA 2BYEA 2RGFA 4K1RB 4JLCA 4ZRJA 3QHTA 4K7WA 1XD3B 2REXA 3ZRCA 2PEAA 2FCSA 3PRMB 4BOSC 1I42A 4DBGA 2GBRA 2D07B 3ZNID 4BKSA 5J17A 2LWPA 4FN2A 1E5WA 4G0NB 3ML9A 2FAZA 2RD0A 3WAMA 3ZDTA 4M8MA 2Z0DB 2KK8A 3RUIB 2KXJA 3WALA 1UH6A 1RFAA 3PTFC 2JRIB 3QARA 1C3TA 3VQIA 5DPRA 2WDTB 4MGYE 1KLVA 3HK0A 5E6PA 3RCZA 4MDKE 2CHZA 3V62A 4IC7B 3KW5B 2MWSB 3TCAA 4WJQA 2WX0A 3DVGY 3PLUA 2JF5A 2JPHA 1BT0A 4PS8A 3IBEA 3B1LX 2WX1A 4TUUA 4URKA 4E3CA 2W9NA 2KTRB 1HE8A 3A33B 3ZTDA 4GIVA 4IWPA 1G6JA 1PQSA 4FHJA 3AULA 1L7YA 3W1YA 1ISNA 2V3SA 1IYFA 2GBKA 2G3QB 2D3GA 2K6DB 4MJSA 4EFOA 2L76A 3WIMA 5AZGA 4FLHA 3OAWA 3PGEA 4HCPB 4RM8A 2BKRB 1ZGUB 2CU1A 4LJPB 2Z59B 2O2VA 5J18A 3DBHI 2LXCA 2NPTA 2NVUI 2JXXA 1WJ6A 2NPTB 4MGIE 4FA6A 3PVLA 3APDA 4G50A 3PRPB 3DVNU 4AOFA 2MRPA 1GNUA 5FR6A 2DHZA 2MBQA 2LXAA 3QQ8B 5CHVC 3L10B 3ZLZA 2GBMA 1Q1OA 2FNJB 3NZSA 4MSQB 3VUYA 3ENEA 2DAJA 2N4FA 2HJ8A 2ZNVB 4BOZB 2J0KA 4PS7A 2J7QB 4HPMB 4KZ0A 1V6EA 4HCNB 3ZO5B 3EHVA 4DK5A 3JSVA 3MJWA 3R66C 3JSVB 2BF8B 4HDQA 4IG7B 2LVOA 3LJ3A 4NJ7A 1Z2MA 1UD7A 4RM9A 3ZIMA 3U7DA 2A4ZA 1WGYA 1ZW7A 1WX9A 3JVZX 3LDZE 3DQVA 3VUWA 3U8ZA 3HM3A 2KLGA 3SDLC 4I6LB 4WJNA 3ZNZB 2MP2A 3SHQA 2MBHA 2GBJA 2MW5A 3H6NA 4GDKA 3M63B 4IM3A 3ZVVA 3UQBA 1EF5A 1TTNA 5JHAA 2AL3A 2J0JA 1WI0A 2DYMA 1VCBA 2MLBA 2NS5A 3UGBB 2JRHA 3APCA 4WJOA 3QC8B 1LQBA 3H1UA 3UIOB 2CKHB 1V81A 2G4SA 2KFJA 2L0FA 4XC2A 2KO3A 3VH4B 4EEWA 5DPSA 5EDSA 2LVQA 3NZUA 1TBEA 2JUOA 5D6JB 4W9CA 4TV3A 2KC2A 3A4RA 3VTVA 1GUAB 2V1YA 1E8XA 2BPSA 4AUQC 4BVUC 1WH3A 3AI5A 1WX7A 3M3JA 4HPLB 4JGHB 4EZKA 1P1AA 4XZ4A 4IWQA 2LVPA 3B0AA 1P0RA 4W9JA 2OJRA 2RR9A 4B9KA 3KUDB 3CF6E 2AYOB 1V86A 2DYOA 3BINA 2WYQA 1J0GA 1FXTB 4MH0E 4TKNA 4OVVA 2NBUA 4W9KA 2IY1B 3QWZB 2DENB 1E8YA 2KANA 3PLVA 2ZJDA 2ZVOA 3NOBA 3DBSA 3I3TB 4GDLB 3ZKJC 4DDID 2IYDB 2K8CA 2BYVE 4PS3A 3S2AA 2NR2A 4WWNA 1RRBA 4GU2A 4ASWC 2O6VD 1V5OA 1Y8RC 4MEMA 2DYBA 4I6NB 2AL6A 1TZ1A 2KVRA 4TQ1A 1EO6A 1ZKHA 1X1MA 1OQYA 2K25A 4ICVA 4NY0A 1WM3A 4NPNA 4II2B 2CS4A 2N9EB 3PV1A 2XK5A 2XK5B 3RZWC 5D94A 1WGRA 1WXVA 1NI2A 5HKHA 3KUZA 3NY5A 2KJRA 2N7EA 3N32A 2KHWB 4KSLC 2FCQA 3DBRI 5LLIA 2EMSA 3PHXB 4AJYB 3ZNHB 3MTNB 4ANUA 5C1ZA 5JZEB 1V49A 4JIOU 2XEWA 2DZMA 2XBBC 2KTRA 3KYDD 3VTWA 1KJTA 1V9JA 1OEYJ 4RMAA 2K6QA 4W9GA 3KYCD 3X0WA 2I1JA 1OGWA 3VVWB 1VD2A 2KDEB 3ZDMC 1Q5WB 3W1SA 2K1FA 5AZFA 1LFDA 3RZFA 1YX5B 2KOXA 3V6CB 1SIFA 1YQBA 1A5RA 2KD0A 4ZYNA 3AU4A 4BFRA 2MQJA 4NQKE 3TBLD 1NDDA 2LGYA 3D32A 2CHXA 3HM6X 3VH3B 2M17A 5KHQA 2DAFA 5C23A 4F1SA 2IO3B 1SGHA 2LZ6A 3IG3A 2LUEA 4GGQA 3L17A 3L0WB 4DDGD 4XX5A 3L54A 3CMMB 4HDOA 3VDZA 2JVCA 2IY0B 3A9JA 3A9JB 4KZCA 4EZLA 4HVBA 1RAXA 1S3SG 4F8CB 1L2NA 3PHWB 5DPTA 3CSTA 2Z0EB 1WE6A 3GZNI 2K8BA 4ANWA 4DHJD 3ZW3A 3CSFA 1GJZA 2O6VB 1WJNA 1WF9A 1V5TA 4KV2A 4CYEA 4IWOA 4A3OA 4WWOA 2N1VA 4IW0A 3VFKA 1U4AA 4NJ6A 3L16A 1KOTA 1UBQA 4GSWA 2ZZPB 3WAPA 3ONSA 4G3XB 3SD5A 1GC7A 2R2OA 3HHMA 3R7RA 4KIKA 1MG8A 4KIKB 3UF8A 1J8CA 4BBNF 1YIWA 1CMXB 2ZVNA 4OVUA 1JRUA 1E7VA 4ZRKA 3QK0A 2JY6A 2MA9B 4FJYA 1WMHB 4W9DA 3VHTC 2BWFA 2ZEQA 3IVFA 4FJVB 1XT9B 3ECIA 2PPHA 5D7GA 3TIXA 2KDBA 3QIJA 4G11A 2R2QA 3M95A 5CHFA 2OOBB 4N9F4 4J6IA 3ALBA 1WJUA 4FADA 4BKSD 2M0XA 2C60A 2KDIA 3H7SA 5DCNA 2YVCA 3A1QB 3QX1A 4ZRIA 1P3QU 4CHKA 2KX3A 3QCAA 1KM7A 2J0MA 3DOWA 2C7NB
chains in the Genus database with same CATH superfamily
2GBNA 4HJKA 4JQWC 4GOCA 5G2NA 5LNK1 1KTKA 3C0RB 3C19A 4LDTD 3M62B 2FIFA 1FIQA 2KN4A 1MPEA 5D3DA 2AEHA 1GC6A 1T0RC 5G5HA 1BUIC 2HTHA 1RM6C 2NCNA 2L8JA 2LGDA 1C1YB 1QOBA 3B08A 2L7RA 4NNJB 1QOGA 2ZPYA 1E0ZA 1ACCA 2N1WA 1ESFA 1WXSA 1I4GA 4W9EA 4XDDA 2WGSA 4K81A 3UQAA 1IPGA 4C4VA 1WZ0A 2C5LC 4NAWA 1NBFC 2I38A 4C00A 3N1XC 5BO4B 2KN5A 1FXIA 4DHZB 2WXNA 3PZDA 2FIDA 1BMLC 1WRDB 2PVOD 3PZ7A 5J2RA 3K9PB 1YQ4B 1N5WA 2YEPB 1D5MC 5G55A 2HE7A 4LDTB 3VR8B 2JZPA 1L0YB 2WXJA 1WZ3A 1J7BA 2D2QA 3ZGZA 2M8SA 4MJSB 1D3ZA 1T6BX 3AEEB 4MACA 2DBYA 2W82A 1C78A 4HROA 4BKTA 2KWVB 1XF5L 2O6VA 4A20A 1JWUD 2BGFA 4DQOC 1XQQA 5H92C 5E6NA 3APFA 4W9FA 1SSNA 2ZPNA 3B2FA 3N1ZC 3KH0A 1P98A 3NUHB 3W2DA 1YJ1A 2QJLA 3O13A 2E6XA 2IO2B 3A1QA 2M4NA 3AEBB 3ZRFA 5AZHA 1P9DU 4WJPA 2KTFA 4HLEA 3QJZA 2LEKA 5KHOA 1IUEA 3VAWA 4GDKB 5MPOA 5IOIA 4YT0B 1N61A 3OJ3A 1UGJA 2G45B 4WWMA 5IKCM 1RLFA 2WXPA 1VZ6A 4ZOHC 2IO0B 2UU7A 1F77A 3DVGX 2KFKA 2AQ3B 4IM0A 1MG4A 2PE6B 3TJPA 4WAAA 3N3KB 4IOIE 2Y5CA 4PYUA 1WGHA 2W3SA 1AWDA 1FXAA 2JSVX 1UZXB 2J52A 1C77A 4EOYA 2DZKA 2K3UA 2RGFA 4JLCA 3AEFB 5FK9C 2JYTA 2RDHA 2SEBD 2D07B 4YTMB 3ZNID 2JX5A 3Q8AA 3ML9A 4M8MA 3RUIB 1CQVA 1QT9A 1C3TA 4MGYE 1KLUD 2CHZA 4IC7B 3KW5B 1NYQA 3TCAA 3B2GA 3DVGY 2JF5A 2FBWB 2W55A 2WX1A 4KX6B 1XEEA 1LO5D 5JXVA 3J9CA 4LNFA 2LHEA 4GIVA 1PQSA 3AULA 1L7YA 3MC8A 5EE1A 3W1YA 3EFCA 2G3QB 2K6DB 3WIMA 1B9RA 2AQ1B 3OAWA 2QC8A 1ZGUB 2Z59B 2WXKA 1I7HA 2O2VA 3Q3MC 4MGIE 3PVLA 3PRPB 4LNNA 1GB4A 1V8CA 2MRPA 4M0WA 1GNUA 2DHZA 1VZ8A 3ABVB 2MBQA 2LXAA 3L10B 3ZLZA 1Q1OA 3VUYA 3ENEA 3RPFC 3IXSA 3U52E 2KACA 4KZ0A 3P42A 4HCNB 4RH6A 3EHVA 3LJ3A 1SJED 1FEHA 1P7EA 4L2YA 3LDZE 3VUWA 3HM3A 3Q8BA 2KLGA 3U2SC 4LTUA 2MP2A 2MBHA 2MW5A 3UQBA 1TTNA 2DYMA 2PVGC 2MLBA 3UGBB 4KGTA 3QC8B 3UIOB 2MJ3A 2KFJA 3VH4B 2KO3A 4JX1C 2LVQA 4XWWA 2JUOA 5BYRA 2KC2A 2X38A 3MC0B 3I9V1 3VTVA 1WYGA 2V1YA 4BVUC 3DHHC 3M3JA 4HPLB 4P16A 2BYTA 3KUDB 1ENFA 2AYOB 5AUKA 1KF6B 2NBUA 2ACZB 2BS3B 3NOBA 2GB1A 2HTME 1PFDA 2K8CA 2BYVE 3S2AA 4WWNA 2O6VD 1V5OA 4MEMA 2AL6A 1TZ1A 2K25A 4ICVA 3P4RB 4MH8A 1FM0D 2XK5B 1WGRA 1NI2A 3NY5A 4LK0M 2KJRA 2N7EA 3N32A 3DBRI 4C4VB 4AJYB 3RNGC 4N58A 2H89B 1XO3A 2DZMA 2MHJA 1V1OA 1JQ4A 1V9JA 1T0SC 3X0WA 3SFEB 4KGSA 3W1SA 1LFDA 5HHDG 1YX5B 2MQJA 3IAM1 1K52A 1NI3A 2QMTA 2LGYA 3KQ4A 3WCQA 1XLNA 2M17A 2DAFA 5BMGA 4F1SA 3IG3A 2LUEA 4GGQA 2OJWA 4DDGD 3A9JB 4KZCA 3PHWB 1OQRA 3ZW3A 1CK1A 2WDRB 2O6VB 1A70A 3BIID 1WF9A 4RGTA 4CYEA 1RFKA 2N1VA 1ZXIA 4G3XB 4KIKB 2IGHA 1JRUA 1C4PA 2ZEQA 3ZJUA 2BBCA 2PPHA 5D7GA 3QIJA 4N9F4 1V97A 2KDIA 2WXGA 1IBXB 3A1QB 1C4CA 4CHKA 1JRPA 2WXIA 3QCAA 2J0MA 3PO0A 1UNSA 4JE3B 1H8CA 1SE4A 1WE7A 4MT5A 4S17A 5C3JB 2LRUA 1TY2A 2L05A 1I35A 1H4RA 1YD8U 1UWMA 3P1MA 1Q0WB 2BS2B 1NVID 1L6UA 3UIPB 2HJ1A 2N9PC 1L0VB 4ANVA 1FO4A 1WXQA 2KFKB 4IUMB 1MHXA 1ZOYB 2A5UA 2DZJA 3TEWA 3W5VB 1WIAA 3FILA 5IP4D 2PE9A 1FNUA 3BYTB 5E6OA 5E6JA 5IAAC 1F9JA 3TEYA 3FC4A 3KWLA 2MCNB 1UWXA 2WWZA 4M00A 1QLBB 3Q3FA 1PYWD 2LUMA 4QAYA 3AB5A 2BS4B 2ZW0A 1JWAD 3RT3B 3PT2B 3NS8A 4HJGE 2QSDA 4RGOS 4KVGB 1WYWB 3AU5A 4P1BC 3KUCB 3RNBC 2ZNVC 3AE8B 3NG0A 1I4XA 2KMMA 2RDGA 1JW9D 1LGRA 2FE8A 2L00B 3MHZA 3KWVA 2LJ5A 4ANXA 3A9KB 1EM7A 3ML8A 2QCZA 1S1QB 2DLBA 2WU5B 2O2VB 2N9XA 2IO1B 3JYUA 3RI7C 2KC1A 1TT5B 4PK1A 4M8NA 1IP9A 1UUPA 2KLCA 3EECA 1WFYA 1ZPSA 4M0WB 4MGKE 4LNKA 4YL8A 5CHWA 1D4BA 2MX2A 1GPXA 1FNVA 3VRAB 1WMHA 3IHPC 3PRZA 4I6PA 2PJHA 1BXTA 1E90A 2LD9A 2YEPF 2D10A 4NQLB 4B95A 1C4AA 1OTRB 1UGMA 4HRSA 1M94A 2LASA 2FCNA 2MP2B 4A90A 4K7SA 4LLGM 2N0SB 3TEZA 1SF0A 4BKGA 3PPAA 1AYFA 4E74A 4GXBA 5D2MB 2ZCBA 2L3ZA 4RCOA 4C7ZA 5LXIB 2LGSA 5JHBA 3AM9A 1HTQA 3RMKC 2G4DB 3T9LA 1R4MI 3P4PB 4PYZA 4DWFA 2K0PA 2QIEB 1UBIA 2MJDA 3VTUA 3RD2A 2DX5B 2FUHB 4C56C 2V4LA 2MBOA 2W54A 2IBIB 2LGXA 4IKGA 5HG2A 4ZHOA 1I4RA 4ZRJA 2REXA 2PEAA 1I4QA 3DBLB 1YNTE 4BKSA 5J17A 2LWPA 2NTSA 2FAZA 2RD0A 3ZDTA 3WALA 2KK8A 3MC9A 1UH6A 4J3OD 3VQIA 1PGXA 1Y56A 3RCZA 4MDKE 1R7SA 3OWEB 3V62A 3MP9A 1N5XA 3B1LX 4TUUA 3P63A 4URKA 4E3CA 2W9NA 2K22A 2JWUA 3AE9B 1HE8A 3A33B 1G6JA 4IWPA 4FHJA 1IGCA 4RF1A 1ISNA 3ZXRA 2CU3A 3I57A 4FLHA 3PGEA 3SR6A 2NVUI 1WJ6A 2NPTB 2PKOA 4FA6A 4UDUC 4G50A 3APDA 4A9AA 4IDIA 3AH7A 1R4NB 2V4IB 1EWCA 2LGIA 4HKQA 2GBMA 2FNJB 4MSQB 1KLGD 4BOZB 4PS7A 2J7QB 3ZO5B 3JSVA 1XCTL 4YTNB 4ITKA 3ZIMA 3U7DA 1N6ZA 2A4ZA 1ZW7A 2L52A 3JVZX 1AN8A 5BYQA 3U8ZA 4I6LB 1I4HA 4NJCA 3SHQA 3TEXA 2GBJA 4IM3A 3M63B 3T3OA 1VCBA 4WJOA 4JWUC 3H1UA 5DPSA 4P6VF 3NZUA 1TBEA 2N7JA 4W9CA 1Q10A 4ARIA 1N60A 1DOXA 2AX5A 1GUAB 2WXHA 1E8XA 5EE9A 1QKZA 2IPKD 3AI5A 1WX7A 3DBHB 1XLPA 4EZKA 1P1AA 4XZ4A 4IWQA 3PZ8A 1P0RA 1NENB 4ZRQA 2WYQA 1J0GA 2BTEA 4MH0E 4TKNA 4OVVA 2PTLA 1SE3A 3C8YA 2DENB 2EELA 2ZVOA 3GE8C 3DBSA 2Y3AA 2L32A 3ZKJC 1J7CA 2NR2A 4ASWC 4RNAA 2DYBA 1E6EB 1FCCC 1ZKHA 1PUTA 4NY0A 2L83A 2CS4A 2JYEA 2N9EB 1HXYD 3RZWC 1TYGB 1TY0A 5D94A 1TS4A 1ROEA 1WXVA 5LLIA 2MH7A 2D3CA 4JPSA 3MTNB 5JZEB 4XYCA 4JIOU 4OZAA 2XBBC 3CWIA 3KYDD 4REZA 1KJTA 4RMAA 3VVWB 1VD2A 1TIFA 1Q5WB 2K1FA 1KRHA 3V6CB 1SIFA 1YQBA 1A5RA 2KD0A 3AU4A 2X8XX 4H2AA 3URYA 4TMAB 1SEBD 5EE0A 2IO3B 4JWSC 4WIPA 3LB8C 4TSSA 4C7YA 4HVBA 1L2NA 1FD6A 3CSTA 1WE6A 3GZNI 3RFZB 4DHJD 3NVYA 3ZJTA 1V5TA 4IWOA 4A3OA 4IW0A 1U4AA 4NJ6A 4XGAB 1UBQA 1PDXA 2IDYA 3ONSA 3HHMA 2WNMA 3MJ5A 3TSSA 1JWSD 4BBNF 2ZVNA 2FUG1 2WLBA 4ZRKA 3IT4B 3NVWA 4RGNA 1WMHB 4W9DA 2BWFA 4G11A 3V3XA 2OOBB 1HA5A 1WJUA 4BKSD 3H7SA 3AN1A 2YVCA 2KX3A 1KM7A 2K5PA 2PLPA 1OFFA 2KQ7A 3DWGC 4NAMA 3VUXA 1WGDA 3O65B 5L95C 4AJWA 2L0TA 3RYTA 3DDCB 4JL9A 4K7UA 3K9OB 1GG3A 2I2YA 4FJZA 3E9SA 3KLSX 5LXHA 2KDFB 1E8ZA 4GDLA 2VRRB 4DHJB 3P2BA 2J53A 2YLMA 3ZUNA 1WR1A 4FULA 3AE4B 5DPWA 4YWGG 3DHIC 4OZBA 1WXMA 1EWYC 1MJDA 1QZEA 3GB1A 4MM3A 1WXAA 3N9YC 1WRIA 3L4PA 3T8MA 3V61A 2KWCA 2RSUA 4HEA1 3ZNGC 4NAWB 5FKAC 4HXDA 1WJ4A 2C9WB 3R7QA 3AXCA 2GMIC 1DGJA 3MHSD 1AW7A 2M19A 1SE9A 2KQSA 2Q5WD 4K3BA 1MVKA 1T0YA 3AEGB 2IGGA 3ZTCA 5I4DA 3R2IA 1WGGA 3SU8X 3EC8A 1WX8A 4MGZE 1WR6E 2QHOA 3WANA 1D5XC 4TQ0A 1E7PB 3V6EB 1XLQA 4LCDE 2D11A 4GB9A 2RPQA 2CR5A 2I1KA 3L08A 2GI9A 3L13A 1QF6A 3TL5A 2NMQA 2BWES 3AE3B 2B3AA 1TS5A 3TUOA 4EKUA 3EFUA 3BK2A 1FNWA 2HD5B 4E71A 4WAFA 2CHWA 2WXOA 2MBBB 3HUIA 5IA7A 1HZ6A 3TMPB 3N30A 2MJEA 2Y5PA 3EUB2 1UF0A 5JH5C 4ZYSA 1UELA 4OHJA 4WWPA 3QAQA 4BAXA 3H7PA 3IAS1 4W9LA 3R3MA 3AE1B 1PGAA 5L83A 3PS6A 2BYFA 4S0RA 1QOAA 4KDIC 1FCLA 3GOEA 4GLSC 2KZRA 4OZCA 4IM2A 3Q2AC 5CX3A 4DHZE 3NRZA 2K8HA 1TS3A 4A6QA 2AWTA 2BT6A 4DXAB 4X57B 1Z5SB 2ONQA 1T0QC 2ASQA 4DXFA 3NJTA 3QA8A 4BBNC 2DNFA 3DHGC 3N20C 2WU2B 3JW0X 3DVNV 2BYEA 1KFYB 4K1RB 3PRMB 2GLSA 4BOSC 1I42A 2M56B 3NVVA 4G0NB 1E5WA 1FFVA 4US8A 2Z0DB 2JQRB 2L1AA 3PTFC 5DPRA 1KLVA 1N63A 3HK0A 1TKEA 1E9MA 1M4VA 2B76B 3PLUA 2JPHA 1BT0A 3IBEA 3BVGA 3R8BA 1KH0A 1JWMD 2V3SA 1IYFA 2D3GA 4EFOA 5AZGA 2J4XA 1XXGA 4RM8A 4YXDB 1CZPA 2CU1A 2QILA 1FPYA 3MFGA 2JXXA 4AOFA 1SJHD 5FR6A 4EE2A 3QQ8B 1L6VA 4HPPA 2DAJA 2N4FA 2HJ8A 4C80A 3GP7A 4LNIA 2Z8LA 3AE7B 1YJIA 4HPMB 1V6EA 3R66C 1F0ZA 4NJ7A 4RM9A 1WGYA 5H8YE 2N9LA 2WDQB 4XWTA 1XLOA 3SDLC 3ZNZB 1OQQA 3H6NA 1EF5A 5JHAA 1K51A 3IT6B 2HDEA 3NS1A 2J0JA 2LMCA 1C9FA 1WI0A 1VDVA 2NS5A 2JRHA 4N59A 2CKHB 3EA6A 2J42A 4XC2A 4EEWA 1E10A 3RN9C 5EDSA 2BB5A 5IO9A 1NEKB 3A4RA 3FAHA 1TJEA 3AMZA 2BPSA 1WH3A 1ZDXA 3OG5A 2LJIA 2WXQA 4L1BA 5FR3A 1HQRD 3LXFA 2MEKA 4R3DA 2RR9A 2WXFA 4HKZE 4B9KA 1V86A 2DYOA 3I63C 2E3TA 3U4EG 4W9KA 3QWZB 3GZNB 2V3PA 1L4DB 3I3TB 2V3NA 4GDLB 2IYDB 1SE2A 2VZKD 1Y8RC 4I6NB 2KVRA 2WS3B 1X1MA 1EU3A 4NPNA 4II2B 3PV1A 4B0MA 2XK5A 2N9KA 5HI1A 4MM3B 4M02A 5HKHA 1YQ3B 3KUZA 2K9XA 2KHWB 2BVCA 2QDFA 4KSLC 2FCQA 1D6EC 2JU6X 5C1ZA 2KWDA 3ZXVA 4YTPB 2KTRA 2XNAC 2K6QA 5BMHA 2I1JA 1OGWA 2KDEB 2XN9C 3RZFA 2KOXA 1ZP0B 4BFRA 1ZDVA 4NQKE 3TBLD 3VH3B 5KHQA 3ZJVA 3L0WB 3CMMB 4HDOA 3AEAB 3A9JA 3VDZA 2ZW1A 1RAXA 2WP9B 4F8CB 5DPTA 1WWTA 3GE3C 4O1NA 4A8XC 2K8BA 4ANWA 3HRDD 2VZKB 1GJZA 2D5GA 4YSXB 1KOTA 3L16A 4GSWA 3WAPA 3SD5A 1FMAD 3T3NA 3R7RA 4KIKA 1MG8A 3Q3OC 4ZRPA 5AUIA 1V1PA 1CMXB 4OVUA 3DBRB 4OVZA 4FJYA 3VHTC 4FJVB 1CJEA 1XT9B 1WGKA 4RF0A 5EE3A 3AECB 3TIXA 2D3BA 4J6IA 3ALBA 4FADA 3P4SB 2C60A 1IBXA 1F1HA 4RGMA 2V0GA 2RPVA 4ZRIA 1P3QU 2TSSA 2CJNA 4OW0A 3W9CB 1B1ZA 2C7NB 5C2TB 2V9HA 3V05A 2GOWA 4W9IA 3Q8EA 3H7PB 2BQQA 1K8RB 1STEA 4ZDVA 2KMAA 2LHDA 2JZZA 2MBEA 4WH4A 2JZ3B 1ET6A 4GMVA 4ARCA 4II3B 3W5UB 2DZIA 3Q69A 2JT4B 1YJJA 1TGZB 5T8IA 4P7IA 2KDMA 3V60A 2Y5BB 3DPDA 4HK2A 2PIAA 3FILB 4MELA 4LNOA 2KQ4X 1WY8A 4WQMA 1DOIA 1RWSA 2R61A 4WQOB 2GRIA 1HEZE 4HWIB 3NVZA 4ICUA 2K39A 2NBWB 3W1SC 1QILA 1VLBA 2KWUB 3UINB 1EUVB 4MSMB 2ZCCA 4W9HA 1L4ZB 3BY4B 4EZJA 2JXTA 3ETRA 4GN1A 3RNCC 2IZVB 3WAOA 2WXMA 2C7HA 1F2RC 3DWMA 1E8WA 3NZ3A 3U7ZA 4FBJB 3OJ4B 4CO7A 3A4SC 1F52A 3PSEB 3PREA 1OEYA 2C7MB 2ON8A 1WM2A 1EF1A 5AEKB 5TR5A 1LXDA 1J19A 3KVFB 3VXWA 3A9KA 2UWQA 1YX6B 3N1YC 5GMVA 2KX0A 2JWZA 1E7UA 4KSKC 1WSPA 2VH1A 5CTRC 2N7DA 3NHEB 4NZLB 2BB6A 2UYZB 4AQ7A 4L23A 4B6WA 3SFDB 4A55A 3UI3A 1V2YA 3HIZA 3I5JC 3Q3JA 2MSED 2CJOA 1K50A 4KDLB 2EKIA 3RULA 4KGRA 2EKEC 2KJHB 1SXTA 2LRWA 2WXLA 1AARA 2M1MA 4A3PA 4FHKA 3DBLI 1ZUD2 4XE0A 3Q8FA 3WA0A 1JALA 1YOVB 1GOZA 4F7ZA 2FCMA 2DWQA 1TKGA 1MHHE 3U30A 2KNBA 2OEDA 1C76A 3Q14C 1FRDA 2NBVB 2LI5A 1C79A 4K3CA 5IN7A 1GB1A 2BKFA 1TKYA 3X23A 4LJOB 4AP4C 2KKCA 1LM8B 2G1EA 2KJ6A 4ACFA 5GXGB 4EUTA 1ZE3D 3DCGA 1VR9A 2BW2A 5TSSA 2KMCA 3FKYA 1V80A 2KYWA 1VZ7A 3OLMD 4AWJA 2EMTA 1VRAB 3H9DA 1R4NI 4FXCA 3SEBA 1F2RI 3IFWB 1HZ5A 3QHTA 4K7WA 1XD3B 3ZRCA 2FCSA 2SAKA 4DBGA 1QOFA 2GBRA 5G5GA 3CIRB 2LFIA 1ET9A 4FN2A 1I4PA 4Q2JA 3WAMA 3BVMA 2KXJA 1RFAA 3QARA 2JRIB 2WDTB 5E6PA 2MWSB 1IGDA 4WJQA 2AQ2B 2WX0A 1N62A 4PS8A 3GS2A 1YN5A 2KTRB 4D2KA 3EGRA 3ZTDA 1R4MB 2GBKA 4MJSA 3BZDB 4AS1A 2L76A 4YSZB 1L0XB 2RDBC 1MFWA 4HCPB 1SIJA 2OHFA 2BKRB 4LJPB 1TS2A 1YN4A 5J18A 3DBHI 2LXCA 2NPTA 1EU4A 1D5ZC 3DVNU 5CHVC 2WHIA 3ZQ4A 3NZSA 2ZNVB 3H8HA 1YMHE 1SBBB 2J0KA 4DK5A 3MJWA 3JSVB 1T3QA 2IGDA 2BF8B 4HDQA 4IG7B 2LVOA 1Z2MA 1UD7A 3RNAC 4USAA 1WX9A 3LYYA 3DQVA 4P1CC 2KVZA 1V1PB 4WJNA 4GDKA 3ZVVA 2AL3A 1PGBA 2QEJC 5BMIA 1ZXHA 2PW9A 3P4QB 1K53A 3APCA 1LQBA 1V81A 2G4SA 2L0FA 5HFYA 1FRRA 2WDVB 1L5PA 3Q6BA 5D6JB 5BYSA 4TV3A 4YSYB 4WURA 4KKJA 4AUQC 4DXGA 1JROA 4JGHB 2LVPA 1SB3C 3B0AA 2RMMA 4W9JA 2OJRA 3CF6E 2ICIA 3BINA 5D3IB 1FXTB 2NTTA 2IY1B 1E8YA 1HTOA 2KANA 3PLVA 2ZJDA 3AE5B 4DDID 2VH2A 4PS3A 1TZOA 1RRBA 4GU2A 1XCQL 1RYJA 4ZHPA 4BZAA 3BYYB 4TQ1A 1EO6A 1OQYA 3ZYYX 1WM3A 3AEDB 1DOYA 4RFBA 2IJ0A 2PMVA 2EMSA 3PHXB 3ZNHB 1P7FA 2W3RA 4ANUA 2KT7A 1V49A 2XEWA 3VTWA 1OEYJ 4W9GA 1GAQB 3KYCD 3BK1A 1FFUA 1QQRA 3ZDMC 3HVDA 5AZFA 3VRBB 2M0AA 4KKIA 4ZYNA 1DYQA 4CQNA 1NDDA 1MI0A 3D32A 4PT5A 2CHXA 3HM6X 5C23A 1SGHA 2LZ6A 1JMLA 2INCC 3AE6B 3L17A 4XX5A 3L54A 2JVCA 2IY0B 3BVZA 4EZLA 1S3SG 2G9HD 2Z0EB 4US9A 3RNFC 1J7AA 2WXRA 1NYRA 3CSFA 1WJNA 3Q3NC 4KV2A 1T5XD 3HVZA 4WWOA 3VFKA 3B9JA 2ZZPB 3AE2B 1JWBD 2H88B 1GC7A 2R2OA 4N6EB 2INNE 3UF8A 3Q8CA 1J8CA 1VJKA 3AV8A 1YIWA 4B0EA 1E7VA 3QK0A 2JY6A 2MA9B 2D3AA 1JCKB 3IVFA 3ECIA 1YN3A 2KDBA 3RNEC 2INPE 2R2QA 3M95A 5CHFA 3VR9B 4XDCA 2WQYB 2M0XA 3R2TA 5DCNA 3QX1A 3E56A 2KAJA 3DOWA 3BWUD 4M01A 2INDC
chains in the Genus database with same CATH topology
2GBNA 1H8CA 4HJKA 2GOWA 4JQWC 4GOCA 5G2NA 4W9IA 1WE7A 2KQ7A 3C0RB 3VUXA 1WGDA 3H7PB 2LRUA 3O65B 1I35A 2L05A 1H4RA 1K8RB 1YD8U 4LDTD 4AJWA 5L95C 4ZDVA 2L0TA 1Q0WB 3M62B 2FIFA 2KMAA 3RYTA 3DDCB 4JL9A 4K7UA 2JZZA 1GG3A 3K9OB 2MBEA 4FJZA 3UIPB 2JZ3B 5LXHA 2AEHA 4GMVA 1GC6A 4II3B 2KDFB 1E8ZA 2HTHA 2DZIA 2N9PC 4GDLA 2VRRB 4DHJB 2JT4B 1TGZB 4P7IA 2NCNA 3P2BA 4ANVA 2L8JA 3V60A 2KFKB 4IUMB 2A5UA 2DZJA 2LGDA 2YLMA 1C1YB 3B08A 3ZUNA 2L7RA 1WR1A 2Y5BB 3DPDA 4FULA 4HK2A 4NNJB 1WIAA 4MELA 2PE9A 2ZPYA 5E6OA 5DPWA 2N1WA 1WY8A 1WXSA 4W9EA 1WXMA 4WQOB 4HWIB 1QZEA 5IAAC 1F9JA 4MM3A 4ICUA 4K81A 1WXAA 2K39A 2MCNB 2NBWB 3UQAA 3W1SC 2WWZA 2KWUB 1IPGA 3T8MA 3V61A 3UINB 2KWCA 3Q3FA 1WZ0A 1EUVB 2C5LC 2RSUA 4MSMB 2ZCCA 4NAWA 3ZNGC 4NAWB 1NBFC 4HXDA 4W9HA 3RT3B 3PT2B 3NS8A 3BY4B 4EZJA 1WJ4A 2C9WB 5BO4B 3R7QA 2KN5A 3AXCA 4DHZB 2GMIC 3MHSD 3PZDA 4KVGB 1WYWB 3AU5A 2FIDA 4GN1A 2IZVB 3WAOA 1SE9A 1WRDB 2C7HA 2KQSA 5J2RA 3KUCB 3K9PB 1T0YA 1E8WA 2ZNVC 3ZTCA 4FBJB 5G55A 2HE7A 3OJ4B 4LDTB 4CO7A 3A4SC 1WGGA 3PSEB 3PREA 3SU8X 3EC8A 1WX8A 4MGZE 1OEYA 2C7MB 1WR6E 2QHOA 3WANA 1WZ3A 1WM2A 1EF1A 2L00B 5AEKB 5TR5A 4TQ0A 2D2QA 2LJ5A 2M8SA 4ANXA 1LXDA 1J19A 3KVFB 4MJSB 3V6EB 1D3ZA 3VXWA 3A9KA 2UWQA 4LCDE 1YX6B 3A9KB 2D11A 5GMVA 2KX0A 4GB9A 2JWZA 2RPQA 3ML8A 1E7UA 2CR5A 2I1KA 3L08A 1S1QB 2KWVB 4KSKC 4BKTA 2O6VA 4A20A 3L13A 5CTRC 2N7DA 2BGFA 3NHEB 2O2VB 3TL5A 2N9XA 2BWES 2UYZB 2IO1B 3JYUA 1XQQA 4B6WA 2KC1A 5E6NA 3APFA 2B3AA 4W9FA 4M8NA 1IP9A 1V2YA 2KLCA 3EECA 1WFYA 4M0WB 2ZPNA 3HIZA 3Q3JA 4EKUA 3EFUA 4MGKE 2MSED 5CHWA 4YL8A 2MX2A 3KH0A 2HD5B 1P98A 4E71A 1YJ1A 4KDLB 2CHWA 3RULA 2MBBB 1WMHA 2EKEC 3IHPC 3PRZA 4I6PA 2PJHA 5IA7A 3TMPB 2IO2B 2KJHB 2LRWA 3N30A 1E90A 2LD9A 2D10A 1AARA 2M1MA 4A3PA 4FHKA 3DBLI 3WA0A 4NQLB 3A1QA 4B95A 2M4NA 3ZRFA 1OTRB 5AZHA 1UGMA 1P9DU 5JH5C 4WJPA 1M94A 2KTFA 2LASA 4F7ZA 1UELA 2FCMA 4HLEA 2FCNA 2MP2B 3QJZA 4K7SA 5KHOA 3VAWA 4GDKB 3U30A 4WWPA 3QAQA 2KNBA 4BKGA 3PPAA 4E74A 3H7PA 4GXBA 2ZCBA 2L3ZA 5D2MB 2NBVB 4W9LA 5LXIB 3R3MA 2LI5A 3OJ3A 2G45B 5JHBA 2BKFA 5L83A 3PS6A 2G4DB 3X23A 2BYFA 3T9LA 4LJOB 4AP4C 1RLFA 1R4MI 2KKCA 4KDIC 1LM8B 3GOEA 4PYZA 4DWFA 2KZRA 2IO0B 4IM2A 1UBIA 2KJ6A 5CX3A 4DHZE 2K8HA 3DVGX 4EUTA 2KFKA 3DCGA 4IM0A 3RD2A 3VTUA 2PE6B 2AWTA 2DX5B 4DXAB 4X57B 3TJPA 2FUHB 2KMCA 4WAAA 3N3KB 1V80A 4PYUA 2V4LA 1WGHA 1Z5SB 4AWJA 3OLMD 2MBOA 2ASQA 2EMTA 3H9DA 1R4NI 2IBIB 3QA8A 4BBNC 3JW0X 2LGXA 1UZXB 3IFWB 3DVNV 4EOYA 2DZKA 2BYEA 2RGFA 4K1RB 4JLCA 4ZRJA 3QHTA 4K7WA 1XD3B 2REXA 3ZRCA 2PEAA 2FCSA 3PRMB 4BOSC 1I42A 4DBGA 2GBRA 2D07B 3ZNID 4BKSA 5J17A 2LWPA 4FN2A 1E5WA 4G0NB 3ML9A 2FAZA 2RD0A 3WAMA 3ZDTA 4M8MA 2Z0DB 2KK8A 3RUIB 2KXJA 3WALA 1UH6A 1RFAA 3PTFC 2JRIB 3QARA 1C3TA 3VQIA 5DPRA 2WDTB 4MGYE 1KLVA 3HK0A 5E6PA 3RCZA 4MDKE 2CHZA 3V62A 4IC7B 3KW5B 2MWSB 3TCAA 4WJQA 2WX0A 3DVGY 3PLUA 2JF5A 2JPHA 1BT0A 4PS8A 3IBEA 3B1LX 2WX1A 4TUUA 4URKA 4E3CA 2W9NA 2KTRB 1HE8A 3A33B 3ZTDA 4GIVA 4IWPA 1G6JA 1PQSA 4FHJA 3AULA 1L7YA 3W1YA 1ISNA 2V3SA 1IYFA 2GBKA 2G3QB 2D3GA 2K6DB 4MJSA 4EFOA 2L76A 3WIMA 5AZGA 4FLHA 3OAWA 3PGEA 4HCPB 4RM8A 2BKRB 1ZGUB 2CU1A 4LJPB 2Z59B 2O2VA 5J18A 3DBHI 2LXCA 2NPTA 2NVUI 2JXXA 1WJ6A 2NPTB 4MGIE 4FA6A 3PVLA 3APDA 4G50A 3PRPB 3DVNU 4AOFA 2MRPA 1GNUA 5FR6A 2DHZA 2MBQA 2LXAA 3QQ8B 5CHVC 3L10B 3ZLZA 2GBMA 1Q1OA 2FNJB 3NZSA 4MSQB 3VUYA 3ENEA 2DAJA 2N4FA 2HJ8A 2ZNVB 4BOZB 2J0KA 4PS7A 2J7QB 4HPMB 4KZ0A 1V6EA 4HCNB 3ZO5B 3EHVA 4DK5A 3JSVA 3MJWA 3R66C 3JSVB 2BF8B 4HDQA 4IG7B 2LVOA 3LJ3A 4NJ7A 1Z2MA 1UD7A 4RM9A 3ZIMA 3U7DA 2A4ZA 1WGYA 1ZW7A 1WX9A 3JVZX 3LDZE 3DQVA 3VUWA 3U8ZA 3HM3A 2KLGA 3SDLC 4I6LB 4WJNA 3ZNZB 2MP2A 3SHQA 2MBHA 2GBJA 2MW5A 3H6NA 4GDKA 3M63B 4IM3A 3ZVVA 3UQBA 1EF5A 1TTNA 5JHAA 2AL3A 2J0JA 1WI0A 2DYMA 1VCBA 2MLBA 2NS5A 3UGBB 2JRHA 3APCA 4WJOA 3QC8B 1LQBA 3H1UA 3UIOB 2CKHB 1V81A 2G4SA 2KFJA 2L0FA 4XC2A 2KO3A 3VH4B 4EEWA 5DPSA 5EDSA 2LVQA 3NZUA 1TBEA 2JUOA 5D6JB 4W9CA 4TV3A 2KC2A 3A4RA 3VTVA 1GUAB 2V1YA 1E8XA 2BPSA 4AUQC 4BVUC 1WH3A 3AI5A 1WX7A 3M3JA 4HPLB 4JGHB 4EZKA 1P1AA 4XZ4A 4IWQA 2LVPA 3B0AA 1P0RA 4W9JA 2OJRA 2RR9A 4B9KA 3KUDB 3CF6E 2AYOB 1V86A 2DYOA 3BINA 2WYQA 1J0GA 1FXTB 4MH0E 4TKNA 4OVVA 2NBUA 4W9KA 2IY1B 3QWZB 2DENB 1E8YA 2KANA 3PLVA 2ZJDA 2ZVOA 3NOBA 3DBSA 3I3TB 4GDLB 3ZKJC 4DDID 2IYDB 2K8CA 2BYVE 4PS3A 3S2AA 2NR2A 4WWNA 1RRBA 4GU2A 4ASWC 2O6VD 1V5OA 1Y8RC 4MEMA 2DYBA 4I6NB 2AL6A 1TZ1A 2KVRA 4TQ1A 1EO6A 1ZKHA 1X1MA 1OQYA 2K25A 4ICVA 4NY0A 1WM3A 4NPNA 4II2B 2CS4A 2N9EB 3PV1A 2XK5A 2XK5B 3RZWC 5D94A 1WGRA 1WXVA 1NI2A 5HKHA 3KUZA 3NY5A 2KJRA 2N7EA 3N32A 2KHWB 4KSLC 2FCQA 3DBRI 5LLIA 2EMSA 3PHXB 4AJYB 3ZNHB 3MTNB 4ANUA 5C1ZA 5JZEB 1V49A 4JIOU 2XEWA 2DZMA 2XBBC 2KTRA 3KYDD 3VTWA 1KJTA 1V9JA 1OEYJ 4RMAA 2K6QA 4W9GA 3KYCD 3X0WA 2I1JA 1OGWA 3VVWB 1VD2A 2KDEB 3ZDMC 1Q5WB 3W1SA 2K1FA 5AZFA 1LFDA 3RZFA 1YX5B 2KOXA 3V6CB 1SIFA 1YQBA 1A5RA 2KD0A 4ZYNA 3AU4A 4BFRA 2MQJA 4NQKE 3TBLD 1NDDA 2LGYA 3D32A 2CHXA 3HM6X 3VH3B 2M17A 5KHQA 2DAFA 5C23A 4F1SA 2IO3B 1SGHA 2LZ6A 3IG3A 2LUEA 4GGQA 3L17A 3L0WB 4DDGD 4XX5A 3L54A 3CMMB 4HDOA 3VDZA 2JVCA 2IY0B 3A9JA 3A9JB 4KZCA 4EZLA 4HVBA 1RAXA 1S3SG 4F8CB 1L2NA 3PHWB 5DPTA 3CSTA 2Z0EB 1WE6A 3GZNI 2K8BA 4ANWA 4DHJD 3ZW3A 3CSFA 1GJZA 2O6VB 1WJNA 1WF9A 1V5TA 4KV2A 4CYEA 4IWOA 4A3OA 4WWOA 2N1VA 4IW0A 3VFKA 1U4AA 4NJ6A 3L16A 1KOTA 1UBQA 4GSWA 2ZZPB 3WAPA 3ONSA 4G3XB 3SD5A 1GC7A 2R2OA 3HHMA 3R7RA 4KIKA 1MG8A 4KIKB 3UF8A 1J8CA 4BBNF 1YIWA 1CMXB 2ZVNA 4OVUA 1JRUA 1E7VA 4ZRKA 3QK0A 2JY6A 2MA9B 4FJYA 1WMHB 4W9DA 3VHTC 2BWFA 2ZEQA 3IVFA 4FJVB 1XT9B 3ECIA 2PPHA 5D7GA 3TIXA 2KDBA 3QIJA 4G11A 2R2QA 3M95A 5CHFA 2OOBB 4N9F4 4J6IA 3ALBA 1WJUA 4FADA 4BKSD 2M0XA 2C60A 2KDIA 3H7SA 5DCNA 2YVCA 3A1QB 3QX1A 4ZRIA 1P3QU 4CHKA 2KX3A 3QCAA 1KM7A 2J0MA 3DOWA 2C7NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBN A;  1H8C A;  4HJK A;  2GOW A;  4JQW C;  4GOC A;  5G2N A;  4W9I A;  1WE7 A;  2KQ7 A;  3C0R B;  3VUX A;  1WGD A;  3H7P B;  2LRU A;  3O65 B;  1I35 A;  2L05 A;  1H4R A;  1K8R B;  1YD8 U;  4LDT D;  4AJW A;  5L95 C;  4ZDV A;  2L0T A;  1Q0W B;  3M62 B;  2FIF A;  2KMA A;  3RYT A;  3DDC B;  4JL9 A;  4K7U A;  2JZZ A;  1GG3 A;  3K9O B;  2MBE A;  4FJZ A;  3UIP B;  2JZ3 B;  5LXH A;  2AEH A;  4GMV A;  1GC6 A;  4II3 B;  2KDF B;  1E8Z A;  2HTH A;  2DZI A;  2N9P C;  4GDL A;  2VRR B;  4DHJ B;  2JT4 B;  1TGZ B;  4P7I A;  2NCN A;  3P2B A;  4ANV A;  2L8J A;  3V60 A;  2KFK B;  4IUM B;  2A5U A;  2DZJ A;  2LGD A;  2YLM A;  1C1Y B;  3B08 A;  3ZUN A;  2L7R A;  1WR1 A;  2Y5B B;  3DPD A;  4FUL A;  4HK2 A;  4NNJ B;  1WIA A;  4MEL A;  2PE9 A;  2ZPY A;  5E6O A;  5DPW A;  2N1W A;  1WY8 A;  1WXS A;  4W9E A;  1WXM A;  4WQO B;  4HWI B;  1QZE A;  5IAA C;  1F9J A;  4MM3 A;  4ICU A;  4K81 A;  1WXA A;  2K39 A;  2MCN B;  2NBW B;  3UQA A;  3W1S C;  2WWZ A;  2KWU B;  1IPG A;  3T8M A;  3V61 A;  3UIN B;  2KWC A;  3Q3F A;  1WZ0 A;  1EUV B;  2C5L C;  2RSU A;  4MSM B;  2ZCC A;  4NAW A;  3ZNG C;  4NAW B;  1NBF C;  4HXD A;  4W9H A;  3RT3 B;  3PT2 B;  3NS8 A;  3BY4 B;  4EZJ A;  1WJ4 A;  2C9W B;  5BO4 B;  3R7Q A;  2KN5 A;  3AXC A;  4DHZ B;  2GMI C;  3MHS D;  3PZD A;  4KVG B;  1WYW B;  3AU5 A;  2FID A;  4GN1 A;  2IZV B;  3WAO A;  1SE9 A;  1WRD B;  2C7H A;  2KQS A;  5J2R A;  3KUC B;  3K9P B;  1T0Y A;  1E8W A;  2ZNV C;  3ZTC A;  4FBJ B;  5G55 A;  2HE7 A;  3OJ4 B;  4LDT B;  4CO7 A;  3A4S C;  1WGG A;  3PSE B;  3PRE A;  3SU8 X;  3EC8 A;  1WX8 A;  4MGZ E;  1OEY A;  2C7M B;  1WR6 E;  2QHO A;  3WAN A;  1WZ3 A;  1WM2 A;  1EF1 A;  2L00 B;  5AEK B;  5TR5 A;  4TQ0 A;  2D2Q A;  2LJ5 A;  2M8S A;  4ANX A;  1LXD A;  1J19 A;  3KVF B;  4MJS B;  3V6E B;  1D3Z A;  3VXW A;  3A9K A;  2UWQ A;  4LCD E;  1YX6 B;  3A9K B;  2D11 A;  5GMV A;  2KX0 A;  4GB9 A;  2JWZ A;  2RPQ A;  3ML8 A;  1E7U A;  2CR5 A;  2I1K A;  3L08 A;  1S1Q B;  2KWV B;  4KSK C;  4BKT A;  2O6V A;  4A20 A;  3L13 A;  5CTR C;  2N7D A;  2BGF A;  3NHE B;  2O2V B;  3TL5 A;  2N9X A;  2BWE S;  2UYZ B;  2IO1 B;  3JYU A;  1XQQ A;  4B6W A;  2KC1 A;  5E6N A;  3APF A;  2B3A A;  4W9F A;  4M8N A;  1IP9 A;  1V2Y A;  2KLC A;  3EEC A;  1WFY A;  4M0W B;  2ZPN A;  3HIZ A;  3Q3J A;  4EKU A;  3EFU A;  4MGK E;  2MSE D;  5CHW A;  4YL8 A;  2MX2 A;  3KH0 A;  2HD5 B;  1P98 A;  4E71 A;  1YJ1 A;  4KDL B;  2CHW A;  3RUL A;  2MBB B;  1WMH A;  2EKE C;  3IHP C;  3PRZ A;  4I6P A;  2PJH A;  5IA7 A;  3TMP B;  2IO2 B;  2KJH B;  2LRW A;  3N30 A;  1E90 A;  2LD9 A;  2D10 A;  1AAR A;  2M1M A;  4A3P A;  4FHK A;  3DBL I;  3WA0 A;  4NQL B;  3A1Q A;  4B95 A;  2M4N A;  3ZRF A;  1OTR B;  5AZH A;  1UGM A;  1P9D U;  5JH5 C;  4WJP A;  1M94 A;  2KTF A;  2LAS A;  4F7Z A;  1UEL A;  2FCM A;  4HLE A;  2FCN A;  2MP2 B;  3QJZ A;  4K7S A;  5KHO A;  3VAW A;  4GDK B;  3U30 A;  4WWP A;  3QAQ A;  2KNB A;  4BKG A;  3PPA A;  4E74 A;  3H7P A;  4GXB A;  2ZCB A;  2L3Z A;  5D2M B;  2NBV B;  4W9L A;  5LXI B;  3R3M A;  2LI5 A;  3OJ3 A;  2G45 B;  5JHB A;  2BKF A;  5L83 A;  3PS6 A;  2G4D B;  3X23 A;  2BYF A;  3T9L A;  4LJO B;  4AP4 C;  1RLF A;  1R4M I;  2KKC A;  4KDI C;  1LM8 B;  3GOE A;  4PYZ A;  4DWF A;  2KZR A;  2IO0 B;  4IM2 A;  1UBI A;  2KJ6 A;  5CX3 A;  4DHZ E;  2K8H A;  3DVG X;  4EUT A;  2KFK A;  3DCG A;  4IM0 A;  3RD2 A;  3VTU A;  2PE6 B;  2AWT A;  2DX5 B;  4DXA B;  4X57 B;  3TJP A;  2FUH B;  2KMC A;  4WAA A;  3N3K B;  1V80 A;  4PYU A;  2V4L A;  1WGH A;  1Z5S B;  4AWJ A;  3OLM D;  2MBO A;  2ASQ A;  2EMT A;  3H9D A;  1R4N I;  2IBI B;  3QA8 A;  4BBN C;  3JW0 X;  2LGX A;  1UZX B;  3IFW B;  3DVN V;  4EOY A;  2DZK A;  2BYE A;  2RGF A;  4K1R B;  4JLC A;  4ZRJ A;  3QHT A;  4K7W A;  1XD3 B;  2REX A;  3ZRC A;  2PEA A;  2FCS A;  3PRM B;  4BOS C;  1I42 A;  4DBG A;  2GBR A;  2D07 B;  3ZNI D;  4BKS A;  5J17 A;  2LWP A;  4FN2 A;  1E5W A;  4G0N B;  3ML9 A;  2FAZ A;  2RD0 A;  3WAM A;  3ZDT A;  4M8M A;  2Z0D B;  2KK8 A;  3RUI B;  2KXJ A;  3WAL A;  1UH6 A;  1RFA A;  3PTF C;  2JRI B;  3QAR A;  1C3T A;  3VQI A;  5DPR A;  2WDT B;  4MGY E;  1KLV A;  3HK0 A;  5E6P A;  3RCZ A;  4MDK E;  2CHZ A;  3V62 A;  4IC7 B;  3KW5 B;  2MWS B;  3TCA A;  4WJQ A;  2WX0 A;  3DVG Y;  3PLU A;  2JF5 A;  2JPH A;  1BT0 A;  4PS8 A;  3IBE A;  3B1L X;  2WX1 A;  4TUU A;  4URK A;  4E3C A;  2W9N A;  2KTR B;  1HE8 A;  3A33 B;  3ZTD A;  4GIV A;  4IWP A;  1G6J A;  1PQS A;  4FHJ A;  3AUL A;  1L7Y A;  3W1Y A;  1ISN A;  2V3S A;  1IYF A;  2GBK A;  2G3Q B;  2D3G A;  2K6D B;  4MJS A;  4EFO A;  2L76 A;  3WIM A;  5AZG A;  4FLH A;  3OAW A;  3PGE A;  4HCP B;  4RM8 A;  2BKR B;  1ZGU B;  2CU1 A;  4LJP B;  2Z59 B;  2O2V A;  5J18 A;  3DBH I;  2LXC A;  2NPT A;  2NVU I;  2JXX A;  1WJ6 A;  2NPT B;  4MGI E;  4FA6 A;  3PVL A;  3APD A;  4G50 A;  3PRP B;  3DVN U;  4AOF A;  2MRP A;  1GNU A;  5FR6 A;  2DHZ A;  2MBQ A;  2LXA A;  3QQ8 B;  5CHV C;  3L10 B;  3ZLZ A;  2GBM A;  1Q1O A;  2FNJ B;  3NZS A;  4MSQ B;  3VUY A;  3ENE A;  2DAJ A;  2N4F A;  2HJ8 A;  2ZNV B;  4BOZ B;  2J0K A;  4PS7 A;  2J7Q B;  4HPM B;  4KZ0 A;  1V6E A;  4HCN B;  3ZO5 B;  3EHV A;  4DK5 A;  3JSV A;  3MJW A;  3R66 C;  3JSV B;  2BF8 B;  4HDQ A;  4IG7 B;  2LVO A;  3LJ3 A;  4NJ7 A;  1Z2M A;  1UD7 A;  4RM9 A;  3ZIM A;  3U7D A;  2A4Z A;  1WGY A;  1ZW7 A;  1WX9 A;  3JVZ X;  3LDZ E;  3DQV A;  3VUW A;  3U8Z A;  3HM3 A;  2KLG A;  3SDL C;  4I6L B;  4WJN A;  3ZNZ B;  2MP2 A;  3SHQ A;  2MBH A;  2GBJ A;  2MW5 A;  3H6N A;  4GDK A;  3M63 B;  4IM3 A;  3ZVV A;  3UQB A;  1EF5 A;  1TTN A;  5JHA A;  2AL3 A;  2J0J A;  1WI0 A;  2DYM A;  1VCB A;  2MLB A;  2NS5 A;  3UGB B;  2JRH A;  3APC A;  4WJO A;  3QC8 B;  1LQB A;  3H1U A;  3UIO B;  2CKH B;  1V81 A;  2G4S A;  2KFJ A;  2L0F A;  4XC2 A;  2KO3 A;  3VH4 B;  4EEW A;  5DPS A;  5EDS A;  2LVQ A;  3NZU A;  1TBE A;  2JUO A;  5D6J B;  4W9C A;  4TV3 A;  2KC2 A;  3A4R A;  3VTV A;  1GUA B;  2V1Y A;  1E8X A;  2BPS A;  4AUQ C;  4BVU C;  1WH3 A;  3AI5 A;  1WX7 A;  3M3J A;  4HPL B;  4JGH B;  4EZK A;  1P1A A;  4XZ4 A;  4IWQ A;  2LVP A;  3B0A A;  1P0R A;  4W9J A;  2OJR A;  2RR9 A;  4B9K A;  3KUD B;  3CF6 E;  2AYO B;  1V86 A;  2DYO A;  3BIN A;  2WYQ A;  1J0G A;  1FXT B;  4MH0 E;  4TKN A;  4OVV A;  2NBU A;  4W9K A;  2IY1 B;  3QWZ B;  2DEN B;  1E8Y A;  2KAN A;  3PLV A;  2ZJD A;  2ZVO A;  3NOB A;  3DBS A;  3I3T B;  4GDL B;  3ZKJ C;  4DDI D;  2IYD B;  2K8C A;  2BYV E;  4PS3 A;  3S2A A;  2NR2 A;  4WWN A;  1RRB A;  4GU2 A;  4ASW C;  2O6V D;  1V5O A;  1Y8R C;  4MEM A;  2DYB A;  4I6N B;  2AL6 A;  1TZ1 A;  2KVR A;  4TQ1 A;  1EO6 A;  1ZKH A;  1X1M A;  1OQY A;  2K25 A;  4ICV A;  4NY0 A;  1WM3 A;  4NPN A;  4II2 B;  2CS4 A;  2N9E B;  3PV1 A;  2XK5 A;  2XK5 B;  3RZW C;  5D94 A;  1WGR A;  1WXV A;  1NI2 A;  5HKH A;  3KUZ A;  3NY5 A;  2KJR A;  2N7E A;  3N32 A;  2KHW B;  4KSL C;  2FCQ A;  3DBR I;  5LLI A;  2EMS A;  3PHX B;  4AJY B;  3ZNH B;  3MTN B;  4ANU A;  5C1Z A;  5JZE B;  1V49 A;  4JIO U;  2XEW A;  2DZM A;  2XBB C;  2KTR A;  3KYD D;  3VTW A;  1KJT A;  1V9J A;  1OEY J;  4RMA A;  2K6Q A;  4W9G A;  3KYC D;  3X0W A;  2I1J A;  1OGW A;  3VVW B;  1VD2 A;  2KDE B;  3ZDM C;  1Q5W B;  3W1S A;  2K1F A;  5AZF A;  1LFD A;  3RZF A;  1YX5 B;  2KOX A;  3V6C B;  1SIF A;  1YQB A;  1A5R A;  2KD0 A;  4ZYN A;  3AU4 A;  4BFR A;  2MQJ A;  4NQK E;  3TBL D;  1NDD A;  2LGY A;  3D32 A;  2CHX A;  3HM6 X;  3VH3 B;  2M17 A;  5KHQ A;  2DAF A;  5C23 A;  4F1S A;  2IO3 B;  1SGH A;  2LZ6 A;  3IG3 A;  2LUE A;  4GGQ A;  3L17 A;  3L0W B;  4DDG D;  4XX5 A;  3L54 A;  3CMM B;  4HDO A;  3VDZ A;  2JVC A;  2IY0 B;  3A9J A;  3A9J B;  4KZC A;  4EZL A;  4HVB A;  1RAX A;  1S3S G;  4F8C B;  1L2N A;  3PHW B;  5DPT A;  3CST A;  2Z0E B;  1WE6 A;  3GZN I;  2K8B A;  4ANW A;  4DHJ D;  3ZW3 A;  3CSF A;  1GJZ A;  2O6V B;  1WJN A;  1WF9 A;  1V5T A;  4KV2 A;  4CYE A;  4IWO A;  4A3O A;  4WWO A;  2N1V A;  4IW0 A;  3VFK A;  1U4A A;  4NJ6 A;  3L16 A;  1KOT A;  1UBQ A;  4GSW A;  2ZZP B;  3WAP A;  3ONS A;  4G3X B;  3SD5 A;  1GC7 A;  2R2O A;  3HHM A;  3R7R A;  4KIK A;  1MG8 A;  4KIK B;  3UF8 A;  1J8C A;  4BBN F;  1YIW A;  1CMX B;  2ZVN A;  4OVU A;  1JRU A;  1E7V A;  4ZRK A;  3QK0 A;  2JY6 A;  2MA9 B;  4FJY A;  1WMH B;  4W9D A;  3VHT C;  2BWF A;  2ZEQ A;  3IVF A;  4FJV B;  1XT9 B;  3ECI A;  2PPH A;  5D7G A;  3TIX A;  2KDB A;  3QIJ A;  4G11 A;  2R2Q A;  3M95 A;  5CHF A;  2OOB B;  4N9F 4;  4J6I A;  3ALB A;  1WJU A;  4FAD A;  4BKS D;  2M0X A;  2C60 A;  2KDI A;  3H7S A;  5DCN A;  2YVC A;  3A1Q B;  3QX1 A;  4ZRI A;  1P3Q U;  4CHK A;  2KX3 A;  3QCA A;  1KM7 A;  2J0M A;  3DOW A;  2C7N B; 
#chains in the Genus database with same CATH topology
 2GBN A;  4HJK A;  4JQW C;  4GOC A;  5G2N A;  5LNK 1;  1KTK A;  3C0R B;  3C19 A;  4LDT D;  3M62 B;  2FIF A;  1FIQ A;  2KN4 A;  1MPE A;  5D3D A;  2AEH A;  1GC6 A;  1T0R C;  5G5H A;  1BUI C;  2HTH A;  1RM6 C;  2NCN A;  2L8J A;  2LGD A;  1C1Y B;  1QOB A;  3B08 A;  2L7R A;  4NNJ B;  1QOG A;  2ZPY A;  1E0Z A;  1ACC A;  2N1W A;  1ESF A;  1WXS A;  1I4G A;  4W9E A;  4XDD A;  2WGS A;  4K81 A;  3UQA A;  1IPG A;  4C4V A;  1WZ0 A;  2C5L C;  4NAW A;  1NBF C;  2I38 A;  4C00 A;  3N1X C;  5BO4 B;  2KN5 A;  1FXI A;  4DHZ B;  2WXN A;  3PZD A;  2FID A;  1BML C;  1WRD B;  2PVO D;  3PZ7 A;  5J2R A;  3K9P B;  1YQ4 B;  1N5W A;  2YEP B;  1D5M C;  5G55 A;  2HE7 A;  4LDT B;  3VR8 B;  2JZP A;  1L0Y B;  2WXJ A;  1WZ3 A;  1J7B A;  2D2Q A;  3ZGZ A;  2M8S A;  4MJS B;  1D3Z A;  1T6B X;  3AEE B;  4MAC A;  2DBY A;  2W82 A;  1C78 A;  4HRO A;  4BKT A;  2KWV B;  1XF5 L;  2O6V A;  4A20 A;  1JWU D;  2BGF A;  4DQO C;  1XQQ A;  5H92 C;  5E6N A;  3APF A;  4W9F A;  1SSN A;  2ZPN A;  3B2F A;  3N1Z C;  3KH0 A;  1P98 A;  3NUH B;  3W2D A;  1YJ1 A;  2QJL A;  3O13 A;  2E6X A;  2IO2 B;  3A1Q A;  2M4N A;  3AEB B;  3ZRF A;  5AZH A;  1P9D U;  4WJP A;  2KTF A;  4HLE A;  3QJZ A;  2LEK A;  5KHO A;  1IUE A;  3VAW A;  4GDK B;  5MPO A;  5IOI A;  4YT0 B;  1N61 A;  3OJ3 A;  1UGJ A;  2G45 B;  4WWM A;  5IKC M;  1RLF A;  2WXP A;  1VZ6 A;  4ZOH C;  2IO0 B;  2UU7 A;  1F77 A;  3DVG X;  2KFK A;  2AQ3 B;  4IM0 A;  1MG4 A;  2PE6 B;  3TJP A;  4WAA A;  3N3K B;  4IOI E;  2Y5C A;  4PYU A;  1WGH A;  2W3S A;  1AWD A;  1FXA A;  2JSV X;  1UZX B;  2J52 A;  1C77 A;  4EOY A;  2DZK A;  2K3U A;  2RGF A;  4JLC A;  3AEF B;  5FK9 C;  2JYT A;  2RDH A;  2SEB D;  2D07 B;  4YTM B;  3ZNI D;  2JX5 A;  3Q8A A;  3ML9 A;  4M8M A;  3RUI B;  1CQV A;  1QT9 A;  1C3T A;  4MGY E;  1KLU D;  2CHZ A;  4IC7 B;  3KW5 B;  1NYQ A;  3TCA A;  3B2G A;  3DVG Y;  2JF5 A;  2FBW B;  2W55 A;  2WX1 A;  4KX6 B;  1XEE A;  1LO5 D;  5JXV A;  3J9C A;  4LNF A;  2LHE A;  4GIV A;  1PQS A;  3AUL A;  1L7Y A;  3MC8 A;  5EE1 A;  3W1Y A;  3EFC A;  2G3Q B;  2K6D B;  3WIM A;  1B9R A;  2AQ1 B;  3OAW A;  2QC8 A;  1ZGU B;  2Z59 B;  2WXK A;  1I7H A;  2O2V A;  3Q3M C;  4MGI E;  3PVL A;  3PRP B;  4LNN A;  1GB4 A;  1V8C A;  2MRP A;  4M0W A;  1GNU A;  2DHZ A;  1VZ8 A;  3ABV B;  2MBQ A;  2LXA A;  3L10 B;  3ZLZ A;  1Q1O A;  3VUY A;  3ENE A;  3RPF C;  3IXS A;  3U52 E;  2KAC A;  4KZ0 A;  3P42 A;  4HCN B;  4RH6 A;  3EHV A;  3LJ3 A;  1SJE D;  1FEH A;  1P7E A;  4L2Y A;  3LDZ E;  3VUW A;  3HM3 A;  3Q8B A;  2KLG A;  3U2S C;  4LTU A;  2MP2 A;  2MBH A;  2MW5 A;  3UQB A;  1TTN A;  2DYM A;  2PVG C;  2MLB A;  3UGB B;  4KGT A;  3QC8 B;  3UIO B;  2MJ3 A;  2KFJ A;  3VH4 B;  2KO3 A;  4JX1 C;  2LVQ A;  4XWW A;  2JUO A;  5BYR A;  2KC2 A;  2X38 A;  3MC0 B;  3I9V 1;  3VTV A;  1WYG A;  2V1Y A;  4BVU C;  3DHH C;  3M3J A;  4HPL B;  4P16 A;  2BYT A;  3KUD B;  1ENF A;  2AYO B;  5AUK A;  1KF6 B;  2NBU A;  2ACZ B;  2BS3 B;  3NOB A;  2GB1 A;  2HTM E;  1PFD A;  2K8C A;  2BYV E;  3S2A A;  4WWN A;  2O6V D;  1V5O A;  4MEM A;  2AL6 A;  1TZ1 A;  2K25 A;  4ICV A;  3P4R B;  4MH8 A;  1FM0 D;  2XK5 B;  1WGR A;  1NI2 A;  3NY5 A;  4LK0 M;  2KJR A;  2N7E A;  3N32 A;  3DBR I;  4C4V B;  4AJY B;  3RNG C;  4N58 A;  2H89 B;  1XO3 A;  2DZM A;  2MHJ A;  1V1O A;  1JQ4 A;  1V9J A;  1T0S C;  3X0W A;  3SFE B;  4KGS A;  3W1S A;  1LFD A;  5HHD G;  1YX5 B;  2MQJ A;  3IAM 1;  1K52 A;  1NI3 A;  2QMT A;  2LGY A;  3KQ4 A;  3WCQ A;  1XLN A;  2M17 A;  2DAF A;  5BMG A;  4F1S A;  3IG3 A;  2LUE A;  4GGQ A;  2OJW A;  4DDG D;  3A9J B;  4KZC A;  3PHW B;  1OQR A;  3ZW3 A;  1CK1 A;  2WDR B;  2O6V B;  1A70 A;  3BII D;  1WF9 A;  4RGT A;  4CYE A;  1RFK A;  2N1V A;  1ZXI A;  4G3X B;  4KIK B;  2IGH A;  1JRU A;  1C4P A;  2ZEQ A;  3ZJU A;  2BBC A;  2PPH A;  5D7G A;  3QIJ A;  4N9F 4;  1V97 A;  2KDI A;  2WXG A;  1IBX B;  3A1Q B;  1C4C A;  4CHK A;  1JRP A;  2WXI A;  3QCA A;  2J0M A;  3PO0 A;  1UNS A;  4JE3 B;  1H8C A;  1SE4 A;  1WE7 A;  4MT5 A;  4S17 A;  5C3J B;  2LRU A;  1TY2 A;  2L05 A;  1I35 A;  1H4R A;  1YD8 U;  1UWM A;  3P1M A;  1Q0W B;  2BS2 B;  1NVI D;  1L6U A;  3UIP B;  2HJ1 A;  2N9P C;  1L0V B;  4ANV A;  1FO4 A;  1WXQ A;  2KFK B;  4IUM B;  1MHX A;  1ZOY B;  2A5U A;  2DZJ A;  3TEW A;  3W5V B;  1WIA A;  3FIL A;  5IP4 D;  2PE9 A;  1FNU A;  3BYT B;  5E6O A;  5E6J A;  5IAA C;  1F9J A;  3TEY A;  3FC4 A;  3KWL A;  2MCN B;  1UWX A;  2WWZ A;  4M00 A;  1QLB B;  3Q3F A;  1PYW D;  2LUM A;  4QAY A;  3AB5 A;  2BS4 B;  2ZW0 A;  1JWA D;  3RT3 B;  3PT2 B;  3NS8 A;  4HJG E;  2QSD A;  4RGO S;  4KVG B;  1WYW B;  3AU5 A;  4P1B C;  3KUC B;  3RNB C;  2ZNV C;  3AE8 B;  3NG0 A;  1I4X A;  2KMM A;  2RDG A;  1JW9 D;  1LGR A;  2FE8 A;  2L00 B;  3MHZ A;  3KWV A;  2LJ5 A;  4ANX A;  3A9K B;  1EM7 A;  3ML8 A;  2QCZ A;  1S1Q B;  2DLB A;  2WU5 B;  2O2V B;  2N9X A;  2IO1 B;  3JYU A;  3RI7 C;  2KC1 A;  1TT5 B;  4PK1 A;  4M8N A;  1IP9 A;  1UUP A;  2KLC A;  3EEC A;  1WFY A;  1ZPS A;  4M0W B;  4MGK E;  4LNK A;  4YL8 A;  5CHW A;  1D4B A;  2MX2 A;  1GPX A;  1FNV A;  3VRA B;  1WMH A;  3IHP C;  3PRZ A;  4I6P A;  2PJH A;  1BXT A;  1E90 A;  2LD9 A;  2YEP F;  2D10 A;  4NQL B;  4B95 A;  1C4A A;  1OTR B;  1UGM A;  4HRS A;  1M94 A;  2LAS A;  2FCN A;  2MP2 B;  4A90 A;  4K7S A;  4LLG M;  2N0S B;  3TEZ A;  1SF0 A;  4BKG A;  3PPA A;  1AYF A;  4E74 A;  4GXB A;  5D2M B;  2ZCB A;  2L3Z A;  4RCO A;  4C7Z A;  5LXI B;  2LGS A;  5JHB A;  3AM9 A;  1HTQ A;  3RMK C;  2G4D B;  3T9L A;  1R4M I;  3P4P B;  4PYZ A;  4DWF A;  2K0P A;  2QIE B;  1UBI A;  2MJD A;  3VTU A;  3RD2 A;  2DX5 B;  2FUH B;  4C56 C;  2V4L A;  2MBO A;  2W54 A;  2IBI B;  2LGX A;  4IKG A;  5HG2 A;  4ZHO A;  1I4R A;  4ZRJ A;  2REX A;  2PEA A;  1I4Q A;  3DBL B;  1YNT E;  4BKS A;  5J17 A;  2LWP A;  2NTS A;  2FAZ A;  2RD0 A;  3ZDT A;  3WAL A;  2KK8 A;  3MC9 A;  1UH6 A;  4J3O D;  3VQI A;  1PGX A;  1Y56 A;  3RCZ A;  4MDK E;  1R7S A;  3OWE B;  3V62 A;  3MP9 A;  1N5X A;  3B1L X;  4TUU A;  3P63 A;  4URK A;  4E3C A;  2W9N A;  2K22 A;  2JWU A;  3AE9 B;  1HE8 A;  3A33 B;  1G6J A;  4IWP A;  4FHJ A;  1IGC A;  4RF1 A;  1ISN A;  3ZXR A;  2CU3 A;  3I57 A;  4FLH A;  3PGE A;  3SR6 A;  2NVU I;  1WJ6 A;  2NPT B;  2PKO A;  4FA6 A;  4UDU C;  4G50 A;  3APD A;  4A9A A;  4IDI A;  3AH7 A;  1R4N B;  2V4I B;  1EWC A;  2LGI A;  4HKQ A;  2GBM A;  2FNJ B;  4MSQ B;  1KLG D;  4BOZ B;  4PS7 A;  2J7Q B;  3ZO5 B;  3JSV A;  1XCT L;  4YTN B;  4ITK A;  3ZIM A;  3U7D A;  1N6Z A;  2A4Z A;  1ZW7 A;  2L52 A;  3JVZ X;  1AN8 A;  5BYQ A;  3U8Z A;  4I6L B;  1I4H A;  4NJC A;  3SHQ A;  3TEX A;  2GBJ A;  4IM3 A;  3M63 B;  3T3O A;  1VCB A;  4WJO A;  4JWU C;  3H1U A;  5DPS A;  4P6V F;  3NZU A;  1TBE A;  2N7J A;  4W9C A;  1Q10 A;  4ARI A;  1N60 A;  1DOX A;  2AX5 A;  1GUA B;  2WXH A;  1E8X A;  5EE9 A;  1QKZ A;  2IPK D;  3AI5 A;  1WX7 A;  3DBH B;  1XLP A;  4EZK A;  1P1A A;  4XZ4 A;  4IWQ A;  3PZ8 A;  1P0R A;  1NEN B;  4ZRQ A;  2WYQ A;  1J0G A;  2BTE A;  4MH0 E;  4TKN A;  4OVV A;  2PTL A;  1SE3 A;  3C8Y A;  2DEN B;  2EEL A;  2ZVO A;  3GE8 C;  3DBS A;  2Y3A A;  2L32 A;  3ZKJ C;  1J7C A;  2NR2 A;  4ASW C;  4RNA A;  2DYB A;  1E6E B;  1FCC C;  1ZKH A;  1PUT A;  4NY0 A;  2L83 A;  2CS4 A;  2JYE A;  2N9E B;  1HXY D;  3RZW C;  1TYG B;  1TY0 A;  5D94 A;  1TS4 A;  1ROE A;  1WXV A;  5LLI A;  2MH7 A;  2D3C A;  4JPS A;  3MTN B;  5JZE B;  4XYC A;  4JIO U;  4OZA A;  2XBB C;  3CWI A;  3KYD D;  4REZ A;  1KJT A;  4RMA A;  3VVW B;  1VD2 A;  1TIF A;  1Q5W B;  2K1F A;  1KRH A;  3V6C B;  1SIF A;  1YQB A;  1A5R A;  2KD0 A;  3AU4 A;  2X8X X;  4H2A A;  3URY A;  4TMA B;  1SEB D;  5EE0 A;  2IO3 B;  4JWS C;  4WIP A;  3LB8 C;  4TSS A;  4C7Y A;  4HVB A;  1L2N A;  1FD6 A;  3CST A;  1WE6 A;  3GZN I;  3RFZ B;  4DHJ D;  3NVY A;  3ZJT A;  1V5T A;  4IWO A;  4A3O A;  4IW0 A;  1U4A A;  4NJ6 A;  4XGA B;  1UBQ A;  1PDX A;  2IDY A;  3ONS A;  3HHM A;  2WNM A;  3MJ5 A;  3TSS A;  1JWS D;  4BBN F;  2ZVN A;  2FUG 1;  2WLB A;  4ZRK A;  3IT4 B;  3NVW A;  4RGN A;  1WMH B;  4W9D A;  2BWF A;  4G11 A;  3V3X A;  2OOB B;  1HA5 A;  1WJU A;  4BKS D;  3H7S A;  3AN1 A;  2YVC A;  2KX3 A;  1KM7 A;  2K5P A;  2PLP A;  1OFF A;  2KQ7 A;  3DWG C;  4NAM A;  3VUX A;  1WGD A;  3O65 B;  5L95 C;  4AJW A;  2L0T A;  3RYT A;  3DDC B;  4JL9 A;  4K7U A;  3K9O B;  1GG3 A;  2I2Y A;  4FJZ A;  3E9S A;  3KLS X;  5LXH A;  2KDF B;  1E8Z A;  4GDL A;  2VRR B;  4DHJ B;  3P2B A;  2J53 A;  2YLM A;  3ZUN A;  1WR1 A;  4FUL A;  3AE4 B;  5DPW A;  4YWG G;  3DHI C;  4OZB A;  1WXM A;  1EWY C;  1MJD A;  1QZE A;  3GB1 A;  4MM3 A;  1WXA A;  3N9Y C;  1WRI A;  3L4P A;  3T8M A;  3V61 A;  2KWC A;  2RSU A;  4HEA 1;  3ZNG C;  4NAW B;  5FKA C;  4HXD A;  1WJ4 A;  2C9W B;  3R7Q A;  3AXC A;  2GMI C;  1DGJ A;  3MHS D;  1AW7 A;  2M19 A;  1SE9 A;  2KQS A;  2Q5W D;  4K3B A;  1MVK A;  1T0Y A;  3AEG B;  2IGG A;  3ZTC A;  5I4D A;  3R2I A;  1WGG A;  3SU8 X;  3EC8 A;  1WX8 A;  4MGZ E;  1WR6 E;  2QHO A;  3WAN A;  1D5X C;  4TQ0 A;  1E7P B;  3V6E B;  1XLQ A;  4LCD E;  2D11 A;  4GB9 A;  2RPQ A;  2CR5 A;  2I1K A;  3L08 A;  2GI9 A;  3L13 A;  1QF6 A;  3TL5 A;  2NMQ A;  2BWE S;  3AE3 B;  2B3A A;  1TS5 A;  3TUO A;  4EKU A;  3EFU A;  3BK2 A;  1FNW A;  2HD5 B;  4E71 A;  4WAF A;  2CHW A;  2WXO A;  2MBB B;  3HUI A;  5IA7 A;  1HZ6 A;  3TMP B;  3N30 A;  2MJE A;  2Y5P A;  3EUB 2;  1UF0 A;  5JH5 C;  4ZYS A;  1UEL A;  4OHJ A;  4WWP A;  3QAQ A;  4BAX A;  3H7P A;  3IAS 1;  4W9L A;  3R3M A;  3AE1 B;  1PGA A;  5L83 A;  3PS6 A;  2BYF A;  4S0R A;  1QOA A;  4KDI C;  1FCL A;  3GOE A;  4GLS C;  2KZR A;  4OZC A;  4IM2 A;  3Q2A C;  5CX3 A;  4DHZ E;  3NRZ A;  2K8H A;  1TS3 A;  4A6Q A;  2AWT A;  2BT6 A;  4DXA B;  4X57 B;  1Z5S B;  2ONQ A;  1T0Q C;  2ASQ A;  4DXF A;  3NJT A;  3QA8 A;  4BBN C;  2DNF A;  3DHG C;  3N20 C;  2WU2 B;  3JW0 X;  3DVN V;  2BYE A;  1KFY B;  4K1R B;  3PRM B;  2GLS A;  4BOS C;  1I42 A;  2M56 B;  3NVV A;  4G0N B;  1E5W A;  1FFV A;  4US8 A;  2Z0D B;  2JQR B;  2L1A A;  3PTF C;  5DPR A;  1KLV A;  1N63 A;  3HK0 A;  1TKE A;  1E9M A;  1M4V A;  2B76 B;  3PLU A;  2JPH A;  1BT0 A;  3IBE A;  3BVG A;  3R8B A;  1KH0 A;  1JWM D;  2V3S A;  1IYF A;  2D3G A;  4EFO A;  5AZG A;  2J4X A;  1XXG A;  4RM8 A;  4YXD B;  1CZP A;  2CU1 A;  2QIL A;  1FPY A;  3MFG A;  2JXX A;  4AOF A;  1SJH D;  5FR6 A;  4EE2 A;  3QQ8 B;  1L6V A;  4HPP A;  2DAJ A;  2N4F A;  2HJ8 A;  4C80 A;  3GP7 A;  4LNI A;  2Z8L A;  3AE7 B;  1YJI A;  4HPM B;  1V6E A;  3R66 C;  1F0Z A;  4NJ7 A;  4RM9 A;  1WGY A;  5H8Y E;  2N9L A;  2WDQ B;  4XWT A;  1XLO A;  3SDL C;  3ZNZ B;  1OQQ A;  3H6N A;  1EF5 A;  5JHA A;  1K51 A;  3IT6 B;  2HDE A;  3NS1 A;  2J0J A;  2LMC A;  1C9F A;  1WI0 A;  1VDV A;  2NS5 A;  2JRH A;  4N59 A;  2CKH B;  3EA6 A;  2J42 A;  4XC2 A;  4EEW A;  1E10 A;  3RN9 C;  5EDS A;  2BB5 A;  5IO9 A;  1NEK B;  3A4R A;  3FAH A;  1TJE A;  3AMZ A;  2BPS A;  1WH3 A;  1ZDX A;  3OG5 A;  2LJI A;  2WXQ A;  4L1B A;  5FR3 A;  1HQR D;  3LXF A;  2MEK A;  4R3D A;  2RR9 A;  2WXF A;  4HKZ E;  4B9K A;  1V86 A;  2DYO A;  3I63 C;  2E3T A;  3U4E G;  4W9K A;  3QWZ B;  3GZN B;  2V3P A;  1L4D B;  3I3T B;  2V3N A;  4GDL B;  2IYD B;  1SE2 A;  2VZK D;  1Y8R C;  4I6N B;  2KVR A;  2WS3 B;  1X1M A;  1EU3 A;  4NPN A;  4II2 B;  3PV1 A;  4B0M A;  2XK5 A;  2N9K A;  5HI1 A;  4MM3 B;  4M02 A;  5HKH A;  1YQ3 B;  3KUZ A;  2K9X A;  2KHW B;  2BVC A;  2QDF A;  4KSL C;  2FCQ A;  1D6E C;  2JU6 X;  5C1Z A;  2KWD A;  3ZXV A;  4YTP B;  2KTR A;  2XNA C;  2K6Q A;  5BMH A;  2I1J A;  1OGW A;  2KDE B;  2XN9 C;  3RZF A;  2KOX A;  1ZP0 B;  4BFR A;  1ZDV A;  4NQK E;  3TBL D;  3VH3 B;  5KHQ A;  3ZJV A;  3L0W B;  3CMM B;  4HDO A;  3AEA B;  3A9J A;  3VDZ A;  2ZW1 A;  1RAX A;  2WP9 B;  4F8C B;  5DPT A;  1WWT A;  3GE3 C;  4O1N A;  4A8X C;  2K8B A;  4ANW A;  3HRD D;  2VZK B;  1GJZ A;  2D5G A;  4YSX B;  1KOT A;  3L16 A;  4GSW A;  3WAP A;  3SD5 A;  1FMA D;  3T3N A;  3R7R A;  4KIK A;  1MG8 A;  3Q3O C;  4ZRP A;  5AUI A;  1V1P A;  1CMX B;  4OVU A;  3DBR B;  4OVZ A;  4FJY A;  3VHT C;  4FJV B;  1CJE A;  1XT9 B;  1WGK A;  4RF0 A;  5EE3 A;  3AEC B;  3TIX A;  2D3B A;  4J6I A;  3ALB A;  4FAD A;  3P4S B;  2C60 A;  1IBX A;  1F1H A;  4RGM A;  2V0G A;  2RPV A;  4ZRI A;  1P3Q U;  2TSS A;  2CJN A;  4OW0 A;  3W9C B;  1B1Z A;  2C7N B;  5C2T B;  2V9H A;  3V05 A;  2GOW A;  4W9I A;  3Q8E A;  3H7P B;  2BQQ A;  1K8R B;  1STE A;  4ZDV A;  2KMA A;  2LHD A;  2JZZ A;  2MBE A;  4WH4 A;  2JZ3 B;  1ET6 A;  4GMV A;  4ARC A;  4II3 B;  3W5U B;  2DZI A;  3Q69 A;  2JT4 B;  1YJJ A;  1TGZ B;  5T8I A;  4P7I A;  2KDM A;  3V60 A;  2Y5B B;  3DPD A;  4HK2 A;  2PIA A;  3FIL B;  4MEL A;  4LNO A;  2KQ4 X;  1WY8 A;  4WQM A;  1DOI A;  1RWS A;  2R61 A;  4WQO B;  2GRI A;  1HEZ E;  4HWI B;  3NVZ A;  4ICU A;  2K39 A;  2NBW B;  3W1S C;  1QIL A;  1VLB A;  2KWU B;  3UIN B;  1EUV B;  4MSM B;  2ZCC A;  4W9H A;  1L4Z B;  3BY4 B;  4EZJ A;  2JXT A;  3ETR A;  4GN1 A;  3RNC C;  2IZV B;  3WAO A;  2WXM A;  2C7H A;  1F2R C;  3DWM A;  1E8W A;  3NZ3 A;  3U7Z A;  4FBJ B;  3OJ4 B;  4CO7 A;  3A4S C;  1F52 A;  3PSE B;  3PRE A;  1OEY A;  2C7M B;  2ON8 A;  1WM2 A;  1EF1 A;  5AEK B;  5TR5 A;  1LXD A;  1J19 A;  3KVF B;  3VXW A;  3A9K A;  2UWQ A;  1YX6 B;  3N1Y C;  5GMV A;  2KX0 A;  2JWZ A;  1E7U A;  4KSK C;  1WSP A;  2VH1 A;  5CTR C;  2N7D A;  3NHE B;  4NZL B;  2BB6 A;  2UYZ B;  4AQ7 A;  4L23 A;  4B6W A;  3SFD B;  4A55 A;  3UI3 A;  1V2Y A;  3HIZ A;  3I5J C;  3Q3J A;  2MSE D;  2CJO A;  1K50 A;  4KDL B;  2EKI A;  3RUL A;  4KGR A;  2EKE C;  2KJH B;  1SXT A;  2LRW A;  2WXL A;  1AAR A;  2M1M A;  4A3P A;  4FHK A;  3DBL I;  1ZUD 2;  4XE0 A;  3Q8F A;  3WA0 A;  1JAL A;  1YOV B;  1GOZ A;  4F7Z A;  2FCM A;  2DWQ A;  1TKG A;  1MHH E;  3U30 A;  2KNB A;  2OED A;  1C76 A;  3Q14 C;  1FRD A;  2NBV B;  2LI5 A;  1C79 A;  4K3C A;  5IN7 A;  1GB1 A;  2BKF A;  1TKY A;  3X23 A;  4LJO B;  4AP4 C;  2KKC A;  1LM8 B;  2G1E A;  2KJ6 A;  4ACF A;  5GXG B;  4EUT A;  1ZE3 D;  3DCG A;  1VR9 A;  2BW2 A;  5TSS A;  2KMC A;  3FKY A;  1V80 A;  2KYW A;  1VZ7 A;  3OLM D;  4AWJ A;  2EMT A;  1VRA B;  3H9D A;  1R4N I;  4FXC A;  3SEB A;  1F2R I;  3IFW B;  1HZ5 A;  3QHT A;  4K7W A;  1XD3 B;  3ZRC A;  2FCS A;  2SAK A;  4DBG A;  1QOF A;  2GBR A;  5G5G A;  3CIR B;  2LFI A;  1ET9 A;  4FN2 A;  1I4P A;  4Q2J A;  3WAM A;  3BVM A;  2KXJ A;  1RFA A;  3QAR A;  2JRI B;  2WDT B;  5E6P A;  2MWS B;  1IGD A;  4WJQ A;  2AQ2 B;  2WX0 A;  1N62 A;  4PS8 A;  3GS2 A;  1YN5 A;  2KTR B;  4D2K A;  3EGR A;  3ZTD A;  1R4M B;  2GBK A;  4MJS A;  3BZD B;  4AS1 A;  2L76 A;  4YSZ B;  1L0X B;  2RDB C;  1MFW A;  4HCP B;  1SIJ A;  2OHF A;  2BKR B;  4LJP B;  1TS2 A;  1YN4 A;  5J18 A;  3DBH I;  2LXC A;  2NPT A;  1EU4 A;  1D5Z C;  3DVN U;  5CHV C;  2WHI A;  3ZQ4 A;  3NZS A;  2ZNV B;  3H8H A;  1YMH E;  1SBB B;  2J0K A;  4DK5 A;  3MJW A;  3JSV B;  1T3Q A;  2IGD A;  2BF8 B;  4HDQ A;  4IG7 B;  2LVO A;  1Z2M A;  1UD7 A;  3RNA C;  4USA A;  1WX9 A;  3LYY A;  3DQV A;  4P1C C;  2KVZ A;  1V1P B;  4WJN A;  4GDK A;  3ZVV A;  2AL3 A;  1PGB A;  2QEJ C;  5BMI A;  1ZXH A;  2PW9 A;  3P4Q B;  1K53 A;  3APC A;  1LQB A;  1V81 A;  2G4S A;  2L0F A;  5HFY A;  1FRR A;  2WDV B;  1L5P A;  3Q6B A;  5D6J B;  5BYS A;  4TV3 A;  4YSY B;  4WUR A;  4KKJ A;  4AUQ C;  4DXG A;  1JRO A;  4JGH B;  2LVP A;  1SB3 C;  3B0A A;  2RMM A;  4W9J A;  2OJR A;  3CF6 E;  2ICI A;  3BIN A;  5D3I B;  1FXT B;  2NTT A;  2IY1 B;  1E8Y A;  1HTO A;  2KAN A;  3PLV A;  2ZJD A;  3AE5 B;  4DDI D;  2VH2 A;  4PS3 A;  1TZO A;  1RRB A;  4GU2 A;  1XCQ L;  1RYJ A;  4ZHP A;  4BZA A;  3BYY B;  4TQ1 A;  1EO6 A;  1OQY A;  3ZYY X;  1WM3 A;  3AED B;  1DOY A;  4RFB A;  2IJ0 A;  2PMV A;  2EMS A;  3PHX B;  3ZNH B;  1P7F A;  2W3R A;  4ANU A;  2KT7 A;  1V49 A;  2XEW A;  3VTW A;  1OEY J;  4W9G A;  1GAQ B;  3KYC D;  3BK1 A;  1FFU A;  1QQR A;  3ZDM C;  3HVD A;  5AZF A;  3VRB B;  2M0A A;  4KKI A;  4ZYN A;  1DYQ A;  4CQN A;  1NDD A;  1MI0 A;  3D32 A;  4PT5 A;  2CHX A;  3HM6 X;  5C23 A;  1SGH A;  2LZ6 A;  1JML A;  2INC C;  3AE6 B;  3L17 A;  4XX5 A;  3L54 A;  2JVC A;  2IY0 B;  3BVZ A;  4EZL A;  1S3S G;  2G9H D;  2Z0E B;  4US9 A;  3RNF C;  1J7A A;  2WXR A;  1NYR A;  3CSF A;  1WJN A;  3Q3N C;  4KV2 A;  1T5X D;  3HVZ A;  4WWO A;  3VFK A;  3B9J A;  2ZZP B;  3AE2 B;  1JWB D;  2H88 B;  1GC7 A;  2R2O A;  4N6E B;  2INN E;  3UF8 A;  3Q8C A;  1J8C A;  1VJK A;  3AV8 A;  1YIW A;  4B0E A;  1E7V A;  3QK0 A;  2JY6 A;  2MA9 B;  2D3A A;  1JCK B;  3IVF A;  3ECI A;  1YN3 A;  2KDB A;  3RNE C;  2INP E;  2R2Q A;  3M95 A;  5CHF A;  3VR9 B;  4XDC A;  2WQY B;  2M0X A;  3R2T A;  5DCN A;  3QX1 A;  3E56 A;  2KAJ A;  3DOW A;  3BWU D;  4M01 A;  2IND C; 
#chains in the Genus database with same CATH homology
 2GBN A;  1H8C A;  4HJK A;  2GOW A;  4JQW C;  4GOC A;  5G2N A;  4W9I A;  1WE7 A;  2KQ7 A;  3C0R B;  3VUX A;  1WGD A;  3H7P B;  2LRU A;  3O65 B;  1I35 A;  2L05 A;  1H4R A;  1K8R B;  1YD8 U;  4LDT D;  4AJW A;  5L95 C;  4ZDV A;  2L0T A;  1Q0W B;  3M62 B;  2FIF A;  2KMA A;  3RYT A;  3DDC B;  4JL9 A;  4K7U A;  2JZZ A;  1GG3 A;  3K9O B;  2MBE A;  4FJZ A;  3UIP B;  2JZ3 B;  5LXH A;  2AEH A;  4GMV A;  1GC6 A;  4II3 B;  2KDF B;  1E8Z A;  2HTH A;  2DZI A;  2N9P C;  4GDL A;  2VRR B;  4DHJ B;  2JT4 B;  1TGZ B;  4P7I A;  2NCN A;  3P2B A;  4ANV A;  2L8J A;  3V60 A;  2KFK B;  4IUM B;  2A5U A;  2DZJ A;  2LGD A;  2YLM A;  1C1Y B;  3B08 A;  3ZUN A;  2L7R A;  1WR1 A;  2Y5B B;  3DPD A;  4FUL A;  4HK2 A;  4NNJ B;  1WIA A;  4MEL A;  2PE9 A;  2ZPY A;  5E6O A;  5DPW A;  2N1W A;  1WY8 A;  1WXS A;  4W9E A;  1WXM A;  4WQO B;  4HWI B;  1QZE A;  5IAA C;  1F9J A;  4MM3 A;  4ICU A;  4K81 A;  1WXA A;  2K39 A;  2MCN B;  2NBW B;  3UQA A;  3W1S C;  2WWZ A;  2KWU B;  1IPG A;  3T8M A;  3V61 A;  3UIN B;  2KWC A;  3Q3F A;  1WZ0 A;  1EUV B;  2C5L C;  2RSU A;  4MSM B;  2ZCC A;  4NAW A;  3ZNG C;  4NAW B;  1NBF C;  4HXD A;  4W9H A;  3RT3 B;  3PT2 B;  3NS8 A;  3BY4 B;  4EZJ A;  1WJ4 A;  2C9W B;  5BO4 B;  3R7Q A;  2KN5 A;  3AXC A;  4DHZ B;  2GMI C;  3MHS D;  3PZD A;  4KVG B;  1WYW B;  3AU5 A;  2FID A;  4GN1 A;  2IZV B;  3WAO A;  1SE9 A;  1WRD B;  2C7H A;  2KQS A;  5J2R A;  3KUC B;  3K9P B;  1T0Y A;  1E8W A;  2ZNV C;  3ZTC A;  4FBJ B;  5G55 A;  2HE7 A;  3OJ4 B;  4LDT B;  4CO7 A;  3A4S C;  1WGG A;  3PSE B;  3PRE A;  3SU8 X;  3EC8 A;  1WX8 A;  4MGZ E;  1OEY A;  2C7M B;  1WR6 E;  2QHO A;  3WAN A;  1WZ3 A;  1WM2 A;  1EF1 A;  2L00 B;  5AEK B;  5TR5 A;  4TQ0 A;  2D2Q A;  2LJ5 A;  2M8S A;  4ANX A;  1LXD A;  1J19 A;  3KVF B;  4MJS B;  3V6E B;  1D3Z A;  3VXW A;  3A9K A;  2UWQ A;  4LCD E;  1YX6 B;  3A9K B;  2D11 A;  5GMV A;  2KX0 A;  4GB9 A;  2JWZ A;  2RPQ A;  3ML8 A;  1E7U A;  2CR5 A;  2I1K A;  3L08 A;  1S1Q B;  2KWV B;  4KSK C;  4BKT A;  2O6V A;  4A20 A;  3L13 A;  5CTR C;  2N7D A;  2BGF A;  3NHE B;  2O2V B;  3TL5 A;  2N9X A;  2BWE S;  2UYZ B;  2IO1 B;  3JYU A;  1XQQ A;  4B6W A;  2KC1 A;  5E6N A;  3APF A;  2B3A A;  4W9F A;  4M8N A;  1IP9 A;  1V2Y A;  2KLC A;  3EEC A;  1WFY A;  4M0W B;  2ZPN A;  3HIZ A;  3Q3J A;  4EKU A;  3EFU A;  4MGK E;  2MSE D;  5CHW A;  4YL8 A;  2MX2 A;  3KH0 A;  2HD5 B;  1P98 A;  4E71 A;  1YJ1 A;  4KDL B;  2CHW A;  3RUL A;  2MBB B;  1WMH A;  2EKE C;  3IHP C;  3PRZ A;  4I6P A;  2PJH A;  5IA7 A;  3TMP B;  2IO2 B;  2KJH B;  2LRW A;  3N30 A;  1E90 A;  2LD9 A;  2D10 A;  1AAR A;  2M1M A;  4A3P A;  4FHK A;  3DBL I;  3WA0 A;  4NQL B;  3A1Q A;  4B95 A;  2M4N A;  3ZRF A;  1OTR B;  5AZH A;  1UGM A;  1P9D U;  5JH5 C;  4WJP A;  1M94 A;  2KTF A;  2LAS A;  4F7Z A;  1UEL A;  2FCM A;  4HLE A;  2FCN A;  2MP2 B;  3QJZ A;  4K7S A;  5KHO A;  3VAW A;  4GDK B;  3U30 A;  4WWP A;  3QAQ A;  2KNB A;  4BKG A;  3PPA A;  4E74 A;  3H7P A;  4GXB A;  2ZCB A;  2L3Z A;  5D2M B;  2NBV B;  4W9L A;  5LXI B;  3R3M A;  2LI5 A;  3OJ3 A;  2G45 B;  5JHB A;  2BKF A;  5L83 A;  3PS6 A;  2G4D B;  3X23 A;  2BYF A;  3T9L A;  4LJO B;  4AP4 C;  1RLF A;  1R4M I;  2KKC A;  4KDI C;  1LM8 B;  3GOE A;  4PYZ A;  4DWF A;  2KZR A;  2IO0 B;  4IM2 A;  1UBI A;  2KJ6 A;  5CX3 A;  4DHZ E;  2K8H A;  3DVG X;  4EUT A;  2KFK A;  3DCG A;  4IM0 A;  3RD2 A;  3VTU A;  2PE6 B;  2AWT A;  2DX5 B;  4DXA B;  4X57 B;  3TJP A;  2FUH B;  2KMC A;  4WAA A;  3N3K B;  1V80 A;  4PYU A;  2V4L A;  1WGH A;  1Z5S B;  4AWJ A;  3OLM D;  2MBO A;  2ASQ A;  2EMT A;  3H9D A;  1R4N I;  2IBI B;  3QA8 A;  4BBN C;  3JW0 X;  2LGX A;  1UZX B;  3IFW B;  3DVN V;  4EOY A;  2DZK A;  2BYE A;  2RGF A;  4K1R B;  4JLC A;  4ZRJ A;  3QHT A;  4K7W A;  1XD3 B;  2REX A;  3ZRC A;  2PEA A;  2FCS A;  3PRM B;  4BOS C;  1I42 A;  4DBG A;  2GBR A;  2D07 B;  3ZNI D;  4BKS A;  5J17 A;  2LWP A;  4FN2 A;  1E5W A;  4G0N B;  3ML9 A;  2FAZ A;  2RD0 A;  3WAM A;  3ZDT A;  4M8M A;  2Z0D B;  2KK8 A;  3RUI B;  2KXJ A;  3WAL A;  1UH6 A;  1RFA A;  3PTF C;  2JRI B;  3QAR A;  1C3T A;  3VQI A;  5DPR A;  2WDT B;  4MGY E;  1KLV A;  3HK0 A;  5E6P A;  3RCZ A;  4MDK E;  2CHZ A;  3V62 A;  4IC7 B;  3KW5 B;  2MWS B;  3TCA A;  4WJQ A;  2WX0 A;  3DVG Y;  3PLU A;  2JF5 A;  2JPH A;  1BT0 A;  4PS8 A;  3IBE A;  3B1L X;  2WX1 A;  4TUU A;  4URK A;  4E3C A;  2W9N A;  2KTR B;  1HE8 A;  3A33 B;  3ZTD A;  4GIV A;  4IWP A;  1G6J A;  1PQS A;  4FHJ A;  3AUL A;  1L7Y A;  3W1Y A;  1ISN A;  2V3S A;  1IYF A;  2GBK A;  2G3Q B;  2D3G A;  2K6D B;  4MJS A;  4EFO A;  2L76 A;  3WIM A;  5AZG A;  4FLH A;  3OAW A;  3PGE A;  4HCP B;  4RM8 A;  2BKR B;  1ZGU B;  2CU1 A;  4LJP B;  2Z59 B;  2O2V A;  5J18 A;  3DBH I;  2LXC A;  2NPT A;  2NVU I;  2JXX A;  1WJ6 A;  2NPT B;  4MGI E;  4FA6 A;  3PVL A;  3APD A;  4G50 A;  3PRP B;  3DVN U;  4AOF A;  2MRP A;  1GNU A;  5FR6 A;  2DHZ A;  2MBQ A;  2LXA A;  3QQ8 B;  5CHV C;  3L10 B;  3ZLZ A;  2GBM A;  1Q1O A;  2FNJ B;  3NZS A;  4MSQ B;  3VUY A;  3ENE A;  2DAJ A;  2N4F A;  2HJ8 A;  2ZNV B;  4BOZ B;  2J0K A;  4PS7 A;  2J7Q B;  4HPM B;  4KZ0 A;  1V6E A;  4HCN B;  3ZO5 B;  3EHV A;  4DK5 A;  3JSV A;  3MJW A;  3R66 C;  3JSV B;  2BF8 B;  4HDQ A;  4IG7 B;  2LVO A;  3LJ3 A;  4NJ7 A;  1Z2M A;  1UD7 A;  4RM9 A;  3ZIM A;  3U7D A;  2A4Z A;  1WGY A;  1ZW7 A;  1WX9 A;  3JVZ X;  3LDZ E;  3DQV A;  3VUW A;  3U8Z A;  3HM3 A;  2KLG A;  3SDL C;  4I6L B;  4WJN A;  3ZNZ B;  2MP2 A;  3SHQ A;  2MBH A;  2GBJ A;  2MW5 A;  3H6N A;  4GDK A;  3M63 B;  4IM3 A;  3ZVV A;  3UQB A;  1EF5 A;  1TTN A;  5JHA A;  2AL3 A;  2J0J A;  1WI0 A;  2DYM A;  1VCB A;  2MLB A;  2NS5 A;  3UGB B;  2JRH A;  3APC A;  4WJO A;  3QC8 B;  1LQB A;  3H1U A;  3UIO B;  2CKH B;  1V81 A;  2G4S A;  2KFJ A;  2L0F A;  4XC2 A;  2KO3 A;  3VH4 B;  4EEW A;  5DPS A;  5EDS A;  2LVQ A;  3NZU A;  1TBE A;  2JUO A;  5D6J B;  4W9C A;  4TV3 A;  2KC2 A;  3A4R A;  3VTV A;  1GUA B;  2V1Y A;  1E8X A;  2BPS A;  4AUQ C;  4BVU C;  1WH3 A;  3AI5 A;  1WX7 A;  3M3J A;  4HPL B;  4JGH B;  4EZK A;  1P1A A;  4XZ4 A;  4IWQ A;  2LVP A;  3B0A A;  1P0R A;  4W9J A;  2OJR A;  2RR9 A;  4B9K A;  3KUD B;  3CF6 E;  2AYO B;  1V86 A;  2DYO A;  3BIN A;  2WYQ A;  1J0G A;  1FXT B;  4MH0 E;  4TKN A;  4OVV A;  2NBU A;  4W9K A;  2IY1 B;  3QWZ B;  2DEN B;  1E8Y A;  2KAN A;  3PLV A;  2ZJD A;  2ZVO A;  3NOB A;  3DBS A;  3I3T B;  4GDL B;  3ZKJ C;  4DDI D;  2IYD B;  2K8C A;  2BYV E;  4PS3 A;  3S2A A;  2NR2 A;  4WWN A;  1RRB A;  4GU2 A;  4ASW C;  2O6V D;  1V5O A;  1Y8R C;  4MEM A;  2DYB A;  4I6N B;  2AL6 A;  1TZ1 A;  2KVR A;  4TQ1 A;  1EO6 A;  1ZKH A;  1X1M A;  1OQY A;  2K25 A;  4ICV A;  4NY0 A;  1WM3 A;  4NPN A;  4II2 B;  2CS4 A;  2N9E B;  3PV1 A;  2XK5 A;  2XK5 B;  3RZW C;  5D94 A;  1WGR A;  1WXV A;  1NI2 A;  5HKH A;  3KUZ A;  3NY5 A;  2KJR A;  2N7E A;  3N32 A;  2KHW B;  4KSL C;  2FCQ A;  3DBR I;  5LLI A;  2EMS A;  3PHX B;  4AJY B;  3ZNH B;  3MTN B;  4ANU A;  5C1Z A;  5JZE B;  1V49 A;  4JIO U;  2XEW A;  2DZM A;  2XBB C;  2KTR A;  3KYD D;  3VTW A;  1KJT A;  1V9J A;  1OEY J;  4RMA A;  2K6Q A;  4W9G A;  3KYC D;  3X0W A;  2I1J A;  1OGW A;  3VVW B;  1VD2 A;  2KDE B;  3ZDM C;  1Q5W B;  3W1S A;  2K1F A;  5AZF A;  1LFD A;  3RZF A;  1YX5 B;  2KOX A;  3V6C B;  1SIF A;  1YQB A;  1A5R A;  2KD0 A;  4ZYN A;  3AU4 A;  4BFR A;  2MQJ A;  4NQK E;  3TBL D;  1NDD A;  2LGY A;  3D32 A;  2CHX A;  3HM6 X;  3VH3 B;  2M17 A;  5KHQ A;  2DAF A;  5C23 A;  4F1S A;  2IO3 B;  1SGH A;  2LZ6 A;  3IG3 A;  2LUE A;  4GGQ A;  3L17 A;  3L0W B;  4DDG D;  4XX5 A;  3L54 A;  3CMM B;  4HDO A;  3VDZ A;  2JVC A;  2IY0 B;  3A9J A;  3A9J B;  4KZC A;  4EZL A;  4HVB A;  1RAX A;  1S3S G;  4F8C B;  1L2N A;  3PHW B;  5DPT A;  3CST A;  2Z0E B;  1WE6 A;  3GZN I;  2K8B A;  4ANW A;  4DHJ D;  3ZW3 A;  3CSF A;  1GJZ A;  2O6V B;  1WJN A;  1WF9 A;  1V5T A;  4KV2 A;  4CYE A;  4IWO A;  4A3O A;  4WWO A;  2N1V A;  4IW0 A;  3VFK A;  1U4A A;  4NJ6 A;  3L16 A;  1KOT A;  1UBQ A;  4GSW A;  2ZZP B;  3WAP A;  3ONS A;  4G3X B;  3SD5 A;  1GC7 A;  2R2O A;  3HHM A;  3R7R A;  4KIK A;  1MG8 A;  4KIK B;  3UF8 A;  1J8C A;  4BBN F;  1YIW A;  1CMX B;  2ZVN A;  4OVU A;  1JRU A;  1E7V A;  4ZRK A;  3QK0 A;  2JY6 A;  2MA9 B;  4FJY A;  1WMH B;  4W9D A;  3VHT C;  2BWF A;  2ZEQ A;  3IVF A;  4FJV B;  1XT9 B;  3ECI A;  2PPH A;  5D7G A;  3TIX A;  2KDB A;  3QIJ A;  4G11 A;  2R2Q A;  3M95 A;  5CHF A;  2OOB B;  4N9F 4;  4J6I A;  3ALB A;  1WJU A;  4FAD A;  4BKS D;  2M0X A;  2C60 A;  2KDI A;  3H7S A;  5DCN A;  2YVC A;  3A1Q B;  3QX1 A;  4ZRI A;  1P3Q U;  4CHK A;  2KX3 A;  3QCA A;  1KM7 A;  2J0M A;  3DOW A;  2C7N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...