1YJ7A

Crystal structure of enteropathogenic e.coli (epec) type iii secretion system protein escj
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
167
structure length
154
Chain Sequence
MKEQLYTGLTEKEANQMQALLLSNDVNVSKEMDKSGNMTLSVAAADFVRAITILNNNGFPKKKFADIEVIFPSPSQENAKINYLKEQDIERLLSKIPGVIDCSVSLNVSSAAVLVISSPEVNLAPSVIQIKNLVKNSVDDLKLENISVVIKSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the molecular platform for type III secretion system assembly.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
molecule keywords escJ
total genus 46
structure length 154
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1530 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Hypothetical protein rpa1041 1yj7A01
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1yj7A02
3G7SA 2P2BA 3NYQA 4DG8A 3EQ6A 4R0MA 4RM3A 3VNQA 3L8CA 4OYCA 2P2JA 2QVXX 3DLPX 4ISBA 2VZEA 2P2FA 1MDFA 3A9VA 4FUTA 4IZ6A 3VNRA 3KXWA 5KEIA 3A9UA 5IFIA 3CW8X 4IR7A 4D57A 4RVOA 3LGXA 5K85A 5BSWA 3LAXA 5KYTA 4RVNA 1PG3A 1T5HX 1ULTA 3E7XA 4DG9A 3DAYA 5JRHA 5BSUA 1MD9A 5DV9A 4WV3A 5E7QA 4GXQA 2D1RA 4OXIA 4D4IA 2MKYA 4U5YD 2V7BA 1BA3A 4RLQA 1PG4A 5KYVA 1LCIA 1RY2A 2D1QA 2QVYX 3NI2A 2Y4NA 2Y27A 2QW0X 3NYRA 3FCEA 4GXRA 4FUQA 4ZJZA 1YJ7A 5BSTA 3RG2A 2P2QA 4RM2A 3LNVA 4RMNA 4RLFA 3IPLA 2WD9A 4G36A 3FCCA 1MDBA 3B7WA 4GS5A 1AMUA 2P2MA 4D56A 3C5EA 2P20A 2D1SA 4PZPA 5GTDA 3VNSA 5BSRA 4EATA 4G37A 1T5DX 4W4MA 5BURA 3CW9A 4R1MA 2Y4OA 2QVZX 3ETCA 5BUSA 5BSMA 4R1LA 3R44A 2VSQA 4D4GA 5K8FA 5BUQA 5BSVA 3E7WA 3PBKA 3GPCA 3DHVA 2D1TA
chains in the Genus database with same CATH superfamily
2CPIA 2DNGA 3H5XA 2YNHA 2AGPA 4WZMA 3GKUA 1RAFB 2FJWA 3EQ6A 2VKZG 3I5CA 3PRDA 4P7VA 4DFPA 2Z8QA 2BJ3A 2YVSA 1HR0C 3AA8A 1VK3A 4NLSA 4GRSA 4U7UK 1O93A 1S6PB 2HFSA 5MLCV 1RTDA 5DDQC 2AU0A 3VF0B 1T95A 2AGOA 5A19A 1R8AA 2GMHA 4I0WA 4ID8A 1Y0HA 4DOZA 3KHGA 4X4VA 1P27B 4NASA 5FIIA 3SI8A 2P8IA 1N54B 1Z4UA 2PMZD 3RW6A 2P2JA 1PJ5A 3T5HA 5D4NA 1UA1A 2QFJA 4B3RJ 3K89A 5DETA 5D0HA 1FDNA 3I08A 1IR1A 1S0MA 2XBPA 2R8IA 1S5ZA 4K8RA 1T9VA 3WZ0A 1O51A 4LJMA 2AYEA 3SV4A 2IVFB 4DV1F 1VFJA 2C28A 2YKAA 3GCXP 4C6AA 4ZHRA 3JSRA 2IPOB 2JLEA 1HMVB 3SQGA 2AGQA 1GT8A 4B3MC 2CPXA 4RLEA 3DLHA 1UAWA 1SIWB 2BM0A 2XMWA 2AIRB 1FEEA 1RAGB 4WU2A 2EWHA 3HZEA 2WVEA 3QYYA 2LA4A 4DU8A 4KHMA 1R0BG 3VWSA 2E66A 5IV4A 3BO4A 2RD5C 1JKHA 2L48A 2XI3A 1RYSA 4I67A 2KI2A 2YWBA 4TPSB 1P4EC 1TU0B 3OV7A 2WSFC 2UZAA 4Q44A 2FIUA 2ALYB 2WONB 4WWSA 3P5BP 4X64J 4F3OA 3M6WA 3CUNA 2OEJA 1F5CA 4KC5A 3KNGA 5ETQA 1QM4A 3D0IE 4O23A 3UDLA 1TKZB 4EI2A 1S72S 5IV3A 4BC7A 3H42A 2UXCF 1XTZA 1SKRA 4B9MA 3GR0A 3TQIA 3TZYA 3CMES 1MWYA 3IG1B 3RGIA 1IXKA 1KLMB 1LWCB 3DU6A 5D4LA 4Q8EA 3P6YC 4OX7A 4ICLB 3G6YA 3R3TA 1RAHB 2M5OA 3RBXA 1V60A 4ZJZA 3AT1B 1Q8IA 5CYMA 3PV8A 3DOKA 2BE2B 2IJNA 3PM9A 1PBUA 4D3HA 4B3OA 4O3SA 2UXCJ 3AY0A 4I2PB 1IBMC 2AP6A 4ANEA 1OY9A 3H7HB 3NBPB 5AXKA 3PVXA 1U45A 1VQ8S 5D6GA 3DGPB 2IVYA 4HYKA 2CPDA 4Q2MA 5FDLA 2YKQA 4G65A 2KG1A 3ETOA 2DRBA 2E8FA 1TMJA 1WEZA 1N5YB 4EGLA 4RW9A 3VQTA 1U1LA 2OD6A 3HVWA 3OBIA 2B8PA 2VFVA 3A13A 3UVJB 2FVCA 5F41A 4LBIA 2MQPA 4IG3A 1V5VA 1S1UA 1HR0J 1IBKJ 5F0WA 1S99A 4HTJA 1XR5A 1UFWA 4NA2A 5A8RA 3BPDA 3M2VB 5KG4A 3CW8X 4DV6C 1XWLA 2V4JB 1LQLA 3L7PA 3RZAA 3TW0A 1P7LA 2OPQB 3I0SB 3CXCR 3BKUA 3OR2B 2CPZA 5ADZA 1CQMA 2BX6A 2FJXA 4B3MF 2K3KA 4F0HA 4EATA 2B0GA 1RBOB 2VKRA 4F4KA 3CD6S 5DQGA 5KFUA 1M1HA 1FD2A 4CI0B 1LQ9A 1KVIA 3G4SS 5IT9D 2M5HA 1K1QA 3PRBA 5DM7Q 1GPMA 3ILJA 2BRLA 2Q79A 2R7SA 5HJYA 2ZZMA 1K0RA 3L09A 3L7OA 4ER8A 1NK9A 4ECVA 1S6QB 2Z2MA 4JV0A 3AF5A 1KOOA 1LWFB 3MUMP 1FESA 2GQCA 3NBPA 3I0RA 4B9SA 2E5LC 1F3FA 1RHQB 3CB4A 1U02A 2IJRA 1VC5A 1G2EA 2RJZA 3F56A 3NY0A 4C8OA 1WG4A 2VQFC 4X4RA 2HVEA 3R5BA 2M88A 4DV1C 1VBKA 4ZJQA 1UVNA 3V5RA 3J7Z5 3OVAA 2K7KA 1LV5A 2JEIA 1CLFA 2RB7A 2C3MA 2QA2A 4TY9A 4DS5A 4Y2CA 3RB4A 4KHRA 1K1SA 2UV8A 3IG1A 4Y34A 2V9KA 2P2FA 4I2QB 4LRFA 3SFGA 1OYDA 5KG1A 4AYBD 1YHQS 1RE1B 3SDEA 5J1EA 2P5VA 2EEYA 1XBWA 3NPDA 3T6JA 2MXYA 1P9YA 3CNQP 1FHTA 4KRWA 3Q8RB 3MM9B 2B3TB 1GMUA 3SCLE 2OSQA 3IC1A 3KK1A 4FS2A 2J6SA 3OL8A 4K0KC 4OI6A 3I5AA 4LBPA 1CJKB 2YKNA 7AT1B 4EYHB 3EPGA 1T11A 2ZC4A 6FDRA 4MK9A 2R3VA 2CQ3A 2F8MA 2V8GA 3BR8A 5BSWA 1JKHB 2Y9HA 3NCRA 1VQ9S 1T5HX 3OR1B 5E3PA 3NOGA 4RU2A 1GXUA 2R2RA 4HTIA 2F4VF 3QAEA 3ZZ0A 3GG0A 3GPAA 3ETMA 1MROB 3N79A 2XLIA 2J9EA 1WG5A 2ZBIA 1DAXA 3BYPA 3CJ2A 4DF4A 3FFIB 4NLTA 3TAQA 3ET6B 1UVIA 1T9XA 2QYGA 1S6UA 1XS3A 1T0TV 4K59A 1S57A 1VJQA 2MQOA 2H48B 1OWXA 1HNZJ 2RS8A 2AHOB 3B82A 3CJ4A 3NOCA 4P73A 5KFAA 1V9OA 3R7NB 4A8QA 4BDPA 2HVIA 3TDEA 2E7VA 2CJ9A 2KB2A 5KFYA 1E6YA 1RWWB 5HQ8A 3CDUA 4PXDA 3DLLQ 2VF3A 3MM5B 3S8SA 3M9OB 2V4QA 4CP5A 3AB4B 4RBUA 2VQEJ 2ZH8A 2DR7A 1JQGA 2R4FA 5A8WB 4EO6A 2FHKA 4USIA 3CCSS 2G2OA 3M6XA 4U8VA 4M63A 4FBUA 2DO4A 2V8VA 5DZ7A 3M05A 3DHXA 4IQXA 3LALA 1T02A 2X1BA 1NJZA 3VGUA 2M0GB 3DDKA 1UFKA 4MTNA 4H4OB 2AEFA 5AE3A 1FRMA 4FF1A 3M8PA 2LDIA 4WTOB 2FC8A 4JV1A 1FJ7A 5I4MA 2GW8A 1OSDA 4HI2A 3KJVA 4AQYJ 1F2GA 3KXDA 4RMNA 2CQ0A 1F9FA 5HMWA 3Q23A 1GK8A 3CCVS 2ATLA 3MCMA 3CULA 3X3UA 2MMAB 3O2EA 1M5HA 3R1LA 2WZ1A 4DUZC 2EG2A 1U0HA 1EKRA 1CJVA 1S0OA 3N01A 3HZGA 1RWKB 5IQ6A 5LJ5Y 1MN9A 4DSJA 3X1LB 2DXEA 4DR6J 5AT1B 4G1IA 3HHDA 2OPSA 3MCNA 3OTOF 3NS7B 1C0UB 5LXRA 1XMOC 3KHRA 1LEOA 1XRBA 4B17A 2Z51A 2IM2A 1S10A 2M9KA 1REVB 2ZHOA 3EGWB 1NK4A 4WXWA 4Z2XA 1ULRA 1WHVA 4OI2A 5KFKA 4ZPBA 4QR2A 3K0JA 3UOWA 3FKBA 4NLQA 2V50A 2IDLA 1HNZF 1CS4A 1GTEA 2YWCA 3GIRA 2E9RX 2M52A 1HW9A 1VYAA 2NYHA 1S1UB 4RW6B 3OL9A 2B4OA 1HLWA 4ZKAA 2UXDJ 3QATA 4DR6F 1VI7A 4PR6A 4FVMA 3UNYA 3R5GA 3CCMS 3CCUS 1VQPS 3T1AA 2VIHA 2HHXA 1MWZA 1SQGA 4RL1A 2R42A 2ZJRQ 2DD8S 5LSLA 3HP6A 2OPLB 1Y4ZB 5A8KB 4CT8A 1QVGR 2KJVA 5K5MA 1I1GA 1RJJA 4DHVA 1AYEA 4XX2A 4OX9C 1XNRJ 3R27A 4GMKA 3PXGa 1YBTA 3DHWC 1ELOA 3FGVA 1NZAA 2Z0GA 1X5PA 4CLFA 5C25B 3A8JA 4XPCA 2AKWB 1N34F 2L9DA 4KV8A 1BD6A 3UVJA 3FEXB 1K47A 4W98A 2Q6BA 2V67A 4IG0B 2DNQA 4KR0B 3B54A 4C8ZA 4DSFA 4XO0A 5GVQA 2OI2A 5FDLB 3L8CA 4URQU 3MMBB 3QGHA 1BLUA 5G0RA 3H4BA 3ZFVA 1RWPB 4W90B 4LF4C 3A26A 3N2QA 3OSNA 3FZ2A 2P6SA 3DRYA 4CH0S 4PCQA 3C14A 2JVOA 3PX0A 2GVZB 3OTBA 4JV5F 4C8MA 3A9UA 3U1MA 1FRHA 1VQLS 3CJ8A 2MCQA 2QMUB 3MEEB 4J9LA 3GSIA 2OHDA 3B4DA 3D9BA 3MAAB 5ITHA 4RVOA 5FLXD 2XWYA 3R5AA 3ZTQA 3G82B 4EYIB 2WONA 1HWIA 3NCQA 3LAXA 2EFQA 4DPXA 1ZPVA 1LW2A 2GFFA 3HI9A 4XAKA 4ZVQB 3M8QB 1TVRA 3I56S 2HHSA 2YH0A 1N36J 4PG4A 1PBAA 3MAAA 4URGA 3OJUA 4NOHA 2RILA 1RT5A 1VRTB 2NXJA 2OLWA 1FCAA 2GAHC 4QIEA 2X1AA 5J2NA 5DQHA 1IKVB 1EX8A 1H98A 3GCWP 1Y9OA 3O1LA 2ADBA 1X9WA 4K4SA 4X64C 4YP3A 3HSDA 3EZUA 4DCTA 3ONQA 1FA0A 4LR9A 2A10A 2YNGA 2IMWP 5L46A 2VG7A 3LANA 2KN4A 1WTBA 2K1RA 1FRJA 2QG9B 4LSNA 1RT3A 1OQ3A 5IC4B 2LMIA 2CVIA 3TEGA 1WCJA 1R6YA 4AXIA 4DCSA 4ED8A 1RWUA 3FMWA 1RTJB 4I9FA 4ZVPB 4LF8F 4NMLA 4BWJA 4E2FB 2VG5B 4ZPAA 3FSXA 3K59A 5J2PA 3QJLA 1FEHA 4OZLA 1L3TA 2GHWA 4NLYA 1BWVA 3D6TB 2QLJB 2RU3A 2MMYA 2BJ7A 3A12A 3UDCA 5SUHA 5J2MB 5CD4H 1NPKA 2DR8A 2HHWA 1KTVA 2HSEB 2YNHB 2U2FA 3UW1A 4DCOB 4HEA9 5A1IA 4F04B 4DV2C 2YNIA 1VC6A 2JOQA 2KG0A 2AJ1A 1S77D 3IEUA 2EI5A 2JSXA 3BQ2A 1FDBA 5L38A 3Q2SC 3CD0A 2HVHA 1EARA 3GV8B 3HVAA 5KFRA 3W1YC 1N34C 1J5EC 3MECB 3TVKA 4UOHA 1NRKA 4ZLPA 4N41A 4YB5A 2ZJPQ 1I94F 2DK2A 4IFYA 3CQ3A 1L2FA 3H2VE 4BWMA 1ZS6A 3ICLA 5IM0A 2Y1RI 5GAGI 3TYTA 3JSMA 3PW0A 1W25A 4X84A 2HAFA 3HCXA 3M7VA 7FD1A 1NK6A 4LE5A 1USPA 2NCLA 2JC1A 4U7CA 3EXYA 4RW8A 1HBOA 5B09A 1VRUB 3CIZA 3I6PA 3R9WA 3SEOA 3HVRA 1R8CA 3CJKA 1TV6A 3KYLA 4C9DA 2UUCF 4PWDA 3FQLA 1KQFB 2B5JA 2RIJA 4HH0A 4OJGA 4QYRA 3CC2S 1T5DX 3DLJA 4IOBA 2DR6A 3CEDA 3SSSA 4NXNF 2MZRA 2DGVA 2GX8A 2VFTA 3ITHA 4PZVA 3T5LA 3JSYA 2YQ1A 4DR7J 1BWEA 4DL4A 2W4CA 3MM7B 3CCES 3NGKA 3ZZZA 2MZQA 3D54A 1WKJA 4EZ9A 2IM1A 4H4OA 5BUSA 2IY5B 3EM1A 3FRYA 1RTHA 2ROGA 3UQSA 4U95A 1VIXA 2W9CB 4OYOA 2D1TA 4X64F 1LXNA 1RWOB 3FCWA 3LH2S 4DV0J 2EFPA 2M8HA 2DHMA 2J5AA 2GGPA 4MT1A 4MIWA 2MJNA 4HACB 4HDGA 3HD1A 4I64A 2CY1A 2RVJA 1FD8A 2HFVA 3K8WA 3MECA 3TJAA 2LXIA 3VAKA 4H4MB 1TL7B 4KH0B 4H54A 4OYIA 4PPDA 1WC0A 2AW0A 4KBIA 5A6WA 4ZVOB 3QWUA 4PABA 1RTZA 3RW7A 3ZC4A 4LF8J 4OYCA 2UUAC 2EFOA 1H2TZ 3A9VA 3H5UA 1TELA 2CAJA 4LF9C 3LPYA 4ECZA 3MMCB 2H4WB 3TARA 1S0VA 3PIPQ 2QA1A 1RTIA 2WVFA 4QWBA 5IWAF 1UW4A 4ZOSA 2FD2A 2CQDA 2KVIA 4J9SA 1S12A 1WHWA 2AYMA 4OHVA 3UD4P 3EWGA 1KNZA 5J2PB 2PFDA 1Q81T 4OI0A 3V6HA 3CC7S 4DV7J 1B4SA 2MY7A 4M8LA 3M8RA 2YPYA 3K7RA 1R43A 2RDJA 4DR3C 3EGVA 2EGTA 1GXLA 1LK5A 1WUUA 3NWGA 2ZWPA 4ZMMA 5LXYA 1AZSA 3ZZRA 1UTAA 2N4DA 3CJ5A 3T19A 2H9ZA 5EWGA 2WTFA 1VDHA 5HLFA 1KEKA 1NU4A 3DRPA 1SQFA 3LP1A 1B3TA 2FVPA 4DZ6A 4K5RA 4WP8A 3QRQA 2RAQA 1P1TA 5JJBA 4JI4C 4TN2A 4F0KA 1PJ6A 2CPYA 2XYGB 4U5YD 3UD3P 1V6HA 4LF5F 1FJCA 5T8TA 1SQEA 2E5JA 4I4BA 2N3OA 1VQ7S 4WIIA 3LO3A 1AB8A 2BA9A 3FSIA 4Y2AA 1RLCL 1XMBA 2HG4A 3GJTB 5IOLA 3U27A 3DI6B 3OFHA 2L3MA 1C1CB 2CPFA 2XZTB 3DXBA 3LP2A 5KFHA 1PO6A 4LFCJ 2KJWA 4M95A 2JRSA 2AX1A 1T9UA 2FB0A 1YZ6A 2NPIA 1GX6A 3PG9A 5KFGA 2FVSA 2HBZB 1N32C 3K8VA 4O0NA 2F8EX 2XM3A 4ALZA 8RUCA 2FGOA 2V8PA 2CZ9A 3ULHA 3JB9k 1X5OA 2DXDA 3I0RB 4FYYB 1NHKL 5ETOA 4DPWA 3J7YI 4USHA 3K58A 2XMVA 2Y1LB 1WTFA 5LMUF 5CHCB 1N2FA 2HIYA 3IGVA 2J0SD 3HM9A 4Q8FA 4DG1A 2A3JA 3NP5A 2FHMA 1IJEB 4WK1A 4EFAC 4CLKA 3OLAA 4JI0C 4ZCIA 1WACA 2DGXA 3IRXB 1I5OB 3NKYA 4ED7A 3FCHA 3RBDA 1N56A 2CXCA 4B9UA 1JK9B 4DSEA 3LPEA 5IT9Y 3NEKA 4ED2A 3PO5A 2A18A 2AEMA 2QL5B 4J7CA 4MYTA 3UR3C 3W5ZA 1ZOTA 1KQGB 1R89A 4QCLA 1TTHB 4E0DA 1S4FA 2BQRA 3DU5A 1R8HA 1EHWA 2PDAA 3QT8A 2ZH6A 4LF2A 5HSPA 3DDNA 4X65C 3LNOA 2N7YA 2HMIA 3TA2A 5KFEA 3TWZA 1FJGF 3ZZPA 4QU7A 1D3WA 3R5DA 3VAJA 1TR0A 4UY8T 9ATCB 1N0UA 5J2NB 1UKKA 4P2SA 1M5SA 2HRUA 3KLEB 2Y1JA 2P6TA 2PI4A 3RJMB 2CUYA 4DR4J 1N32F 2BACA 3DRRB 2C1EB 2U1AA 2GIQA 2ZHBA 4I56A 2NXUA 3TZZA 4F2RA 4B9LA 2IA0A 1HI8A 2B9WA 3H98A 3OTDA 4U7UD 4L3NA 1KKGA 3UX3A 2K8GA 1SCJB 4YB1P 2COLA 4QPTA 1SL1A 1HYSA 5IS2A 4I9GA 4TY8A 3WC0A 1PILA 4RW6A 3ZZTA 1O90A 1YVFA 2HLTA 3GE9A 3GLJA 3QIPA 4PPZA 1S9FA 1N8RT 1JLFA 2XMAA 1NSQA 2OTJS 5CYQA 5ETVA 4R0MA 3H90A 4MK8A 5KT6A 1KP6A 5KFPA 4RM3A 3H25A 3MPVA 3LGMA 2R7WA 3OXFA 4RW4B 3JYTB 1VGYA 4A8KA 2AT1B 5DG7A 2Q3PA 3HHEA 3IBFB 3IMLA 2Y8YA 4RNFA 3PDNA 8AT1B 5T8SA 2ZKTA 1TKXB 1RT6A 4M5MA 3Q8QB 4Q0BB 2CQ1A 3RBZA 3HKZD 1JJCB 1TL5A 2C42A 2B9YA 2PMHA 3TOQA 2QX0A 1T9TA 3G8TA 3SSRA 1NJWA 2L9WA 4IKAA 4TXSA 4RNNA 1C4AA 4ES1A 4X66C 3DYAB 4AL6A 3W7BA 3CJQA 3O6QA 2CWKA 1MU2A 1WHYA 1ZM3A 3D66A 3L7UA 3M2UA 1KBRA 1RT6B 4LSLA 1HBUB 4URSA 4UUXA 2DJWA 3PX6A 3QAUA 4KGVB 1J5EJ 3HHLB 2FUG9 1NZ8A 3BSNA 3V81A 3AODA 1P1LA 5DJBA 4OHZA 5KYTA 2G0JA 1ULTA 5GMDA 3OUYA 1UEUA 5BSUA 1DHMA 2DY9A 4N8OA 3MMJA 4DV1J 1TUGB 3G8QA 5A2QY 4ED3A 2E5IA 1FT8A 3FFIA 1H3DA 4UF4A 2RS2A 3D1QA 2JHEA 5KFMA 1O6XA 1HQEB 1UZDA 2YPZA 3CSKA 3FBCA 4CLYA 3OR2A 1QAIA 2ZBRA 4EUVA 1VLAA 1S49A 1TL1B 2UVUA 2Q1LA 5C42B 1XJWB 3J81j 3KK3A 1NY8A 4DV6J 4DX8H 3NI2A 1TK5A 3CDEA 4CZCA 2VFUA 4IOAQ 4ODJA 2R9LA 3RR8A 1IR2A 1UWAA 1JIHA 1ZM4A 3T1YC 4FBTA 3NAIA 1RSCA 3BKTA 2VDHA 2NCKL 2YXLA 4OYPA 3PYFA 4DU7A 1WD6A 2WB1D 1N6QA 2M8DB 4JV5C 1K73T 1Y7PA 2PGCA 1S1XB 2PMWA 3GIMA 2QL9B 1CEZA 2FDNA 1HWLA 4DR3F 4A48A 2PC6A 1RT2B 5J1EB 4TYAA 2HNZB 1TL3A 2NS1B 4A8OA 4ZITA 3J81U 3O44A 4ERDA 4K0KJ 3T5JA 3IO1A 3UR0A 5I3UA 3HFVA 3MTKA 3VAIA 4LQ9A 4B3OB 3A1YG 1CJKA 1RCXB 2VHGA 3C6UA 3VQSA 2RRAA 5T41A 4NA3A 3IRXA 4ZP6A 4PWUA 5CYJA 2CWXA 1G1XA 2J8AA 4C48A 3DYAA 1TKXA 3G8SA 1XNQC 1IBCB 1SH0A 3QLHB 2KU7A 2WW8A 3VHQA 4PYDA 4WFXA 2UVVA 2CDQA 5HI7A 4LF4F 4QYZJ 3FRZA 1VBYA 3KJNB 1R6VA 4I2QA 3QIDA 4NEZA 5GMEA 2GHPA 4J9OA 1Q78A 5E3AA 5K14A 3Q8VA 2LXUA 3HXMA 2UUBF 3B7WA 1AA1B 5HL7Q 2P2MA 5E3RA 4L7IA 2XHWA 4DS4A 2V2ZA 3PEJA 1LOUA 4NRUA 4UUWA 3PJWA 2HFZA 3H8YA 2MLYA 4UQTA 4Y28C 4F36A 3OSPA 3AHPA 1UVMA 1WELA 3IBWA 3J7YU 2XGPA 4JV5J 4DV5C 2N82B 5K8NA 1EETA 4QWEA 1CJUB 2F7VA 1I51B 4CH1A 3R8YA 4NLVA 1OS5A 5LJ3Y 4J9QA 2Y8WA 3ETCA 1JLGB 4PXEA 2WCXA 1Q5YA 3TA0A 4R1LA 2FQQB 2HQIA 2DGTA 4FP9A 4GVLA 4JI0F 2D69A 3H20A 1N5QA 1X4DA 3LOUA 1OSCA 2HQGA 5HO4A 1ZH5A 4IFVA 1SI9A 1X4FA 3ET6A 3POTA 1E6VA 1TUWA 1RAAB 3KKFA 2LEPA 4MKVA 2RKIB 1NDPA 2GVDA 5DGAA 3MI7X 3NYQA 2BKOA 4DG8A 1FKOB 3MEDB 5AJ3F 2VQEF 3F41A 2QO3A 2VG6A 3SIPB 5L8RC 3IMQJ 3R6LB 1T9YA 4KGXB 3OL7A 4PAAA 3RRHA 4LFAC 2OD4A 2VQFJ 4AE5A 3L9ZA 4J9PA 1Q53A 2JZ5A 2V68A 3ILIA 5T14A 2W9BA 1SJ4P 3MZIA 2MM9A 2ZHAA 3MMAB 1X60A 4P2FA 4C0OC 3JQJA 3VNRA 4R25A 2DISA 1VMBA 1DTTA 4IDKA 4ANCA 3KXWA 4IG3B 1TK8A 4JI1F 1LWEA 2KM8C 3J7A1 4WXOA 2MHEA 2DH9A 3D68A 4EWTA 3FQKA 1RKIA 2HQFA 1YTYA 4K4UA 2HBYB 3KWMA 4JBCA 4LVOP 4RW9B 1HNWJ 4DV5F 3KMQA 4F4XA 5KFWA 3WX4A 1QJHA 1I94C 3CD5A 2BKNA 3FNNA 4YQWA 5LMUC 1PG3A 4KGZB 1RHRB 2DNMA 3MM7A 5JVGQ 4DUYJ 4A8XA 3TUJC 2RRBA 3AFGA 1XRAA 4QWCA 3GP9A 3D4JA 1I6JA 2H5IB 1MMDA 5A0YB 4HPVA 2LQJA 2VICA 2MKCA 4B9VA 6AT1B 1BQXA 3VGSA 1TKZA 2UXBJ 4RBVA 1VQ4S 1YBAA 4LRDA 2V7BA 2XYPB 4DF8A 1NUEA 2CNLB 3PNIA 4RZRA 1S1WA 2GJ2A 1TL4A 5KT4A 3DCAA 2HFNA 4OQJA 1CG2A 2H51B 4UOFA 4WYWA 5CQGA 4ZS6A 3R97A 1WKLA 2I8EA 5H9EK 4JI8F 2YX7A 2HFOA 4X4UA 3EZ5A 3UEBA 4NZ7A 1VHIA 2ZKUA 4P10A 4K4TA 1BGXT 2C3OA 2ZJQQ 2OO4A 2OAUA 1LFPA 7FDRA 1EAYC 3IRWP 3I4PA 3M8ZA 4YY3F 3Q86A 2VPXB 1SKWA 3BQ0A 2PA3A 1KFSA 4UZCA 2P9GA 2XB2D 1QTNB 3RG2A 4MFBA 2VQFF 2F4VC 3AD7C 3IEVA 1OQ6A 1NHUA 4OYBA 1U24A 3PX4A 1HL6A 4ECUA 3DGPA 3TP2A 3MHYA 3S7RA 3CCRS 5LSRA 4PHTA 1OPZA 1DJ0A 1WC3A 5KT5A 4P75A 2I6WA 2MZTA 2N4CA 2I5JA 4NXMC 2DNRA 2ZEJA 3O5TB 4GC7A 2E1CA 1CVJA 2HRTA 4HHUA 2D7SA 3QO9A 4YY3J 1RZMA 2QL7B 3UI3A 4ZHRB 1RG9A 2B4UA 1ZAXA 3W9HA 4CLLA 4EEYA 5L1KA 1L3UA 1HD1A 1BE4A 2QE5A 2Y0BB 1KKHA 4JI7F 4FNIA 4P74A 1Y5NB 4HL9A 1H7XA 1LW0A 5D0GA 2IMOA 1UZHA 2BEFA 4TU8A 5DLFA 4IZ6A 4N8NA 1SH3A 2CFXA 3US5A 1IM6A 1YQHA 4D56A 1F5AA 8ATCB 3BGRA 2P20A 3R1HA 5EDWA 1RAJA 1Y00A 4J5OA 5EX0A 3C15B 2DTJA 2LQBA 5HJXA 1X4CA 2ILZA 4MIBA 4NL5A 4OX6A 5KT7A 4TU9A 1U1MA 2K7JA 2D3ZA 1GTHA 4OZ2A 3MM6B 2W1BA 2QGFB 4ETZA 3MAHA 1JXLA 1HBMB 4L75A 4XDDA 4QIVA 1Q79A 2J6TA 2E5LJ 5B0BA 4H4KA 4M5KA 4JYAJ 1RB0A 1HNIA 2ZE2B 4EZ6A 4FF3A 3LWLA 4ZA1A 2G13A 2B6AB 4C98A 2KYZA 2ASYA 5I42A 1EJ7L 5CZVA 4DWIA 3PBKA 1FDDA 1IWAA 3A3PB 3P8BB 1TV6B 1BC6A 2P2BA 2MDAA 4JP8A 1KQSR 1HNIB 2EBGA 2FLOA 3EZOA 1HHTP 4PUOA 5KFSA 3ZTRA 3KUEA 5DO2A 1NXIA 3UN2A 4DR7C 2UUCC 4X4OA 1HNVB 2V6AA 2D28C 3MURP 2KT2A 1YJRA 4XK8C 4DL0C 2HHHF 2ZOGA 1GMWA 2HKEA 2FLPA 1F9HA 3MEEA 2QYCA 2WP0C 2VODA 1NK5A 1YK9A 3CCLS 2PIIA 3OW2R 5C25A 2WAQD 1KONA 2BOAA 2CJYB 5CCLA 2CKWA 4CM0A 4OJHA 3HPOA 4DQRA 3GTYX 1GXTA 3D6FB 3L4BC 5GADU 1TP7A 1D1UA 1XNRF 3Q22A 1RAOA 2W2QP 3P49B 1JLCA 2CRLA 3C66A 2P9CA 4R8UA 1O5JA 3W66A 3SBMA 3N6NA 4MIAA 3SCJE 4IR7A 3WIUA 4NZ0A 4USVA 4FXDA 3ISND 3LQVA 4LRBA 2O1PA 4K4VA 1SC4B 1M5VC 1D9DA 2Y1IA 1RADB 4NWBA 3D1OA 3V6DB 2CADA 3Q8SB 5E7OB 4F0MA 2BXJA 2MSTA 2VA3A 1VLYA 2LA6A 4QIWD 1A0OB 5A6PA 1XHJA 1P9QC 1T94A 3NGRA 2ZM6J 4ECSA 3T1HJ 2E7GA 4ECYA 3QRPA 4GO5X 4GKJF 4TU7A 2B56A 3DRSA 3FBEA 3GJRB 1RTJA 3LP0A 4RW7A 1XMQF 1WF2A 4F25A 1S1WB 4YDXA 4PUOB 3OVSA 4OMFG 1EQMA 4ID5A 3VTIA 2XWXA 3L95X 1RY2A 2DIUA 4X62F 2QVYX 1ICEB 1ZPWX 1HARA 3MOZA 2C2MB 1RT5B 2HURA 3MWBA 4HACA 5DDOC 2IM0A 1ZBTA 3K5MA 4DV2F 3KOAA 2Y27A 4NXNC 4ZVGA 2W7OA 1HPZA 3WHIA 1OYEA 1RWNB 4ZP9A 2VJUA 1UVJA 1REVA 2XY7A 3VR1A 1WI6A 2OEKA 2GJFA 2R7RA 4FYXB 1FX4A 2IRYA 4LF7C 3MD1A 3GONA 3PEHA 4B3TF 3W8GA 4NA1A 3CDAA 3MM6A 4CO1A 1X9MA 3G87A 2YWHA 3IR5B 3MTJA 4P6QA 3MR2A 1M6XA 5LMNF 2HGMA 1U4BA 2RNEA 3NNHA 3Q8UA 3WBZA 2EXUA 1YI2S 1H2UX 4NMXA 3HK2A 2H3EB 2BE9B 3P3DA 3QLHA 5B08A 4KHPC 2DIVA 2VC0A 3AD8C 3K5PA 2VC1A 5D0RA 5I3PA 2OH2A 3KK2B 2GIFA 4LF6C 3LNVA 1VJWA 1IQTA 1KLNA 1YJVA 2YH1A 3OLBA 2BDPA 3FVYA 2E1MC 3D0GE 4CLZA 3MDFA 4ZIWA 1VC0A 4DR5C 4U96A 3FEYB 4ITSA 3CJKB 3SCKE 2UXBF 3IPLA 3EDQB 2VFSA 2CVEA 2ZWOA 2DHGA 3H0PA 4QW8A 3EYZA 2ZH4A 1X0PA 1RHJB 2DRDA 2QV6A 1LNQA 3WDOA 5LMNJ 4J9NA 1LW0B 1QDUB 4D3GA 2ACMA 2LECA 1AMUA 3BJYA 2FJDB 2IFXA 2QMWA 2CIMA 4K5SA 4IG0A 4R8UB 3VZHA 3CJRA 3JSMB 4DV7F 1KSPA 5K8MA 1CBKA 2GQ2A 1X4HA 2ZNYA 3UNGC 3SFUA 4F4YA 4USTA 3T1HF 1PG5B 2CQCA 4G1QA 3IS9A 1UJ5A 3IM9A 3IN5A 5F8LA 3CO9A 3JTPA 1KD1T 3MPWA 3DOMA 3F44A 4ZVHA 4EMDA 1FNOA 3OJSA 3CCTA 3IFEA 3NCPA 4V19X 2X3DA 4QPXA 4K4XA 2Y4OA 4PG5A 5JVHQ 2VG7B 2OPLA 2GVDB 1SC6A 3JQMA 1O8BA 5J2QB 3SCIE 2ZBQA 3BQ1A 4D57A 1HIYA 4WF9Q 1EP4A 2E5HA 3BREA 1RU2A 3DLEA 1JB0C 2POKA 1X0FA 2W25A 4CO4A 4YUDA 2VV5A 3GPCA 1HHSA 2KZ0A 5AJ3J 2AD9A 4L73A 4MKAA 2FY8A 4AQYF 3DLKA 4O4GB 5J1NA 5K8OA 1RAEB 1RI7A 1D09B 2MKKA 4B3TJ 1HNZC 3MEKA 1IQZA 2BYCA 4CTAB 2VDIA 4X62C 3RAQA 4Q45A 3T9NA 4DX5A 3PW4A 3LAMA 1RT4B 2D9OA 3GV7B 3R5CA 4CO0A 3CF5Q 2MEWA 1HBMA 3I31A 3KLIA 4ZVTB 5HK4A 5KFIA 4UOGA 5KT2A 1K0VA 5BR8C 3M30B 2J6UA 2XCPA 3KMSA 5HQLA 4F4ZA 3DKDA 1RT1A 5DM6Q 1C1BA 4BCAA 4PUGA 4JI6C 1RACB 3DRXA 3R2DJ 1BHNA 2X7IA 4NI2B 4JI2F 4IR9A 3TEHB 1K44A 2RE1A 3LF0A 4R5PB 4ZDNA 2DY1A 3PR5B 3CCQS 3G6ES 5I3UB 2F4FA 4KAIA 1FTRA 4B3SF 4CM2A 4MJKA 4W92B 1GEHA 1KDNA 4I7FB 4RBTA 5RUBA 2RQ4A 4FXWA 3DOLA 2QA4S 4YR3A 1IBLF 1BQNB 3CTRA 4PQUA 3TQ1A 3KLGA 4RW4A 2DB1A 4KGKA 4KTVA 2DGQA 4DV5J 4J90A 3C8YA 4LRAA 3OL6A 3NS5A 1Q86T 4MKYA 4ILLA 4IYQA 1IKXA 1LWEB 2D1CA 4ELVA 5JRHA 2A0FB 4OX9F 3QZ8A 2R8KA 2JVRA 3KNAA 1M0SA 3ELHA 3DGVA 4PG6A 3W2WB 1E6YB 3I87A 3BBCA 4NCGA 2A2CA 2F4VJ 1LWFA 4IH6A 4D4IA 3Q2TC 1WKKA 1KHVA 2HHHC 1S9GA 5F8IA 3BF4A 1CSJA 4KTTA 5AXNA 5ETKA 4DR6C 1JXEA 4N7TA 4IO9Q 1RLDA 2X51A 2CZ4A 2VFRA 4JI6J 1JX4A 3GFHA 4H4KC 5HP1B 2ROEA 2XZDB 2A6OA 2E0GA 3NYRA 1Y10A 3MPYA 3OUYB 3DDIA 2MLXA 4WFZA 4MH8A 3BGOP 5J1PA 2WBRA 3BZQA 3HX9A 2LVWA 2JC0A 2LU2A 3EVOA 5BSTA 5IT0A 2G2YA 3RYLA 4LF4J 2OPQA 3FDSA 4RWWA 3KDOA 4L4QA 2CNKB 3BSCA 1RBLA 4C2MA 2JDJA 5E2QA 2R7UA 1YRXA 2CG8A 3TUIC 3W9JA 4CQ1A 1C2PA 3H5SA 2Y3YA 2XMJA 3HHNB 2AJ2A 3N4WA 1U0HB 4QZVB 2RHQB 3N5FA 2YWKA 1TKTB 1WC1A 2IBOA 1SJRA 2G1DA 2JNVA 1RAIB 2H65B 2N3LA 4PXBA 4QJVA 4ED0A 1SIZA 2DRAA 1HHQA 4P2XA 3W2VB 1ZAWA 3GILA 2FYXA 2DGOA 5KFZA 3NWRA 3FCCA 3G82A 4C8NA 3W5XA 4DR5F 3ILLA 2C2EA 1N88A 4NOZA 1W7WA 2V8HA 4ED4A 3QGPA 2DXFA 2GVZA 3CVKA 3RB3A 2XLKA 1N5SA 4X4TA 3M8WA 5EWEA 3TRGA 4NRTA 1B0VA 5GTDA 1T7PA 1C1BB 5BSRA 1FRLA 2OP5A 1BXNA 3G86A 1U8WA 2ZFHA 5DLGA 1Q4RA 3KLGB 1NB2A 4FYWB 1YITS 2CQBA 2BKPA 3UE2A 5A2QU 3M2RB 4N56A 4K7QA 3EICA 5D77A 5EHHA 2ZVSA 2KXFA 2GAGC 3MOJB 4DR5J 3B4MA 1DLOA 3CIMA 5KFTA 4F67A 4YMEA 1D8YA 2W4PA 5JMNA 2FJEB 3B8HA 2OEMA 5CYQB 2UP1A 1R8BA 1U09A 2VU5A 1NEEA 5HVHA 1SXLA 4NI2A 3EUNA 1S1XA 3RG6A 3TR5A 3BYRA 4YR2A 1C4CA 5U47A 1VQMS 1JLAB 3DHVA 1E6VB 4KKOB 1X4BA 2HWHA 3EPIA 2OIHA 2UU9F 3Q89A 4NYPA 2KFNA 1VBZA 4ZLJA 1Y5IB 3D67A 3WIVA 4CLSA 1IBMJ 1XNQJ 2VOPA 1UVKA 2NSBA 3HDSA 1RHMB 2EPIA 3P45B 1FXDA 2C2DA 2C3PA 4CTAA 1YJNS 1S59A 4NLGA 2M5YA 2UXDC 3HVTA 5GMKa 3IAS9 3ISNC 1UPPA 2W24A 1UETA 4FN5A 2KFZA 1FXRA 4ZVEA 4V1Ak 2VH7A 4UTGA 1HMVA 5EX3A 3SQGB 2AMCB 2OGUA 3GIKA 2O01C 3AA9A 5E3CA 1U7LA 3M9NB 2XYHB 1MROA 3ZTPA 5J2QA 2KZZA 2HS0A 3U7JA 4OLOA 4ZVSB 3UDEA 1KVKA 4RUAA 4X4QA 2UVWA 2VOOA 3HFKA 4NLUA 3RR7A 4JI5C 3BEGB 1U25A 1PYOB 4I7FA 3GR1A 1CULB 3RRGA 1HH2P 2NUHA 4DQQA 2IHR1 3LUYA 2QZ8A 4KO0B 4OZ5A 1Z2ZA 2C22A 3BKFA 1YIJS 1N5YA 3LGXA 4DR2C 2DNNA 2F63A 4ATNA 3QJPA 3Q24A 1QLNA 4G6VB 4ZCLA 2W8KA 4A46A 1JNZB 5L1LA 1SB6A 3MR6A 2FVRA 4A4JA 4IQMA 2ILYA 3BBFA 4DG1B 2PROA 3PACA 1SV5A 3M8PB 2HNDA 3SDEB 2GCFA 2DBBA 4DV0F 1MG7A 2PT7G 2JFKA 2WOMB 1VEHA 3MUVP 1R8PA 3BH7B 3ZNJ1 1W2IA 4XDCA 4DV3C 3P96A 2WVDA 5KYVA 2R7OA 4YB7A 4DXLA 1D9AA 2VQEC 2HGLA 1FVSA 2ATCB 2F9JA 1EP4B 4OZ1A 4X65F 3M4XA 4ZVFA 1R0AB 2I38A 1TKDA 1KTQA 4KSEB 5CH7B 3CQ1A 2EFGA 2O5DA 2J8SA 3OXGA 2FLNA 4FTFA 4CLUA 2CYYA 2CJBA 4ANDA 3KK3B 4PUIA 1JLBB 1VR6A 2KT5A 3VZIA 2W2OP 5KFDA 1S9EA 3DC2A 3KLEA 2ZD1B 4DPOA 1QE1A 1WC4A 1T05A 4DV6F 1U48A 4N5SA 5C2CA 2QT7A 3KJQB 5A8RB 5HLFB 1XC9A 1Q7YT 4A8MP 2FLLA 1B0PA 1PKUA 4DV3F 2I2YA 1ZB9A 1LFWA 1FRXA 2ADCA 3HSGA 3EVWA 2DHHA 4KQZA 3PHTA 4JI2C 5KG7A 1X7VA 2O67A 2KRBA 3QZ7A 1NK7A 2EKYA 3W64A 3GIIA 1FKPA 3FBFA 2EK1A 2RHSB 3UN5A 4CNZA 2N7CA 2V0NA 1T03A 1P8GA 4G1QB 3MPDA 4DCPB 4L3KA 3TR3A 1H6KX 4CLPA 3HLUA 1B99A 1ZM2A 4WP9A 3ZZYA 3H4DA 4J9UE 2DGSA 3OFEA 3C5EA 2WK4A 4PZPA 4JI6F 4TQSA 4ETXA 2M2BA 2DNYA 2SXLA 4AFFA 4U8YA 4DDFA 5AE2A 2V4RA 2E1PA 4NCBA 2KDOA 4YS2A 1P6TA 2YKPA 3WX8A 2MTLA 1CC7A 1DTQA 1PIEA 1CJTA 5FD1A 4UZBA 2BQ3A 1G6BA 3N28A 4KY3A 4M1KA 1TK0A 4KTQA 2LFVA 4W4MA 1JXVA 1VQSA 1MW7A 4NXNJ 3EERA 3PRVA 1WDTA 4M5IA 1MNEA 1SBRA 4RUBA 3HF5A 5E5NA 1M90T 5D4PA 5CXTA 1VQNS 4LF9J 2MZSA 1PAEX 3QFWA 5KFFA 5BSMA 2OELA 2JL9A 2QSWA 2CJXB 1IKVA 4USKA 3PFEA 3DMJA 3QQCD 3R5JB 1N36F 2R7XA 4D4GA 1XMQC 2GQQA 2UV8G 2Z58B 1GX5A 1FWKA 1NSAA 1WSVA 4YN3B 2YX1A 4ID5B 3NRBA 1U1QA 3GMGA 2NSCA 3I9V9 3OXLA 2GO9A 4ZLLA 2HHUA 4NLRA 1S6QA 2KZMA 1AUDA 2KXHA 3B6BA 4NX9A 3JYTA 2DHSA 2DH8A 4NZ6A 4KPYA 4FXVA 3THTA 5EUHA 3BB5A 4Y0FA 4L6V3 1YX2A 1HNWF 4X62J 2FGCA 3GYNA 4ILMA 3H5YA 5F8GA 5ETTA 5KG2A 3DLKB 4O4GA 1VRQC 2HVDA 4MYUA 2WVCA 3CGIA 2VZEA 5D8HB 4DV4F 1RHUB 1U0SA 3NL0A 3R6GB 4OJ3A 2HQCA 4DN9A 4OZ3A 3VGVA 4LF6J 4X66F 4LF7J 3CCWA 1BUXA 1NLKL 2DGWA 1WHXA 1SPBP 2LYVA 1PCAA 2OMOA 2QJ3A 1LXJA 2RRNA 5K8PA 3KLFA 2NYIA 4XTTA 1EKSA 4KH1B 2V94A 1DQ9A 3UPFA 4OV6A 2EW9A 2GHVC 2VBYA 3MD3A 3J80Y 1QSLA 1V25A 2DNPA 3KJFB 1DTQB 3QGIA 1T3OA 2YWFA 2RQMA 3P4UB 4FVCA 4K2JA 3W60A 3MMCA 3Q83A 4ES2A 2X3GA 5BR8J 3QO9B 4ED5A 3V6DA 1U6ZA 1OJ4A 4P7TA 5HBMB 4JI8J 4C4WA 2V2QA 3DAYA 4ZK7M 1FXLA 1URRA 4DMZA 1I94J 4DLGA 1U6FA 2QN6B 2V34A 3AXKA 1H38A 2ASBA 4OX9J 2AWZA 3M32B 2CU6A 2GNKA 3H59A 5EGYA 1DARA 3AOCA 2PN6A 1SJQA 3D3BJ 5KTQA 4TQRA 3J7ZT 3A8EA 3BR9A 5DG9A 1FRKA 1HA1A 1HI0P 4DCUA 4RJVA 3I96A 4KFBA 4LFBJ 3I5BA 1FJGC 3ZZOA 4RPFA 5LL6d 1IM4A 2KTQA 2Z2ZA 1HNXF 2KDNA 3HMJG 2AYBA 4KGMA 3FBBA 1XN9A 3BPSP 2LP4A 1CS4B 1T9WA 1RTHB 2DNKA 3GG1A 3SYZA 1HQUA 2UVRA 2PI5A 1OY8A 1G3OA 2HHVA 3M1VB 4YOEA 4K4YA 4GS5A 4FUQA 3M8QA 1LKZA 3GYGA 3JTOA 3NS6A 3TO8A 9RUBA 3EX7B 4K4ZA 5BYSA 1HBNA 1RU1A 1YJ7A 1SC3B 3DI6A 5LCIA 1A6LA 3VAGA 3MEGA 2XNQA 4JI4J 1WI8A 3ITHB 2DPLA 4EO8A 3EMTA 1XMOJ 3QMQA 2B8QA 3I32A 5BXIA 3IP0A 1QTMA 1N52B 4CO2A 5FLXY 3NAHA 5KFNA 1FNXH 4KB7A 2WVBA 2J9CA 2PA8D 3NLCA 2XEXA 3PCOB 3HULA 4F50A 3C46A 3SSQA 1QUPA 5AXLA 4PYAA 1DRZA 2QSFA 1ZAVA 2K3IA 4A47A 4ECRA 5EN1A 3UN3A 4WE1A 4OYXA 2J9DA 2CQIA 1RCOB 2KL8A 4WBFA 1N5TA 5B0CA 1F6TA 3ZTSA 5IM0B 4A8YA 2JEFA 1RISA 4JI1C 1FF2A 1Q0NA 4IH7A 5KG3A 4C7QA 5L9NA 4RW8B 1WF3A 2LQ9A 3JTNA 4DUYF 1USPB 2KZFA 2E5LF 1PYSB 2MJUA 3DMJB 1X4EA 5GAEI 3PR4A 2GO8A 2LCWA 3T1HC 1Q95G 1G4CA 4ECQA 2IRUA 4BHQA 2APOA 2PFFB 2XTJP 4OYMA 2JH3A 1AUSL 1AZSB 3C16B 3C19A 4ENOA 1Q7LB 2KM8B 2C3YA 3W3SA 4OHYA 3QRRA 4G37A 4B3SC 1U2RA 2KHDA 5IQQA 3PY8A 2ROPA 3J81D 3T5KA 1TL7A 3HHKA 1R3NA 1HKAA 2YNIB 4ZCKA 4CIOA 5T7LA 4OI1A 3CD7A 2H5JB 4HT7A 2HYIB 1FE4A 1S6OA 1WOPA 2YBVA 4NLPA 3T1YJ 1YRUA 5F0UA 2ASLA 1JLEB 3CDWA 2DNZA 1XMQJ 4U67Q 2L08A 2G0CA 2V5HG 3MMAA 4LR7A 3MR3A 2VSQA 4OYWA 3M9MB 3FC9A 3POTB 2UUAF 4L76A 1RA7A 4DSIA 5BSVA 1FDAA 4YHHF 1IBMF 2CJQA 2RMLA 2ZUGA 1TQLA 4I6YA 4DV3J 1QVFR 1B70B 2FJVA 1VQYA 1FKPB 3CMQA 4DSLA 4IRDA 1JLBA 4YFUA 4JYAC 2UU9J 2VG6B 1VQOS 3DLBA 1KR4A 2OUGA 4C97A 2X1GA 2XI2A 1U1KA 2ONFA 2B4PA 3PW2A 2PE8A 2MKSA 3IAM9 4Y00A 3H40A 1T3NA 2H54B 1HNWC 4Z7YA 1I3OB 1L3KA 1QAJA 1HWJA 2J0QD 3NNCA 2D7VA 2I0XA 1FJEB 3LUSA 1GMVA 1D9FA 3V6KA 2KH9A 1Y5LB 3THVA 5DQIA 3TUFA 2EK6A 2CXEA 1HBNB 1UEKA 4DL6A 1M1GA 1CJVB 2HBRB 3QBCA 3OTOJ 3C14B 3A8IA 4JOUA 4MH4A 1ZYQA 4C8LA 4WKRA 1XR6A 4IFYB 1NK8A 3E7XA 1WEXA 4PEOA 3IWNC 3AQOA 5THWA 2ZC3A 1L3VA 2HHTA 2R7TA 1Y3JA 5KG6A 3RBEA 4DV4C 2HIQA 1RP5A 3OTCA 4KO0A 1ZETA 3TQEA 1CJTB 3IM8A 2D1RA 1IKYB 2ZNZA 1ZM9A 3AH6A 2E7WA 1HBOB 1S48A 2DNLA 3GJSB 4BBYA 3NGDA 3LTOA 2OJ3A 5L39A 4QU6A 2BJEA 1WDDA 3TAPA 4O44B 1F3VA 1U1OA 3ENAA 4QQBA 2LDYA 1O9TA 1FVQA 2ASDA 4Y3CA 1QAXA 1Y3KA 1IBKF 1ZA2B 2CZVC 4QYZK 4HH1A 2J9DE 4HHHA 4YHHJ 2F65A 1TKTA 2EBEA 2FHJD 4IFVB 4QWDA 3E8OA 2Y4NA 3MM5A 1MWQA 2P2CB 4EBCA 1S79A 1MN7A 4GXRA 2KO1A 4TVAB 2DEJA 3MF5A 1URNA 2ZZNA 1IWGA 3T41A 1RT3B 2VB6A 1DFDA 1FUGA 2YKMB 2K1RB 3M6VA 4LSNB 2XULA 4R0JA 4UQGA 4DPUA 4DX6A 4O0IA 5LM7E 3OFFA 4FKYA 2GV1A 4OZNA 2IM3A 4ZPVR 3TAMA 4KKOA 4ZCMA 4JI5F 3SO4A 4QIFA 4OZ0A 2P2QA 3MM9A 2W2NP 2HZCA 5BR8F 2MKIA 4DX7A 1NSPA 4ZVRB 4C11B 3M6UA 3UCUP 1X8DA 5HVGA 2YKMA 1S9EB 3VGTA 1XRCA 1UEVA 2G9OA 3HKWA 3QGGA 2AV5A 3G71S 1U8SA 1YDLA 4QW9A 2R2UA 5K14B 1F5BA 4FDFA 1H0HB 3OHAA 1Y11A 1XNRC 1IUJA 3C6TA 2MGZA 4Q5VA 1NJYA 2G4BA 5F8MA 1FE0A 4DR7F 2YKNB 4FNHA 1HR0F 2YQ3A 3V4IB 1VHFA 3ADAC 1ROFA 5M2UA 4E8UA 1D8ZA 2ZH7A 3CQ2A 5C7PA 5DG8A 1EB0A 3FMBA 5SZTA 3ZO7A 4C8KA 3EGNA 5H9FK 1BQMA 1V3SA 2XSFA 4WFYA 2W8LA 3MR7A 4YB6A 5GADI 2XO6A 1PU1A 4Y2KA 2ZBCA 4RO0A 1K8AT 4GKJJ 4EBEA 1PAUB 3KLHA 1TAUA 4DUZF 2H5EA 5ETSA 4ZJLA 4LIRA 3M2RA 2JEJA 4PQUB 1SKSA 1MXBA 3PIOQ 3BGFA 2VASA 2ZH3A 2UXCC 2FTRA 2VBZA 5ETPA 1H72C 1MU2B 1AT1B 1GMWD 2BANA 3M2UB 3CW9A 2XY6A 1KQKA 1OO0B 1XMOF 1GAOA 2B4VA 4IO1A 1U2CA 3M8YA 1N4LA 1K9MT 2DHXA 4KPCA 2RF2A 4M5NA 5E3QA 3VAFA 2XS5A 3A25A 4NDNA 4KYZA 4Y6IA 1HD0A 4TY8B 3N54B 3RUBL 4BC9A 1D0EA 2EFNA 2V63A 3W2VA 2OFGX 1M5KC 2RSQA 3LWMA 4JI7C 4ZVUB 4ZP8A 1FFGB 1B0TA 2MQMA 2YNFA 2C2OB 2M7SA 4LFAJ 4GVBB 3IBCB 5F3TA 3ZTOA 2HRYA 4USJC 4Y2IA 3CJEA 3SQOP 3W5YA 4NXMJ 3VNQA 4TNOA 2WSEC 3BSAA 4J91A 2MKJA 2RUGA 3VCDA 4YR0A 3DLPX 4CDIA 4JI3J 1MLAA 4GKKJ 3AOBA 4LFCC 3V4IA 1QY7A 2FJAB 2YY3A 5E41A 3NXZA 4FZVA 3KLVA 5L1JA 2MQNA 4NLOA 3KHHA 3CO0P 2BJ9A 4LRCA 3I0SA 5KFVA 3CPWR 3B78A 4LF6F 2UUBC 1S7IA 4LF7F 1HBUA 2BRKA 4LSLB 1VQ5S 4NXMF 4LMZA 3NGUA 2BUNA 2LEAA 2Z2LA 2AYAA 3W2WA 1JLEA 2BVZA 4AQYC 2BJDA 2IYGA 1IBKC 4EK2A 4LUBA 1EETB 1HI1A 3A3OB 4F2SA 4LBHA 3GYXB 4N47A 1NHVA 2BH1X 3OPKA 4DL7A 3ZNUA 2BANB 4GO7X 2RQKA 4F4WA 1RDRA 2YCBA 4Q7AA 1JNRB 2ABYA 2OSRA 4WPAA 3K6RA 1BQNA 1VISA 1NKBA 4DQPA 4WV3A 2HGNA 5E0OA 4GC6A 2BQUA 3J80D 3CJ3A 1K0TA 1UJ6A 3OD2A 3UO0A 3K5NA 2MKYA 2WBMA 2KT3A 2WOMA 2ZOMA 4WK3A 1IJFB 2V2VA 2LEBA 1JJ2R 2FY1A 1BA3A 4OFZA 4DCJB 4QWAA 3PYEA 1WSRA 5A0YA 1F0XA 3AXMA 3QIPB 4DQSA 5A1GA 1QAYA 1UP1A 3H2LA 3OQ2A 4LF9F 5LMUJ 2DCUB 1U1NA 2QW0X 1N5VA 4ICLA 4LREA 4U6PA 3KLIB 4F3MA 1GFWB 4O4RA 2RDDA 2Z30B 2XCAA 1M5OC 2DR5A 4IR1A 4Y2MA 4LFAF 4YHHC 2D3O1 5CZXA 2H4YB 2LKZA 2YTCA 2AJ0A 4FF4A 1L3SA 1FERA 4HLBA 4F4AA 1DTTB 2D74B 2JWNA 2B6AA 2M4MA 2YWEA 2BV3A 2ZZTA 2BM1A 3BGUA 3NG8A 4WJBA 3V4MA 4A8FA 1YRTA 5A8WA 4CWBA 4DL2A 4V19J 2NZCA 3WC2A 1A9NB 1QSYA 2D9PA 3BDEA 1NPPA 3MEGB 3D5MA 3NGTA 2B7BB 4NLXA 4P72A 1HQ2A 1F1BB 2J7UA 2VBXA 1P4EA 4OYZA 3NNAA 2CQPA 4WYLA 5KFBA 1QUVA 2CQHA 4LF1A 3HVTB 4ZPCA 4QBUA 3C3LA 3TZXA 5C24B 1VS3A 4JI7J 4B3TC 1TUVA 4LR8A 2WD9A 1AXQA 3PHEA 4EBDA 2H1YA 2QIFA 2AZ3A 2NQPA 2HJGA 1Q1KA 2W01A 3K2YA 2GMLA 4M94A 4DI6A 2EVZA 3TAMB 1V5IB 2YKOA 2NXNA 2JX2A 5D78A 3BDPA 4M5DA 1EIYB 2D1SA 4LIWA 1V3ZA 4N77A 3ENWA 1HWUA 4X66J 4I1TA 2PO4A 2R7QA 2XHCA 4NPOA 1MXCA 1IKYA 3U02A 1OY6A 3KG1A 4C3MA 5CCMA 3DOMB 1JMTA 1RT7A 3E2EA 2CQGA 4JI8C 3N9UC 4C3LA 4H4MA 2QLWA 5HBMA 3Q8PB 4AD6A 4GKJC 3E01B 3GSDA 3KDNA 5BURA 1UFLA 1Q8LA 1WJ9A 1SJ3P 1SUQA 3QT7A 4WFBQ 4R1MA 2UXDF 5HMYA 1ZTTA 4PG8A 1B7FA 1IB8A 1FFWB 2DH7A 2W7AA 1H74A 5AE1A 3LP2B 2W9CA 2DPIA 3KG4A 2XMKA 3AAWB 1FJGJ 3PJXA 2VL1A 1WEYA 4RWXA 4F7VA 1U1RA 1CQNA 4Q0BA 1JLQB 1KFDA 1XERA 1YBUA 1Z1ZA 2CNNB 2KYXA 2AEJA 3S01A 3AJ1A 1MXAA 4K0BA 2A2DA 2XSJB 5HMXA 2ZH1A 1WF1A 2DYAA 3W61A 2B9XA 1R0AA 2IRXA 1AFJA 1J2VA 1HPZB 1FFSB 3M30A 3QNWB 5KFLA 4DR3J 1JLFB 1ZZFA 1XK8A 3JQKA 4HDHA 4ZIVA 3FJ2A 3E51A 2ACYA 5K8FA 2HNYA 4UY85 1ZZNA 1KHWA 2C2RA 2AJQA 1S1TA 1O92A 1HWKA 3AQPA 3O2IA 4ZN3A 1KRPA 4USWA 5IFMA 1RT2A 5IT9U 3BS9A 5LMNC 1VRUA 2XLJA 2HK2A 1L5UA 4F02A 3I4HX 3DNCA 5H9UA 2EC2A 2GS8A 4JB8B 3UX2A 1PYTA 2V4JA 5L9XA 1DQAA 1X5TA 1SVDA 5C5JA 1N33C 2O66A 1ACMB 1W26A 2BZ2A 1VOMA 2Q6CA 3BV8A 3E01A 3NGSA 2I1RA 4MMOA 1MMNA 2FHJA 3HSZA 2NUUG 3N6MA 4FS1A 4K50A 5F3ZA 2LQ8A 2J7KA 2ZM6F 1DZ5A 2HMIB 3U1NA 4DLEA 2E8CA 2XR1A 1NKEA 1VLOA 1YJTA 2VD3A 1UVLA 1DURA 2WRMA 5ETRA 4FF2A 2AJ4A 4IOCQ 2F1FA 2V69A 1NM2A 1XIQA 4IDKB 2E44A 2MZJA 2WW4A 5IXUA 2VONA 5HQMA 2E29A 5F8NA 5A2QD 2WB4A 2PT0A 4WIQA 1NPRA 2AF6A 4P71A 2F3JA 3TVZA 2R8GA 1DQ8A 3AJDA 4PROC 2OPPA 2ZH9A 1YLXA 2CJKA 4JI0J 1SJ1A 5CD4A 2W4DA 2E1AA 2WSCC 3W63A 3JAMY 3D0HE 3UWTA 4AL7A 4JI2J 2XGQA 4IUFA 3PW7A 3RV2A 2E5GA 3MCOA 1LWCA 5FJ4A 4LSZB 4MFBB 3KK2A 1ITPA 2ZM6C 3QT6A 4ED1A 3NMAA 4RU9A 1S1VB 1AW0A 3UD5A 4BLGA 2L41A 3CCZA 4DR1C 1EZZB 2EFVA 4R5PA 4KHPF 2VG5A 2DNOA 1Z2LA 3SV3A 3KUGA 1Q8KA 1R27B 2EG1A 4RX6A 2MQQA 2NXCA 2C2NA 2XZWA 2OKQA 4LT6A 1JJ4A 2AYGA 2ZE2A 3O3LA 2Q66A 4OYAA 2W9AA 4ILRA 2IC3A 4RM2A 4B9NA 2HNYB 1IN0A 1OMSA 4XIUA 4DR2J 2D3OR 2QA4G 3BO3A 4E98A 1RT4A 2RU9A 1SL2A 3OTEA 3GV5B 2BJOA 4BS2A 1WF0A 2IYIA 2OFHX 3MM8B 2FPHX 2C3UA 3JS9A 1N34J 1J5EF 4OL8A 2KVQE 3PTWA 5F8HA 1NH7A 1REGX 3EJMA 1WOOA 4DFKA 5ETLA 4Q43A 2CPHA 4ECXA 2JEGA 1MMLA 4IRKA 4CYUA 2B5JB 4G3IA 2XSJA 1UWDA 5HROA 1IBLC 2ATWA 2HW3A 5EWFA 2NREA 2P9EA 4UW2A 3TJ8A 3BGRB 4DR1J 3SMZA 3G6XA 1HYSB 2B9EA 3CJTA 1NYEA 3MM8A 4LFCF 1M6XC 2HK3A 2M3DA 1YKWA 3N0VA 2CNOB 3PJ9A 3D3CJ 4ZPDA 1YJWS 3WQPA 3I07A 2ZBPA 3K57A 1ZB8A 2ZOFA 4DR4C 1R31A 1SV5B 3T6BA 3V6JA 1X4AA 4OHWA 2UUCJ 2E9TA 3PROC 1NMEB 2PN2A 3BBBA 4I69A 1S0NA 3CE8A 2F9DA 5CA5A 1KOHA 4DUZJ 4M5HA 5DZ6A 1SUQB 2DO0A 4UT4A 3S82A 2JFDA 3IS9B 4OX8A 2CA9A 4S0MA 1S7HA 4K4WA 2YWWA 4LFBF 2J76E 5IZHA 1PC4A 4DSKA 3G9CA 5B7WA 1NAQA 2HZAA 4ZPTR 2HNZA 3E7WA 1R0CB 5KOWA 1O0PA 1H2VZ 1Q82T 3JAMD 2CPEA 4CRJA 4CLWA 5KFXA 5MAOA 2E8EA 1N6QB 2HEKA 4ZN1A 2MQLA 1YG0A 5B0FA 3N5BA 1VIOA 3TZWA 1FRIA 1RTDB 4DL5A 1N48A 1VCTA 2JMPA 5KFQA 2DR9A 4B02A 1N33J 1WORA 4B9TA 4CO3A 2Z2YB 3UCZP 2HAIA 2MQ8A 3FSYA 5C42A 1HW8A 4GVBA 1T03B 4DPYA 5IWAJ 5A8KA 2D41A 1JWWA 2ZD1A 4JI3F 2OPRA 2QLBB 3DLGB 2JNJA 3AOAA 4FPRA 5C24A 2OPSB 4WU3A 3LA0A 1RGVA 1UWBA 3TJ9A 3UFCX 1IBLJ 1ZA1B 4WTYA 1APSA 2VPZB 1NBEB 4OI3A 1PC5A 1FWLA 5DDRC 2UUBJ 3BGLA 4YY3C 3F0NA 4I6WA 1X31C 5K85A 4DR1F 2BOPA 2IAJB 2FZKB 3BN4A 2OTLS 2MSSA 4DV4J 5ETMA 1Q8BA 4X4PA 1NO8A 3V81B 1ZTWA 2NPFA 1LW2B 1IVZA 3H2TA 3A3NB 2A1BA 4JV2A 3MFIA 1WC5A 3DOLB 1MD9A 1XQIA 5H9EJ 3VALA 4C0BA 4LFBC 1JJHA 2JJ4D 4DQIA 4DCVA 1RXOB 1SJFA 1EGAA 5D0EA 2ZDPA 2MYFA 3DRSB 3BO2A 4HKQA 2KKHA 5D15A 2RT3A 3V2UC 4JI4F 1J5OA 5GAEU 3RAMA 3ZZUA 3MR5A 1PG4A 2FJBB 2LLZA 4G1PA 4WP3A 5B0AA 4RNOA 1KN6A 2MKHA 4GKKC 3LGHA 2DGUA 3PO4A 2HHQA 3LGNA 4O3RA 1VQ6S 5LSOA 1YGYA 3RU0A 3OVBA 4DUTA 2BR0A 5KAKA 2MZ1A 1RWMB 5E33A 5KFOA 3PW5A 1NJXA 3W8PA 5HATA 3EGZA 1FKOA 3D7SB 3MEDA 5D4OA 4KE5A 2RQCA 5L1IA 3THPA 2I5JB 4DBQA 3EDRB 1YJ9S 2JLGA 5J2MA 2LXFA 1N33F 1N0VC 2G1HA 2F8HA 4XPEA 4O3PA 2YWGA 3I82A 4KT0C 2E7XA 3TUZC 3MUTP 1TFWA 4ZJOA 4DUYC 3DM2A 3QPIA 2MLZA 2NZ4A 1N36C 1QM9A 3GB0A 3QJJA 2GA7A 4OV1A 5D3GA 3ENQA 1UW9A 1UA0A 2R8JA 4TYBA 3KHLA 2V9WA 4RLFA 2EC0A 5B0EA 4QOTA 1VBXA 1NDLA 2F40A 3KG0A 1T8EA 5FLXU 3R9XA 3DM2B 4M5DB 4JUZA 2RKIA 2YNGB 3CJSA 3LAKA 4ZP7A 1SL0A 1S4EA 2GGPB 2L9NA 4R0EA 1XEZA 5M2RA 2MB0B 3GFXA 3VVUA 3KJVB 1RHKB 1VRTA 5CAAA 1QE1B 2YQ0A 1R7IA 1FO1A 4WFAQ 1T05B 1S9GB 2MPUA 3D6MB 1RWXB 2UUWA 3EE3A 3IGNA 3KUHA 3LW5C 4OHXA 3QSYB 2UUAJ 2HWIA 5B0GA 4CT9A 4LF8C 1DLOB 1YWXA 3BH6B 2ZH2A 3HO1A 4WS9A 3HJFA 5KFCA 3A8KA 4TKTA 2CQ2A 1B7YB 1JLAA 1FK9A 3IWLA 3IA0A 3L3CA 1U1PA 2NXEA 4USMA 4JYAF 1NSKL 2GMJA 2FZCB 3TX0A 4ELTA 2XQCA 1G7CB 1KS2A 2Q43A 4K0KF 1HNXC 3D2WA 3R44A 3G6VA 5DS7A 4DEZA 4PWWA 4J37A 4MK7A 4P9SA 5KG0A 3J7AN 5JXSA 3G7SA 1TL3B 4MAKA 1BQMB 2K06A 2Y0SD 4X4NA 3IXQA 1ML8A 3W62A 5BJRA 5C2GA 2VUGA 3F73A 3KLHB 4LF5J 4UOCA 2XMMA 3H2UB 2BW2A 3M8SA 4C3KA 1LWXA 1C0TB 3CDBA 3C6UB 4DFJA 1M1KT 2LU1A 2PEBA 3AJ2A 1OIAA 2Z56B 3VV2B 3TANA 2CJAA 5LOQA 2KRRA 5BYRA 3ZXWA 5F9NA 4ISBA 3BM7A 1DBDA 3D1HA 3GFZA 4K2XA 1CULA 3GQCA 2W2MP 4ZPWR 1MDFA 2J0XA 1NKCA 3DFEA 2AX0A 2HHPA 2OPRB 2PEHA 5D3GB 2R2SA 4ELUA 5KT3A 4FUTA 5KEIA 4L2ZA 3OTOC 4B3MJ 1MSWD 2QLXA 2OMLA 1UJ4A 2FVQA 1SC1B 3R7BB 5HMZA 4NEYA 2Z4PA 2R7VA 4N76A 5IFIA 3M2VA 5I3QA 5G4DA 2FZGB 2UXBC 5HP1A 4C0HA 3MCSA 2B43A 3QFHA 3CC4S 3OR1A 1UMJA 5AXMA 2C2ZB 3AD9C 2ERRA 4DG9A 3D6HB 2DHAA 1TL1A 2C2KB 4L72B 3W9IA 4OLPA 1A7GE 5DV9A 2IVMA 2I9SA 4OZJA 3TVYA 2AZ1A 5K20B 1X5SA 1FKAF 5E7QA 2GJIA 4AUKA 2HPUA 1RWVB 2QLFB 2WHOA 3CT9A 2W7PA 2IA6A 1WNEA 4QIGA 1RTIB 2CDRB 4DFMA 3FEZA 1MKYA 3KK1B 1BY9A 1KWMA 1J5OB 2QTWA 3MXHP 4RLQA 1VK8A 1J27A 2MHNA 5DGBA 4ECTA 1PSDA 3DOKB 3JXOA 2E1RA 3PYGA 4JI5J 3HD2A 4PXCA 1GNKA 2RUSA 4F3QA 2BBEA 2IJFA 5DDPC 3JAMU 4O44A 1Q16B 4WE1B 1EQ0A 3VAMA 3MFHA 1QD1A 4Z37A 3C16A 2RDIA 1KLMA 2F5GA 4DN0A 2M70A 1HFEL 1U26A 4KHPJ 1TH5A 4Q2LA 1FLOA 4NLWA 4J9RA 2HHHJ 3KFWX 2P02A 3PKMA 4GXQA 2GZOA 2HS3A 4FKXA 2R8HA 5CYMB 3BSOA 5GAHU 4O3NA 3E3XA 3T9ZA 1TAQA 1U49A 1NJIT 2HZVA 1RUSA 2W9BB 1IR0A 2G0IA 2V8DA 3MMBA 5G0RB 3R7SB 4YDDB 2JLFA 2CG4A 2KHCA 4OXIA 1BMQB 1C1CA 3OFGA 1NK0A 4FYVB 3U1LA 3G96A 3KTQA 3ILOA 1GH8A 2DYJA 3PESA 3A4IA 1PA4A 4FYDA 6FD1A 3DRRA 4DR2F 2GC8A 4KJIA 3QT5A 4LVNP 2ALZA 3UCGA 2XO7A 4C11A 1F60B 4PWDB 1UCNA 2FHOB 4Y65A 1MDBA 2MY8A 4HI1A 4IRCA 1WG1A 1LK7A 2W2PP 4J9VA 1HNXJ 2VPYB 4B3RF 3IR6B 2XNRA 3QWPA 5IC6B 1WC6A 2MGZB 3G2XA 4B08A 4ED6A 3A4TA 3OT9A 2QRRA 1F9EB 1JLGA 1VQKS 1TFYA 2NLWA 1YJUA 2Z57B 3MGJA 5HAOA 4JI3C 3CCJS 4CNYA 1QWIA 4NCGB 2J0WA 1NCLA 4L74A 2ZUAA 5H1SV 1YZ7A 3W65A 2HQ3A 3N6LA 3HT3A 2UU9C 3MPUB 4LF5C 4USUA 5T7LB 1IKXB 5H9FJ 2VBWA 1AROP 1H73A 3QSIA 5BYQA 2DKOB 4ECWA 2YNFB 3PFOA 2V2KA 4HVZA 4CH7A 2PSZA 3GZ7A 3HHLA 2A6MA 5GAHI 1NDKA 2PD1A 4RR5A 3OHBA 1C0UA 4GKKF 2QMXA 1WOSA 3RAXA 4RNHA 1WWHA 5JUMA 1JLCB 3FZBA 5KG5A 2VZ9A 5F9LA 4WFNQ 3HSJA 2ZH5A 4C8YA 2ZITA 4HR2A 5KFJA 3T3FA 1PGZA 1S76D 4PQAA 2RF2B 2BE2A 1S6PA 2G2ZA 1X4GA 2LQ5A 2O3DA 3HHLD 1C0TA 3UDVA 4U9RA 5IT4A 2VPWB 3SZ2A 4X2BA 3HT0A 1FK9B 3RRKA 2AQ4A 5F8JA 2GIRA 4I68A 3VNSA 2QVXX 4X65J 3KLFB 3VAHA 3GWCA 2UUTA 1V3RA 2BABA 1M5PC 1B64A 1CC8A 4NLDA 3EVMA 4RKUC 3DN9A 2ZVIA 4PKDB 4WKYA 4JI1J 1S1TB 4CO5A 2IAJA 2RH3A 4F26A 4WCEQ 4J9MA 4DL3A 4M5JA 5DRKA 2KFYA 2IBKA 2YX4A 3CWJA 3TA1A 1FNMA 1RT1B 2BJ1A 2K2PA 3BN7A 1RK8A 2QFIA 3DRPB 3K5OA 3LP1B 1F2HA 2VJVA 2DCLA 3EXCX 3DLGA 2J7WA 1UKUA 5HVFA 3HJVA 3ENVA 2XMUA 5K9FA 4MTPA 4DZDA 1U47A 1Q5VA 3C6TB 3NMRA 3PZPA 2QL8A 4RVNA 2XS2A 3AF6A 2X1FA 1UWBB 3DXSX 1UL3A 1U6BA 4NYZA 1JLQA 5ETNA 2FC9A 3C2PA 2IIHA 3TUPA 3K17A 3RTVA 4AL5A 1IKWA 4B3SJ 4P52A 4OI4A 1SH2A 2DNHA 4IH5A 3RB6A 1HQEA 4NE9C 3DLEB 4M5GA 4RUHA 3CJ0A 4J9KA 1JOSA 3M1VA 3PYDA 3SXLA 1U2FA 1RABB 1UPMB 2CQ4A 3I9ZA 4NYOA 4RUCA 1KC8T 2DEIA 1FX2A 4F8RA 1WH9A 3FCVA 3GIJA 1N32J 4DR4F 1KVJA 1LCIA 2D1QA 2DVIA 4WZQA 2BE7D 2HBQB 1FI4A 3M32A 3IWXA 4PUHA 5B0DA 2AJFE 4DJBA 4KFBB 5KOXA 4KV8B 4QR1A 5HANA 3FCEA 1V26A 4MKBA 1NDCA 5CABA 4PRFA 3TNVA 4O3OA 1XR7A 3IR7B 3I55S 1FTCA 4NCAA 2KXNB 3JSBA 1SKUB 3RB0A 1AFIA 4ZLNA 1GQEA 4OJ1A 4TLRA 1XNQF 4X4SA 3FUYA 3GJQB 4I2PA 4QR0A 4EU0A 5IWAC 4O3QA 2XY5A 4DV0C 3AB2B 4DPTA 4HT5A 3J81Y 3K5LA 2QC3A 2ZDOA 4AT1B 1H7WA 2XS7A 4HHJA 4ES3A 2XC9A 4JM1A 1NNDA 3Q0AA 1FWPA 2CPJA 4YEAA 2XG8A 2HS4A 1HNVA 1TMMA 2DT9A 4RNMA 1CJUA 4CLTA 1RBAA 5M2PA 2NR0A 1RYRA 4CCHA 3S1TA 3P5TL 2D27A 2OBVA 2B7CB 1YSJA 3PKYA 2BJ8A 2DPJA 2B51A 3Q8YA 4AXJA 3CMAS 3CW2C 4G36A 3O8WA 5HROB 3GU0A 1IKWB 4A8SA 2DITA 4PG7A 4CYUB 2QEXS 4KIAA 4FPIA 5HN0A 3R2CJ 2HVZA 1W2BR 3TX8A 4BSZA 1PJ7A 1TVRB 2BMBA 3S6EA 3ISZA 4DV2J 1RA6A 3LP0B 4RW7B 1OPIA 3GFYA 3UZ0A 3MAQA 4B3RC 1RKJA 3R9LA 1NH8A 2HFUA 2HNDB 3D28A 4Z7CA 5LT5A 1X9SA 2BW7A 2IC3B 4P2MA 1TZ0A 1S1VA 4TLQA 3J80U 1NB7A 1HQUB 1RQ0A 2IDEA 2HQDA 4I6AA 2HWTA 2R2TA 5I42B 4A8WA 2ASJA 1QSSA 1DY3A 3VVTA 2VA2A 2E9ZA 3C15A 4LQ3A 2QVZX 2D3UA 4DV7C 4OIXA 3TI0A 2EKNA 2XMTA 1RT7B 1CPZA 3FK4A 4M5LA 5A76A 2OPPB 3T1YF 5BUQA 5GAGU 2HLUA 3HHLC 1S97A 3HFZB
chains in the Genus database with same CATH topology
1O90A 3GKUA 3EQ6A 4R0MA 1HR0C 1MXAA 4K0BA 1O93A 4RM3A 2UXDC 5A19A 4DV4C 2PT7G 3IMLA 5T8SA 2P2JA 1O92A 5LMNC 5H9UA 3CW8X 1HH2P 3GR1A 4B3MC 3LGXA 1N33C 5KYTA 1ULTA 2YWBA 4TPSB 5BSUA 2E8CA 2XR1A 1QM4A 4BC7A 5A2QD 1VLAA 4DV3C 3GR0A 5KYVA 3TQIA 2VQEC 3NI2A 4PROC 4ODJA 3T1YC 4ZJZA 3RV2A 4JV5C 2ZM6C 1IBMC 4DR1C 2E8FA 3ETOA 1ZB9A 4RM2A 4JI2C 2BJOA 1XNQC 4DV6C 2ATWA 1LQLA 1IBLC 3B7WA 4GS5A 1P7LA 4X66C 2P2MA 4B3SC 4L7IA 1NYEA 3C5EA 4PZPA 5ADZA 5AE2A 4FTFA 3I07A 4EATA 1ZB8A 4DR4C 3PROC 4DV5C 2PN2A 4W4MA 5IT9D 3EERA 3S82A 1K0RA 3ETCA 5BSMA 4R1LA 1GPMA 4D4GA 3AF5A 1XMQC 3E7WA 3JAMD 2E5LC 3NYQA 4DG8A 2E8EA 2VQFC 2JMPA 4LFAC 2VZEA 2P2FA 3VNRA 3KXWA 3NPDA 1HNZC 4D57A 4YY3C 1V25A 4LF7C 5K85A 1I94C 5BSWA 5LMUC 1PG3A 1T5HX 3H2TA 3DAYA 1XRAA 1MD9A 4LFBC 4HPVA 2ASBA 4DCVA 1EGAA 4GXQA 2UUAC 4OXIA 2V7BA 4DCUA 1FJGC 1PG4A 3TDEA 4GKKC 2OO4A 4FUQA 3N2QA 1YJ7A 4K0KC 2F4VC 3RG2A 2UXBC 2DPLA 3IEVA 4PHTA 4DUYC 4MTNA 5AE3A 1N36C 4NXMC 4RMNA 4RLFA 1RG9A 4DUZC 3R9XA 1WF3A 1USPB 2KZFA 4G1IA 3T1HC 4D56A 1XMOC 1XRBA 2P20A 2BH1X 4LF8C 4WS9A 3UOWA 4G37A 2YWCA 3J81D 4XX2A 2OPLB 1HNXC 3R44A 2VSQA 3I08A 5K8FA 4JI5C 5BSVA 3PBKA 5CZVA 3G7SA 2P2BA 1ML8A 4OX9C 4JYAC 4DR7C 2UUCC 2ONFA 2D28C 3L8CA 5BR8C 2WP0C 4ISBA 1HNWC 1MDFA 4LF4C 2D7VA 4FUTA 4IZ6A 3LUSA 3OTOC 5KEIA 4L2ZA 3A9UA 3TUFA 5IFIA 4IR7A 5FLXD 4RVOA 3LAXA 3E7XA 4DG9A 5DV9A 5E7QA 2D1RA 2E7GA 2UXCC 4BBYA 4X64C 1MKYA 4RLQA 4DCTA 1O9TA 1RY2A 3L95X 2QVYX 4DCSA 4NXNC 2Y4NA 2Y27A 4I9FA 4GXRA 1FUGA 2P02A 5A1IA 3SO4A 4DV2C 2P2QA 3IEUA 4KHPC 1XRCA 4LF6C 1N34C 3LNVA 3PESA 1J5EC 2DYJA 4ZLPA 3A4IA 1PA4A 1XNRC 4DR5C 1L2FA 3IPLA 4LE5A 1USPA 1MDBA 1AMUA 3R9WA 3VNSA 4JI3C 1QWIA 1T5DX 2UU9C 4LF5C 1MXBA 3CW9A 2Y4OA 5BUSA 2OPLA 4NDNA 3N54B 3GPCA 2D1TA 4BC9A 4JI7C 4DV1C 4X62C 3CJEA 2CY1A 3VNQA 4OYCA 2QVXX 3DLPX 4BCAA 4JI6C 4LFCC 3A9VA 4LF9C 2UUBC 2AYAA 4JI1C 4AQYC 1IBKC 2PROA 4DR3C 4KTVA 4RVNA 2EGTA 2QL8A 3AF6A 5JRHA 2YCBA 4WV3A 3J80D 4JI4C 4D4IA 2MKYA 1JOSA 4U5YD 1BA3A 5T8TA 2HHHC 4KTTA 1WH9A 4DR6C 1LCIA 5A1GA 2D1QA 2E0GA 2QW0X 3NYRA 1N32C 3FCEA 1V26A 4YHHC 5CZXA 5BSTA 5IWAC 4L4QA 4DV0C 1N2FA 4JM1A 4JI0C 2CXCA 4B3TC 2WD9A 2D27A 2OBVA 3FCCA 4G36A 4DR2C 2HJGA 4NOZA 4BSZA 4X65C 2D1SA 3UZ0A 5GTDA 4B3RC 5BSRA 1UKKA 1MXCA 4JI8C 4GKJC 5BURA 4R1MA 2QVZX 4DV7C 1KKGA 5BUQA 5AE1A 4MH4A 4I9GA 3DHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G7S A;  2P2B A;  3NYQ A;  4DG8 A;  3EQ6 A;  4R0M A;  4RM3 A;  3VNQ A;  3L8C A;  4OYC A;  2P2J A;  2QVX X;  3DLP X;  4ISB A;  2VZE A;  2P2F A;  1MDF A;  3A9V A;  4FUT A;  4IZ6 A;  3VNR A;  3KXW A;  5KEI A;  3A9U A;  5IFI A;  3CW8 X;  4IR7 A;  4D57 A;  4RVO A;  3LGX A;  5K85 A;  5BSW A;  3LAX A;  5KYT A;  4RVN A;  1PG3 A;  1T5H X;  1ULT A;  3E7X A;  4DG9 A;  3DAY A;  5JRH A;  5BSU A;  1MD9 A;  5DV9 A;  4WV3 A;  5E7Q A;  4GXQ A;  2D1R A;  4OXI A;  4D4I A;  2MKY A;  4U5Y D;  2V7B A;  1BA3 A;  4RLQ A;  1PG4 A;  5KYV A;  1LCI A;  1RY2 A;  2D1Q A;  2QVY X;  3NI2 A;  2Y4N A;  2Y27 A;  2QW0 X;  3NYR A;  3FCE A;  4GXR A;  4FUQ A;  4ZJZ A;  1YJ7 A;  5BST A;  3RG2 A;  2P2Q A;  4RM2 A;  3LNV A;  4RMN A;  4RLF A;  3IPL A;  2WD9 A;  4G36 A;  3FCC A;  1MDB A;  3B7W A;  4GS5 A;  1AMU A;  2P2M A;  4D56 A;  3C5E A;  2P20 A;  2D1S A;  4PZP A;  5GTD A;  3VNS A;  5BSR A;  4EAT A;  4G37 A;  1T5D X;  4W4M A;  5BUR A;  3CW9 A;  4R1M A;  2Y4O A;  2QVZ X;  3ETC A;  5BUS A;  5BSM A;  4R1L A;  3R44 A;  2VSQ A;  4D4G A;  5K8F A;  5BUQ A;  5BSV A;  3E7W A;  3PBK A;  3GPC A;  3DHV A;  2D1T A; 
#chains in the Genus database with same CATH topology
 2CPI A;  2DNG A;  3H5X A;  2YNH A;  2AGP A;  4WZM A;  3GKU A;  1RAF B;  2FJW A;  3EQ6 A;  2VKZ G;  3I5C A;  3PRD A;  4P7V A;  4DFP A;  2Z8Q A;  2BJ3 A;  2YVS A;  1HR0 C;  3AA8 A;  1VK3 A;  4NLS A;  4GRS A;  4U7U K;  1O93 A;  1S6P B;  2HFS A;  5MLC V;  1RTD A;  5DDQ C;  2AU0 A;  3VF0 B;  1T95 A;  2AGO A;  5A19 A;  1R8A A;  2GMH A;  4I0W A;  4ID8 A;  1Y0H A;  4DOZ A;  3KHG A;  4X4V A;  1P27 B;  4NAS A;  5FII A;  3SI8 A;  2P8I A;  1N54 B;  1Z4U A;  2PMZ D;  3RW6 A;  2P2J A;  1PJ5 A;  3T5H A;  5D4N A;  1UA1 A;  2QFJ A;  4B3R J;  3K89 A;  5DET A;  5D0H A;  1FDN A;  3I08 A;  1IR1 A;  1S0M A;  2XBP A;  2R8I A;  1S5Z A;  4K8R A;  1T9V A;  3WZ0 A;  1O51 A;  4LJM A;  2AYE A;  3SV4 A;  2IVF B;  4DV1 F;  1VFJ A;  2C28 A;  2YKA A;  3GCX P;  4C6A A;  4ZHR A;  3JSR A;  2IPO B;  2JLE A;  1HMV B;  3SQG A;  2AGQ A;  1GT8 A;  4B3M C;  2CPX A;  4RLE A;  3DLH A;  1UAW A;  1SIW B;  2BM0 A;  2XMW A;  2AIR B;  1FEE A;  1RAG B;  4WU2 A;  2EWH A;  3HZE A;  2WVE A;  3QYY A;  2LA4 A;  4DU8 A;  4KHM A;  1R0B G;  3VWS A;  2E66 A;  5IV4 A;  3BO4 A;  2RD5 C;  1JKH A;  2L48 A;  2XI3 A;  1RYS A;  4I67 A;  2KI2 A;  2YWB A;  4TPS B;  1P4E C;  1TU0 B;  3OV7 A;  2WSF C;  2UZA A;  4Q44 A;  2FIU A;  2ALY B;  2WON B;  4WWS A;  3P5B P;  4X64 J;  4F3O A;  3M6W A;  3CUN A;  2OEJ A;  1F5C A;  4KC5 A;  3KNG A;  5ETQ A;  1QM4 A;  3D0I E;  4O23 A;  3UDL A;  1TKZ B;  4EI2 A;  1S72 S;  5IV3 A;  4BC7 A;  3H42 A;  2UXC F;  1XTZ A;  1SKR A;  4B9M A;  3GR0 A;  3TQI A;  3TZY A;  3CME S;  1MWY A;  3IG1 B;  3RGI A;  1IXK A;  1KLM B;  1LWC B;  3DU6 A;  5D4L A;  4Q8E A;  3P6Y C;  4OX7 A;  4ICL B;  3G6Y A;  3R3T A;  1RAH B;  2M5O A;  3RBX A;  1V60 A;  4ZJZ A;  3AT1 B;  1Q8I A;  5CYM A;  3PV8 A;  3DOK A;  2BE2 B;  2IJN A;  3PM9 A;  1PBU A;  4D3H A;  4B3O A;  4O3S A;  2UXC J;  3AY0 A;  4I2P B;  1IBM C;  2AP6 A;  4ANE A;  1OY9 A;  3H7H B;  3NBP B;  5AXK A;  3PVX A;  1U45 A;  1VQ8 S;  5D6G A;  3DGP B;  2IVY A;  4HYK A;  2CPD A;  4Q2M A;  5FDL A;  2YKQ A;  4G65 A;  2KG1 A;  3ETO A;  2DRB A;  2E8F A;  1TMJ A;  1WEZ A;  1N5Y B;  4EGL A;  4RW9 A;  3VQT A;  1U1L A;  2OD6 A;  3HVW A;  3OBI A;  2B8P A;  2VFV A;  3A13 A;  3UVJ B;  2FVC A;  5F41 A;  4LBI A;  2MQP A;  4IG3 A;  1V5V A;  1S1U A;  1HR0 J;  1IBK J;  5F0W A;  1S99 A;  4HTJ A;  1XR5 A;  1UFW A;  4NA2 A;  5A8R A;  3BPD A;  3M2V B;  5KG4 A;  3CW8 X;  4DV6 C;  1XWL A;  2V4J B;  1LQL A;  3L7P A;  3RZA A;  3TW0 A;  1P7L A;  2OPQ B;  3I0S B;  3CXC R;  3BKU A;  3OR2 B;  2CPZ A;  5ADZ A;  1CQM A;  2BX6 A;  2FJX A;  4B3M F;  2K3K A;  4F0H A;  4EAT A;  2B0G A;  1RBO B;  2VKR A;  4F4K A;  3CD6 S;  5DQG A;  5KFU A;  1M1H A;  1FD2 A;  4CI0 B;  1LQ9 A;  1KVI A;  3G4S S;  5IT9 D;  2M5H A;  1K1Q A;  3PRB A;  5DM7 Q;  1GPM A;  3ILJ A;  2BRL A;  2Q79 A;  2R7S A;  5HJY A;  2ZZM A;  1K0R A;  3L09 A;  3L7O A;  4ER8 A;  1NK9 A;  4ECV A;  1S6Q B;  2Z2M A;  4JV0 A;  3AF5 A;  1KOO A;  1LWF B;  3MUM P;  1FES A;  2GQC A;  3NBP A;  3I0R A;  4B9S A;  2E5L C;  1F3F A;  1RHQ B;  3CB4 A;  1U02 A;  2IJR A;  1VC5 A;  1G2E A;  2RJZ A;  3F56 A;  3NY0 A;  4C8O A;  1WG4 A;  2VQF C;  4X4R A;  2HVE A;  3R5B A;  2M88 A;  4DV1 C;  1VBK A;  4ZJQ A;  1UVN A;  3V5R A;  3J7Z 5;  3OVA A;  2K7K A;  1LV5 A;  2JEI A;  1CLF A;  2RB7 A;  2C3M A;  2QA2 A;  4TY9 A;  4DS5 A;  4Y2C A;  3RB4 A;  4KHR A;  1K1S A;  2UV8 A;  3IG1 A;  4Y34 A;  2V9K A;  2P2F A;  4I2Q B;  4LRF A;  3SFG A;  1OYD A;  5KG1 A;  4AYB D;  1YHQ S;  1RE1 B;  3SDE A;  5J1E A;  2P5V A;  2EEY A;  1XBW A;  3NPD A;  3T6J A;  2MXY A;  1P9Y A;  3CNQ P;  1FHT A;  4KRW A;  3Q8R B;  3MM9 B;  2B3T B;  1GMU A;  3SCL E;  2OSQ A;  3IC1 A;  3KK1 A;  4FS2 A;  2J6S A;  3OL8 A;  4K0K C;  4OI6 A;  3I5A A;  4LBP A;  1CJK B;  2YKN A;  7AT1 B;  4EYH B;  3EPG A;  1T11 A;  2ZC4 A;  6FDR A;  4MK9 A;  2R3V A;  2CQ3 A;  2F8M A;  2V8G A;  3BR8 A;  5BSW A;  1JKH B;  2Y9H A;  3NCR A;  1VQ9 S;  1T5H X;  3OR1 B;  5E3P A;  3NOG A;  4RU2 A;  1GXU A;  2R2R A;  4HTI A;  2F4V F;  3QAE A;  3ZZ0 A;  3GG0 A;  3GPA A;  3ETM A;  1MRO B;  3N79 A;  2XLI A;  2J9E A;  1WG5 A;  2ZBI A;  1DAX A;  3BYP A;  3CJ2 A;  4DF4 A;  3FFI B;  4NLT A;  3TAQ A;  3ET6 B;  1UVI A;  1T9X A;  2QYG A;  1S6U A;  1XS3 A;  1T0T V;  4K59 A;  1S57 A;  1VJQ A;  2MQO A;  2H48 B;  1OWX A;  1HNZ J;  2RS8 A;  2AHO B;  3B82 A;  3CJ4 A;  3NOC A;  4P73 A;  5KFA A;  1V9O A;  3R7N B;  4A8Q A;  4BDP A;  2HVI A;  3TDE A;  2E7V A;  2CJ9 A;  2KB2 A;  5KFY A;  1E6Y A;  1RWW B;  5HQ8 A;  3CDU A;  4PXD A;  3DLL Q;  2VF3 A;  3MM5 B;  3S8S A;  3M9O B;  2V4Q A;  4CP5 A;  3AB4 B;  4RBU A;  2VQE J;  2ZH8 A;  2DR7 A;  1JQG A;  2R4F A;  5A8W B;  4EO6 A;  2FHK A;  4USI A;  3CCS S;  2G2O A;  3M6X A;  4U8V A;  4M63 A;  4FBU A;  2DO4 A;  2V8V A;  5DZ7 A;  3M05 A;  3DHX A;  4IQX A;  3LAL A;  1T02 A;  2X1B A;  1NJZ A;  3VGU A;  2M0G B;  3DDK A;  1UFK A;  4MTN A;  4H4O B;  2AEF A;  5AE3 A;  1FRM A;  4FF1 A;  3M8P A;  2LDI A;  4WTO B;  2FC8 A;  4JV1 A;  1FJ7 A;  5I4M A;  2GW8 A;  1OSD A;  4HI2 A;  3KJV A;  4AQY J;  1F2G A;  3KXD A;  4RMN A;  2CQ0 A;  1F9F A;  5HMW A;  3Q23 A;  1GK8 A;  3CCV S;  2ATL A;  3MCM A;  3CUL A;  3X3U A;  2MMA B;  3O2E A;  1M5H A;  3R1L A;  2WZ1 A;  4DUZ C;  2EG2 A;  1U0H A;  1EKR A;  1CJV A;  1S0O A;  3N01 A;  3HZG A;  1RWK B;  5IQ6 A;  5LJ5 Y;  1MN9 A;  4DSJ A;  3X1L B;  2DXE A;  4DR6 J;  5AT1 B;  4G1I A;  3HHD A;  2OPS A;  3MCN A;  3OTO F;  3NS7 B;  1C0U B;  5LXR A;  1XMO C;  3KHR A;  1LEO A;  1XRB A;  4B17 A;  2Z51 A;  2IM2 A;  1S10 A;  2M9K A;  1REV B;  2ZHO A;  3EGW B;  1NK4 A;  4WXW A;  4Z2X A;  1ULR A;  1WHV A;  4OI2 A;  5KFK A;  4ZPB A;  4QR2 A;  3K0J A;  3UOW A;  3FKB A;  4NLQ A;  2V50 A;  2IDL A;  1HNZ F;  1CS4 A;  1GTE A;  2YWC A;  3GIR A;  2E9R X;  2M52 A;  1HW9 A;  1VYA A;  2NYH A;  1S1U B;  4RW6 B;  3OL9 A;  2B4O A;  1HLW A;  4ZKA A;  2UXD J;  3QAT A;  4DR6 F;  1VI7 A;  4PR6 A;  4FVM A;  3UNY A;  3R5G A;  3CCM S;  3CCU S;  1VQP S;  3T1A A;  2VIH A;  2HHX A;  1MWZ A;  1SQG A;  4RL1 A;  2R42 A;  2ZJR Q;  2DD8 S;  5LSL A;  3HP6 A;  2OPL B;  1Y4Z B;  5A8K B;  4CT8 A;  1QVG R;  2KJV A;  5K5M A;  1I1G A;  1RJJ A;  4DHV A;  1AYE A;  4XX2 A;  4OX9 C;  1XNR J;  3R27 A;  4GMK A;  3PXG a;  1YBT A;  3DHW C;  1ELO A;  3FGV A;  1NZA A;  2Z0G A;  1X5P A;  4CLF A;  5C25 B;  3A8J A;  4XPC A;  2AKW B;  1N34 F;  2L9D A;  4KV8 A;  1BD6 A;  3UVJ A;  3FEX B;  1K47 A;  4W98 A;  2Q6B A;  2V67 A;  4IG0 B;  2DNQ A;  4KR0 B;  3B54 A;  4C8Z A;  4DSF A;  4XO0 A;  5GVQ A;  2OI2 A;  5FDL B;  3L8C A;  4URQ U;  3MMB B;  3QGH A;  1BLU A;  5G0R A;  3H4B A;  3ZFV A;  1RWP B;  4W90 B;  4LF4 C;  3A26 A;  3N2Q A;  3OSN A;  3FZ2 A;  2P6S A;  3DRY A;  4CH0 S;  4PCQ A;  3C14 A;  2JVO A;  3PX0 A;  2GVZ B;  3OTB A;  4JV5 F;  4C8M A;  3A9U A;  3U1M A;  1FRH A;  1VQL S;  3CJ8 A;  2MCQ A;  2QMU B;  3MEE B;  4J9L A;  3GSI A;  2OHD A;  3B4D A;  3D9B A;  3MAA B;  5ITH A;  4RVO A;  5FLX D;  2XWY A;  3R5A A;  3ZTQ A;  3G82 B;  4EYI B;  2WON A;  1HWI A;  3NCQ A;  3LAX A;  2EFQ A;  4DPX A;  1ZPV A;  1LW2 A;  2GFF A;  3HI9 A;  4XAK A;  4ZVQ B;  3M8Q B;  1TVR A;  3I56 S;  2HHS A;  2YH0 A;  1N36 J;  4PG4 A;  1PBA A;  3MAA A;  4URG A;  3OJU A;  4NOH A;  2RIL A;  1RT5 A;  1VRT B;  2NXJ A;  2OLW A;  1FCA A;  2GAH C;  4QIE A;  2X1A A;  5J2N A;  5DQH A;  1IKV B;  1EX8 A;  1H98 A;  3GCW P;  1Y9O A;  3O1L A;  2ADB A;  1X9W A;  4K4S A;  4X64 C;  4YP3 A;  3HSD A;  3EZU A;  4DCT A;  3ONQ A;  1FA0 A;  4LR9 A;  2A10 A;  2YNG A;  2IMW P;  5L46 A;  2VG7 A;  3LAN A;  2KN4 A;  1WTB A;  2K1R A;  1FRJ A;  2QG9 B;  4LSN A;  1RT3 A;  1OQ3 A;  5IC4 B;  2LMI A;  2CVI A;  3TEG A;  1WCJ A;  1R6Y A;  4AXI A;  4DCS A;  4ED8 A;  1RWU A;  3FMW A;  1RTJ B;  4I9F A;  4ZVP B;  4LF8 F;  4NML A;  4BWJ A;  4E2F B;  2VG5 B;  4ZPA A;  3FSX A;  3K59 A;  5J2P A;  3QJL A;  1FEH A;  4OZL A;  1L3T A;  2GHW A;  4NLY A;  1BWV A;  3D6T B;  2QLJ B;  2RU3 A;  2MMY A;  2BJ7 A;  3A12 A;  3UDC A;  5SUH A;  5J2M B;  5CD4 H;  1NPK A;  2DR8 A;  2HHW A;  1KTV A;  2HSE B;  2YNH B;  2U2F A;  3UW1 A;  4DCO B;  4HEA 9;  5A1I A;  4F04 B;  4DV2 C;  2YNI A;  1VC6 A;  2JOQ A;  2KG0 A;  2AJ1 A;  1S77 D;  3IEU A;  2EI5 A;  2JSX A;  3BQ2 A;  1FDB A;  5L38 A;  3Q2S C;  3CD0 A;  2HVH A;  1EAR A;  3GV8 B;  3HVA A;  5KFR A;  3W1Y C;  1N34 C;  1J5E C;  3MEC B;  3TVK A;  4UOH A;  1NRK A;  4ZLP A;  4N41 A;  4YB5 A;  2ZJP Q;  1I94 F;  2DK2 A;  4IFY A;  3CQ3 A;  1L2F A;  3H2V E;  4BWM A;  1ZS6 A;  3ICL A;  5IM0 A;  2Y1R I;  5GAG I;  3TYT A;  3JSM A;  3PW0 A;  1W25 A;  4X84 A;  2HAF A;  3HCX A;  3M7V A;  7FD1 A;  1NK6 A;  4LE5 A;  1USP A;  2NCL A;  2JC1 A;  4U7C A;  3EXY A;  4RW8 A;  1HBO A;  5B09 A;  1VRU B;  3CIZ A;  3I6P A;  3R9W A;  3SEO A;  3HVR A;  1R8C A;  3CJK A;  1TV6 A;  3KYL A;  4C9D A;  2UUC F;  4PWD A;  3FQL A;  1KQF B;  2B5J A;  2RIJ A;  4HH0 A;  4OJG A;  4QYR A;  3CC2 S;  1T5D X;  3DLJ A;  4IOB A;  2DR6 A;  3CED A;  3SSS A;  4NXN F;  2MZR A;  2DGV A;  2GX8 A;  2VFT A;  3ITH A;  4PZV A;  3T5L A;  3JSY A;  2YQ1 A;  4DR7 J;  1BWE A;  4DL4 A;  2W4C A;  3MM7 B;  3CCE S;  3NGK A;  3ZZZ A;  2MZQ A;  3D54 A;  1WKJ A;  4EZ9 A;  2IM1 A;  4H4O A;  5BUS A;  2IY5 B;  3EM1 A;  3FRY A;  1RTH A;  2ROG A;  3UQS A;  4U95 A;  1VIX A;  2W9C B;  4OYO A;  2D1T A;  4X64 F;  1LXN A;  1RWO B;  3FCW A;  3LH2 S;  4DV0 J;  2EFP A;  2M8H A;  2DHM A;  2J5A A;  2GGP A;  4MT1 A;  4MIW A;  2MJN A;  4HAC B;  4HDG A;  3HD1 A;  4I64 A;  2CY1 A;  2RVJ A;  1FD8 A;  2HFV A;  3K8W A;  3MEC A;  3TJA A;  2LXI A;  3VAK A;  4H4M B;  1TL7 B;  4KH0 B;  4H54 A;  4OYI A;  4PPD A;  1WC0 A;  2AW0 A;  4KBI A;  5A6W A;  4ZVO B;  3QWU A;  4PAB A;  1RTZ A;  3RW7 A;  3ZC4 A;  4LF8 J;  4OYC A;  2UUA C;  2EFO A;  1H2T Z;  3A9V A;  3H5U A;  1TEL A;  2CAJ A;  4LF9 C;  3LPY A;  4ECZ A;  3MMC B;  2H4W B;  3TAR A;  1S0V A;  3PIP Q;  2QA1 A;  1RTI A;  2WVF A;  4QWB A;  5IWA F;  1UW4 A;  4ZOS A;  2FD2 A;  2CQD A;  2KVI A;  4J9S A;  1S12 A;  1WHW A;  2AYM A;  4OHV A;  3UD4 P;  3EWG A;  1KNZ A;  5J2P B;  2PFD A;  1Q81 T;  4OI0 A;  3V6H A;  3CC7 S;  4DV7 J;  1B4S A;  2MY7 A;  4M8L A;  3M8R A;  2YPY A;  3K7R A;  1R43 A;  2RDJ A;  4DR3 C;  3EGV A;  2EGT A;  1GXL A;  1LK5 A;  1WUU A;  3NWG A;  2ZWP A;  4ZMM A;  5LXY A;  1AZS A;  3ZZR A;  1UTA A;  2N4D A;  3CJ5 A;  3T19 A;  2H9Z A;  5EWG A;  2WTF A;  1VDH A;  5HLF A;  1KEK A;  1NU4 A;  3DRP A;  1SQF A;  3LP1 A;  1B3T A;  2FVP A;  4DZ6 A;  4K5R A;  4WP8 A;  3QRQ A;  2RAQ A;  1P1T A;  5JJB A;  4JI4 C;  4TN2 A;  4F0K A;  1PJ6 A;  2CPY A;  2XYG B;  4U5Y D;  3UD3 P;  1V6H A;  4LF5 F;  1FJC A;  5T8T A;  1SQE A;  2E5J A;  4I4B A;  2N3O A;  1VQ7 S;  4WII A;  3LO3 A;  1AB8 A;  2BA9 A;  3FSI A;  4Y2A A;  1RLC L;  1XMB A;  2HG4 A;  3GJT B;  5IOL A;  3U27 A;  3DI6 B;  3OFH A;  2L3M A;  1C1C B;  2CPF A;  2XZT B;  3DXB A;  3LP2 A;  5KFH A;  1PO6 A;  4LFC J;  2KJW A;  4M95 A;  2JRS A;  2AX1 A;  1T9U A;  2FB0 A;  1YZ6 A;  2NPI A;  1GX6 A;  3PG9 A;  5KFG A;  2FVS A;  2HBZ B;  1N32 C;  3K8V A;  4O0N A;  2F8E X;  2XM3 A;  4ALZ A;  8RUC A;  2FGO A;  2V8P A;  2CZ9 A;  3ULH A;  3JB9 k;  1X5O A;  2DXD A;  3I0R B;  4FYY B;  1NHK L;  5ETO A;  4DPW A;  3J7Y I;  4USH A;  3K58 A;  2XMV A;  2Y1L B;  1WTF A;  5LMU F;  5CHC B;  1N2F A;  2HIY A;  3IGV A;  2J0S D;  3HM9 A;  4Q8F A;  4DG1 A;  2A3J A;  3NP5 A;  2FHM A;  1IJE B;  4WK1 A;  4EFA C;  4CLK A;  3OLA A;  4JI0 C;  4ZCI A;  1WAC A;  2DGX A;  3IRX B;  1I5O B;  3NKY A;  4ED7 A;  3FCH A;  3RBD A;  1N56 A;  2CXC A;  4B9U A;  1JK9 B;  4DSE A;  3LPE A;  5IT9 Y;  3NEK A;  4ED2 A;  3PO5 A;  2A18 A;  2AEM A;  2QL5 B;  4J7C A;  4MYT A;  3UR3 C;  3W5Z A;  1ZOT A;  1KQG B;  1R89 A;  4QCL A;  1TTH B;  4E0D A;  1S4F A;  2BQR A;  3DU5 A;  1R8H A;  1EHW A;  2PDA A;  3QT8 A;  2ZH6 A;  4LF2 A;  5HSP A;  3DDN A;  4X65 C;  3LNO A;  2N7Y A;  2HMI A;  3TA2 A;  5KFE A;  3TWZ A;  1FJG F;  3ZZP A;  4QU7 A;  1D3W A;  3R5D A;  3VAJ A;  1TR0 A;  4UY8 T;  9ATC B;  1N0U A;  5J2N B;  1UKK A;  4P2S A;  1M5S A;  2HRU A;  3KLE B;  2Y1J A;  2P6T A;  2PI4 A;  3RJM B;  2CUY A;  4DR4 J;  1N32 F;  2BAC A;  3DRR B;  2C1E B;  2U1A A;  2GIQ A;  2ZHB A;  4I56 A;  2NXU A;  3TZZ A;  4F2R A;  4B9L A;  2IA0 A;  1HI8 A;  2B9W A;  3H98 A;  3OTD A;  4U7U D;  4L3N A;  1KKG A;  3UX3 A;  2K8G A;  1SCJ B;  4YB1 P;  2COL A;  4QPT A;  1SL1 A;  1HYS A;  5IS2 A;  4I9G A;  4TY8 A;  3WC0 A;  1PIL A;  4RW6 A;  3ZZT A;  1O90 A;  1YVF A;  2HLT A;  3GE9 A;  3GLJ A;  3QIP A;  4PPZ A;  1S9F A;  1N8R T;  1JLF A;  2XMA A;  1NSQ A;  2OTJ S;  5CYQ A;  5ETV A;  4R0M A;  3H90 A;  4MK8 A;  5KT6 A;  1KP6 A;  5KFP A;  4RM3 A;  3H25 A;  3MPV A;  3LGM A;  2R7W A;  3OXF A;  4RW4 B;  3JYT B;  1VGY A;  4A8K A;  2AT1 B;  5DG7 A;  2Q3P A;  3HHE A;  3IBF B;  3IML A;  2Y8Y A;  4RNF A;  3PDN A;  8AT1 B;  5T8S A;  2ZKT A;  1TKX B;  1RT6 A;  4M5M A;  3Q8Q B;  4Q0B B;  2CQ1 A;  3RBZ A;  3HKZ D;  1JJC B;  1TL5 A;  2C42 A;  2B9Y A;  2PMH A;  3TOQ A;  2QX0 A;  1T9T A;  3G8T A;  3SSR A;  1NJW A;  2L9W A;  4IKA A;  4TXS A;  4RNN A;  1C4A A;  4ES1 A;  4X66 C;  3DYA B;  4AL6 A;  3W7B A;  3CJQ A;  3O6Q A;  2CWK A;  1MU2 A;  1WHY A;  1ZM3 A;  3D66 A;  3L7U A;  3M2U A;  1KBR A;  1RT6 B;  4LSL A;  1HBU B;  4URS A;  4UUX A;  2DJW A;  3PX6 A;  3QAU A;  4KGV B;  1J5E J;  3HHL B;  2FUG 9;  1NZ8 A;  3BSN A;  3V81 A;  3AOD A;  1P1L A;  5DJB A;  4OHZ A;  5KYT A;  2G0J A;  1ULT A;  5GMD A;  3OUY A;  1UEU A;  5BSU A;  1DHM A;  2DY9 A;  4N8O A;  3MMJ A;  4DV1 J;  1TUG B;  3G8Q A;  5A2Q Y;  4ED3 A;  2E5I A;  1FT8 A;  3FFI A;  1H3D A;  4UF4 A;  2RS2 A;  3D1Q A;  2JHE A;  5KFM A;  1O6X A;  1HQE B;  1UZD A;  2YPZ A;  3CSK A;  3FBC A;  4CLY A;  3OR2 A;  1QAI A;  2ZBR A;  4EUV A;  1VLA A;  1S49 A;  1TL1 B;  2UVU A;  2Q1L A;  5C42 B;  1XJW B;  3J81 j;  3KK3 A;  1NY8 A;  4DV6 J;  4DX8 H;  3NI2 A;  1TK5 A;  3CDE A;  4CZC A;  2VFU A;  4IOA Q;  4ODJ A;  2R9L A;  3RR8 A;  1IR2 A;  1UWA A;  1JIH A;  1ZM4 A;  3T1Y C;  4FBT A;  3NAI A;  1RSC A;  3BKT A;  2VDH A;  2NCK L;  2YXL A;  4OYP A;  3PYF A;  4DU7 A;  1WD6 A;  2WB1 D;  1N6Q A;  2M8D B;  4JV5 C;  1K73 T;  1Y7P A;  2PGC A;  1S1X B;  2PMW A;  3GIM A;  2QL9 B;  1CEZ A;  2FDN A;  1HWL A;  4DR3 F;  4A48 A;  2PC6 A;  1RT2 B;  5J1E B;  4TYA A;  2HNZ B;  1TL3 A;  2NS1 B;  4A8O A;  4ZIT A;  3J81 U;  3O44 A;  4ERD A;  4K0K J;  3T5J A;  3IO1 A;  3UR0 A;  5I3U A;  3HFV A;  3MTK A;  3VAI A;  4LQ9 A;  4B3O B;  3A1Y G;  1CJK A;  1RCX B;  2VHG A;  3C6U A;  3VQS A;  2RRA A;  5T41 A;  4NA3 A;  3IRX A;  4ZP6 A;  4PWU A;  5CYJ A;  2CWX A;  1G1X A;  2J8A A;  4C48 A;  3DYA A;  1TKX A;  3G8S A;  1XNQ C;  1IBC B;  1SH0 A;  3QLH B;  2KU7 A;  2WW8 A;  3VHQ A;  4PYD A;  4WFX A;  2UVV A;  2CDQ A;  5HI7 A;  4LF4 F;  4QYZ J;  3FRZ A;  1VBY A;  3KJN B;  1R6V A;  4I2Q A;  3QID A;  4NEZ A;  5GME A;  2GHP A;  4J9O A;  1Q78 A;  5E3A A;  5K14 A;  3Q8V A;  2LXU A;  3HXM A;  2UUB F;  3B7W A;  1AA1 B;  5HL7 Q;  2P2M A;  5E3R A;  4L7I A;  2XHW A;  4DS4 A;  2V2Z A;  3PEJ A;  1LOU A;  4NRU A;  4UUW A;  3PJW A;  2HFZ A;  3H8Y A;  2MLY A;  4UQT A;  4Y28 C;  4F36 A;  3OSP A;  3AHP A;  1UVM A;  1WEL A;  3IBW A;  3J7Y U;  2XGP A;  4JV5 J;  4DV5 C;  2N82 B;  5K8N A;  1EET A;  4QWE A;  1CJU B;  2F7V A;  1I51 B;  4CH1 A;  3R8Y A;  4NLV A;  1OS5 A;  5LJ3 Y;  4J9Q A;  2Y8W A;  3ETC A;  1JLG B;  4PXE A;  2WCX A;  1Q5Y A;  3TA0 A;  4R1L A;  2FQQ B;  2HQI A;  2DGT A;  4FP9 A;  4GVL A;  4JI0 F;  2D69 A;  3H20 A;  1N5Q A;  1X4D A;  3LOU A;  1OSC A;  2HQG A;  5HO4 A;  1ZH5 A;  4IFV A;  1SI9 A;  1X4F A;  3ET6 A;  3POT A;  1E6V A;  1TUW A;  1RAA B;  3KKF A;  2LEP A;  4MKV A;  2RKI B;  1NDP A;  2GVD A;  5DGA A;  3MI7 X;  3NYQ A;  2BKO A;  4DG8 A;  1FKO B;  3MED B;  5AJ3 F;  2VQE F;  3F41 A;  2QO3 A;  2VG6 A;  3SIP B;  5L8R C;  3IMQ J;  3R6L B;  1T9Y A;  4KGX B;  3OL7 A;  4PAA A;  3RRH A;  4LFA C;  2OD4 A;  2VQF J;  4AE5 A;  3L9Z A;  4J9P A;  1Q53 A;  2JZ5 A;  2V68 A;  3ILI A;  5T14 A;  2W9B A;  1SJ4 P;  3MZI A;  2MM9 A;  2ZHA A;  3MMA B;  1X60 A;  4P2F A;  4C0O C;  3JQJ A;  3VNR A;  4R25 A;  2DIS A;  1VMB A;  1DTT A;  4IDK A;  4ANC A;  3KXW A;  4IG3 B;  1TK8 A;  4JI1 F;  1LWE A;  2KM8 C;  3J7A 1;  4WXO A;  2MHE A;  2DH9 A;  3D68 A;  4EWT A;  3FQK A;  1RKI A;  2HQF A;  1YTY A;  4K4U A;  2HBY B;  3KWM A;  4JBC A;  4LVO P;  4RW9 B;  1HNW J;  4DV5 F;  3KMQ A;  4F4X A;  5KFW A;  3WX4 A;  1QJH A;  1I94 C;  3CD5 A;  2BKN A;  3FNN A;  4YQW A;  5LMU C;  1PG3 A;  4KGZ B;  1RHR B;  2DNM A;  3MM7 A;  5JVG Q;  4DUY J;  4A8X A;  3TUJ C;  2RRB A;  3AFG A;  1XRA A;  4QWC A;  3GP9 A;  3D4J A;  1I6J A;  2H5I B;  1MMD A;  5A0Y B;  4HPV A;  2LQJ A;  2VIC A;  2MKC A;  4B9V A;  6AT1 B;  1BQX A;  3VGS A;  1TKZ A;  2UXB J;  4RBV A;  1VQ4 S;  1YBA A;  4LRD A;  2V7B A;  2XYP B;  4DF8 A;  1NUE A;  2CNL B;  3PNI A;  4RZR A;  1S1W A;  2GJ2 A;  1TL4 A;  5KT4 A;  3DCA A;  2HFN A;  4OQJ A;  1CG2 A;  2H51 B;  4UOF A;  4WYW A;  5CQG A;  4ZS6 A;  3R97 A;  1WKL A;  2I8E A;  5H9E K;  4JI8 F;  2YX7 A;  2HFO A;  4X4U A;  3EZ5 A;  3UEB A;  4NZ7 A;  1VHI A;  2ZKU A;  4P10 A;  4K4T A;  1BGX T;  2C3O A;  2ZJQ Q;  2OO4 A;  2OAU A;  1LFP A;  7FDR A;  1EAY C;  3IRW P;  3I4P A;  3M8Z A;  4YY3 F;  3Q86 A;  2VPX B;  1SKW A;  3BQ0 A;  2PA3 A;  1KFS A;  4UZC A;  2P9G A;  2XB2 D;  1QTN B;  3RG2 A;  4MFB A;  2VQF F;  2F4V C;  3AD7 C;  3IEV A;  1OQ6 A;  1NHU A;  4OYB A;  1U24 A;  3PX4 A;  1HL6 A;  4ECU A;  3DGP A;  3TP2 A;  3MHY A;  3S7R A;  3CCR S;  5LSR A;  4PHT A;  1OPZ A;  1DJ0 A;  1WC3 A;  5KT5 A;  4P75 A;  2I6W A;  2MZT A;  2N4C A;  2I5J A;  4NXM C;  2DNR A;  2ZEJ A;  3O5T B;  4GC7 A;  2E1C A;  1CVJ A;  2HRT A;  4HHU A;  2D7S A;  3QO9 A;  4YY3 J;  1RZM A;  2QL7 B;  3UI3 A;  4ZHR B;  1RG9 A;  2B4U A;  1ZAX A;  3W9H A;  4CLL A;  4EEY A;  5L1K A;  1L3U A;  1HD1 A;  1BE4 A;  2QE5 A;  2Y0B B;  1KKH A;  4JI7 F;  4FNI A;  4P74 A;  1Y5N B;  4HL9 A;  1H7X A;  1LW0 A;  5D0G A;  2IMO A;  1UZH A;  2BEF A;  4TU8 A;  5DLF A;  4IZ6 A;  4N8N A;  1SH3 A;  2CFX A;  3US5 A;  1IM6 A;  1YQH A;  4D56 A;  1F5A A;  8ATC B;  3BGR A;  2P20 A;  3R1H A;  5EDW A;  1RAJ A;  1Y00 A;  4J5O A;  5EX0 A;  3C15 B;  2DTJ A;  2LQB A;  5HJX A;  1X4C A;  2ILZ A;  4MIB A;  4NL5 A;  4OX6 A;  5KT7 A;  4TU9 A;  1U1M A;  2K7J A;  2D3Z A;  1GTH A;  4OZ2 A;  3MM6 B;  2W1B A;  2QGF B;  4ETZ A;  3MAH A;  1JXL A;  1HBM B;  4L75 A;  4XDD A;  4QIV A;  1Q79 A;  2J6T A;  2E5L J;  5B0B A;  4H4K A;  4M5K A;  4JYA J;  1RB0 A;  1HNI A;  2ZE2 B;  4EZ6 A;  4FF3 A;  3LWL A;  4ZA1 A;  2G13 A;  2B6A B;  4C98 A;  2KYZ A;  2ASY A;  5I42 A;  1EJ7 L;  5CZV A;  4DWI A;  3PBK A;  1FDD A;  1IWA A;  3A3P B;  3P8B B;  1TV6 B;  1BC6 A;  2P2B A;  2MDA A;  4JP8 A;  1KQS R;  1HNI B;  2EBG A;  2FLO A;  3EZO A;  1HHT P;  4PUO A;  5KFS A;  3ZTR A;  3KUE A;  5DO2 A;  1NXI A;  3UN2 A;  4DR7 C;  2UUC C;  4X4O A;  1HNV B;  2V6A A;  2D28 C;  3MUR P;  2KT2 A;  1YJR A;  4XK8 C;  4DL0 C;  2HHH F;  2ZOG A;  1GMW A;  2HKE A;  2FLP A;  1F9H A;  3MEE A;  2QYC A;  2WP0 C;  2VOD A;  1NK5 A;  1YK9 A;  3CCL S;  2PII A;  3OW2 R;  5C25 A;  2WAQ D;  1KON A;  2BOA A;  2CJY B;  5CCL A;  2CKW A;  4CM0 A;  4OJH A;  3HPO A;  4DQR A;  3GTY X;  1GXT A;  3D6F B;  3L4B C;  5GAD U;  1TP7 A;  1D1U A;  1XNR F;  3Q22 A;  1RAO A;  2W2Q P;  3P49 B;  1JLC A;  2CRL A;  3C66 A;  2P9C A;  4R8U A;  1O5J A;  3W66 A;  3SBM A;  3N6N A;  4MIA A;  3SCJ E;  4IR7 A;  3WIU A;  4NZ0 A;  4USV A;  4FXD A;  3ISN D;  3LQV A;  4LRB A;  2O1P A;  4K4V A;  1SC4 B;  1M5V C;  1D9D A;  2Y1I A;  1RAD B;  4NWB A;  3D1O A;  3V6D B;  2CAD A;  3Q8S B;  5E7O B;  4F0M A;  2BXJ A;  2MST A;  2VA3 A;  1VLY A;  2LA6 A;  4QIW D;  1A0O B;  5A6P A;  1XHJ A;  1P9Q C;  1T94 A;  3NGR A;  2ZM6 J;  4ECS A;  3T1H J;  2E7G A;  4ECY A;  3QRP A;  4GO5 X;  4GKJ F;  4TU7 A;  2B56 A;  3DRS A;  3FBE A;  3GJR B;  1RTJ A;  3LP0 A;  4RW7 A;  1XMQ F;  1WF2 A;  4F25 A;  1S1W B;  4YDX A;  4PUO B;  3OVS A;  4OMF G;  1EQM A;  4ID5 A;  3VTI A;  2XWX A;  3L95 X;  1RY2 A;  2DIU A;  4X62 F;  2QVY X;  1ICE B;  1ZPW X;  1HAR A;  3MOZ A;  2C2M B;  1RT5 B;  2HUR A;  3MWB A;  4HAC A;  5DDO C;  2IM0 A;  1ZBT A;  3K5M A;  4DV2 F;  3KOA A;  2Y27 A;  4NXN C;  4ZVG A;  2W7O A;  1HPZ A;  3WHI A;  1OYE A;  1RWN B;  4ZP9 A;  2VJU A;  1UVJ A;  1REV A;  2XY7 A;  3VR1 A;  1WI6 A;  2OEK A;  2GJF A;  2R7R A;  4FYX B;  1FX4 A;  2IRY A;  4LF7 C;  3MD1 A;  3GON A;  3PEH A;  4B3T F;  3W8G A;  4NA1 A;  3CDA A;  3MM6 A;  4CO1 A;  1X9M A;  3G87 A;  2YWH A;  3IR5 B;  3MTJ A;  4P6Q A;  3MR2 A;  1M6X A;  5LMN F;  2HGM A;  1U4B A;  2RNE A;  3NNH A;  3Q8U A;  3WBZ A;  2EXU A;  1YI2 S;  1H2U X;  4NMX A;  3HK2 A;  2H3E B;  2BE9 B;  3P3D A;  3QLH A;  5B08 A;  4KHP C;  2DIV A;  2VC0 A;  3AD8 C;  3K5P A;  2VC1 A;  5D0R A;  5I3P A;  2OH2 A;  3KK2 B;  2GIF A;  4LF6 C;  3LNV A;  1VJW A;  1IQT A;  1KLN A;  1YJV A;  2YH1 A;  3OLB A;  2BDP A;  3FVY A;  2E1M C;  3D0G E;  4CLZ A;  3MDF A;  4ZIW A;  1VC0 A;  4DR5 C;  4U96 A;  3FEY B;  4ITS A;  3CJK B;  3SCK E;  2UXB F;  3IPL A;  3EDQ B;  2VFS A;  2CVE A;  2ZWO A;  2DHG A;  3H0P A;  4QW8 A;  3EYZ A;  2ZH4 A;  1X0P A;  1RHJ B;  2DRD A;  2QV6 A;  1LNQ A;  3WDO A;  5LMN J;  4J9N A;  1LW0 B;  1QDU B;  4D3G A;  2ACM A;  2LEC A;  1AMU A;  3BJY A;  2FJD B;  2IFX A;  2QMW A;  2CIM A;  4K5S A;  4IG0 A;  4R8U B;  3VZH A;  3CJR A;  3JSM B;  4DV7 F;  1KSP A;  5K8M A;  1CBK A;  2GQ2 A;  1X4H A;  2ZNY A;  3UNG C;  3SFU A;  4F4Y A;  4UST A;  3T1H F;  1PG5 B;  2CQC A;  4G1Q A;  3IS9 A;  1UJ5 A;  3IM9 A;  3IN5 A;  5F8L A;  3CO9 A;  3JTP A;  1KD1 T;  3MPW A;  3DOM A;  3F44 A;  4ZVH A;  4EMD A;  1FNO A;  3OJS A;  3CCT A;  3IFE A;  3NCP A;  4V19 X;  2X3D A;  4QPX A;  4K4X A;  2Y4O A;  4PG5 A;  5JVH Q;  2VG7 B;  2OPL A;  2GVD B;  1SC6 A;  3JQM A;  1O8B A;  5J2Q B;  3SCI E;  2ZBQ A;  3BQ1 A;  4D57 A;  1HIY A;  4WF9 Q;  1EP4 A;  2E5H A;  3BRE A;  1RU2 A;  3DLE A;  1JB0 C;  2POK A;  1X0F A;  2W25 A;  4CO4 A;  4YUD A;  2VV5 A;  3GPC A;  1HHS A;  2KZ0 A;  5AJ3 J;  2AD9 A;  4L73 A;  4MKA A;  2FY8 A;  4AQY F;  3DLK A;  4O4G B;  5J1N A;  5K8O A;  1RAE B;  1RI7 A;  1D09 B;  2MKK A;  4B3T J;  1HNZ C;  3MEK A;  1IQZ A;  2BYC A;  4CTA B;  2VDI A;  4X62 C;  3RAQ A;  4Q45 A;  3T9N A;  4DX5 A;  3PW4 A;  3LAM A;  1RT4 B;  2D9O A;  3GV7 B;  3R5C A;  4CO0 A;  3CF5 Q;  2MEW A;  1HBM A;  3I31 A;  3KLI A;  4ZVT B;  5HK4 A;  5KFI A;  4UOG A;  5KT2 A;  1K0V A;  5BR8 C;  3M30 B;  2J6U A;  2XCP A;  3KMS A;  5HQL A;  4F4Z A;  3DKD A;  1RT1 A;  5DM6 Q;  1C1B A;  4BCA A;  4PUG A;  4JI6 C;  1RAC B;  3DRX A;  3R2D J;  1BHN A;  2X7I A;  4NI2 B;  4JI2 F;  4IR9 A;  3TEH B;  1K44 A;  2RE1 A;  3LF0 A;  4R5P B;  4ZDN A;  2DY1 A;  3PR5 B;  3CCQ S;  3G6E S;  5I3U B;  2F4F A;  4KAI A;  1FTR A;  4B3S F;  4CM2 A;  4MJK A;  4W92 B;  1GEH A;  1KDN A;  4I7F B;  4RBT A;  5RUB A;  2RQ4 A;  4FXW A;  3DOL A;  2QA4 S;  4YR3 A;  1IBL F;  1BQN B;  3CTR A;  4PQU A;  3TQ1 A;  3KLG A;  4RW4 A;  2DB1 A;  4KGK A;  4KTV A;  2DGQ A;  4DV5 J;  4J90 A;  3C8Y A;  4LRA A;  3OL6 A;  3NS5 A;  1Q86 T;  4MKY A;  4ILL A;  4IYQ A;  1IKX A;  1LWE B;  2D1C A;  4ELV A;  5JRH A;  2A0F B;  4OX9 F;  3QZ8 A;  2R8K A;  2JVR A;  3KNA A;  1M0S A;  3ELH A;  3DGV A;  4PG6 A;  3W2W B;  1E6Y B;  3I87 A;  3BBC A;  4NCG A;  2A2C A;  2F4V J;  1LWF A;  4IH6 A;  4D4I A;  3Q2T C;  1WKK A;  1KHV A;  2HHH C;  1S9G A;  5F8I A;  3BF4 A;  1CSJ A;  4KTT A;  5AXN A;  5ETK A;  4DR6 C;  1JXE A;  4N7T A;  4IO9 Q;  1RLD A;  2X51 A;  2CZ4 A;  2VFR A;  4JI6 J;  1JX4 A;  3GFH A;  4H4K C;  5HP1 B;  2ROE A;  2XZD B;  2A6O A;  2E0G A;  3NYR A;  1Y10 A;  3MPY A;  3OUY B;  3DDI A;  2MLX A;  4WFZ A;  4MH8 A;  3BGO P;  5J1P A;  2WBR A;  3BZQ A;  3HX9 A;  2LVW A;  2JC0 A;  2LU2 A;  3EVO A;  5BST A;  5IT0 A;  2G2Y A;  3RYL A;  4LF4 J;  2OPQ A;  3FDS A;  4RWW A;  3KDO A;  4L4Q A;  2CNK B;  3BSC A;  1RBL A;  4C2M A;  2JDJ A;  5E2Q A;  2R7U A;  1YRX A;  2CG8 A;  3TUI C;  3W9J A;  4CQ1 A;  1C2P A;  3H5S A;  2Y3Y A;  2XMJ A;  3HHN B;  2AJ2 A;  3N4W A;  1U0H B;  4QZV B;  2RHQ B;  3N5F A;  2YWK A;  1TKT B;  1WC1 A;  2IBO A;  1SJR A;  2G1D A;  2JNV A;  1RAI B;  2H65 B;  2N3L A;  4PXB A;  4QJV A;  4ED0 A;  1SIZ A;  2DRA A;  1HHQ A;  4P2X A;  3W2V B;  1ZAW A;  3GIL A;  2FYX A;  2DGO A;  5KFZ A;  3NWR A;  3FCC A;  3G82 A;  4C8N A;  3W5X A;  4DR5 F;  3ILL A;  2C2E A;  1N88 A;  4NOZ A;  1W7W A;  2V8H A;  4ED4 A;  3QGP A;  2DXF A;  2GVZ A;  3CVK A;  3RB3 A;  2XLK A;  1N5S A;  4X4T A;  3M8W A;  5EWE A;  3TRG A;  4NRT A;  1B0V A;  5GTD A;  1T7P A;  1C1B B;  5BSR A;  1FRL A;  2OP5 A;  1BXN A;  3G86 A;  1U8W A;  2ZFH A;  5DLG A;  1Q4R A;  3KLG B;  1NB2 A;  4FYW B;  1YIT S;  2CQB A;  2BKP A;  3UE2 A;  5A2Q U;  3M2R B;  4N56 A;  4K7Q A;  3EIC A;  5D77 A;  5EHH A;  2ZVS A;  2KXF A;  2GAG C;  3MOJ B;  4DR5 J;  3B4M A;  1DLO A;  3CIM A;  5KFT A;  4F67 A;  4YME A;  1D8Y A;  2W4P A;  5JMN A;  2FJE B;  3B8H A;  2OEM A;  5CYQ B;  2UP1 A;  1R8B A;  1U09 A;  2VU5 A;  1NEE A;  5HVH A;  1SXL A;  4NI2 A;  3EUN A;  1S1X A;  3RG6 A;  3TR5 A;  3BYR A;  4YR2 A;  1C4C A;  5U47 A;  1VQM S;  1JLA B;  3DHV A;  1E6V B;  4KKO B;  1X4B A;  2HWH A;  3EPI A;  2OIH A;  2UU9 F;  3Q89 A;  4NYP A;  2KFN A;  1VBZ A;  4ZLJ A;  1Y5I B;  3D67 A;  3WIV A;  4CLS A;  1IBM J;  1XNQ J;  2VOP A;  1UVK A;  2NSB A;  3HDS A;  1RHM B;  2EPI A;  3P45 B;  1FXD A;  2C2D A;  2C3P A;  4CTA A;  1YJN S;  1S59 A;  4NLG A;  2M5Y A;  2UXD C;  3HVT A;  5GMK a;  3IAS 9;  3ISN C;  1UPP A;  2W24 A;  1UET A;  4FN5 A;  2KFZ A;  1FXR A;  4ZVE A;  4V1A k;  2VH7 A;  4UTG A;  1HMV A;  5EX3 A;  3SQG B;  2AMC B;  2OGU A;  3GIK A;  2O01 C;  3AA9 A;  5E3C A;  1U7L A;  3M9N B;  2XYH B;  1MRO A;  3ZTP A;  5J2Q A;  2KZZ A;  2HS0 A;  3U7J A;  4OLO A;  4ZVS B;  3UDE A;  1KVK A;  4RUA A;  4X4Q A;  2UVW A;  2VOO A;  3HFK A;  4NLU A;  3RR7 A;  4JI5 C;  3BEG B;  1U25 A;  1PYO B;  4I7F A;  3GR1 A;  1CUL B;  3RRG A;  1HH2 P;  2NUH A;  4DQQ A;  2IHR 1;  3LUY A;  2QZ8 A;  4KO0 B;  4OZ5 A;  1Z2Z A;  2C22 A;  3BKF A;  1YIJ S;  1N5Y A;  3LGX A;  4DR2 C;  2DNN A;  2F63 A;  4ATN A;  3QJP A;  3Q24 A;  1QLN A;  4G6V B;  4ZCL A;  2W8K A;  4A46 A;  1JNZ B;  5L1L A;  1SB6 A;  3MR6 A;  2FVR A;  4A4J A;  4IQM A;  2ILY A;  3BBF A;  4DG1 B;  2PRO A;  3PAC A;  1SV5 A;  3M8P B;  2HND A;  3SDE B;  2GCF A;  2DBB A;  4DV0 F;  1MG7 A;  2PT7 G;  2JFK A;  2WOM B;  1VEH A;  3MUV P;  1R8P A;  3BH7 B;  3ZNJ 1;  1W2I A;  4XDC A;  4DV3 C;  3P96 A;  2WVD A;  5KYV A;  2R7O A;  4YB7 A;  4DXL A;  1D9A A;  2VQE C;  2HGL A;  1FVS A;  2ATC B;  2F9J A;  1EP4 B;  4OZ1 A;  4X65 F;  3M4X A;  4ZVF A;  1R0A B;  2I38 A;  1TKD A;  1KTQ A;  4KSE B;  5CH7 B;  3CQ1 A;  2EFG A;  2O5D A;  2J8S A;  3OXG A;  2FLN A;  4FTF A;  4CLU A;  2CYY A;  2CJB A;  4AND A;  3KK3 B;  4PUI A;  1JLB B;  1VR6 A;  2KT5 A;  3VZI A;  2W2O P;  5KFD A;  1S9E A;  3DC2 A;  3KLE A;  2ZD1 B;  4DPO A;  1QE1 A;  1WC4 A;  1T05 A;  4DV6 F;  1U48 A;  4N5S A;  5C2C A;  2QT7 A;  3KJQ B;  5A8R B;  5HLF B;  1XC9 A;  1Q7Y T;  4A8M P;  2FLL A;  1B0P A;  1PKU A;  4DV3 F;  2I2Y A;  1ZB9 A;  1LFW A;  1FRX A;  2ADC A;  3HSG A;  3EVW A;  2DHH A;  4KQZ A;  3PHT A;  4JI2 C;  5KG7 A;  1X7V A;  2O67 A;  2KRB A;  3QZ7 A;  1NK7 A;  2EKY A;  3W64 A;  3GII A;  1FKP A;  3FBF A;  2EK1 A;  2RHS B;  3UN5 A;  4CNZ A;  2N7C A;  2V0N A;  1T03 A;  1P8G A;  4G1Q B;  3MPD A;  4DCP B;  4L3K A;  3TR3 A;  1H6K X;  4CLP A;  3HLU A;  1B99 A;  1ZM2 A;  4WP9 A;  3ZZY A;  3H4D A;  4J9U E;  2DGS A;  3OFE A;  3C5E A;  2WK4 A;  4PZP A;  4JI6 F;  4TQS A;  4ETX A;  2M2B A;  2DNY A;  2SXL A;  4AFF A;  4U8Y A;  4DDF A;  5AE2 A;  2V4R A;  2E1P A;  4NCB A;  2KDO A;  4YS2 A;  1P6T A;  2YKP A;  3WX8 A;  2MTL A;  1CC7 A;  1DTQ A;  1PIE A;  1CJT A;  5FD1 A;  4UZB A;  2BQ3 A;  1G6B A;  3N28 A;  4KY3 A;  4M1K A;  1TK0 A;  4KTQ A;  2LFV A;  4W4M A;  1JXV A;  1VQS A;  1MW7 A;  4NXN J;  3EER A;  3PRV A;  1WDT A;  4M5I A;  1MNE A;  1SBR A;  4RUB A;  3HF5 A;  5E5N A;  1M90 T;  5D4P A;  5CXT A;  1VQN S;  4LF9 J;  2MZS A;  1PAE X;  3QFW A;  5KFF A;  5BSM A;  2OEL A;  2JL9 A;  2QSW A;  2CJX B;  1IKV A;  4USK A;  3PFE A;  3DMJ A;  3QQC D;  3R5J B;  1N36 F;  2R7X A;  4D4G A;  1XMQ C;  2GQQ A;  2UV8 G;  2Z58 B;  1GX5 A;  1FWK A;  1NSA A;  1WSV A;  4YN3 B;  2YX1 A;  4ID5 B;  3NRB A;  1U1Q A;  3GMG A;  2NSC A;  3I9V 9;  3OXL A;  2GO9 A;  4ZLL A;  2HHU A;  4NLR A;  1S6Q A;  2KZM A;  1AUD A;  2KXH A;  3B6B A;  4NX9 A;  3JYT A;  2DHS A;  2DH8 A;  4NZ6 A;  4KPY A;  4FXV A;  3THT A;  5EUH A;  3BB5 A;  4Y0F A;  4L6V 3;  1YX2 A;  1HNW F;  4X62 J;  2FGC A;  3GYN A;  4ILM A;  3H5Y A;  5F8G A;  5ETT A;  5KG2 A;  3DLK B;  4O4G A;  1VRQ C;  2HVD A;  4MYU A;  2WVC A;  3CGI A;  2VZE A;  5D8H B;  4DV4 F;  1RHU B;  1U0S A;  3NL0 A;  3R6G B;  4OJ3 A;  2HQC A;  4DN9 A;  4OZ3 A;  3VGV A;  4LF6 J;  4X66 F;  4LF7 J;  3CCW A;  1BUX A;  1NLK L;  2DGW A;  1WHX A;  1SPB P;  2LYV A;  1PCA A;  2OMO A;  2QJ3 A;  1LXJ A;  2RRN A;  5K8P A;  3KLF A;  2NYI A;  4XTT A;  1EKS A;  4KH1 B;  2V94 A;  1DQ9 A;  3UPF A;  4OV6 A;  2EW9 A;  2GHV C;  2VBY A;  3MD3 A;  3J80 Y;  1QSL A;  1V25 A;  2DNP A;  3KJF B;  1DTQ B;  3QGI A;  1T3O A;  2YWF A;  2RQM A;  3P4U B;  4FVC A;  4K2J A;  3W60 A;  3MMC A;  3Q83 A;  4ES2 A;  2X3G A;  5BR8 J;  3QO9 B;  4ED5 A;  3V6D A;  1U6Z A;  1OJ4 A;  4P7T A;  5HBM B;  4JI8 J;  4C4W A;  2V2Q A;  3DAY A;  4ZK7 M;  1FXL A;  1URR A;  4DMZ A;  1I94 J;  4DLG A;  1U6F A;  2QN6 B;  2V34 A;  3AXK A;  1H38 A;  2ASB A;  4OX9 J;  2AWZ A;  3M32 B;  2CU6 A;  2GNK A;  3H59 A;  5EGY A;  1DAR A;  3AOC A;  2PN6 A;  1SJQ A;  3D3B J;  5KTQ A;  4TQR A;  3J7Z T;  3A8E A;  3BR9 A;  5DG9 A;  1FRK A;  1HA1 A;  1HI0 P;  4DCU A;  4RJV A;  3I96 A;  4KFB A;  4LFB J;  3I5B A;  1FJG C;  3ZZO A;  4RPF A;  5LL6 d;  1IM4 A;  2KTQ A;  2Z2Z A;  1HNX F;  2KDN A;  3HMJ G;  2AYB A;  4KGM A;  3FBB A;  1XN9 A;  3BPS P;  2LP4 A;  1CS4 B;  1T9W A;  1RTH B;  2DNK A;  3GG1 A;  3SYZ A;  1HQU A;  2UVR A;  2PI5 A;  1OY8 A;  1G3O A;  2HHV A;  3M1V B;  4YOE A;  4K4Y A;  4GS5 A;  4FUQ A;  3M8Q A;  1LKZ A;  3GYG A;  3JTO A;  3NS6 A;  3TO8 A;  9RUB A;  3EX7 B;  4K4Z A;  5BYS A;  1HBN A;  1RU1 A;  1YJ7 A;  1SC3 B;  3DI6 A;  5LCI A;  1A6L A;  3VAG A;  3MEG A;  2XNQ A;  4JI4 J;  1WI8 A;  3ITH B;  2DPL A;  4EO8 A;  3EMT A;  1XMO J;  3QMQ A;  2B8Q A;  3I32 A;  5BXI A;  3IP0 A;  1QTM A;  1N52 B;  4CO2 A;  5FLX Y;  3NAH A;  5KFN A;  1FNX H;  4KB7 A;  2WVB A;  2J9C A;  2PA8 D;  3NLC A;  2XEX A;  3PCO B;  3HUL A;  4F50 A;  3C46 A;  3SSQ A;  1QUP A;  5AXL A;  4PYA A;  1DRZ A;  2QSF A;  1ZAV A;  2K3I A;  4A47 A;  4ECR A;  5EN1 A;  3UN3 A;  4WE1 A;  4OYX A;  2J9D A;  2CQI A;  1RCO B;  2KL8 A;  4WBF A;  1N5T A;  5B0C A;  1F6T A;  3ZTS A;  5IM0 B;  4A8Y A;  2JEF A;  1RIS A;  4JI1 C;  1FF2 A;  1Q0N A;  4IH7 A;  5KG3 A;  4C7Q A;  5L9N A;  4RW8 B;  1WF3 A;  2LQ9 A;  3JTN A;  4DUY F;  1USP B;  2KZF A;  2E5L F;  1PYS B;  2MJU A;  3DMJ B;  1X4E A;  5GAE I;  3PR4 A;  2GO8 A;  2LCW A;  3T1H C;  1Q95 G;  1G4C A;  4ECQ A;  2IRU A;  4BHQ A;  2APO A;  2PFF B;  2XTJ P;  4OYM A;  2JH3 A;  1AUS L;  1AZS B;  3C16 B;  3C19 A;  4ENO A;  1Q7L B;  2KM8 B;  2C3Y A;  3W3S A;  4OHY A;  3QRR A;  4G37 A;  4B3S C;  1U2R A;  2KHD A;  5IQQ A;  3PY8 A;  2ROP A;  3J81 D;  3T5K A;  1TL7 A;  3HHK A;  1R3N A;  1HKA A;  2YNI B;  4ZCK A;  4CIO A;  5T7L A;  4OI1 A;  3CD7 A;  2H5J B;  4HT7 A;  2HYI B;  1FE4 A;  1S6O A;  1WOP A;  2YBV A;  4NLP A;  3T1Y J;  1YRU A;  5F0U A;  2ASL A;  1JLE B;  3CDW A;  2DNZ A;  1XMQ J;  4U67 Q;  2L08 A;  2G0C A;  2V5H G;  3MMA A;  4LR7 A;  3MR3 A;  2VSQ A;  4OYW A;  3M9M B;  3FC9 A;  3POT B;  2UUA F;  4L76 A;  1RA7 A;  4DSI A;  5BSV A;  1FDA A;  4YHH F;  1IBM F;  2CJQ A;  2RML A;  2ZUG A;  1TQL A;  4I6Y A;  4DV3 J;  1QVF R;  1B70 B;  2FJV A;  1VQY A;  1FKP B;  3CMQ A;  4DSL A;  4IRD A;  1JLB A;  4YFU A;  4JYA C;  2UU9 J;  2VG6 B;  1VQO S;  3DLB A;  1KR4 A;  2OUG A;  4C97 A;  2X1G A;  2XI2 A;  1U1K A;  2ONF A;  2B4P A;  3PW2 A;  2PE8 A;  2MKS A;  3IAM 9;  4Y00 A;  3H40 A;  1T3N A;  2H54 B;  1HNW C;  4Z7Y A;  1I3O B;  1L3K A;  1QAJ A;  1HWJ A;  2J0Q D;  3NNC A;  2D7V A;  2I0X A;  1FJE B;  3LUS A;  1GMV A;  1D9F A;  3V6K A;  2KH9 A;  1Y5L B;  3THV A;  5DQI A;  3TUF A;  2EK6 A;  2CXE A;  1HBN B;  1UEK A;  4DL6 A;  1M1G A;  1CJV B;  2HBR B;  3QBC A;  3OTO J;  3C14 B;  3A8I A;  4JOU A;  4MH4 A;  1ZYQ A;  4C8L A;  4WKR A;  1XR6 A;  4IFY B;  1NK8 A;  3E7X A;  1WEX A;  4PEO A;  3IWN C;  3AQO A;  5THW A;  2ZC3 A;  1L3V A;  2HHT A;  2R7T A;  1Y3J A;  5KG6 A;  3RBE A;  4DV4 C;  2HIQ A;  1RP5 A;  3OTC A;  4KO0 A;  1ZET A;  3TQE A;  1CJT B;  3IM8 A;  2D1R A;  1IKY B;  2ZNZ A;  1ZM9 A;  3AH6 A;  2E7W A;  1HBO B;  1S48 A;  2DNL A;  3GJS B;  4BBY A;  3NGD A;  3LTO A;  2OJ3 A;  5L39 A;  4QU6 A;  2BJE A;  1WDD A;  3TAP A;  4O44 B;  1F3V A;  1U1O A;  3ENA A;  4QQB A;  2LDY A;  1O9T A;  1FVQ A;  2ASD A;  4Y3C A;  1QAX A;  1Y3K A;  1IBK F;  1ZA2 B;  2CZV C;  4QYZ K;  4HH1 A;  2J9D E;  4HHH A;  4YHH J;  2F65 A;  1TKT A;  2EBE A;  2FHJ D;  4IFV B;  4QWD A;  3E8O A;  2Y4N A;  3MM5 A;  1MWQ A;  2P2C B;  4EBC A;  1S79 A;  1MN7 A;  4GXR A;  2KO1 A;  4TVA B;  2DEJ A;  3MF5 A;  1URN A;  2ZZN A;  1IWG A;  3T41 A;  1RT3 B;  2VB6 A;  1DFD A;  1FUG A;  2YKM B;  2K1R B;  3M6V A;  4LSN B;  2XUL A;  4R0J A;  4UQG A;  4DPU A;  4DX6 A;  4O0I A;  5LM7 E;  3OFF A;  4FKY A;  2GV1 A;  4OZN A;  2IM3 A;  4ZPV R;  3TAM A;  4KKO A;  4ZCM A;  4JI5 F;  3SO4 A;  4QIF A;  4OZ0 A;  2P2Q A;  3MM9 A;  2W2N P;  2HZC A;  5BR8 F;  2MKI A;  4DX7 A;  1NSP A;  4ZVR B;  4C11 B;  3M6U A;  3UCU P;  1X8D A;  5HVG A;  2YKM A;  1S9E B;  3VGT A;  1XRC A;  1UEV A;  2G9O A;  3HKW A;  3QGG A;  2AV5 A;  3G71 S;  1U8S A;  1YDL A;  4QW9 A;  2R2U A;  5K14 B;  1F5B A;  4FDF A;  1H0H B;  3OHA A;  1Y11 A;  1XNR C;  1IUJ A;  3C6T A;  2MGZ A;  4Q5V A;  1NJY A;  2G4B A;  5F8M A;  1FE0 A;  4DR7 F;  2YKN B;  4FNH A;  1HR0 F;  2YQ3 A;  3V4I B;  1VHF A;  3ADA C;  1ROF A;  5M2U A;  4E8U A;  1D8Z A;  2ZH7 A;  3CQ2 A;  5C7P A;  5DG8 A;  1EB0 A;  3FMB A;  5SZT A;  3ZO7 A;  4C8K A;  3EGN A;  5H9F K;  1BQM A;  1V3S A;  2XSF A;  4WFY A;  2W8L A;  3MR7 A;  4YB6 A;  5GAD I;  2XO6 A;  1PU1 A;  4Y2K A;  2ZBC A;  4RO0 A;  1K8A T;  4GKJ J;  4EBE A;  1PAU B;  3KLH A;  1TAU A;  4DUZ F;  2H5E A;  5ETS A;  4ZJL A;  4LIR A;  3M2R A;  2JEJ A;  4PQU B;  1SKS A;  1MXB A;  3PIO Q;  3BGF A;  2VAS A;  2ZH3 A;  2UXC C;  2FTR A;  2VBZ A;  5ETP A;  1H72 C;  1MU2 B;  1AT1 B;  1GMW D;  2BAN A;  3M2U B;  3CW9 A;  2XY6 A;  1KQK A;  1OO0 B;  1XMO F;  1GAO A;  2B4V A;  4IO1 A;  1U2C A;  3M8Y A;  1N4L A;  1K9M T;  2DHX A;  4KPC A;  2RF2 A;  4M5N A;  5E3Q A;  3VAF A;  2XS5 A;  3A25 A;  4NDN A;  4KYZ A;  4Y6I A;  1HD0 A;  4TY8 B;  3N54 B;  3RUB L;  4BC9 A;  1D0E A;  2EFN A;  2V63 A;  3W2V A;  2OFG X;  1M5K C;  2RSQ A;  3LWM A;  4JI7 C;  4ZVU B;  4ZP8 A;  1FFG B;  1B0T A;  2MQM A;  2YNF A;  2C2O B;  2M7S A;  4LFA J;  4GVB B;  3IBC B;  5F3T A;  3ZTO A;  2HRY A;  4USJ C;  4Y2I A;  3CJE A;  3SQO P;  3W5Y A;  4NXM J;  3VNQ A;  4TNO A;  2WSE C;  3BSA A;  4J91 A;  2MKJ A;  2RUG A;  3VCD A;  4YR0 A;  3DLP X;  4CDI A;  4JI3 J;  1MLA A;  4GKK J;  3AOB A;  4LFC C;  3V4I A;  1QY7 A;  2FJA B;  2YY3 A;  5E41 A;  3NXZ A;  4FZV A;  3KLV A;  5L1J A;  2MQN A;  4NLO A;  3KHH A;  3CO0 P;  2BJ9 A;  4LRC A;  3I0S A;  5KFV A;  3CPW R;  3B78 A;  4LF6 F;  2UUB C;  1S7I A;  4LF7 F;  1HBU A;  2BRK A;  4LSL B;  1VQ5 S;  4NXM F;  4LMZ A;  3NGU A;  2BUN A;  2LEA A;  2Z2L A;  2AYA A;  3W2W A;  1JLE A;  2BVZ A;  4AQY C;  2BJD A;  2IYG A;  1IBK C;  4EK2 A;  4LUB A;  1EET B;  1HI1 A;  3A3O B;  4F2S A;  4LBH A;  3GYX B;  4N47 A;  1NHV A;  2BH1 X;  3OPK A;  4DL7 A;  3ZNU A;  2BAN B;  4GO7 X;  2RQK A;  4F4W A;  1RDR A;  2YCB A;  4Q7A A;  1JNR B;  2ABY A;  2OSR A;  4WPA A;  3K6R A;  1BQN A;  1VIS A;  1NKB A;  4DQP A;  4WV3 A;  2HGN A;  5E0O A;  4GC6 A;  2BQU A;  3J80 D;  3CJ3 A;  1K0T A;  1UJ6 A;  3OD2 A;  3UO0 A;  3K5N A;  2MKY A;  2WBM A;  2KT3 A;  2WOM A;  2ZOM A;  4WK3 A;  1IJF B;  2V2V A;  2LEB A;  1JJ2 R;  2FY1 A;  1BA3 A;  4OFZ A;  4DCJ B;  4QWA A;  3PYE A;  1WSR A;  5A0Y A;  1F0X A;  3AXM A;  3QIP B;  4DQS A;  5A1G A;  1QAY A;  1UP1 A;  3H2L A;  3OQ2 A;  4LF9 F;  5LMU J;  2DCU B;  1U1N A;  2QW0 X;  1N5V A;  4ICL A;  4LRE A;  4U6P A;  3KLI B;  4F3M A;  1GFW B;  4O4R A;  2RDD A;  2Z30 B;  2XCA A;  1M5O C;  2DR5 A;  4IR1 A;  4Y2M A;  4LFA F;  4YHH C;  2D3O 1;  5CZX A;  2H4Y B;  2LKZ A;  2YTC A;  2AJ0 A;  4FF4 A;  1L3S A;  1FER A;  4HLB A;  4F4A A;  1DTT B;  2D74 B;  2JWN A;  2B6A A;  2M4M A;  2YWE A;  2BV3 A;  2ZZT A;  2BM1 A;  3BGU A;  3NG8 A;  4WJB A;  3V4M A;  4A8F A;  1YRT A;  5A8W A;  4CWB A;  4DL2 A;  4V19 J;  2NZC A;  3WC2 A;  1A9N B;  1QSY A;  2D9P A;  3BDE A;  1NPP A;  3MEG B;  3D5M A;  3NGT A;  2B7B B;  4NLX A;  4P72 A;  1HQ2 A;  1F1B B;  2J7U A;  2VBX A;  1P4E A;  4OYZ A;  3NNA A;  2CQP A;  4WYL A;  5KFB A;  1QUV A;  2CQH A;  4LF1 A;  3HVT B;  4ZPC A;  4QBU A;  3C3L A;  3TZX A;  5C24 B;  1VS3 A;  4JI7 J;  4B3T C;  1TUV A;  4LR8 A;  2WD9 A;  1AXQ A;  3PHE A;  4EBD A;  2H1Y A;  2QIF A;  2AZ3 A;  2NQP A;  2HJG A;  1Q1K A;  2W01 A;  3K2Y A;  2GML A;  4M94 A;  4DI6 A;  2EVZ A;  3TAM B;  1V5I B;  2YKO A;  2NXN A;  2JX2 A;  5D78 A;  3BDP A;  4M5D A;  1EIY B;  2D1S A;  4LIW A;  1V3Z A;  4N77 A;  3ENW A;  1HWU A;  4X66 J;  4I1T A;  2PO4 A;  2R7Q A;  2XHC A;  4NPO A;  1MXC A;  1IKY A;  3U02 A;  1OY6 A;  3KG1 A;  4C3M A;  5CCM A;  3DOM B;  1JMT A;  1RT7 A;  3E2E A;  2CQG A;  4JI8 C;  3N9U C;  4C3L A;  4H4M A;  2QLW A;  5HBM A;  3Q8P B;  4AD6 A;  4GKJ C;  3E01 B;  3GSD A;  3KDN A;  5BUR A;  1UFL A;  1Q8L A;  1WJ9 A;  1SJ3 P;  1SUQ A;  3QT7 A;  4WFB Q;  4R1M A;  2UXD F;  5HMY A;  1ZTT A;  4PG8 A;  1B7F A;  1IB8 A;  1FFW B;  2DH7 A;  2W7A A;  1H74 A;  5AE1 A;  3LP2 B;  2W9C A;  2DPI A;  3KG4 A;  2XMK A;  3AAW B;  1FJG J;  3PJX A;  2VL1 A;  1WEY A;  4RWX A;  4F7V A;  1U1R A;  1CQN A;  4Q0B A;  1JLQ B;  1KFD A;  1XER A;  1YBU A;  1Z1Z A;  2CNN B;  2KYX A;  2AEJ A;  3S01 A;  3AJ1 A;  1MXA A;  4K0B A;  2A2D A;  2XSJ B;  5HMX A;  2ZH1 A;  1WF1 A;  2DYA A;  3W61 A;  2B9X A;  1R0A A;  2IRX A;  1AFJ A;  1J2V A;  1HPZ B;  1FFS B;  3M30 A;  3QNW B;  5KFL A;  4DR3 J;  1JLF B;  1ZZF A;  1XK8 A;  3JQK A;  4HDH A;  4ZIV A;  3FJ2 A;  3E51 A;  2ACY A;  5K8F A;  2HNY A;  4UY8 5;  1ZZN A;  1KHW A;  2C2R A;  2AJQ A;  1S1T A;  1O92 A;  1HWK A;  3AQP A;  3O2I A;  4ZN3 A;  1KRP A;  4USW A;  5IFM A;  1RT2 A;  5IT9 U;  3BS9 A;  5LMN C;  1VRU A;  2XLJ A;  2HK2 A;  1L5U A;  4F02 A;  3I4H X;  3DNC A;  5H9U A;  2EC2 A;  2GS8 A;  4JB8 B;  3UX2 A;  1PYT A;  2V4J A;  5L9X A;  1DQA A;  1X5T A;  1SVD A;  5C5J A;  1N33 C;  2O66 A;  1ACM B;  1W26 A;  2BZ2 A;  1VOM A;  2Q6C A;  3BV8 A;  3E01 A;  3NGS A;  2I1R A;  4MMO A;  1MMN A;  2FHJ A;  3HSZ A;  2NUU G;  3N6M A;  4FS1 A;  4K50 A;  5F3Z A;  2LQ8 A;  2J7K A;  2ZM6 F;  1DZ5 A;  2HMI B;  3U1N A;  4DLE A;  2E8C A;  2XR1 A;  1NKE A;  1VLO A;  1YJT A;  2VD3 A;  1UVL A;  1DUR A;  2WRM A;  5ETR A;  4FF2 A;  2AJ4 A;  4IOC Q;  2F1F A;  2V69 A;  1NM2 A;  1XIQ A;  4IDK B;  2E44 A;  2MZJ A;  2WW4 A;  5IXU A;  2VON A;  5HQM A;  2E29 A;  5F8N A;  5A2Q D;  2WB4 A;  2PT0 A;  4WIQ A;  1NPR A;  2AF6 A;  4P71 A;  2F3J A;  3TVZ A;  2R8G A;  1DQ8 A;  3AJD A;  4PRO C;  2OPP A;  2ZH9 A;  1YLX A;  2CJK A;  4JI0 J;  1SJ1 A;  5CD4 A;  2W4D A;  2E1A A;  2WSC C;  3W63 A;  3JAM Y;  3D0H E;  3UWT A;  4AL7 A;  4JI2 J;  2XGQ A;  4IUF A;  3PW7 A;  3RV2 A;  2E5G A;  3MCO A;  1LWC A;  5FJ4 A;  4LSZ B;  4MFB B;  3KK2 A;  1ITP A;  2ZM6 C;  3QT6 A;  4ED1 A;  3NMA A;  4RU9 A;  1S1V B;  1AW0 A;  3UD5 A;  4BLG A;  2L41 A;  3CCZ A;  4DR1 C;  1EZZ B;  2EFV A;  4R5P A;  4KHP F;  2VG5 A;  2DNO A;  1Z2L A;  3SV3 A;  3KUG A;  1Q8K A;  1R27 B;  2EG1 A;  4RX6 A;  2MQQ A;  2NXC A;  2C2N A;  2XZW A;  2OKQ A;  4LT6 A;  1JJ4 A;  2AYG A;  2ZE2 A;  3O3L A;  2Q66 A;  4OYA A;  2W9A A;  4ILR A;  2IC3 A;  4RM2 A;  4B9N A;  2HNY B;  1IN0 A;  1OMS A;  4XIU A;  4DR2 J;  2D3O R;  2QA4 G;  3BO3 A;  4E98 A;  1RT4 A;  2RU9 A;  1SL2 A;  3OTE A;  3GV5 B;  2BJO A;  4BS2 A;  1WF0 A;  2IYI A;  2OFH X;  3MM8 B;  2FPH X;  2C3U A;  3JS9 A;  1N34 J;  1J5E F;  4OL8 A;  2KVQ E;  3PTW A;  5F8H A;  1NH7 A;  1REG X;  3EJM A;  1WOO A;  4DFK A;  5ETL A;  4Q43 A;  2CPH A;  4ECX A;  2JEG A;  1MML A;  4IRK A;  4CYU A;  2B5J B;  4G3I A;  2XSJ A;  1UWD A;  5HRO A;  1IBL C;  2ATW A;  2HW3 A;  5EWF A;  2NRE A;  2P9E A;  4UW2 A;  3TJ8 A;  3BGR B;  4DR1 J;  3SMZ A;  3G6X A;  1HYS B;  2B9E A;  3CJT A;  1NYE A;  3MM8 A;  4LFC F;  1M6X C;  2HK3 A;  2M3D A;  1YKW A;  3N0V A;  2CNO B;  3PJ9 A;  3D3C J;  4ZPD A;  1YJW S;  3WQP A;  3I07 A;  2ZBP A;  3K57 A;  1ZB8 A;  2ZOF A;  4DR4 C;  1R31 A;  1SV5 B;  3T6B A;  3V6J A;  1X4A A;  4OHW A;  2UUC J;  2E9T A;  3PRO C;  1NME B;  2PN2 A;  3BBB A;  4I69 A;  1S0N A;  3CE8 A;  2F9D A;  5CA5 A;  1KOH A;  4DUZ J;  4M5H A;  5DZ6 A;  1SUQ B;  2DO0 A;  4UT4 A;  3S82 A;  2JFD A;  3IS9 B;  4OX8 A;  2CA9 A;  4S0M A;  1S7H A;  4K4W A;  2YWW A;  4LFB F;  2J76 E;  5IZH A;  1PC4 A;  4DSK A;  3G9C A;  5B7W A;  1NAQ A;  2HZA A;  4ZPT R;  2HNZ A;  3E7W A;  1R0C B;  5KOW A;  1O0P A;  1H2V Z;  1Q82 T;  3JAM D;  2CPE A;  4CRJ A;  4CLW A;  5KFX A;  5MAO A;  2E8E A;  1N6Q B;  2HEK A;  4ZN1 A;  2MQL A;  1YG0 A;  5B0F A;  3N5B A;  1VIO A;  3TZW A;  1FRI A;  1RTD B;  4DL5 A;  1N48 A;  1VCT A;  2JMP A;  5KFQ A;  2DR9 A;  4B02 A;  1N33 J;  1WOR A;  4B9T A;  4CO3 A;  2Z2Y B;  3UCZ P;  2HAI A;  2MQ8 A;  3FSY A;  5C42 A;  1HW8 A;  4GVB A;  1T03 B;  4DPY A;  5IWA J;  5A8K A;  2D41 A;  1JWW A;  2ZD1 A;  4JI3 F;  2OPR A;  2QLB B;  3DLG B;  2JNJ A;  3AOA A;  4FPR A;  5C24 A;  2OPS B;  4WU3 A;  3LA0 A;  1RGV A;  1UWB A;  3TJ9 A;  3UFC X;  1IBL J;  1ZA1 B;  4WTY A;  1APS A;  2VPZ B;  1NBE B;  4OI3 A;  1PC5 A;  1FWL A;  5DDR C;  2UUB J;  3BGL A;  4YY3 C;  3F0N A;  4I6W A;  1X31 C;  5K85 A;  4DR1 F;  2BOP A;  2IAJ B;  2FZK B;  3BN4 A;  2OTL S;  2MSS A;  4DV4 J;  5ETM A;  1Q8B A;  4X4P A;  1NO8 A;  3V81 B;  1ZTW A;  2NPF A;  1LW2 B;  1IVZ A;  3H2T A;  3A3N B;  2A1B A;  4JV2 A;  3MFI A;  1WC5 A;  3DOL B;  1MD9 A;  1XQI A;  5H9E J;  3VAL A;  4C0B A;  4LFB C;  1JJH A;  2JJ4 D;  4DQI A;  4DCV A;  1RXO B;  1SJF A;  1EGA A;  5D0E A;  2ZDP A;  2MYF A;  3DRS B;  3BO2 A;  4HKQ A;  2KKH A;  5D15 A;  2RT3 A;  3V2U C;  4JI4 F;  1J5O A;  5GAE U;  3RAM A;  3ZZU A;  3MR5 A;  1PG4 A;  2FJB B;  2LLZ A;  4G1P A;  4WP3 A;  5B0A A;  4RNO A;  1KN6 A;  2MKH A;  4GKK C;  3LGH A;  2DGU A;  3PO4 A;  2HHQ A;  3LGN A;  4O3R A;  1VQ6 S;  5LSO A;  1YGY A;  3RU0 A;  3OVB A;  4DUT A;  2BR0 A;  5KAK A;  2MZ1 A;  1RWM B;  5E33 A;  5KFO A;  3PW5 A;  1NJX A;  3W8P A;  5HAT A;  3EGZ A;  1FKO A;  3D7S B;  3MED A;  5D4O A;  4KE5 A;  2RQC A;  5L1I A;  3THP A;  2I5J B;  4DBQ A;  3EDR B;  1YJ9 S;  2JLG A;  5J2M A;  2LXF A;  1N33 F;  1N0V C;  2G1H A;  2F8H A;  4XPE A;  4O3P A;  2YWG A;  3I82 A;  4KT0 C;  2E7X A;  3TUZ C;  3MUT P;  1TFW A;  4ZJO A;  4DUY C;  3DM2 A;  3QPI A;  2MLZ A;  2NZ4 A;  1N36 C;  1QM9 A;  3GB0 A;  3QJJ A;  2GA7 A;  4OV1 A;  5D3G A;  3ENQ A;  1UW9 A;  1UA0 A;  2R8J A;  4TYB A;  3KHL A;  2V9W A;  4RLF A;  2EC0 A;  5B0E A;  4QOT A;  1VBX A;  1NDL A;  2F40 A;  3KG0 A;  1T8E A;  5FLX U;  3R9X A;  3DM2 B;  4M5D B;  4JUZ A;  2RKI A;  2YNG B;  3CJS A;  3LAK A;  4ZP7 A;  1SL0 A;  1S4E A;  2GGP B;  2L9N A;  4R0E A;  1XEZ A;  5M2R A;  2MB0 B;  3GFX A;  3VVU A;  3KJV B;  1RHK B;  1VRT A;  5CAA A;  1QE1 B;  2YQ0 A;  1R7I A;  1FO1 A;  4WFA Q;  1T05 B;  1S9G B;  2MPU A;  3D6M B;  1RWX B;  2UUW A;  3EE3 A;  3IGN A;  3KUH A;  3LW5 C;  4OHX A;  3QSY B;  2UUA J;  2HWI A;  5B0G A;  4CT9 A;  4LF8 C;  1DLO B;  1YWX A;  3BH6 B;  2ZH2 A;  3HO1 A;  4WS9 A;  3HJF A;  5KFC A;  3A8K A;  4TKT A;  2CQ2 A;  1B7Y B;  1JLA A;  1FK9 A;  3IWL A;  3IA0 A;  3L3C A;  1U1P A;  2NXE A;  4USM A;  4JYA F;  1NSK L;  2GMJ A;  2FZC B;  3TX0 A;  4ELT A;  2XQC A;  1G7C B;  1KS2 A;  2Q43 A;  4K0K F;  1HNX C;  3D2W A;  3R44 A;  3G6V A;  5DS7 A;  4DEZ A;  4PWW A;  4J37 A;  4MK7 A;  4P9S A;  5KG0 A;  3J7A N;  5JXS A;  3G7S A;  1TL3 B;  4MAK A;  1BQM B;  2K06 A;  2Y0S D;  4X4N A;  3IXQ A;  1ML8 A;  3W62 A;  5BJR A;  5C2G A;  2VUG A;  3F73 A;  3KLH B;  4LF5 J;  4UOC A;  2XMM A;  3H2U B;  2BW2 A;  3M8S A;  4C3K A;  1LWX A;  1C0T B;  3CDB A;  3C6U B;  4DFJ A;  1M1K T;  2LU1 A;  2PEB A;  3AJ2 A;  1OIA A;  2Z56 B;  3VV2 B;  3TAN A;  2CJA A;  5LOQ A;  2KRR A;  5BYR A;  3ZXW A;  5F9N A;  4ISB A;  3BM7 A;  1DBD A;  3D1H A;  3GFZ A;  4K2X A;  1CUL A;  3GQC A;  2W2M P;  4ZPW R;  1MDF A;  2J0X A;  1NKC A;  3DFE A;  2AX0 A;  2HHP A;  2OPR B;  2PEH A;  5D3G B;  2R2S A;  4ELU A;  5KT3 A;  4FUT A;  5KEI A;  4L2Z A;  3OTO C;  4B3M J;  1MSW D;  2QLX A;  2OML A;  1UJ4 A;  2FVQ A;  1SC1 B;  3R7B B;  5HMZ A;  4NEY A;  2Z4P A;  2R7V A;  4N76 A;  5IFI A;  3M2V A;  5I3Q A;  5G4D A;  2FZG B;  2UXB C;  5HP1 A;  4C0H A;  3MCS A;  2B43 A;  3QFH A;  3CC4 S;  3OR1 A;  1UMJ A;  5AXM A;  2C2Z B;  3AD9 C;  2ERR A;  4DG9 A;  3D6H B;  2DHA A;  1TL1 A;  2C2K B;  4L72 B;  3W9I A;  4OLP A;  1A7G E;  5DV9 A;  2IVM A;  2I9S A;  4OZJ A;  3TVY A;  2AZ1 A;  5K20 B;  1X5S A;  1FKA F;  5E7Q A;  2GJI A;  4AUK A;  2HPU A;  1RWV B;  2QLF B;  2WHO A;  3CT9 A;  2W7P A;  2IA6 A;  1WNE A;  4QIG A;  1RTI B;  2CDR B;  4DFM A;  3FEZ A;  1MKY A;  3KK1 B;  1BY9 A;  1KWM A;  1J5O B;  2QTW A;  3MXH P;  4RLQ A;  1VK8 A;  1J27 A;  2MHN A;  5DGB A;  4ECT A;  1PSD A;  3DOK B;  3JXO A;  2E1R A;  3PYG A;  4JI5 J;  3HD2 A;  4PXC A;  1GNK A;  2RUS A;  4F3Q A;  2BBE A;  2IJF A;  5DDP C;  3JAM U;  4O44 A;  1Q16 B;  4WE1 B;  1EQ0 A;  3VAM A;  3MFH A;  1QD1 A;  4Z37 A;  3C16 A;  2RDI A;  1KLM A;  2F5G A;  4DN0 A;  2M70 A;  1HFE L;  1U26 A;  4KHP J;  1TH5 A;  4Q2L A;  1FLO A;  4NLW A;  4J9R A;  2HHH J;  3KFW X;  2P02 A;  3PKM A;  4GXQ A;  2GZO A;  2HS3 A;  4FKX A;  2R8H A;  5CYM B;  3BSO A;  5GAH U;  4O3N A;  3E3X A;  3T9Z A;  1TAQ A;  1U49 A;  1NJI T;  2HZV A;  1RUS A;  2W9B B;  1IR0 A;  2G0I A;  2V8D A;  3MMB A;  5G0R B;  3R7S B;  4YDD B;  2JLF A;  2CG4 A;  2KHC A;  4OXI A;  1BMQ B;  1C1C A;  3OFG A;  1NK0 A;  4FYV B;  3U1L A;  3G96 A;  3KTQ A;  3ILO A;  1GH8 A;  2DYJ A;  3PES A;  3A4I A;  1PA4 A;  4FYD A;  6FD1 A;  3DRR A;  4DR2 F;  2GC8 A;  4KJI A;  3QT5 A;  4LVN P;  2ALZ A;  3UCG A;  2XO7 A;  4C11 A;  1F60 B;  4PWD B;  1UCN A;  2FHO B;  4Y65 A;  1MDB A;  2MY8 A;  4HI1 A;  4IRC A;  1WG1 A;  1LK7 A;  2W2P P;  4J9V A;  1HNX J;  2VPY B;  4B3R F;  3IR6 B;  2XNR A;  3QWP A;  5IC6 B;  1WC6 A;  2MGZ B;  3G2X A;  4B08 A;  4ED6 A;  3A4T A;  3OT9 A;  2QRR A;  1F9E B;  1JLG A;  1VQK S;  1TFY A;  2NLW A;  1YJU A;  2Z57 B;  3MGJ A;  5HAO A;  4JI3 C;  3CCJ S;  4CNY A;  1QWI A;  4NCG B;  2J0W A;  1NCL A;  4L74 A;  2ZUA A;  5H1S V;  1YZ7 A;  3W65 A;  2HQ3 A;  3N6L A;  3HT3 A;  2UU9 C;  3MPU B;  4LF5 C;  4USU A;  5T7L B;  1IKX B;  5H9F J;  2VBW A;  1ARO P;  1H73 A;  3QSI A;  5BYQ A;  2DKO B;  4ECW A;  2YNF B;  3PFO A;  2V2K A;  4HVZ A;  4CH7 A;  2PSZ A;  3GZ7 A;  3HHL A;  2A6M A;  5GAH I;  1NDK A;  2PD1 A;  4RR5 A;  3OHB A;  1C0U A;  4GKK F;  2QMX A;  1WOS A;  3RAX A;  4RNH A;  1WWH A;  5JUM A;  1JLC B;  3FZB A;  5KG5 A;  2VZ9 A;  5F9L A;  4WFN Q;  3HSJ A;  2ZH5 A;  4C8Y A;  2ZIT A;  4HR2 A;  5KFJ A;  3T3F A;  1PGZ A;  1S76 D;  4PQA A;  2RF2 B;  2BE2 A;  1S6P A;  2G2Z A;  1X4G A;  2LQ5 A;  2O3D A;  3HHL D;  1C0T A;  3UDV A;  4U9R A;  5IT4 A;  2VPW B;  3SZ2 A;  4X2B A;  3HT0 A;  1FK9 B;  3RRK A;  2AQ4 A;  5F8J A;  2GIR A;  4I68 A;  3VNS A;  2QVX X;  4X65 J;  3KLF B;  3VAH A;  3GWC A;  2UUT A;  1V3R A;  2BAB A;  1M5P C;  1B64 A;  1CC8 A;  4NLD A;  3EVM A;  4RKU C;  3DN9 A;  2ZVI A;  4PKD B;  4WKY A;  4JI1 J;  1S1T B;  4CO5 A;  2IAJ A;  2RH3 A;  4F26 A;  4WCE Q;  4J9M A;  4DL3 A;  4M5J A;  5DRK A;  2KFY A;  2IBK A;  2YX4 A;  3CWJ A;  3TA1 A;  1FNM A;  1RT1 B;  2BJ1 A;  2K2P A;  3BN7 A;  1RK8 A;  2QFI A;  3DRP B;  3K5O A;  3LP1 B;  1F2H A;  2VJV A;  2DCL A;  3EXC X;  3DLG A;  2J7W A;  1UKU A;  5HVF A;  3HJV A;  3ENV A;  2XMU A;  5K9F A;  4MTP A;  4DZD A;  1U47 A;  1Q5V A;  3C6T B;  3NMR A;  3PZP A;  2QL8 A;  4RVN A;  2XS2 A;  3AF6 A;  2X1F A;  1UWB B;  3DXS X;  1UL3 A;  1U6B A;  4NYZ A;  1JLQ A;  5ETN A;  2FC9 A;  3C2P A;  2IIH A;  3TUP A;  3K17 A;  3RTV A;  4AL5 A;  1IKW A;  4B3S J;  4P52 A;  4OI4 A;  1SH2 A;  2DNH A;  4IH5 A;  3RB6 A;  1HQE A;  4NE9 C;  3DLE B;  4M5G A;  4RUH A;  3CJ0 A;  4J9K A;  1JOS A;  3M1V A;  3PYD A;  3SXL A;  1U2F A;  1RAB B;  1UPM B;  2CQ4 A;  3I9Z A;  4NYO A;  4RUC A;  1KC8 T;  2DEI A;  1FX2 A;  4F8R A;  1WH9 A;  3FCV A;  3GIJ A;  1N32 J;  4DR4 F;  1KVJ A;  1LCI A;  2D1Q A;  2DVI A;  4WZQ A;  2BE7 D;  2HBQ B;  1FI4 A;  3M32 A;  3IWX A;  4PUH A;  5B0D A;  2AJF E;  4DJB A;  4KFB B;  5KOX A;  4KV8 B;  4QR1 A;  5HAN A;  3FCE A;  1V26 A;  4MKB A;  1NDC A;  5CAB A;  4PRF A;  3TNV A;  4O3O A;  1XR7 A;  3IR7 B;  3I55 S;  1FTC A;  4NCA A;  2KXN B;  3JSB A;  1SKU B;  3RB0 A;  1AFI A;  4ZLN A;  1GQE A;  4OJ1 A;  4TLR A;  1XNQ F;  4X4S A;  3FUY A;  3GJQ B;  4I2P A;  4QR0 A;  4EU0 A;  5IWA C;  4O3Q A;  2XY5 A;  4DV0 C;  3AB2 B;  4DPT A;  4HT5 A;  3J81 Y;  3K5L A;  2QC3 A;  2ZDO A;  4AT1 B;  1H7W A;  2XS7 A;  4HHJ A;  4ES3 A;  2XC9 A;  4JM1 A;  1NND A;  3Q0A A;  1FWP A;  2CPJ A;  4YEA A;  2XG8 A;  2HS4 A;  1HNV A;  1TMM A;  2DT9 A;  4RNM A;  1CJU A;  4CLT A;  1RBA A;  5M2P A;  2NR0 A;  1RYR A;  4CCH A;  3S1T A;  3P5T L;  2D27 A;  2OBV A;  2B7C B;  1YSJ A;  3PKY A;  2BJ8 A;  2DPJ A;  2B51 A;  3Q8Y A;  4AXJ A;  3CMA S;  3CW2 C;  4G36 A;  3O8W A;  5HRO B;  3GU0 A;  1IKW B;  4A8S A;  2DIT A;  4PG7 A;  4CYU B;  2QEX S;  4KIA A;  4FPI A;  5HN0 A;  3R2C J;  2HVZ A;  1W2B R;  3TX8 A;  4BSZ A;  1PJ7 A;  1TVR B;  2BMB A;  3S6E A;  3ISZ A;  4DV2 J;  1RA6 A;  3LP0 B;  4RW7 B;  1OPI A;  3GFY A;  3UZ0 A;  3MAQ A;  4B3R C;  1RKJ A;  3R9L A;  1NH8 A;  2HFU A;  2HND B;  3D28 A;  4Z7C A;  5LT5 A;  1X9S A;  2BW7 A;  2IC3 B;  4P2M A;  1TZ0 A;  1S1V A;  4TLQ A;  3J80 U;  1NB7 A;  1HQU B;  1RQ0 A;  2IDE A;  2HQD A;  4I6A A;  2HWT A;  2R2T A;  5I42 B;  4A8W A;  2ASJ A;  1QSS A;  1DY3 A;  3VVT A;  2VA2 A;  2E9Z A;  3C15 A;  4LQ3 A;  2QVZ X;  2D3U A;  4DV7 C;  4OIX A;  3TI0 A;  2EKN A;  2XMT A;  1RT7 B;  1CPZ A;  3FK4 A;  4M5L A;  5A76 A;  2OPP B;  3T1Y F;  5BUQ A;  5GAG U;  2HLU A;  3HHL C;  1S97 A;  3HFZ B; 
#chains in the Genus database with same CATH homology
 1O90 A;  3GKU A;  3EQ6 A;  4R0M A;  1HR0 C;  1MXA A;  4K0B A;  1O93 A;  4RM3 A;  2UXD C;  5A19 A;  4DV4 C;  2PT7 G;  3IML A;  5T8S A;  2P2J A;  1O92 A;  5LMN C;  5H9U A;  3CW8 X;  1HH2 P;  3GR1 A;  4B3M C;  3LGX A;  1N33 C;  5KYT A;  1ULT A;  2YWB A;  4TPS B;  5BSU A;  2E8C A;  2XR1 A;  1QM4 A;  4BC7 A;  5A2Q D;  1VLA A;  4DV3 C;  3GR0 A;  5KYV A;  3TQI A;  2VQE C;  3NI2 A;  4PRO C;  4ODJ A;  3T1Y C;  4ZJZ A;  3RV2 A;  4JV5 C;  2ZM6 C;  1IBM C;  4DR1 C;  2E8F A;  3ETO A;  1ZB9 A;  4RM2 A;  4JI2 C;  2BJO A;  1XNQ C;  4DV6 C;  2ATW A;  1LQL A;  1IBL C;  3B7W A;  4GS5 A;  1P7L A;  4X66 C;  2P2M A;  4B3S C;  4L7I A;  1NYE A;  3C5E A;  4PZP A;  5ADZ A;  5AE2 A;  4FTF A;  3I07 A;  4EAT A;  1ZB8 A;  4DR4 C;  3PRO C;  4DV5 C;  2PN2 A;  4W4M A;  5IT9 D;  3EER A;  3S82 A;  1K0R A;  3ETC A;  5BSM A;  4R1L A;  1GPM A;  4D4G A;  3AF5 A;  1XMQ C;  3E7W A;  3JAM D;  2E5L C;  3NYQ A;  4DG8 A;  2E8E A;  2VQF C;  2JMP A;  4LFA C;  2VZE A;  2P2F A;  3VNR A;  3KXW A;  3NPD A;  1HNZ C;  4D57 A;  4YY3 C;  1V25 A;  4LF7 C;  5K85 A;  1I94 C;  5BSW A;  5LMU C;  1PG3 A;  1T5H X;  3H2T A;  3DAY A;  1XRA A;  1MD9 A;  4LFB C;  4HPV A;  2ASB A;  4DCV A;  1EGA A;  4GXQ A;  2UUA C;  4OXI A;  2V7B A;  4DCU A;  1FJG C;  1PG4 A;  3TDE A;  4GKK C;  2OO4 A;  4FUQ A;  3N2Q A;  1YJ7 A;  4K0K C;  2F4V C;  3RG2 A;  2UXB C;  2DPL A;  3IEV A;  4PHT A;  4DUY C;  4MTN A;  5AE3 A;  1N36 C;  4NXM C;  4RMN A;  4RLF A;  1RG9 A;  4DUZ C;  3R9X A;  1WF3 A;  1USP B;  2KZF A;  4G1I A;  3T1H C;  4D56 A;  1XMO C;  1XRB A;  2P20 A;  2BH1 X;  4LF8 C;  4WS9 A;  3UOW A;  4G37 A;  2YWC A;  3J81 D;  4XX2 A;  2OPL B;  1HNX C;  3R44 A;  2VSQ A;  3I08 A;  5K8F A;  4JI5 C;  5BSV A;  3PBK A;  5CZV A;  3G7S A;  2P2B A;  1ML8 A;  4OX9 C;  4JYA C;  4DR7 C;  2UUC C;  2ONF A;  2D28 C;  3L8C A;  5BR8 C;  2WP0 C;  4ISB A;  1HNW C;  1MDF A;  4LF4 C;  2D7V A;  4FUT A;  4IZ6 A;  3LUS A;  3OTO C;  5KEI A;  4L2Z A;  3A9U A;  3TUF A;  5IFI A;  4IR7 A;  5FLX D;  4RVO A;  3LAX A;  3E7X A;  4DG9 A;  5DV9 A;  5E7Q A;  2D1R A;  2E7G A;  2UXC C;  4BBY A;  4X64 C;  1MKY A;  4RLQ A;  4DCT A;  1O9T A;  1RY2 A;  3L95 X;  2QVY X;  4DCS A;  4NXN C;  2Y4N A;  2Y27 A;  4I9F A;  4GXR A;  1FUG A;  2P02 A;  5A1I A;  3SO4 A;  4DV2 C;  2P2Q A;  3IEU A;  4KHP C;  1XRC A;  4LF6 C;  1N34 C;  3LNV A;  3PES A;  1J5E C;  2DYJ A;  4ZLP A;  3A4I A;  1PA4 A;  1XNR C;  4DR5 C;  1L2F A;  3IPL A;  4LE5 A;  1USP A;  1MDB A;  1AMU A;  3R9W A;  3VNS A;  4JI3 C;  1QWI A;  1T5D X;  2UU9 C;  4LF5 C;  1MXB A;  3CW9 A;  2Y4O A;  5BUS A;  2OPL A;  4NDN A;  3N54 B;  3GPC A;  2D1T A;  4BC9 A;  4JI7 C;  4DV1 C;  4X62 C;  3CJE A;  2CY1 A;  3VNQ A;  4OYC A;  2QVX X;  3DLP X;  4BCA A;  4JI6 C;  4LFC C;  3A9V A;  4LF9 C;  2UUB C;  2AYA A;  4JI1 C;  4AQY C;  1IBK C;  2PRO A;  4DR3 C;  4KTV A;  4RVN A;  2EGT A;  2QL8 A;  3AF6 A;  5JRH A;  2YCB A;  4WV3 A;  3J80 D;  4JI4 C;  4D4I A;  2MKY A;  1JOS A;  4U5Y D;  1BA3 A;  5T8T A;  2HHH C;  4KTT A;  1WH9 A;  4DR6 C;  1LCI A;  5A1G A;  2D1Q A;  2E0G A;  2QW0 X;  3NYR A;  1N32 C;  3FCE A;  1V26 A;  4YHH C;  5CZX A;  5BST A;  5IWA C;  4L4Q A;  4DV0 C;  1N2F A;  4JM1 A;  4JI0 C;  2CXC A;  4B3T C;  2WD9 A;  2D27 A;  2OBV A;  3FCC A;  4G36 A;  4DR2 C;  2HJG A;  4NOZ A;  4BSZ A;  4X65 C;  2D1S A;  3UZ0 A;  5GTD A;  4B3R C;  5BSR A;  1UKK A;  1MXC A;  4JI8 C;  4GKJ C;  5BUR A;  4R1M A;  2QVZ X;  4DV7 C;  1KKG A;  5BUQ A;  5AE1 A;  4MH4 A;  4I9G A;  3DHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...