1YJ7A

Crystal structure of enteropathogenic e.coli (epec) type iii secretion system protein escj
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
167
structure length
154
Chain Sequence
MKEQLYTGLTEKEANQMQALLLSNDVNVSKEMDKSGNMTLSVAAADFVRAITILNNNGFPKKKFADIEVIFPSPSQENAKINYLKEQDIERLLSKIPGVIDCSVSLNVSSAAVLVISSPEVNLAPSVIQIKNLVKNSVDDLKLENISVVIKSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords escJ
publication title Structural characterization of the molecular platform for type III secretion system assembly.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 46
structure length 154
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1530 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Hypothetical protein rpa1041 1yj7A01
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1yj7A02
4G37A 2VZEA 4G36A 2D1SA 5JRHA 3R44A 1MDFA 4RLQA 2QVXX 4RLFA 2QW0X 3NYQA 2P2BA 2V7BA 3CW8X 5BSUA 3LNVA 2P20A 3E7WA 2D1TA 3VNSA 4IZ6A 4OXIA 1MDBA 2Y4NA 3LGXA 1LCIA 2P2FA 1PG3A 4U5YD 5BSVA 3NI2A 4ISBA 4GXRA 4FUTA 5K85A 4ZJZA 3DLPX 4PZPA 3CW9A 2VSQA 5BSTA 3B7WA 3C5EA 4RVNA 5BURA 4FUQA 4EATA 3DAYA 3FCCA 1T5HX 5BUSA 4D4GA 5BSRA 4DG9A 3GPCA 3LAXA 3DHVA 2QVZX 3A9VA 3KXWA 4RM3A 4GS5A 5IFIA 3EQ6A 2D1RA 5BSMA 4R1MA 1AMUA 5KYVA 3FCEA 4RM2A 4RVOA 5DV9A 3PBKA 2Y27A 4DG8A 5KEIA 5GTDA 5K8FA 1RY2A 1YJ7A 4D57A 4GXQA 2Y4OA 5KYTA 3VNQA 3VNRA 3RG2A 4RMNA 3NYRA 4D4IA 3IPLA 4D56A 3E7XA 3A9UA 1PG4A 3G7SA 2MKYA 4OYCA 3ETCA 2P2MA 2WD9A 1T5DX 2QVYX 4IR7A 2D1QA 5BUQA 2P2QA 4WV3A 4R1LA 1ULTA 3L8CA 5E7QA 2P2JA 1BA3A 5BSWA 4W4MA 1MD9A 4R0MA
chains in the Genus database with same CATH superfamily
1X4FA 4JYAF 1AROP 3GIMA 2Q79A 3M8YA 1TAUA 3S7RA 3BGFA 1VBKA 3S1TA 2ZBRA 2JL9A 2IHR1 2AZ1A 3TANA 1FKOA 4LF8C 4WIQA 3M1VA 4CLSA 4EYHB 2W25A 4CLPA 3AF5A 2JLFA 1U0SA 2C2NA 2P9CA 3Q8VA 1EIYB 2VQFF 2N7YA 1FRLA 3G6ES 3AAWB 1TL3B 4C11B 1KQKA 4RW6B 1BUXA 2V94A 3V4IA 3CDEA 2JEGA 3THTA 1JJCB 2F9JA 5HK4A 3P6YC 3MM5A 3PEHA 2XMKA 4PPZA 3H5XA 2XNRA 2OKQA 1WC4A 4J9QA 1IBMC 3TX0A 2DO0A 1M6XC 4P2FA 2Y1JA 3M7VA 1QAXA 4BBYA 2CADA 4LR7A 1REVB 5K9FA 3ZTSA 4PR6A 3M8PA 3JYTB 3KHHA 2NREA 3NYQA 3UZ0A 4RBVA 1SVDA 3HHLD 2ZUGA 2HEKA 1CULA 4DF4A 1N88A 1DTQA 4FUTA 4UOHA 1UFWA 1K0VA 2BVZA 3PYGA 2WSEC 4K4YA 4DX6A 1TV6A 2JEFA 4L6V3 1FJGJ 4XX2A 1M1GA 4ZP6A 5EDWA 2YPYA 4WFAQ 5LOQA 3QT6A 4DS5A 2XMTA 5KFWA 2V2KA 2A6OA 1AB8A 3G82A 2MQQA 3V2UC 2IVFB 4ZVFA 2Z30B 2JEIA 5U47A 5CABA 4DR3C 4M5LA 5DJBA 4IRKA 1H0HB 4MYTA 2YNIA 3MMCA 4DV4J 2BJ1A 1O9TA 1DLOA 1HHTP 5F3TA 4MFBB 4ANDA 5LT5A 4IRCA 4EFAC 1O92A 3EVMA 1BLUA 2BM1A 1S1TB 3M8SA 5D3GB 5H9UA 2GAGC 2R7UA 1NEEA 4ZLJA 4K50A 3C6UA 5DLGA 3TO8A 3C8YA 4C8ZA 3M9NB 3KFWX 1XK8A 3B4MA 4LSLA 5DM7Q 3ZZYA 1UEVA 3HT0A 1N33J 1JXLA 2DISA 3EGWB 4QIFA 1RA6A 1B0VA 2F65A 3M8QA 2EVZA 2DR8A 4G36A 4KQZA 2KL8A 1NHUA 1NUEA 3OR2B 2AQ4A 5CAAA 4UOCA 4B3OB 1NSAA 4KJIA 4DV0C 2OP5A 2P6TA 2KHCA 1WC6A 3LUSA 4DLEA 2IDEA 4J9KA 1RTHA 4ZPDA 3RBEA 2CYYA 1HNZC 2O01C 3DLPX 2V4JB 1S10A 4ID8A 3GMGA 4G1QB 2C2DA 2XBPA 5DQHA 1S6QB 1V25A 1F3FA 4DR6F 4IRDA 1ITPA 1MSWD 5KG7A 1WOPA 4RM3A 2NUUG 3VF0B 4RM2A 3MM6A 1RAIB 4U8YA 2UU9J 2KYZA 3BJYA 3H90A 4NXMF 4CT9A 2FLOA 1UEKA 2KXHA 2GX8A 2HPUA 5KFFA 3EZ5A 1SJ1A 2W2NP 2DVIA 2NPIA 3DLEB 1UW4A 5DDQC 2OI2A 2OPLB 3C6TB 5A8WA 2ASLA 3EDQB 5GAHI 5HQMA 5HL7Q 2ACYA 2B4VA 1MD9A 4P52A 2CPHA 3EVWA 3WHIA 5KTQA 3R44A 4H54A 1Q95G 1F9HA 2P20A 4M1KA 3PYDA 1AUDA 3HZGA 3IP0A 1UWBA 4KGXB 4Y2AA 5HJYA 5BR8F 2YY3A 3MPDA 2VQEC 2GIFA 3MMJA 3R9LA 4DCVA 2RKIA 1CQMA 4HI2A 1QAYA 2EBGA 2DNNA 4ID5A 4PYDA 1RT5A 1RI7A 4TU7A 2XY7A 5AXNA 5ETMA 4XDCA 1U26A 2CZVC 1HWKA 4NXNJ 1U6FA 1HI1A 1AYEA 2VDHA 3R6LB 3QT7A 3CDUA 3MPUB 2DIUA 1ZTWA 4IH6A 3AD8C 1OO0B 4LFAF 4C0BA 4X62C 1S1WB 1VQLS 4LRFA 3ZZZA 4KTQA 3J81j 2M7SA 2W7OA 3QRPA 8AT1B 2KYXA 5DETA 4KY3A 3WZ0A 2W9BB 2QYGA 5ETLA 4FYWB 3MZIA 2OEJA 4ECWA 3CJ0A 3KLIB 4PG5A 2FVPA 4G65A 1F9EB 4B3RJ 1RT4A 1QM4A 4IG0B 4IFYB 3DM2B 4QR0A 5L9XA 4Z37A 3I31A 1UCNA 1EP4B 4C8NA 1WKJA 2GIRA 5H9FK 2K7KA 2DB1A 4URGA 5K8OA 2ZBIA 1C0UB 1BE4A 2ZHOA 4OHZA 2QX0A 2ATCB 2VG7A 2JNVA 4ZPWR 1XQIA 3NXZA 2HVIA 3BSNA 1Q5VA 2GQQA 2O66A 2Q66A 2LQ8A 3V4MA 3NGDA 2GGPB 3I4HX 4BHQA 3QQCD 5F3ZA 1X60A 3UD3P 3PBKA 2KJVA 4X4OA 1UFLA 2ACMA 1C1CA 4YB1P 3MEDA 3W65A 4ZJOA 4D56A 5F8HA 1HBNB 2K3IA 2HYIB 3HSZA 4B9TA 5F9NA 1NCLA 3DHWC 3TUIC 2RSQA 1IB8A 4NE9C 3BQ0A 1JLFA 1CJTA 1N5TA 2CY1A 3EYZA 3R3TA 4G6VB 1W7WA 3A8IA 5AJ3J 2QLBB 4CLUA 1OPIA 4GRSA 2LQJA 4NCGB 2ATLA 4KV8B 3LWMA 5HBMA 4ZS6A 2BR0A 3E01A 1GXUA 5GMDA 4DUZC 1RT6B 3IFEA 4UUWA 1TUWA 1FKPB 4YB6A 3NS5A 3PYFA 1VYAA 2WVEA 1UVKA 4NLYA 2CPIA 5A8RB 5KEIA 1JB0C 3G96A 3KJNB 1T9TA 2LCWA 2GMLA 2EC2A 3TQEA 2XLJA 3E8OA 1MXAA 5IWAF 3FNNA 4OYMA 2ADCA 2YKMA 2EG2A 3KJFB 3QATA 3RW7A 4UZBA 1MLAA 2HMIA 4C3MA 1XBWA 2WBMA 1AFIA 1U48A 1U45A 3LGNA 3BGUA 4MTPA 2VJVA 4JI2C 3U27A 4NWBA 4NA3A 4A48A 1WF0A 4QPXA 1BA3A 4JM1A 2C2OB 4NEYA 2OLWA 3PW2A 3R6GB 2EKYA 4YB7A 1KBRA 4JI7F 3Q8UA 4LF7J 2LYVA 4RUBA 4KHPJ 1MKYA 4DN9A 2AGOA 1AXQA 2RB7A 3LF0A 1NNDA 2WVDA 4WFZA 1NH8A 2M9KA 2OIHA 1KN6A 5CZXA 1PAUB 1B4SA 2B5JB 5T7LA 3HVWA 2VFSA 1U1RA 4IH7A 3FFIB 4GKKJ 2CQ2A 2WSCC 4NLPA 4RW9A 1J5EJ 3K59A 2RRNA 4JV5F 4QIEA 1FTCA 2IAJB 4KFBB 3T9NA 1SV5A 3JQMA 1D9DA 3T1HC 4DV6F 1SBRA 1KWMA 1HBOB 3GE9A 2NXJA 2K3KA 2SXLA 1S72S 2VA2A 1HNXC 4N5SA 1XRCA 3ZO7A 3CXCR 5HMZA 2B43A 3FEXB 4OV1A 4FVCA 1VHFA 5F0WA 3ILLA 3IG1B 2P2BA 3PX0A 1B0PA 2OJ3A 1PC4A 1VQOS 2RT3A 2DRBA 1FD8A 2CDRB 2CIMA 1T9VA 3EM1A 4DUYJ 4ISBA 5MAOA 3DRXA 1VQ6S 3H2VE 2YNFA 3FEYB 2HAFA 1F9FA 1HR0C 2QLXA 1UP1A 1RXOB 3JTOA 2NPFA 3POTA 2FHMA 2D1RA 4NLXA 4U96A 1RWXB 1QSSA 1TZ0A 2BACA 1ZM3A 2W9CA 3KWMA 2KFYA 4ZP9A 3DDKA 2PMHA 4DL2A 3OR1B 2XMWA 5CA5A 3D54A 1OWXA 4O44B 1LWEA 3SFUA 1ACMB 2HQGA 3OFFA 3QO9A 2OPSA 3R5CA 3PM9A 4I2QB 2MQOA 3W64A 1KC8T 3TWZA 5E41A 3NPDA 2N3OA 3GFYA 1U7LA 1RTJA 2PT0A 3CGIA 3IM9A 2B9XA 4IFVA 1WF1A 4H4OB 2WSFC 1H38A 3PO5A 1BMQB 5JJBA 3PJ9A 1B0TA 3CIMA 3T5JA 4RW8B 2HHXA 5BSRA 1C0TB 1YIJS 4BCAA 3FZ2A 3QLHB 4ZVQB 2Y8WA 1W25A 3KLFA 1U6BA 5KYVA 2WB1D 4LQ9A 2Z4PA 1IKYA 3PX4A 1RT2B 1TKTA 3I07A 1QWIA 2VQFJ 3CJKA 3NYRA 4DOZA 1IWAA 3O1LA 2HZVA 5HI7A 4OL8A 3UCZP 1B64A 5HP1B 3KLHB 3BPDA 2XHCA 5FDLA 4B9SA 5DZ6A 4UY85 4O4GB 1QJHA 2CNNB 2WTFA 2PN6A 4IOBA 5KOWA 1CJKA 5KG6A 3PX6A 3R27A 3OSPA 1VQMS 1JK9B 4JI6J 3E7WA 3MAHA 3NGKA 3K7RA 3L09A 2ZKUA 4CNZA 2GHPA 1QDUB 1F2GA 2ZE2B 1XR7A 3ICLA 3D0GE 3MMAA 3D67A 2J0QD 2XCPA 2YWGA 4F67A 3I08A 3NEKA 4KIAA 2CNOB 4J9OA 3A8JA 5BUSA 3MF5A 1KHVA 1T05B 1TL7B 3FBCA 3MUVP 2VV5A 4ZJQA 3H2TA 1IKXB 4DR3F 4HHUA 3IC1A 3FK4A 3PVXA 4HI1A 3JSMA 3ENVA 2XMUA 3ZTOA 1JNRB 1RT7B 1F0XA 3IR6B 1TR0A 4U7UD 3BV8A 4RBUA 4OI4A 3RAXA 3FBFA 3MECB 2NR0A 1TU0B 2DJWA 4WYLA 2YWCA 2FQQB 3L7OA 4C0OC 3IGVA 1VI7A 3ETOA 4DDFA 3L4BC 2QFJA 2Z56B 2C3UA 2D69A 2KXNB 5F41A 3AB2B 2MKKA 2FY8A 3DLGB 3I87A 3BKTA 5FLXY 2XTJP 2ZH5A 2PFDA 4DV0F 3FRYA 5C7PA 2Q43A 1IBKC 3SDEA 3HFZB 1B70B 2CJQA 2X1AA 4HVZA 2DNMA 3IO1A 1GEHA 4OZJA 2J6TA 1DRZA 2KFNA 4F4ZA 1ZAXA 3VAHA 3P5TL 2CQ3A 2LQ9A 3GSDA 2XSJA 5IM0B 2GS8A 2FGOA 1USPA 5I3UA 4F0KA 2X7IA 2C3YA 5HQLA 5EWEA 5IS2A 3ZZTA 4PEOA 3AJDA 2B4PA 1PG5B 1D3WA 3FMBA 2ZOGA 2HQCA 2F40A 1JLCB 5JMNA 3I82A 1WC1A 3PJXA 1OY9A 1G7CB 2HBYB 4MJKA 2E0GA 2DR7A 3LWLA 3W8PA 4OI2A 3K2YA 1WHXA 4BSZA 3NAHA 1XERA 3KK2A 2GQ2A 4K4VA 3H5SA 2WOMB 4KTVA 3IAM9 4M5IA 2VODA 4QWAA 2CJ9A 2NQPA 3HD2A 3BR9A 4PG7A 2L9DA 2XULA 4ZKAA 3CT9A 5E2QA 2PSZA 2DIVA 1SJQA 1QE1B 5IFIA 2ZHAA 5BSMA 2E5JA 3D66A 1H2TZ 2FYXA 2DEIA 2RIJA 2AD9A 5J2QA 4B9UA 5LMNJ 1DJ0A 2GJ2A 5KT7A 1ZM9A 3GFXA 1IKVA 4R8UA 1TKXB 2YNHB 4CDIA 4RMNA 2CQ1A 1UPPA 3IPLA 4O3QA 1IWGA 1HYSB 3NRBA 4OX9F 1HBUB 4P7VA 1XNQC 4DV4C 4X62F 3A12A 3UVJA 4TYAA 4N8NA 2GIQA 4G37A 2HNZA 2BYCA 1Q81T 1M5KC 3KNAA 4Y65A 2Y1IA 4WCEQ 5K8MA 2OTLS 1ZZFA 2VKZG 1NJXA 2HS4A 3GU0A 2VPXB 2LP4A 1N33C 5CYMB 4I68A 3KLGB 2DH9A 2C3MA 4Q7AA 1X0FA 1VRQC 2IA0A 2QA4S 2R7OA 1S1VA 1NK8A 2VFUA 2PEBA 5KFOA 3Q8RB 4ZOSA 1VK8A 1HHSA 1I94J 1UAWA 1U1OA 1CJVA 3CIZA 4URQU 5DO2A 3CCQS 2AT1B 4OHYA 2AEJA 3TX8A 3SQGA 2J7UA 1ZPVA 4ZLNA 2KM8B 2GJIA 4CLWA 1HWJA 3RBXA 4K4WA 3HXMA 4PXDA 2OELA 4K5RA 4DR2J 3CCTA 4X65F 3OW2R 4OHVA 4WBFA 4KPCA 2DRAA 4JV2A 2MKIA 1RYSA 3LPYA 2BEFA 4C0HA 4DQQA 1R8CA 4OYPA 4WZMA 1JNZB 4CTAB 1Y9OA 2BKPA 2F7VA 3UD4P 3HVTB 4F36A 2CJYB 5K85A 2KXFA 2J9EA 4DSJA 4CLYA 4N41A 3VZHA 2XLKA 4Y3CA 3H98A 4AD6A 2JFKA 3RUBL 4YDXA 3Q8QB 1RHMB 2N7CA 4B3MJ 3RBDA 4GKJC 1FO1A 2CZ4A 4KSEB 1RWKB 4DUZF 1RAEB 3TAMA 4IUFA 3PACA 3OPKA 4HEA9 4O3RA 3F56A 1T02A 1E6VB 1BQXA 2BRLA 3W61A 4PKDB 4OYCA 2VOPA 1EAYC 4EO6A 2AJQA 2UXCC 2V2VA 2DRDA 3O8WA 1TMJA 3C14B 4JI2F 1R0BG 2X3DA 3R1HA 4R0MA 4K4TA 3A4IA 4WWSA 5AE1A 2OTJS 1LW2A 3K5OA 1YI2S 5D8HB 5B7WA 4Y2KA 1FFSB 4O3OA 4RNHA 3V6JA 5A8KB 1U8WA 1V5VA 2VPZB 3CC7S 3IWNC 1XRBA 3ZNUA 1ML8A 4DV2J 4EMDA 3C15A 3OVSA 2D7SA 4B3RC 2A18A 2LXIA 3OUYB 2QLWA 2YKNB 1C1BB 2YKAA 4UOFA 4LBPA 2LU2A 1RCOB 2I9SA 2C3PA 4C8YA 3DGPA 4UZCA 1HNVA 3TQ1A 1VBZA 2HURA 2PI5A 3ELHA 1OYDA 4TY8B 2LDIA 3PKMA 1HNIB 4YDDB 2HRTA 1Q8KA 4OLOA 4D4IA 1B3TA 4D3GA 2A2DA 4XTTA 1L3KA 2V4RA 2EFNA 3I4PA 2KRRA 2Q1LA 4KYZA 2UXBF 3RU0A 5J1EA 1AZSB 3PR5B 3PNIA 4CCHA 1S1XB 2VC0A 2BJOA 1JLQA 2MXYA 2Z2ZA 3ILIA 1LW0A 4ETXA 5IV4A 2OUGA 1N32C 2RRAA 3A1YG 3DLKB 2J5AA 3EPIA 3LGXA 3GJTB 3DRPB 2KG0A 2RD5C 4K4ZA 2FTRA 3DOMA 4DR4J 2XYGB 2MMAB 1Q4RA 4KC5A 3IEVA 3OTCA 1YRTA 5KFCA 2WB4A 3H0PA 3IRXB 1QSYA 2DXEA 1K44A 2QO3A 5KT4A 5EUHA 2KO1A 3TR3A 1LWCB 1NHKL 4V1Ak 2VU5A 3MCNA 3VGUA 1M5SA 4U7CA 1HR0F 4YY3F 2I6WA 4TQRA 2HLUA 1UVJA 1YBTA 2QGFB 3M2RB 2CPDA 5BYQA 4LF2A 3AH6A 1VQ5S 4BWMA 4CYUB 3LQVA 3T1AA 4ECUA 4I64A 4ETZA 4FBUA 5HATA 4HACA 2IJRA 3BGRA 3M05A 2RVJA 1AFJA 2CA9A 3GYGA 2DR6A 2MGZB 4MH4A 1XR6A 1GX5A 1XMOF 4LF5J 1VC5A 1GPMA 4B3SJ 3MR6A 1UPMB 4W4MA 3BSOA 1ZAVA 2ZNZA 5I42B 2OSRA 2JDJA 4DV3J 4OFZA 3FSIA 4NI2A 5DG8A 2CPZA 1Z2LA 1IBLJ 3PJWA 5CH7B 1PYOB 1BGXT 1PBUA 3LAKA 4J37A 3LP0A 2C2EA 2VC1A 1Y0HA 4DLGA 4AYBD 3D28A 1KVKA 2B6AB 2OSQA 3LAXA 1HHQA 1Z4UA 3DXSX 1FJEB 4I6AA 1HKAA 2EEYA 4UY8T 2XM3A 3OL8A 1FKOB 4YOEA 4OJGA 2F4VJ 3RB0A 3M1VB 3VQSA 1GXTA 4HHHA 4GKKC 3O3LA 3N5FA 1BWVA 5GADI 4L3NA 3ILOA 1J5EC 2UXDJ 2VFTA 1KR4A 1HWUA 4ZCLA 1GTEA 3LUYA 3JSBA 1KONA 3V4IB 3CD5A 4NOHA 3L8CA 4CT8A 3B6BA 2DNRA 4OZ1A 1FJ7A 4HTIA 3ADAC 3MM5B 3PHEA 1O5JA 3FQKA 4K8RA 5B0DA 4ELTA 4L4QA 4LF6J 4J9NA 4PABA 4F4KA 3HFVA 3GLJA 3JB9k 1RTIA 4CI0B 4X64J 1VQ9S 2Q3PA 4J9PA 2ZJPQ 4JI8J 3TDEA 2QLJB 1MG7A 2QN6B 1T0TV 1YWXA 2IM0A 2RQCA 3HLUA 3KUHA 1U1MA 4HLBA 4B9VA 2QL7B 2FY1A 4DUYC 4JI3J 1JLEA 1XJWB 5H9FJ 3TZYA 3Q89A 4NLUA 3ZTPA 4WPAA 5IT4A 3CJTA 1R8HA 4O3PA 2DHSA 1T3OA 1CULB 4KPYA 4WU3A 1DTQB 1HNWJ 3T1YJ 1TV6B 5GMEA 4B9NA 2XMJA 3G82B 2RDJA 4WP8A 2AP6A 4X66C 4ZVHA 3VGTA 2OMOA 1P9QC 1DLOB 2HS3A 3DYAA 2PA8D 2AX1A 2ALYB 5A0YB 2KTQA 5K8NA 1WKLA 2E66A 5HLFA 3N5BA 1S0MA 4WIIA 3ZZ0A 4YQWA 3ZZRA 2HHHC 1XMQJ 4CM0A 3C16A 4ZJZA 2DNOA 3D0IE 4YHHJ 1MXCA 2GVDA 1S6OA 5FIIA 3MEEA 1MMNA 2RJZA 3PRBA 4LFBC 2VFVA 1OJ4A 2V8PA 3CWJA 4FNHA 4AL6A 3M8QB 4HTJA 4N7TA 3FRZA 3IWXA 3HX9A 2XCAA 5HAOA 2WVBA 4DQSA 3FCEA 2M5HA 3PIOQ 3I32A 5DDOC 1V6HA 2KI2A 1RTHB 4H4MA 2BMBA 4JYAC 2UUCJ 3T6BA 4MK8A 1PILA 3H5UA 1M1KT 4A8SA 3R7SB 3DRSA 3OHAA 3AB4B 4Q2LA 4WF9Q 2MY7A 2W4DA 2VBYA 2MB0B 2AYMA 1FKAF 1RAJA 2E5IA 4USVA 1C4AA 2DXDA 3D6FB 3MM6B 3O6QA 2MZSA 4QR2A 2RU9A 4L2ZA 2VQFC 4C3KA 2IM1A 4ED1A 4B3TJ 3EZOA 3VZIA 2VG6A 1HI8A 5A1IA 2HQ3A 2UUAF 3EX7B 3RGIA 3SEOA 3BF4A 5A8WB 1MNEA 4YS2A 4C2MA 1RKJA 1D8YA 3NGSA 3MR3A 3ET6A 1VQ8S 3PXGa 4AQYJ 1H2VZ 2AW0A 5KG0A 1YG0A 4I67A 1RB0A 4YP3A 1NJZA 3CCMS 2E8CA 2HNDA 1S99A 4TKTA 4PQAA 5B0CA 3SZ2A 1UWBB 1JQGA 2MZ1A 4A8OA 3PV8A 4FYXB 4DL3A 3HHKA 5E3PA 2WRMA 1P6TA 1FJGF 2RKIB 3KK3B 3U1MA 4KO0A 4ID5B 4PG8A 4QQBA 1RABB 1RT5B 4YFUA 1SQFA 2ERRA 1KQFB 4DV4F 5AE2A 4OLPA 2GJFA 2JLGA 4M94A 5L1KA 1WC0A 1E6YA 1TK0A 4NASA 2WK4A 1KQSR 1T11A 4F2RA 5C42A 2LKZA 3HSGA 1GMWD 1FF2A 1EZZB 2KFZA 2XG8A 1N33F 1S77D 3C19A 4F25A 2FJAB 2NCKL 3A9VA 3RTVA 4ZVUB 2Z2LA 1WOOA 1YJRA 1NKBA 3BYRA 3QWUA 4OJ1A 3QNWB 3O2IA 2ABYA 5CYJA 2PT7G 2CFXA 1W2IA 2DR9A 4F7VA 3QJLA 4DV5J 4ZPTR 1FRKA 4DN0A 4GXQA 1RWOB 2E5LJ 1FFWB 1OMSA 1XWLA 2HIQA 2VG7B 5DRKA 2HVDA 1LK5A 4RNFA 2L48A 3OD2A 4R5PA 2QRRA 1QAIA 4DQPA 5EGYA 1DTTA 5F8NA 2C2MB 2UU9F 5B0AA 5EX3A 1NB7A 1PKUA 4Z7CA 5GAEI 4PWDA 4IQXA 4DR6C 2CQGA 1C1CB 2OEMA 4A8WA 4AL7A 3MEDB 1D09B 2B4UA 3CJRA 1N2FA 4L3KA 3MR7A 4U7UK 3EGVA 2IPOB 2Z2YB 1CC7A 4RW6A 5C2CA 2OHDA 3FZBA 2MQNA 3QGHA 4RUCA 1S48A 1MROA 1WNEA 3TUJC 2D41A 1IVZA 2EW9A 3SSQA 3JTNA 1SH0A 1DQ9A 2W7AA 5EWFA 1VBXA 2C2RA 1I1GA 2PMWA 3MXHP 4ZPBA 4MKYA 2GO9A 2I5JA 1WHYA 2XEXA 3KJQB 1JLFB 1REGX 1CJTB 2L9WA 1S9GA 3UI3A 2E1PA 3QMQA 1A9NB 3A3OB 3W9JA 1M5VC 1U4BA 2FZGB 3PTWA 4A8KA 1O6XA 4DFPA 1SKRA 1O0PA 1EJ7L 5AT1B 4EGLA 3N4WA 1WDDA 4OYOA 5HBMB 1QY7A 5BR8C 2WD9A 3E01B 5B08A 4NXNF 5KFAA 3UO0A 2LLZA 3UOWA 1RADB 3NG8A 4EZ6A 1FE0A 4P73A 1M5PC 2A1BA 4WJBA 3GCWP 3OV7A 3I9V9 3US5A 3RRHA 2ILZA 3RR8A 1N5QA 5A2QU 3EXYA 2YKMB 1H2UX 4USJC 2XWXA 2B4OA 3UCGA 2FHJD 3I56S 3IXQA 3AQOA 3RAMA 3KG4A 1OYEA 1MXBA 1R0AA 1KVIA 4B3RF 2VF3A 2BE9B 3KK1B 3T5LA 1LK7A 1SC4B 1U24A 2Y1RI 1VJWA 2LEBA 1ZH5A 1FWLA 5ETNA 1RP5A 3UDVA 1MMDA 3M30A 1TL5A 4I2PA 4LIRA 1RCXB 2CVEA 4L76A 3BBFA 2AGQA 4DV1J 1I94C 4FF1A 2RHSB 2XC9A 5T7LB 2XZTB 5DGBA 3QZ8A 1IJEB 2CG4A 4ZPVR 3GG0A 4RW9B 3EE3A 4DCSA 2HWTA 4IH5A 5IV3A 3A25A 3SBMA 3W1YC 2E8FA 1SV5B 1RHQB 2QMXA 2UUBJ 5M2PA 1J5OA 2V4JA 3EUNA 2YH1A 2HNYB 2ZM6J 2MZRA 5B0GA 1K0RA 2M4MA 4DR2C 5ITHA 1UJ4A 4O3NA 1S6QA 1KHWA 1M0SA 2Y0SD 4F4AA 1P4EC 4DCTA 4KKOA 1JJ4A 2DITA 2C42A 1OPZA 2CXEA 2DCUB 3ENAA 3GYNA 4CO1A 2ALZA 3M32B 1F3VA 2P6SA 3QZ7A 4WKRA 3AT1B 1T03B 1NH7A 5BYSA 1XNRJ 3HHEA 2HVZA 3MAQA 1URNA 1VS3A 4DUTA 2XS5A 1JOSA 5AJ3F 3TRGA 2VPYB 4J9LA 3DFEA 3EMTA 1XN9A 2FHKA 2YNFB 4B3MC 4ER8A 4HDGA 5G0RA 1Y4ZB 4YY3J 4NDNA 4NZ0A 1WG1A 3POTB 4PQUB 3ISNC 4LBHA 3MOJB 3HPOA 1UETA 1H7WA 1OS5A 4M5JA 3BGOP 3Q23A 1Q86T 4ZK7M 4PG4A 4X4TA 1YRXA 2MSTA 2VZEA 3AD9C 5I3QA 5ETQA 3W9HA 4RKUC 5LMUJ 3D0HE 3I5BA 2W9CB 2MYFA 3PESA 4ELUA 3FKBA 2CQ0A 4PUOA 3JS9A 1U0HA 4ZJLA 3WQPA 4LVOP 2VG5A 4YR0A 1RT3B 4QIVA 2GNKA 3RBZA 1LWEB 1IQTA 4CLFA 4K4XA 3RB3A 3SCJE 4FPRA 3QO9B 2OPSB 4IDKA 5T14A 4OHXA 5IWAC 1CSJA 4LF9J 1ZA2B 4LF7F 4J7CA 4KHPF 1FDNA 2MKSA 5C25A 1RTJB 1S0OA 4K2JA 5A2QY 5GTDA 1X4DA 3LAMA 4IFVB 4QR1A 1Y3KA 1NPKA 3KOAA 3W5YA 4NMLA 4JI7C 2V8HA 3W2WA 3MPVA 3W5ZA 1NK9A 3HI9A 2NZ4A 3G7SA 4GKKF 2YWFA 1J5EF 5DDRC 1JLGA 1R7IA 4Q43A 1WORA 3MM9A 3RRKA 3FGVA 1HW9A 5GAHU 1WEZA 1IKYB 4Y2CA 1YHQS 3DU6A 1ZOTA 3G8QA 1TKTB 1R89A 3BBBA 3DLLQ 4RWXA 4I0WA 3CJKB 5BSVA 3G2XA 4DV7J 3CDWA 3BQ2A 1S9EA 3S01A 3BDPA 1KKGA 5AXKA 5BYRA 2ZVSA 1KLMA 5D77A 3HK2A 1LWFA 3HFKA 5FDLB 4DL5A 4F4XA 5LSLA 1T94A 2HFNA 4DR7J 1TP7A 3LOUA 3SO4A 1CJKB 1IJFB 3X1LB 2MMYA 2AV5A 2RNEA 4QW8A 2EGTA 4DUYF 4DR1J 1PA4A 1JLAA 2V9KA 2AJ4A 2PIIA 2H5IB 5H9EK 1YJ7A 1K1QA 2AGPA 1M5OC 4I56A 2DY1A 2E5GA 2W2MP 3TZXA 4N76A 4MH8A 2EG1A 1FJCA 2CPJA 1SJ4P 3LW5C 2ZVIA 2AYBA 5J2MA 3UDLA 5LSOA 2MQLA 3QIPB 2BJ3A 2R2SA 2DHMA 2HLTA 1UKUA 3UWTA 1V60A 1WI8A 4S0MA 3JSMB 2UP1A 2QVXX 4HPVA 1Y00A 1VEHA 1X9SA 4HHJA 2PD1A 2HSEB 2IC3B 3VAKA 2X1FA 5F8JA 5ETVA 4LF5C 4NRTA 2HHUA 2J6UA 4ECTA 1HMVA 4B3SC 1FCAA 5JUMA 2IVYA 1S7IA 1FRIA 1N34J 3TA2A 5JVHQ 1FKPA 1BQMA 5L39A 4DV3C 2QMWA 2NXUA 4UF4A 7AT1B 2UVVA 1IBLC 1P27B 5IXUA 2F5GA 3TEHB 1I5OB 4ERDA 2VUGA 4ZVSB 2PDAA 2RDIA 2MHNA 3SDEB 1Z1ZA 4XK8C 3HKZD 1WJ9A 3PO4A 1KFSA 4TQSA 4ELVA 1KLNA 3DRRA 3O5TB 2NYHA 1YVFA 4DFMA 3M9OB 4Y2IA 3GIKA 2YX1A 3BO3A 2XSJB 3TJ9A 2W2PP 1CJUA 3J7Z5 3G6YA 2J0WA 1USPB 5I3UB 2XY6A 4LF8J 3CMES 3FCHA 4FDFA 2UXDC 2I2YA 3PW0A 2GQCA 3BREA 3OJSA 1V9OA 2GCFA 4CO5A 3O2EA 3D5MA 4AL5A 2AMCB 3EERA 4KFBA 1JXEA 5B0BA 4WKYA 3NCQA 2YTCA 3K5LA 3R9XA 4OI0A 2ZC4A 3BKUA 4JI6F 5KFQA 4LF6C 5H1SV 3AFGA 4JI1J 1O51A 3TJ8A 1HBOA 5A76A 2UUAJ 2IIHA 2K1RB 4NLDA 4OX7A 3KK2B 4DSIA 2JMPA 4FN5A 3S8SA 4FZVA 4FF3A 2D74B 3IR5B 1ZB8A 4PXEA 1CG2A 1IBMJ 2DPJA 2XB2D 4JI3C 2FLNA 2FJDB 4X4RA 1RGVA 3MFIA 2OPRB 1ZB9A 1KS2A 1W26A 2DGQA 3CJ8A 1SKUB 3OXLA 1UWAA 2BABA 5BSWA 4P2MA 2IM3A 4OI6A 1Y7PA 1MMLA 3MHYA 2DXFA 2EKNA 5J2QB 5A6PA 4MK7A 3MM7A 3VHQA 3LGHA 1IKVB 3GJRB 2D27A 2HGMA 3DLJA 3NY0A 4E8UA 1TFYA 4PROC 5ETRA 4I7FB 2D1CA 4LJMA 3IMQJ 2DTJA 4NA2A 3SQOP 1TL1A 5DLFA 4ZMMA 3CJEA 5BURA 1FERA 3UVJB 1LQLA 5KFEA 1VQPS 3T41A 2VA3A 2HS0A 3CD6S 1FRXA 2HNZB 1F5AA 2CRLA 3H20A 5ETSA 4QJVA 2F8MA 1O90A 1XMQC 3EZUA 3KLVA 3OR1A 1U2FA 4YHHC 4LSZB 4W92B 4ZPAA 3CO0P 4MMOA 1JMTA 3GTYX 2KM8C 3NAIA 5J2PB 1PGZA 2J6SA 2DT9A 1VIOA 3D3BJ 5CZVA 3VGVA 3W9IA 1S1VB 2YNGA 2RHQB 3ETCA 5C24A 4UOGA 2Q6BA 1Q8LA 4ECZA 1VIXA 1CJVB 5DG7A 3Q22A 2N4DA 3CDBA 1N52B 2UUCC 3K6RA 1IR1A 4OX6A 1X5TA 4TPSB 4OJHA 4MT1A 1PG3A 2HFUA 3AOCA 4CLZA 1HNZJ 1RHKB 4EEYA 1EHWA 2ZBCA 4I9GA 4OYBA 4NPOA 2BE7D 1WG4A 2MKJA 3DLHA 5L46A 2RU3A 5LL6d 3MUTP 2FVQA 4ZVGA 3LP1A 3SYZA 2W2OP 1L2FA 5F8LA 2ZH9A 4B3TC 3GFHA 4ILLA 2U1AA 1RT2A 1G6BA 1UEUA 5GMKa 2LEPA 5IC6B 5AXLA 5K5MA 1DBDA 4FYYB 1K73T 2E9TA 3WDOA 1IR2A 2RAQA 1R27B 5HANA 1ZZNA 2G9OA 4J90A 1FDBA 3CSKA 4AQYC 2F4FA 1C4CA 2DNPA 3UPFA 2OAUA 2K06A 4WP3A 2V34A 4O4GA 2V6AA 2BOPA 1CQNA 3DOLA 4JI4J 2R2RA 4GO7X 2HFSA 3VQTA 3TAMB 5LMNF 3CQ2A 2ZHBA 5J2NB 5KFUA 1BC6A 4MIAA 1UA1A 1YGYA 2VQEJ 3R7NB 4GXRA 5CCMA 1D9AA 3N6LA 1A0OB 3GG1A 3KTQA 3VAFA 2M0GB 1HQUA 3LGMA 3W63A 3QFHA 1GFWB 4RU2A 1JJHA 2NZCA 4U8VA 3BEGB 4DL0C 1T9UA 2CQIA 1QD1A 1YBAA 3H40A 3QSYB 4OX9C 1LW2B 2D3OR 2WW8A 3HD1A 1Y11A 1WF3A 3UR3C 1U8SA 2H65B 5DV9A 3MECA 4FKXA 3HHLA 3CULA 2CG8A 3GJSB 2XYPB 1B7YB 3K58A 5GAGU 5KFKA 3PG9A 3C15B 2YX4A 4USMA 5D6GA 3AA9A 4PUGA 3I0SA 5HVFA 5CXTA 4QWBA 1I94F 2YWEA 2QVYX 4P6QA 1SUQA 2DGWA 3DGPB 1HNVB 1VLAA 3DLGA 1B99A 4OYAA 4USUA 2KB2A 1SB6A 5JRHA 4ZP8A 2E5LC 4HKQA 2JJ4D 3VWSA 4A4JA 2OPQA 4DSKA 5BSUA 4C8LA 2XO6A 2Y9HA 2AJ2A 4CO2A 3AJ1A 1PAEX 4JOUA 3M2UA 2W24A 4K2XA 2H3EB 4KGKA 3WBZA 2QEXS 4DR2F 2IRUA 1K1SA 3CMQA 5LM7E 3DLBA 2VSQA 2AYGA 4TY9A 5KG5A 2WVFA 3KG0A 3V81B 2QVZX 3H42A 2KZFA 1IR0A 2YVSA 5LXRA 2BM0A 1JLQB 2B8QA 4GS5A 1U1PA 3QIDA 3D1QA 1NU4A 1LW0B 2ZUAA 3MR5A 1AMUA 1FEEA 4QW9A 2DGVA 4X65C 2LVWA 8ATCB 3MD3A 1T3NA 2FGCA 4QCLA 2FPHX 3G9CA 2XO7A 1RJJA 3M8RA 3WC0A 1FX2A 2J7KA 4WU2A 5KFRA 4B3MF 1M1HA 2A6MA 1XEZA 1DZ5A 2LU1A 1L3UA 4KRWA 3J81U 4OJ3A 3W62A 2FIUA 1DY3A 1IKWA 5KG4A 3UW1A 3GV7B 3NGRA 1T95A 1TQLA 4C8KA 3SV3A 4RLQA 1GNKA 2FLLA 2HHTA 1IM6A 5CHCB 2OFGX 3KUGA 2NCLA 4HACB 4KHRA 1SQEA 3BGRB 3RRGA 2DR5A 4OYWA 4PZVA 2JEJA 3TQIA 3D9BA 5HO4A 1FVQA 4OYIA 1SKSA 2DHHA 3MCMA 4Y2MA 1VRUB 8RUCA 3BH6B 4BC7A 1R0CB 4F04B 1M6XA 3CJ3A 3ZTRA 1I51B 3IAS9 2H4WB 1RE1B 1A6LA 5M2UA 1TMMA 3ITHA 4AUKA 2LMIA 4NI2B 2QC3A 4QWCA 3WIUA 4ALZA 4DV2F 4A8XA 3CO9A 5K8FA 4K4UA 1HBUA 3LP0B 3PFEA 2Y4OA 2KG1A 1KEKA 1J2VA 3J7YU 1MWZA 1Q7LB 4P75A 3IEUA 1T5DX 3FCWA 1NAQA 3BS9A 2QSFA 1LWXA 4DS4A 3BH7B 3K5MA 1VQ7S 2FJBB 3QAEA 1RT1A 2R8JA 1NLKL 3TI0A 3TUFA 1Q53A 4EK2A 1N54B 1LKZA 5CYMA 4RLFA 4DV1C 4J91A 4DSLA 4ZVRB 2D1TA 1UWDA 1RISA 2ZKTA 1TVRA 1SCJB 1DFDA 2ZWPA 3D6HB 3UDCA 3CD0A 4DX7A 4DHVA 3NNCA 1RWWB 2BE2A 3DNCA 2AJ1A 3QGPA 4Q44A 2UUBC 2LQ5A 2BX6A 2VBWA 3IRWP 1LXNA 2ZM6C 2CDQA 3TVKA 4QWDA 3Q86A 4EO8A 5T8TA 1MW7A 2FLPA 4DR4F 3T1HJ 2UXBC 3M4XA 2FC9A 3P3DA 3D3CJ 4KH0B 4DEZA 1YJ9S 3VNQA 3DGVA 2HRYA 4GVLA 1T9WA 1NDCA 3R5AA 3TNVA 3BO4A 1HNXJ 1XNRC 4CO4A 3JQJA 4CH0S 1NK0A 2MTLA 1R3NA 1N36J 3AD7C 1RYRA 2H5JB 2KT3A 4F50A 3PKYA 1U09A 1JLEB 4X4SA 4DPTA 3KHGA 3M6VA 4B17A 4L74A 1Y3JA 1V3ZA 4L73A 2DBBA 3CC4S 1QUVA 5CYQA 3OTOJ 4YY3C 2PN2A 2EPIA 2VIHA 1EQMA 4LE5A 3B4DA 3WC2A 1PCAA 2M8DB 3I0RA 4W98A 3QGGA 2W8KA 3VV2B 3CPWR 4LF5F 4FXVA 2HGNA 2LDYA 2O5DA 4TLQA 4B3SF 1HARA 1F6TA 1FE4A 1MWQA 3J81Y 2OEKA 3Q2TC 5LMUC 1QVGR 4UTGA 3CC2S 2C1EB 4DV3F 3DYAB 3I96A 3QAUA 4KH1B 1VGYA 3GIRA 4NL5A 4MAKA 4BC9A 4HT5A 2BA9A 1IBLF 1XMOC 5HLFB 4PUIA 3HMJG 3FDSA 2Y27A 3K17A 3OXFA 5F8MA 2JZ5A 4WXWA 2DHAA 2EFQA 4ZLPA 4DQRA 3TYTA 3J7ZT 5F0UA 1R31A 2QA4G 1TUVA 3NS7B 3MEEB 2IFXA 4LF9C 1S6PA 5L1JA 2IY5B 1SI9A 3R8YA 1IBCB 1CEZA 2X1GA 4ECRA 1HPZA 4USKA 5ETOA 5E7QA 4IR1A 3ENQA 1UTAA 1ZBTA 2W9AA 3SSRA 2F4VF 4H4MB 1VJQA 2ZJRQ 3QSIA 5KFNA 3NMRA 1XR5A 1MDBA 3JXOA 3J80U 4DPWA 1P1TA 3VAGA 2UXDF 2K8GA 2BANA 2B9YA 4EYIB 1SJ3P 3DRSB 2O3DA 2YWHA 4ZITA 4X4QA 4PZPA 5E3AA 2BJ9A 2B9EA 5HVHA 5J1NA 4BWJA 4DSFA 2BBEA 3UN3A 3Q83A 3CB4A 1VCTA 2DKOB 4DV7C 3BQ1A 3UDEA 2AEFA 4LF6F 2QL8A 4NYZA 1KP6A 2VG6B 3CF5Q 5B0FA 4CH7A 3G8SA 4X64F 3R9WA 4JI8F 1FX4A 2D3UA 1WTBA 4DR7C 4O3SA 2R7TA 2VB6A 3FQLA 2GZOA 3CQ1A 2QFIA 1P7LA 2M52A 4Z2XA 3CCLS 3ZNJ1 3AXMA 4JI3F 5A2QD 2N3LA 3K57A 2KDOA 4QU7A 4OZ0A 4DQIA 4NYPA 1S59A 3PIPQ 2U2FA 1HNWF 1JXVA 1N6QA 3OFHA 3IN5A 2COLA 3T1YF 5IQ6A 1VRTB 2AYAA 2XS7A 1L3VA 1LWCA 4JV0A 1S4EA 3S82A 3T6JA 1HLWA 2FC8A 3ZXWA 1X9WA 3M2RA 4ZIVA 2BH1X 1MN7A 3D6TB 3K5PA 2AJFE 3GYXB 2CQDA 4RL1A 1X4AA 3H4DA 4JUZA 3CUNA 4HH0A 1EQ0A 3EQ6A 2GC8A 4NEZA 1E6YB 1NDPA 2CUYA 5IC4B 3TW0A 4FS1A 1XMQF 4PXBA 1V26A 2FD2A 1KDNA 1N34C 1VDHA 3TUZC 1RWNB 4YHHF 1OY6A 1V3SA 3SXLA 4ED7A 2L3MA 3GV8B 4DMZA 4CM2A 2KVIA 2WONB 4DPYA 2CAJA 3N6NA 5KFJA 2BKNA 3C2PA 5E7OB 1HBMA 2J9CA 2BQ3A 2EC0A 4A8FA 2HQIA 1NPRA 1NZAA 3PDNA 3VAJA 3W66A 3OHBA 3KJVA 3ULHA 4A46A 2ZH6A 2JNJA 4ED4A 1O8BA 5D4OA 2UUCF 5KT5A 2ZBQA 4LSNA 4YN3B 3UFCX 5D0EA 4OXIA 4F26A 3M6UA 4FXWA 2HVEA 4PXCA 2B6AA 2ROGA 1IBKJ 1S0VA 1HI0P 1WUUA 3OFEA 4R5PB 4ED6A 1G2EA 1DTTB 1Y5IB 2ASDA 2MZTA 4B3TF 5IFMA 4DWIA 4M8LA 4PWDB 2HK3A 3P49B 4R25A 3M6WA 4DG8A 4U9RA 1KTVA 3CCVS 3IWLA 3DU5A 3J80Y 3RG6A 2IDLA 2PC6A 3QBCA 4L7IA 1RLDA 1MROB 5KFBA 4AQYF 4L72B 3NS6A 3AJ2A 2EK1A 2HIYA 4RNOA 1GQEA 4JI1C 3C3LA 4OYZA 2UUAC 2XZWA 1KOHA 1WELA 2I5JB 3R2CJ 1EETA 3HO1A 2D1SA 2CWXA 4ECQA 1S9GB 2JHEA 2VH7A 3VVUA 4IO9Q 1SJRA 4ECVA 4A8QA 4OQJA 3FUYA 2A10A 4ECYA 3P5BP 4NLWA 1NO8A 3U02A 3KHLA 4J9SA 2J76E 3AODA 1FJGC 3RYLA 2D7VA 4TNOA 3QRRA 4IG3A 2OD4A 4A8MP 1X0PA 1CS4A 4R1MA 2NSCA 1OSDA 2IA6A 4W90B 1I6JA 3DOKB 1SH2A 2G0CA 2ZDPA 3GIIA 4USHA 2R7RA 1PJ5A 1RU1A 3D1OA 2B56A 4RBTA 2R7WA 2A0FB 2XWYA 4NLSA 1XNQJ 2ZD1B 4YEAA 1PG4A 1R0AB 2W1BA 5GADU 4MKBA 1FNMA 3UNGC 5A0YA 5H9EJ 2KH9A 5KFPA 1FT8A 2WCXA 4LFCJ 4FS2A 1H6KX 4DV5F 3KKFA 1ZAWA 4P9SA 2QW0X 3M30B 4Z7YA 4RX6A 1NJWA 4RW4B 2E5LF 3PHTA 4I2PB 4CO0A 2AIRB 4BS2A 1RHRB 1X31C 2XI3A 1F2HA 2IMWP 2ROEA 3MGJA 1NB2A 4ICLA 4UQGA 3T9ZA 2E9ZA 3BBCA 3TA0A 2RILA 4RVNA 2DYAA 2J8AA 4CIOA 3OLAA 3FSYA 4USWA 4CH1A 1RWMB 2R7SA 3PYEA 3PCOB 4DX8H 1J5OB 4GVBA 3NOGA 1IXKA 1RSCA 2BW7A 5JVGQ 2UU9C 4C9DA 1R43A 4O0NA 1CPZA 2WVCA 2DO4A 4KB7A 1WDTA 1HWIA 4WE1A 4KKOB 4PHTA 1WEXA 1GMUA 1JIHA 1VOMA 2R7QA 3KMQA 4NLVA 1NK7A 2NLWA 2J7WA 2O67A 3M2VA 3B82A 2HG4A 4OZ5A 5K20B 1N0VC 4V19X 3JAMU 1UFKA 4ILMA 2G2ZA 3OVBA 2Z51A 5KFTA 2BV3A 3IM8A 1YKWA 3CCRS 2CQPA 1H74A 1RA7A 4K0KJ 1FXDA 2NS1B 2OGUA 2ONFA 1NXIA 1D0EA 4JI4C 1TELA 5E5NA 2GVZA 3CTRA 4ZLLA 3QJPA 5G0RB 3KYLA 3CJSA 1Y5NB 2CVIA 2WHOA 3ISZA 2CNLB 1HWLA 3R2DJ 4JI0J 4GKJJ 2V8GA 1JLBA 2Z8QA 2R7XA 3LH2S 3R7BB 3G87A 1K8AT 2OPPA 2FHOB 4TYBA 4DPOA 4MK9A 2BUNA 1F5CA 3KXDA 1ULRA 4USTA 3QWPA 3MD1A 3KK3A 5KFXA 2MZQA 4NXNC 3HCXA 4PUOB 2W2QP 2Z57B 3FCVA 1U0HB 5KFSA 2VG5B 1N5YA 2E7GA 2WBRA 2FZKB 2J0XA 1LFPA 3HHDA 2E7WA 3IBWA 1KTQA 1CLFA 1G3OA 1NDLA 4IDKB 1BD6A 3D2WA 2UXCJ 3ONQA 7FDRA 1S1UB 1X4HA 4DPUA 2ZH4A 3U1NA 3DMJA 2MLZA 3KUEA 3MAAA 5DQGA 4DFJA 5C25B 1WHVA 1WSVA 2VOOA 1FEHA 3G86A 5KFYA 4LF4J 3T19A 3CW8X 4ZHRA 4MKAA 5IT9U 2JX2A 4DV1F 1OQ3A 3MTJA 1WTFA 3Q24A 1RZMA 4ZCKA 3W2WB 1YRUA 2XSFA 5GVQA 4WTOB 2BRKA 3BO2A 3C5EA 2ZZNA 1JLGB 2P2CB 2GV1A 2Q6CA 2UZAA 1N5SA 2UUBF 3MM9B 1NKCA 1RHJB 2VHGA 9ATCB 3V6DA 2MCQA 1NJYA 1ICEB 4C97A 2ZM6F 5IT0A 3B8HA 3K0JA 1MU2A 4RVOA 1FHTA 2P8IA 1UZDA 5C5JA 2F9DA 1OQ6A 3CNQP 1S9EB 1OY8A 2MLXA 2BW2A 4QU6A 3P96A 4ODJA 4DL6A 1KLMB 2YPZA 5FJ4A 4J9VA 2ADBA 1LWFB 3KLEA 2YQ0A 2VASA 4Y34A 2ASYA 1FTRA 1XNRF 4Q0BA 3AHPA 1YK9A 1JWWA 3EVOA 2KU7A 2P2JA 4ZCIA 4ZIWA 2VFRA 1JLAB 1N32J 2V7BA 5LSRA 4EI2A 3H4BA 3EPGA 1JKHA 2YQ3A 1SL0A 3HVAA 3JSRA 4DBQA 1HH2P 2QE5A 2V8DA 1SJFA 2V69A 4E98A 2FJXA 1FFGB 1WC5A 3FSXA 4EU0A 3OT9A 4FYDA 5M2RA 3R5JB 2Y8YA 5J2MB 3UX2A 2VBZA 3JAMY 5A19A 1S97A 4FF4A 2E1CA 1DQAA 1OIAA 4DCUA 5LMUF 4QOTA 3GZ7A 5D15A 1VQKS 1HD1A 2ZDOA 2J9DA 3DHXA 5E3QA 1YSJA 3C46A 1VISA 1FWPA 4P2SA 4D57A 1HMVB 1ZS6A 7FD1A 2B7CB 3AOBA 2OH2A 2PO4A 1RTZA 2POKA 3MEKA 4C8MA 3A4TA 3NLCA 5D0RA 1BQMB 4LR9A 3NNAA 1RWPB 4QPTA 1WG5A 4LF9F 4TU9A 2RF2B 1WD6A 2R42A 2DD8S 2HW3A 5KT2A 1TK5A 3GILA 3UNYA 1SC3B 1BQNA 3MUMP 3A8EA 1VHIA 1V3RA 2J0SD 4M5DB 4LF7C 1R8PA 4ED3A 5GAEU 4U5YD 4KHPC 2G0JA 2RMLA 5AE3A 3Q8PB 2YKOA 3KK1A 3DRRB 4QZVB 4DR5J 1S76D 5LJ5Y 3N2QA 2IMOA 2V5HG 1SIZA 2YWKA 4OZLA 1CJUB 2MDAA 2P5VA 1X5PA 3HF5A 4BLGA 2F1FA 4DV7F 5IT9Y 4C98A 2R9LA 5LJ3Y 2FVCA 1FUGA 1L3TA 1VQ4S 1D1UA 3L95X 2B9WA 4DG1A 1L5UA 4EBDA 1Q5YA 2E29A 4IOCQ 4DR7F 2H48B 2HK2A 3KDOA 3MM8A 4LT6A 1YJVA 4XDDA 2C22A 3MOZA 5DGAA 4NLQA 1S4FA 4OI3A 4ITSA 2DPLA 2HNYA 4DR1F 1TK8A 4NMXA 5L8RC 4ED8A 2MLYA 1T8EA 3OXGA 2HBRB 2DNQA 3CCZA 3N28A 1LEOA 2NUHA 2RDDA 3TARA 3M8PB 2RS2A 1QAJA 2IRYA 3MMBA 1NBEB 1N36C 2ATWA 3M32A 3BN4A 3DI6A 3W60A 1T9XA 2LA6A 3IR7B 1T03A 3M6XA 4WFXA 4RR5A 1S49A 1G4CA 3NNHA 2G1HA 2E5HA 3LP2A 4JI5J 1YQHA 4LRCA 3OTOC 4Y00A 4X84A 4NZ6A 1X8DA 4PRFA 3KMSA 4ED5A 4DJBA 2A3JA 2ZC3A 4M5MA 2XI2A 4DPXA 3MM7B 5K14A 2L08A 1U49A 2E1RA 2D9PA 4IO1A 4B02A 4F2SA 3BDEA 1FWKA 1SPBP 2YNIB 3MMCB 1N34F 1TL1B 2Z2MA 4PQUA 4F4WA 3KHRA 1UW9A 1EARA 3NOCA 3DC2A 4ZVPB 1FXRA 4YR3A 3TEGA 1WI6A 2MJNA 3Q0AA 4X66J 3GONA 5D0HA 5D4LA 2C2KB 2PMZD 4LQ3A 3C6UB 2AWZA 1SC1B 3MPWA 3RZAA 5FLXU 1SL1A 2CXCA 2X1BA 4LSLB 4CO3A 1PBAA 5E33A 5DZ7A 4QBUA 1RT3A 3KDNA 3HVRA 1KNZA 1AA1B 2JOQA 1Z2ZA 3A3PB 4DX5A 4PG6A 2GFFA 1F1BB 2V50A 3RAQA 2HHHJ 1HW8A 4OIXA 1NYEA 5KFHA 2YNGB 4IQMA 4KHMA 2C3OA 4GC6A 5C24B 4LFBJ 3TZWA 2H5EA 1NJIT 2HZCA 1Q8IA 1OSCA 5HROA 3DHVA 2V9WA 1TKZA 4DL7A 2AJ0A 2HKEA 3V6HA 4Q8EA 4ANEA 3GCXP 3GR1A 4DF8A 4J9RA 4LF8F 3ZFVA 2DK2A 4RO0A 5ETPA 2CPFA 2FJEB 4JYAJ 4XAKA 3G8TA 4GC7A 2FUG9 3J81D 1UVNA 2R7VA 4QYZK 4WFYA 4HDHA 4O4RA 1UVLA 2PFFB 4B08A 2HZAA 2H54B 5K8PA 1NKEA 1GK8A 3LP1B 4TN2A 3MEGA 5GAGI 5EWGA 4JI1F 2GW8A 1WWHA 3DDIA 3GPAA 2M3DA 1FK9A 5CQGA 2JC0A 4TLRA 2XLIA 4C48A 5DDPC 2MPUA 1IBMF 3VNSA 1RTDA 3OSNA 3CDAA 2XR1A 4JI6C 1NY8A 2YKQA 3OTDA 3MDFA 3OL9A 3H2UB 2D28C 4DL4A 2HFOA 2EXUA 4RU9A 3DOLB 2W01A 2OMLA 4C7QA 3FBBA 3PRDA 1WEYA 4ZCMA 4DG9A 2KJWA 3FBEA 1M5HA 3HSJA 1FD2A 1S6UA 2G2YA 1KFDA 1TH5A 2CQHA 2XQCA 2DGTA 9RUBA 4JB8B 3W2VA 5LCIA 4RW7A 1HQEA 2JRSA 4O0IA 1RDRA 2OBVA 4Y28C 1HQUB 3QT8A 2HVHA 3QIPA 3IS9A 1Q0NA 2V67A 2ZH8A 3WX4A 3E2EA 4K4SA 4NOZA 3ENWA 2IC3A 3NBPA 3QJJA 3BPSP 4G1PA 4FTFA 3UN2A 3HHLB 2EFOA 4AFFA 2DGUA 3OTBA 3W5XA 3LA0A 5F8GA 4IZ6A 1PIEA 2ZITA 1RT4B 4I6WA 4DSEA 4LRDA 3I0SB 2V2ZA 1NHVA 2ZJQQ 1PC5A 2YWBA 1SUQB 3E51A 2CPYA 4FUQA 2A2CA 3FCCA 4CP5A 1FA0A 2AF6A 3BGLA 3MR2A 2QT7A 3SV4A 3NCPA 3CQ3A 2OPQB 3SCIE 3TVYA 3TAQA 1HNZF 3M2UB 1XTZA 1WACA 3PW4A 5KG2A 1I3OB 3F41A 3RW6A 2GAHC 2I8EA 4V19J 3VNRA 3KNGA 3I55S 2CJKA 3L9ZA 3OQ2A 3J7YI 4FKYA 5D0GA 2M2BA 4F02A 1PJ7A 1TL3A 5SZTA 2IVMA 3P45B 2MQ8A 4C11A 2DNZA 3QFWA 2UUTA 4DR6J 1UMJA 4LMZA 1RWVB 2NXCA 5DQIA 2XMMA 1FRHA 2IM2A 4WK3A 4R0EA 3BN7A 2K2PA 1TUGB 3J7AN 1QVFR 1X4BA 3H2LA 2AHOB 2HHQA 4NXMJ 4JI4F 3T5KA 2M5OA 2XGQA 1IKWB 2K1RA 5AXMA 2RH3A 1REVA 4MIWA 3SSSA 3TZZA 3TUPA 4IR9A 3CVKA 3JYTA 2VQEF 1BXNA 4OYXA 3HSDA 3HHNB 4RUAA 1HL6A 1SC6A 2KN4A 1WCJA 1QLNA 4HH1A 1G1XA 2OPRA 1DHMA 5LMNC 4DXLA 5BR8J 2JWNA 4K0BA 5D78A 1U1NA 1S79A 4MKVA 2GHVC 4ES1A 1EB0A 3JTPA 1GT8A 3J80D 2F3JA 3PR4A 2MQPA 4OZ3A 4OHWA 3ITHB 4JV1A 3BR8A 1ROFA 2HMIB 3V5RA 2HBZB 4I7FA 1VR6A 1A7GE 2OO4A 3CD7A 2R8IA 3OL7A 2VDIA 3OL6A 2RRBA 4MFBA 1XC9A 4NLTA 4EUVA 1U47A 2ZH1A 2BJEA 3DXBA 2BQRA 1S1TA 5D3GA 1HA1A 1SXLA 3RV2A 4USIA 4LFCC 2E8EA 1QSLA 1TKDA 3G6VA 3OTEA 3ZC4A 1YZ6A 1RT1B 2J8SA 3ETMA 4LFAJ 4CRJA 2VD3A 1M90T 2M8HA 3X3UA 5J2PA 3R97A 4DCPB 3TA1A 3T3FA 3TAPA 2V68A 2UVUA 1TVRB 4RUHA 3DDNA 3OR2A 1GMWA 4A47A 4B3OA 1DURA 2DNGA 3RG2A 2BE2B 4AT1B 1UJ6A 3CMAS 2WP0C 4ES3A 4G1QA 1YJUA 3A3NB 5FD1A 5IQQA 1K47A 5B0EA 4XPEA 2JC1A 3VGSA 2RQMA 2XMVA 2YCBA 4HR2A 4ENOA 3HZEA 4D3HA 3HT3A 1FDDA 4X4UA 3NI2A 4ZN3A 3EDRB 3VCDA 1H73A 3W3SA 1S57A 4TVAB 1S0NA 3DLEA 3B7WA 3NKYA 2HQFA 2OPLA 4I69A 3C6TA 4KAIA 5DG9A 4OX8A 2QIFA 1YLXA 3K5NA 1UA0A 2AYEA 4K0KC 1U1QA 4RNMA 3N6MA 5CYQB 4G1IA 1VLYA 5IZHA 2R8HA 1RAGB 2ZBPA 4KTTA 3I0RB 4LUBA 1VMBA 4CNYA 2B3TB 4JI0C 5D4NA 5HMWA 5KYTA 5HQ8A 4FBTA 4JBCA 3AQPA 2GMHA 3T5HA 4NCBA 1X5SA 2I1RA 3M9MB 1H72C 5KFVA 4DI6A 1Y5LB 3P4UB 1GMVA 5J2NA 2UV8A 6FDRA 4EBEA 5E3CA 4URSA 3CCUS 4B9LA 1Q78A 1BHNA 3OBIA 1GAOA 3HKWA 4P72A 1ZM4A 4F0HA 1W2BR 5ETKA 4OMFG 3UN5A 2P2FA 2W4CA 2MEWA 5KFGA 1S6PB 2V2QA 1N8RT 2RS8A 4DV2C 5KFIA 3VVTA 3U1LA 2ZZMA 4Y6IA 4ECXA 1HPZB 5IWAJ 1S1WA 2RE1A 4LF4C 2HHPA 2CJXB 3BKFA 4EBCA 4X4VA 2MKCA 2W9BA 4B9MA 3F44A 3KLIA 4K59A 3ZZUA 2IYGA 4IG0A 2HHVA 4N8OA 4IFYA 3DM2A 1KSPA 4RWWA 3MURP 1WF2A 3OJUA 2BANB 3MWBA 3KLFB 1Q16B 2FZCB 4PWWA 4NA1A 4JI7J 1EP4A 3EXCX 4WYWA 2FHJA 1NSKL 1ZM2A 5I3PA 3UQSA 1PO6A 1C0UA 2P2MA 2E44A 3LALA 3N79A 2Y3YA 2MJUA 2PEHA 3THPA 2CZ9A 4ZVTB 3T1HF 1PSDA 5L1IA 4KR0B 1HIYA 2D3O1 4I4BA 2QMUB 2D3ZA 3FC9A 3U7JA 2GGPA 1RAAB 2HFZA 2E1MC 1XRAA 4NRUA 4JV5J 4YUDA 3R5DA 1HNXF 2BOAA 3IBCB 3N9UC 2ZFHA 2R2UA 2HFVA 3V81A 5JXSA 1N36F 4DR4C 4DV6J 4KE5A 3OVAA 4H4KC 4DFKA 2XHWA 1HBNA 1AUSL 3GJQB 1RHUB 1CVJA 3GR0A 3GSIA 3MMAB 1FRJA 3DKDA 3GQCA 3MFHA 3L7UA 2QYCA 3OTOF 1N6QB 3CCSS 1Q1KA 1NRKA 2FB0A 3CW2C 4K7QA 4GO5X 1S9FA 2CPXA 1BWEA 2HGLA 4JP8A 3QT5A 3ISND 2ASJA 3HULA 1WKKA 3E7XA 3CJ2A 1GXLA 4IR7A 2MHEA 3PROC 1DQ8A 5BUQA 4NCGA 4KV8A 1X4GA 4ES2A 3MCSA 2QL9B 4KGZB 1VQSA 1RT6A 2K7JA 2LFVA 1VK3A 1XIQA 2R4FA 2M88A 1NM2A 4NX9A 3THVA 1VRUA 5A8RA 1PJ6A 1Q7YT 4M5HA 2KZ0A 5G4DA 3H5YA 1FNOA 5KG3A 1U1LA 2H9ZA 4WTYA 1HBMB 3AOAA 3RR7A 4DZ6A 1S12A 3KJVB 3HP6A 3KXWA 2LA4A 3NMAA 2KDNA 4FVMA 3CCWA 3QPIA 2ZZTA 1X4CA 4LSNB 1QUPA 2YQ1A 2CJBA 1FRMA 2HQDA 4Q5VA 4U95A 4DR5C 3JAMD 1SQGA 4IKAA 4OI1A 2F4VC 2ZNYA 1SL2A 2ZWOA 2NXEA 2AEMA 1N5VA 2QTWA 1F60B 2IJNA 2QA2A 2QL5B 2OD6A 1UVIA 2EI5A 2B8PA 1YJWS 4ED0A 2B5JA 3MTKA 2CU6A 4TU8A 3FFIA 5KOXA 1NMEB 2GMJA 4C8OA 4P2XA 2LXFA 1GTHA 2IAJA 3FMWA 5KFDA 4RNNA 4YR2A 4CLTA 2W8LA 2V0NA 4WFBQ 1URRA 4E0DA 1ZPWX 2ROPA 2ZH3A 2DH7A 4X64C 5F9LA 4JI8C 1N48A 1R6YA 1T5HX 1TAQA 4QWEA 4CWBA 4O23A 1EETB 4M5KA 2E7XA 3I9ZA 3OLBA 2CQBA 2YH0A 2APOA 4RZRA 1Q79A 2JH3A 1RBAA 2DHXA 3A8KA 2CPEA 3IG1A 3UR0A 1FXLA 1L3SA 1HNWC 2QG9B 4JI5C 4U67Q 2DGSA 3T1YC 2G13A 4F8RA 2KRBA 5HMXA 1P4EA 2XS2A 3A13A 3R5BA 5IT9D 4R8UB 4IG3B 3PEJA 5F8IA 1CS4B 4FF2A 2AZ3A 3DCAA 2FJWA 3MPYA 3NP5A 4CLLA 2RQKA 2F8EX 2JVOA 3TR5A 4DR3J 1YITS 3GIJA 2DY9A 1R8AA 3I5AA 4F3QA 4NYOA 4XIUA 1ZA1B 3S6EA 1KD1T 2UV8G 3O44A 3HJVA 2W7PA 5BSTA 5T41A 2LECA 4NLOA 4O44A 3LPEA 3N0VA 1ZTTA 5KFMA 3HM9A 3GKUA 3FJ2A 1EGAA 1FDAA 4I2QA 1FESA 5LXYA 2P9EA 5EHHA 1FNXH 2GO8A 1ZYQA 4YMEA 1IBKF 3R1LA 4YB5A 1J27A 2KZZA 1RY2A 1EX8A 2V4QA 2DGOA 2NSBA 3ZZPA 4ICLB 3A9UA 2G0IA 5SUHA 3NGTA 3SQGB 4H4OA 4DV0J 3SIPB 3SCKE 1XS3A 3GFZA 4EZ9A 4RW8A 3PY8A 4F3MA 4GVBB 4DU8A 1C0TA 3RJMB 5HN0A 3UCUP 3QLHA 4X2BA 1S5ZA 4TXSA 3B78A 2C28A 2N4CA 2VPWB 2NYIA 1F5BA 3QGIA 4WE1B 3FEZA 4X4NA 4KT0C 1VLOA 2EFGA 1NSPA 2PGCA 3M2VB 4ILRA 4PYAA 3ILJA 4A8YA 1LOUA 5HP1A 3KLHA 5BJRA 4CQ1A 4F4YA 3WX8A 1SIWB 1RWUA 4ED2A 4MYUA 4UUXA 3QYYA 3LNOA 2YKPA 1KRPA 4ZVOB 3H59A 2V63A 3BYPA 4KGMA 2FVSA 4WFNQ 4G3IA 4QIWD 2IYIA 2GVZB 2PE8A 2CQ4A 3KG1A 2E1AA 4ZA1A 3CJ5A 2ZE2A 2VICA 1JLBB 3PW7A 2OPPB 5D4PA 4WV3A 4IYQA 3N54B 2G4BA 5BXIA 1T05A 1TL7A 1VRTA 2AX0A 1FVSA 2QZ8A 2KKHA 1CBKA 1U02A 2RUGA 1CC8A 1N5YB 1IKXA 1YZ7A 1HQ2A 1U6ZA 3AXKA 4H4KA 3NL0A 2Y4NA 1LCIA 3M8ZA 1IM4A 1XNQF 1RT7A 2VBXA 1IUJA 1RAFB 1VC0A 4N77A 4WS9A 1NDKA 3D1HA 2BDPA 4I9FA 2F8HA 5KT3A 3DMJB 4C4WA 2DYJA 3CCES 4LFCF 4HT7A 1DAXA 3MAAB 5KFLA 4PUHA 2UVWA 2ZEJA 4OX9J 1X4EA 1QTNB 2BJ8A 2HHWA 4X62J 4ZHRB 4P10A 2F63A 4ZN1A 3LTOA 5E3RA 3H25A 2NXNA 4FP9A 1U2CA 1X5OA 2WONA 4DV5C 3TJAA 2BJDA 2EFPA 2GA7A 5EX0A 3VR1A 5L9NA 1RUSA 3GB0A 2KVQE 3V6DB 2DCLA 3IMLA 2XYHB 2QLFB 4WP9A 1MU2B 4RLEA 1VQNS 3SFGA 4LBIA 1N4LA 4J9UE 2W4PA 4OZNA 1RBOB 4F0MA 2LQBA 2CNKB 3D68A 4K5SA 5IM0A 3RB4A 1T9YA 2Y1LB 3UE2A 5J1EB 3UD5A 5HMYA 3KLEB 2IBOA 5IOLA 2Z58B 5T8SA 2BXJA 4P74A 3ZZOA 4Q0BB 3CW9A 1NK4A 4EATA 5HJXA 3DOMB 3PFOA 2HRUA 4LR8A 3VAMA 1JLCA 2JLEA 3FVYA 1R8BA 5E0OA 1KQGB 1GX6A 4X65J 4ANCA 3QRQA 3G6XA 1JKHB 2L9NA 4NXMC 4LRBA 4K0KF 2EK6A 1NSQA 1Q8BA 3Q8SB 4QYRA 1MWYA 3CCJS 2RQ4A 2MSSA 2HWHA 3HJFA 3WIVA 4ZP7A 1V5IB 2WAQD 3P8BB 5FLXD 2L41A 4P71A 1RLCL 4JI0F 4GKJF 2H51B 2DHGA 2WOMA 4OV6A 1RK8A 2IJFA 2Y0BB 2P9GA 1DARA 4P7TA 2H1YA 3MCOA 1IN0A 1UKKA 4Q2MA 2MKHA 3V6KA 4QYZJ 1NK6A 4DCJB 1QE1A 3I5CA 3H8YA 4NLRA 1X7VA 2MY8A 1BY9A 2ZH7A 4F3OA 4DUZJ 3IBFB 4FXDA 4OZ2A 2BQUA 2UXCF 4HYKA 2X3GA 3EWGA 3IGNA 1TKXA 3CJQA 3JSYA 2YNHA 4AXJA 2KHDA 2DNYA 3SCLE 1HYSA 3AY0A 3DOKA 3GPCA 1RACB 4LF4F 3PZPA 4ATNA 5L1LA 1BQNB 2V8VA 3BM7A 1YJTA 1YX2A 4JI2J 2R3VA 2EBEA 1RAHB 2HJGA 2ZD1A 3NWRA 6FD1A 5A1GA 1P9YA 1N56A 2AU0A 2YXLA 1WC3A 3N01A 5A6WA 2M5YA 1KVJA 2RUSA 4LFAC 2OFHX 1Y10A 3KLGA 2E9RX 3SMZA 3D7SB 2B7BB 4NZ7A 2ILYA 2EFVA 2WW4A 2P2QA 4FNIA 4RW4A 4KGVB 1XHJA 1T7PA 1D8ZA 4UW2A 2CJAA 3VALA 4I1TA 1RQ0A 2FJVA 4J9MA 2PI4A 1K0TA 1IQZA 4M5NA 5L38A 3EJMA 1WHWA 3A26A 5CD4H 4DG1B 3W7BA 3RB6A 2I0XA 1UVMA 2IRXA 2UUWA 3L7PA 2CQCA 3MM8B 3CE8A 1RAOA 2C2ZB 3DRYA 2VJUA 4UQTA 1K9MT 2XMAA 1JJ2R 2HHSA 1FLOA 1RTIB 1N32F 2VZ9A 3PRVA 2ASBA 1U1KA 3EGNA 2UXBJ 3Q8YA 4CLKA 1VBYA 4EWTA 2XZDB 1VC6A 1RG9A 1KKHA 2QA1A 3MMBB 4C3LA 1QTMA 2I38A 1RKIA 2MZJA 3DI6B 2YWWA 4CTAA 3HVTA 4WZQA 4PWUA 3BSAA 1MN9A 4UT4A 1C2PA 4WXOA 3MI7X 4PCQA 5RUBA 3LP2B 4DZDA 1AT1B 4R1LA 3DN9A 2O1PA 2QV6A 1PYTA 3GV5B 4GMKA 5K14B 4RJVA 3LO3A 4Q8FA 1MDFA 2DEJA 1HR0J 2JSXA 4LVNP 3VTIA 4ZVEA 1TTHB 2UVRA 2LXUA 3K89A 4J5OA 1R6VA 1NK5A 1B7FA 3G71S 2CKWA 1LV5A 2H4YB 2DPIA 2R8KA 1E6VA 2GHWA 3DAYA 1KOOA 1SKWA 4XO0A 5HSPA 3J7A1 1D9FA 2LEAA 1PYSB 3C16B 1WH9A 5DS7A 1YDLA 2GVDB 2PROA 3B54A 2FVRA 3C14A 5KT6A 1XMOJ 2KZMA 4N56A 2DNKA 1RBLA 3D6MB 1U25A 4RPFA 4LIWA 3AF6A 3K8VA 1P8GA 1S1UA 5C2GA 3K8WA 5KFZA 5MLCV 1LNQA 4DR5F 1NZ8A 2CWKA 5A8KA 2IBKA 1SH3A 2KT2A 2Z0GA 2MM9A 3Q2SC 3GWCA 5THWA 5HROB 2N82B 1TKZB 2XGPA 2FDNA 4QIGA 3OUYA 4U6PA 2JVRA 2YKNA 1H3DA 3F0NA 3TOQA 1C1BA 3BZQA 2ZOMA 1GH8A 4ECSA 4LREA 2M70A 1UL3A 2WZ1A 1JX4A 2DH8A 1HFEL 4L75A 1YTYA 4M63A 4WK1A 3D4JA 2ZH2A 4X4PA 2HAIA 2XNQA 2BKOA 4TY8A 2VL1A 4KBIA 3BB5A 1HNIA 5J1PA 3H7HB 2E7VA 4Y0FA 3MEGB 1WSRA 4NCAA 3L3CA 2PA3A 5ADZA 2MQMA 4ZPCA 2D9OA 5DM6Q 1NPPA 3CJ4A 1ZETA 2HBQB 2AKWB 1H7XA 4PAAA 1FK9B 1P1LA 1UJ5A 1PU1A 4JV5C 2R8GA 2JFDA 1HD0A 4PPDA 4CZCA 1ELOA 4BDPA 3ET6B 5HVGA 1H98A 3I6PA 3NCRA 1RTDB 1AZSA 1S1XA 3UEBA 2XY5A 4LF1A 2G2OA 4DV6C 5B09A 1TFWA 4DR1C 1RU2A 5ETTA 3GP9A 2HNDB 3DLKA 3VAIA 4E2FB 3DRPA 3R5GA 3PW5A 2DNLA 1Q82T 1EKRA 5CCLA 4JI5F 2MKYA 3HDSA 6AT1B 3NWGA 1O93A 3IRXA 4KO0B 4R0JA 2R2TA 4HL9A 3G4SS 2BZ2A 1LQ9A 3HHLC 1UZHA 3CEDA 3C66A 3EICA 4ZDNA 2VONA 4M95A 4DCOB 1VQYA 3LNVA 4I6YA 4FPIA 2B51A 3W2VB 1LXJA 4RW7B 1HQEB 4MTNA 2B0GA 4CYUA 3NGUA 2HWIA 3AA8A 4X66F 5I4MA 1X9MA 2VKRA 3E3XA 3IS9B 4IOAQ 2QSWA 1U2RA 1S7HA 1WOSA 3TP2A 2X51A 3TVZA 5C42B 3SI8A 4DU7A 3BSCA 5CD4A 3M8WA 2MGZA 4LRAA 4C6AA 4D4GA 1AW0A 3NBPB 5EN1A 4FYVB 1FI4A 4N47A 3F73A 2ZOFA 4MIBA 1YJNS 1QM9A 2KT5A 4AE5A 2BJ7A 2EWHA 2HHHF 2QJ3A 4M5GA 3OFGA 5I42A 4NLGA 4Q45A 1XMBA 1APSA 2P02A 1VFJA 3IA0A 3LANA 3UX3A 4LFBF 1N0UA 4AXIA 2G1DA 2YX7A 1TL4A 1YBUA 2RF2A 3JQKA 1EKSA 1LFWA 5KG1A 2J9DE 2YBVA 5KAKA 3ZTQA 2DNHA 4XPCA 2D1QA 1ULTA 3EGZA 4M5DA 2DGXA 3W8GA
chains in the Genus database with same CATH topology
4G37A 2VZEA 1QM4A 4RLQA 3NPDA 1XRAA 3PESA 2D27A 2AYAA 4LF8C 4PROC 2ONFA 1N36C 1N33C 4JI4C 2ATWA 3TQIA 3S82A 4DR4C 3AF5A 3CJEA 5BURA 4BC7A 1LQLA 2BH1X 3GR0A 5BSRA 3LAXA 5IWAC 3A9VA 3OTOC 4BCAA 2ASBA 3EQ6A 1O90A 5KYVA 2PT7G 1XMQC 3PBKA 4NXNC 4YHHC 1RG9A 5GTDA 1V26A 5K8FA 2E7GA 1N34C 4GXQA 3I07A 2Y4OA 1QWIA 5LMNC 4GKKC 4JI7C 5CZVA 3NYRA 4D56A 1IBMC 1J5EC 3E7XA 4K0BA 3G7SA 3IEUA 3ETCA 1T5DX 4IR7A 4BBYA 3PROC 5BUQA 4WV3A 4R1LA 3L8CA 3N54B 3J80D 3TUFA 2CXCA 2UUCC 1MDFA 4RLFA 3NYQA 3CW8X 4DV1C 3UZ0A 2OO4A 3E7WA 4DR6C 2D1TA 4OXIA 4TPSB 2Y4NA 1LCIA 4L4QA 1PG3A 5BSVA 2CY1A 1NYEA 1N2FA 4FUTA 5K85A 1KKGA 4WS9A 4I9GA 3TDEA 3RV2A 4LFCC 4I9FA 3C5EA 4XX2A 2E8EA 2DYJA 3DAYA 3I08A 2UUBC 1L2FA 5BUSA 3DHVA 4B3TC 4GKJC 3SO4A 3KXWA 1WH9A 2ZM6C 2PROA 4DR3C 4DUZC 3GR1A 3H2TA 4DUYC 5T8TA 2EGTA 1O9TA 4RVOA 4DG8A 5KEIA 1PA4A 2UXBC 1O92A 3AF6A 4DR5C 1YJ7A 3JAMD 3J81D 4DV5C 5H9UA 4ODJA 4AQYC 3VNQA 2F4VC 1MXAA 4L7IA 3RG2A 1XNRC 4OYCA 2YWCA 4JI1C 5BR8C 2WD9A 2UXCC 2WP0C 2UUAC 4X66C 4JI2C 3ETOA 3IMLA 2P2JA 1BA3A 4JM1A 4R0MA 3UOWA 3A4IA 4G36A 2D1SA 5AE1A 2QVXX 2V7BA 2YCBA 4HPVA 3VNSA 2XR1A 4JI6C 4DV0C 4YY3C 2PN2A 1MKYA 3LUSA 1HH2P 4LE5A 3NI2A 4LF5C 1XRBA 5T8SA 4GXRA 1ML8A 2D28C 2HHHC 4B3SC 4ZJZA 1HNZC 1IBKC 3DLPX 1MXCA 3CW9A 5ADZA 4X64C 3B7WA 4JI8C 5CZXA 4EATA 4B3RC 1MXBA 2OPLA 1T5HX 4LFBC 1FJGC 5A19A 4DV3C 5LMUC 2D7VA 4DG9A 1V25A 4JV5C 4DCUA 4RM3A 4OX9C 1IBLC 4K0KC 4R1MA 1WF3A 4BC9A 3FCEA 4RM2A 4G1IA 4NXMC 1XMOC 5DV9A 2Y27A 4DV6C 4KTTA 4DR1C 1USPA 4D57A 3T1HC 4ZLPA 4JYAC 4JI0C 5FLXD 5KYTA 2OBVA 1HNWC 4JI5C 4D4IA 1I94C 4LF9C 3T1YC 1PG4A 2OPLB 2MKYA 1HNXC 2QVYX 5IT9D 1O93A 4DCSA 1XRCA 1UKKA 1VLAA 5E7QA 4NOZA 1MD9A 2E0GA 2E8FA 4FTFA 2BJOA 5JRHA 3R44A 2E5LC 4L2ZA 2VQFC 2QW0X 2P2BA 5BSUA 3LNVA 1USPB 2P20A 4BSZA 1N32C 4IZ6A 1MDBA 4MTNA 4LF7C 3LGXA 2P2FA 2UXDC 5A1IA 4U5YD 4KHPC 1K0RA 4ISBA 4DR2C 5AE3A 4KTVA 2VQEC 2YWBA 4DCVA 4DCTA 3IEVA 4PZPA 4DV2C 2VSQA 5BSTA 4RVNA 4FUQA 3FCCA 3EERA 3N2QA 4LF4C 1HR0C 4D4GA 3GPCA 2QVZX 2KZFA 3R9XA 3GKUA 4GS5A 5IFIA 4LF6C 1EGAA 2E8CA 2D1RA 5BSMA 4DV7C 1AMUA 4X65C 2QL8A 2HJGA 2P02A 1JOSA 2JMPA 5A1GA 1RY2A 2UU9C 3R9WA 1ZB8A 1FUGA 4DR7C 4PHTA 4B3MC 4LFAC 3VNRA 3L95X 4RMNA 3IPLA 3A9UA 4X62C 4JI3C 4MH4A 2P2MA 1P7LA 1XNQC 4NDNA 4DV4C 2D1QA 1ZB9A 5A2QD 2P2QA 1GPMA 1ULTA 5AE2A 2DPLA 5BSWA 4W4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G37 A;  2VZE A;  4G36 A;  2D1S A;  5JRH A;  3R44 A;  1MDF A;  4RLQ A;  2QVX X;  4RLF A;  2QW0 X;  3NYQ A;  2P2B A;  2V7B A;  3CW8 X;  5BSU A;  3LNV A;  2P20 A;  3E7W A;  2D1T A;  3VNS A;  4IZ6 A;  4OXI A;  1MDB A;  2Y4N A;  3LGX A;  1LCI A;  2P2F A;  1PG3 A;  4U5Y D;  5BSV A;  3NI2 A;  4ISB A;  4GXR A;  4FUT A;  5K85 A;  4ZJZ A;  3DLP X;  4PZP A;  3CW9 A;  2VSQ A;  5BST A;  3B7W A;  3C5E A;  4RVN A;  5BUR A;  4FUQ A;  4EAT A;  3DAY A;  3FCC A;  1T5H X;  5BUS A;  4D4G A;  5BSR A;  4DG9 A;  3GPC A;  3LAX A;  3DHV A;  2QVZ X;  3A9V A;  3KXW A;  4RM3 A;  4GS5 A;  5IFI A;  3EQ6 A;  2D1R A;  5BSM A;  4R1M A;  1AMU A;  5KYV A;  3FCE A;  4RM2 A;  4RVO A;  5DV9 A;  3PBK A;  2Y27 A;  4DG8 A;  5KEI A;  5GTD A;  5K8F A;  1RY2 A;  1YJ7 A;  4D57 A;  4GXQ A;  2Y4O A;  5KYT A;  3VNQ A;  3VNR A;  3RG2 A;  4RMN A;  3NYR A;  4D4I A;  3IPL A;  4D56 A;  3E7X A;  3A9U A;  1PG4 A;  3G7S A;  2MKY A;  4OYC A;  3ETC A;  2P2M A;  2WD9 A;  1T5D X;  2QVY X;  4IR7 A;  2D1Q A;  5BUQ A;  2P2Q A;  4WV3 A;  4R1L A;  1ULT A;  3L8C A;  5E7Q A;  2P2J A;  1BA3 A;  5BSW A;  4W4M A;  1MD9 A;  4R0M A; 
#chains in the Genus database with same CATH topology
 1X4F A;  4JYA F;  1ARO P;  3GIM A;  2Q79 A;  3M8Y A;  1TAU A;  3S7R A;  3BGF A;  1VBK A;  3S1T A;  2ZBR A;  2JL9 A;  2IHR 1;  2AZ1 A;  3TAN A;  1FKO A;  4LF8 C;  4WIQ A;  3M1V A;  4CLS A;  4EYH B;  2W25 A;  4CLP A;  3AF5 A;  2JLF A;  1U0S A;  2C2N A;  2P9C A;  3Q8V A;  1EIY B;  2VQF F;  2N7Y A;  1FRL A;  3G6E S;  3AAW B;  1TL3 B;  4C11 B;  1KQK A;  4RW6 B;  1BUX A;  2V94 A;  3V4I A;  3CDE A;  2JEG A;  3THT A;  1JJC B;  2F9J A;  5HK4 A;  3P6Y C;  3MM5 A;  3PEH A;  2XMK A;  4PPZ A;  3H5X A;  2XNR A;  2OKQ A;  1WC4 A;  4J9Q A;  1IBM C;  3TX0 A;  2DO0 A;  1M6X C;  4P2F A;  2Y1J A;  3M7V A;  1QAX A;  4BBY A;  2CAD A;  4LR7 A;  1REV B;  5K9F A;  3ZTS A;  4PR6 A;  3M8P A;  3JYT B;  3KHH A;  2NRE A;  3NYQ A;  3UZ0 A;  4RBV A;  1SVD A;  3HHL D;  2ZUG A;  2HEK A;  1CUL A;  4DF4 A;  1N88 A;  1DTQ A;  4FUT A;  4UOH A;  1UFW A;  1K0V A;  2BVZ A;  3PYG A;  2WSE C;  4K4Y A;  4DX6 A;  1TV6 A;  2JEF A;  4L6V 3;  1FJG J;  4XX2 A;  1M1G A;  4ZP6 A;  5EDW A;  2YPY A;  4WFA Q;  5LOQ A;  3QT6 A;  4DS5 A;  2XMT A;  5KFW A;  2V2K A;  2A6O A;  1AB8 A;  3G82 A;  2MQQ A;  3V2U C;  2IVF B;  4ZVF A;  2Z30 B;  2JEI A;  5U47 A;  5CAB A;  4DR3 C;  4M5L A;  5DJB A;  4IRK A;  1H0H B;  4MYT A;  2YNI A;  3MMC A;  4DV4 J;  2BJ1 A;  1O9T A;  1DLO A;  1HHT P;  5F3T A;  4MFB B;  4AND A;  5LT5 A;  4IRC A;  4EFA C;  1O92 A;  3EVM A;  1BLU A;  2BM1 A;  1S1T B;  3M8S A;  5D3G B;  5H9U A;  2GAG C;  2R7U A;  1NEE A;  4ZLJ A;  4K50 A;  3C6U A;  5DLG A;  3TO8 A;  3C8Y A;  4C8Z A;  3M9N B;  3KFW X;  1XK8 A;  3B4M A;  4LSL A;  5DM7 Q;  3ZZY A;  1UEV A;  3HT0 A;  1N33 J;  1JXL A;  2DIS A;  3EGW B;  4QIF A;  1RA6 A;  1B0V A;  2F65 A;  3M8Q A;  2EVZ A;  2DR8 A;  4G36 A;  4KQZ A;  2KL8 A;  1NHU A;  1NUE A;  3OR2 B;  2AQ4 A;  5CAA A;  4UOC A;  4B3O B;  1NSA A;  4KJI A;  4DV0 C;  2OP5 A;  2P6T A;  2KHC A;  1WC6 A;  3LUS A;  4DLE A;  2IDE A;  4J9K A;  1RTH A;  4ZPD A;  3RBE A;  2CYY A;  1HNZ C;  2O01 C;  3DLP X;  2V4J B;  1S10 A;  4ID8 A;  3GMG A;  4G1Q B;  2C2D A;  2XBP A;  5DQH A;  1S6Q B;  1V25 A;  1F3F A;  4DR6 F;  4IRD A;  1ITP A;  1MSW D;  5KG7 A;  1WOP A;  4RM3 A;  2NUU G;  3VF0 B;  4RM2 A;  3MM6 A;  1RAI B;  4U8Y A;  2UU9 J;  2KYZ A;  3BJY A;  3H90 A;  4NXM F;  4CT9 A;  2FLO A;  1UEK A;  2KXH A;  2GX8 A;  2HPU A;  5KFF A;  3EZ5 A;  1SJ1 A;  2W2N P;  2DVI A;  2NPI A;  3DLE B;  1UW4 A;  5DDQ C;  2OI2 A;  2OPL B;  3C6T B;  5A8W A;  2ASL A;  3EDQ B;  5GAH I;  5HQM A;  5HL7 Q;  2ACY A;  2B4V A;  1MD9 A;  4P52 A;  2CPH A;  3EVW A;  3WHI A;  5KTQ A;  3R44 A;  4H54 A;  1Q95 G;  1F9H A;  2P20 A;  4M1K A;  3PYD A;  1AUD A;  3HZG A;  3IP0 A;  1UWB A;  4KGX B;  4Y2A A;  5HJY A;  5BR8 F;  2YY3 A;  3MPD A;  2VQE C;  2GIF A;  3MMJ A;  3R9L A;  4DCV A;  2RKI A;  1CQM A;  4HI2 A;  1QAY A;  2EBG A;  2DNN A;  4ID5 A;  4PYD A;  1RT5 A;  1RI7 A;  4TU7 A;  2XY7 A;  5AXN A;  5ETM A;  4XDC A;  1U26 A;  2CZV C;  1HWK A;  4NXN J;  1U6F A;  1HI1 A;  1AYE A;  2VDH A;  3R6L B;  3QT7 A;  3CDU A;  3MPU B;  2DIU A;  1ZTW A;  4IH6 A;  3AD8 C;  1OO0 B;  4LFA F;  4C0B A;  4X62 C;  1S1W B;  1VQL S;  4LRF A;  3ZZZ A;  4KTQ A;  3J81 j;  2M7S A;  2W7O A;  3QRP A;  8AT1 B;  2KYX A;  5DET A;  4KY3 A;  3WZ0 A;  2W9B B;  2QYG A;  5ETL A;  4FYW B;  3MZI A;  2OEJ A;  4ECW A;  3CJ0 A;  3KLI B;  4PG5 A;  2FVP A;  4G65 A;  1F9E B;  4B3R J;  1RT4 A;  1QM4 A;  4IG0 B;  4IFY B;  3DM2 B;  4QR0 A;  5L9X A;  4Z37 A;  3I31 A;  1UCN A;  1EP4 B;  4C8N A;  1WKJ A;  2GIR A;  5H9F K;  2K7K A;  2DB1 A;  4URG A;  5K8O A;  2ZBI A;  1C0U B;  1BE4 A;  2ZHO A;  4OHZ A;  2QX0 A;  2ATC B;  2VG7 A;  2JNV A;  4ZPW R;  1XQI A;  3NXZ A;  2HVI A;  3BSN A;  1Q5V A;  2GQQ A;  2O66 A;  2Q66 A;  2LQ8 A;  3V4M A;  3NGD A;  2GGP B;  3I4H X;  4BHQ A;  3QQC D;  5F3Z A;  1X60 A;  3UD3 P;  3PBK A;  2KJV A;  4X4O A;  1UFL A;  2ACM A;  1C1C A;  4YB1 P;  3MED A;  3W65 A;  4ZJO A;  4D56 A;  5F8H A;  1HBN B;  2K3I A;  2HYI B;  3HSZ A;  4B9T A;  5F9N A;  1NCL A;  3DHW C;  3TUI C;  2RSQ A;  1IB8 A;  4NE9 C;  3BQ0 A;  1JLF A;  1CJT A;  1N5T A;  2CY1 A;  3EYZ A;  3R3T A;  4G6V B;  1W7W A;  3A8I A;  5AJ3 J;  2QLB B;  4CLU A;  1OPI A;  4GRS A;  2LQJ A;  4NCG B;  2ATL A;  4KV8 B;  3LWM A;  5HBM A;  4ZS6 A;  2BR0 A;  3E01 A;  1GXU A;  5GMD A;  4DUZ C;  1RT6 B;  3IFE A;  4UUW A;  1TUW A;  1FKP B;  4YB6 A;  3NS5 A;  3PYF A;  1VYA A;  2WVE A;  1UVK A;  4NLY A;  2CPI A;  5A8R B;  5KEI A;  1JB0 C;  3G96 A;  3KJN B;  1T9T A;  2LCW A;  2GML A;  2EC2 A;  3TQE A;  2XLJ A;  3E8O A;  1MXA A;  5IWA F;  3FNN A;  4OYM A;  2ADC A;  2YKM A;  2EG2 A;  3KJF B;  3QAT A;  3RW7 A;  4UZB A;  1MLA A;  2HMI A;  4C3M A;  1XBW A;  2WBM A;  1AFI A;  1U48 A;  1U45 A;  3LGN A;  3BGU A;  4MTP A;  2VJV A;  4JI2 C;  3U27 A;  4NWB A;  4NA3 A;  4A48 A;  1WF0 A;  4QPX A;  1BA3 A;  4JM1 A;  2C2O B;  4NEY A;  2OLW A;  3PW2 A;  3R6G B;  2EKY A;  4YB7 A;  1KBR A;  4JI7 F;  3Q8U A;  4LF7 J;  2LYV A;  4RUB A;  4KHP J;  1MKY A;  4DN9 A;  2AGO A;  1AXQ A;  2RB7 A;  3LF0 A;  1NND A;  2WVD A;  4WFZ A;  1NH8 A;  2M9K A;  2OIH A;  1KN6 A;  5CZX A;  1PAU B;  1B4S A;  2B5J B;  5T7L A;  3HVW A;  2VFS A;  1U1R A;  4IH7 A;  3FFI B;  4GKK J;  2CQ2 A;  2WSC C;  4NLP A;  4RW9 A;  1J5E J;  3K59 A;  2RRN A;  4JV5 F;  4QIE A;  1FTC A;  2IAJ B;  4KFB B;  3T9N A;  1SV5 A;  3JQM A;  1D9D A;  3T1H C;  4DV6 F;  1SBR A;  1KWM A;  1HBO B;  3GE9 A;  2NXJ A;  2K3K A;  2SXL A;  1S72 S;  2VA2 A;  1HNX C;  4N5S A;  1XRC A;  3ZO7 A;  3CXC R;  5HMZ A;  2B43 A;  3FEX B;  4OV1 A;  4FVC A;  1VHF A;  5F0W A;  3ILL A;  3IG1 B;  2P2B A;  3PX0 A;  1B0P A;  2OJ3 A;  1PC4 A;  1VQO S;  2RT3 A;  2DRB A;  1FD8 A;  2CDR B;  2CIM A;  1T9V A;  3EM1 A;  4DUY J;  4ISB A;  5MAO A;  3DRX A;  1VQ6 S;  3H2V E;  2YNF A;  3FEY B;  2HAF A;  1F9F A;  1HR0 C;  2QLX A;  1UP1 A;  1RXO B;  3JTO A;  2NPF A;  3POT A;  2FHM A;  2D1R A;  4NLX A;  4U96 A;  1RWX B;  1QSS A;  1TZ0 A;  2BAC A;  1ZM3 A;  2W9C A;  3KWM A;  2KFY A;  4ZP9 A;  3DDK A;  2PMH A;  4DL2 A;  3OR1 B;  2XMW A;  5CA5 A;  3D54 A;  1OWX A;  4O44 B;  1LWE A;  3SFU A;  1ACM B;  2HQG A;  3OFF A;  3QO9 A;  2OPS A;  3R5C A;  3PM9 A;  4I2Q B;  2MQO A;  3W64 A;  1KC8 T;  3TWZ A;  5E41 A;  3NPD A;  2N3O A;  3GFY A;  1U7L A;  1RTJ A;  2PT0 A;  3CGI A;  3IM9 A;  2B9X A;  4IFV A;  1WF1 A;  4H4O B;  2WSF C;  1H38 A;  3PO5 A;  1BMQ B;  5JJB A;  3PJ9 A;  1B0T A;  3CIM A;  3T5J A;  4RW8 B;  2HHX A;  5BSR A;  1C0T B;  1YIJ S;  4BCA A;  3FZ2 A;  3QLH B;  4ZVQ B;  2Y8W A;  1W25 A;  3KLF A;  1U6B A;  5KYV A;  2WB1 D;  4LQ9 A;  2Z4P A;  1IKY A;  3PX4 A;  1RT2 B;  1TKT A;  3I07 A;  1QWI A;  2VQF J;  3CJK A;  3NYR A;  4DOZ A;  1IWA A;  3O1L A;  2HZV A;  5HI7 A;  4OL8 A;  3UCZ P;  1B64 A;  5HP1 B;  3KLH B;  3BPD A;  2XHC A;  5FDL A;  4B9S A;  5DZ6 A;  4UY8 5;  4O4G B;  1QJH A;  2CNN B;  2WTF A;  2PN6 A;  4IOB A;  5KOW A;  1CJK A;  5KG6 A;  3PX6 A;  3R27 A;  3OSP A;  1VQM S;  1JK9 B;  4JI6 J;  3E7W A;  3MAH A;  3NGK A;  3K7R A;  3L09 A;  2ZKU A;  4CNZ A;  2GHP A;  1QDU B;  1F2G A;  2ZE2 B;  1XR7 A;  3ICL A;  3D0G E;  3MMA A;  3D67 A;  2J0Q D;  2XCP A;  2YWG A;  4F67 A;  3I08 A;  3NEK A;  4KIA A;  2CNO B;  4J9O A;  3A8J A;  5BUS A;  3MF5 A;  1KHV A;  1T05 B;  1TL7 B;  3FBC A;  3MUV P;  2VV5 A;  4ZJQ A;  3H2T A;  1IKX B;  4DR3 F;  4HHU A;  3IC1 A;  3FK4 A;  3PVX A;  4HI1 A;  3JSM A;  3ENV A;  2XMU A;  3ZTO A;  1JNR B;  1RT7 B;  1F0X A;  3IR6 B;  1TR0 A;  4U7U D;  3BV8 A;  4RBU A;  4OI4 A;  3RAX A;  3FBF A;  3MEC B;  2NR0 A;  1TU0 B;  2DJW A;  4WYL A;  2YWC A;  2FQQ B;  3L7O A;  4C0O C;  3IGV A;  1VI7 A;  3ETO A;  4DDF A;  3L4B C;  2QFJ A;  2Z56 B;  2C3U A;  2D69 A;  2KXN B;  5F41 A;  3AB2 B;  2MKK A;  2FY8 A;  3DLG B;  3I87 A;  3BKT A;  5FLX Y;  2XTJ P;  2ZH5 A;  2PFD A;  4DV0 F;  3FRY A;  5C7P A;  2Q43 A;  1IBK C;  3SDE A;  3HFZ B;  1B70 B;  2CJQ A;  2X1A A;  4HVZ A;  2DNM A;  3IO1 A;  1GEH A;  4OZJ A;  2J6T A;  1DRZ A;  2KFN A;  4F4Z A;  1ZAX A;  3VAH A;  3P5T L;  2CQ3 A;  2LQ9 A;  3GSD A;  2XSJ A;  5IM0 B;  2GS8 A;  2FGO A;  1USP A;  5I3U A;  4F0K A;  2X7I A;  2C3Y A;  5HQL A;  5EWE A;  5IS2 A;  3ZZT A;  4PEO A;  3AJD A;  2B4P A;  1PG5 B;  1D3W A;  3FMB A;  2ZOG A;  2HQC A;  2F40 A;  1JLC B;  5JMN A;  3I82 A;  1WC1 A;  3PJX A;  1OY9 A;  1G7C B;  2HBY B;  4MJK A;  2E0G A;  2DR7 A;  3LWL A;  3W8P A;  4OI2 A;  3K2Y A;  1WHX A;  4BSZ A;  3NAH A;  1XER A;  3KK2 A;  2GQ2 A;  4K4V A;  3H5S A;  2WOM B;  4KTV A;  3IAM 9;  4M5I A;  2VOD A;  4QWA A;  2CJ9 A;  2NQP A;  3HD2 A;  3BR9 A;  4PG7 A;  2L9D A;  2XUL A;  4ZKA A;  3CT9 A;  5E2Q A;  2PSZ A;  2DIV A;  1SJQ A;  1QE1 B;  5IFI A;  2ZHA A;  5BSM A;  2E5J A;  3D66 A;  1H2T Z;  2FYX A;  2DEI A;  2RIJ A;  2AD9 A;  5J2Q A;  4B9U A;  5LMN J;  1DJ0 A;  2GJ2 A;  5KT7 A;  1ZM9 A;  3GFX A;  1IKV A;  4R8U A;  1TKX B;  2YNH B;  4CDI A;  4RMN A;  2CQ1 A;  1UPP A;  3IPL A;  4O3Q A;  1IWG A;  1HYS B;  3NRB A;  4OX9 F;  1HBU B;  4P7V A;  1XNQ C;  4DV4 C;  4X62 F;  3A12 A;  3UVJ A;  4TYA A;  4N8N A;  2GIQ A;  4G37 A;  2HNZ A;  2BYC A;  1Q81 T;  1M5K C;  3KNA A;  4Y65 A;  2Y1I A;  4WCE Q;  5K8M A;  2OTL S;  1ZZF A;  2VKZ G;  1NJX A;  2HS4 A;  3GU0 A;  2VPX B;  2LP4 A;  1N33 C;  5CYM B;  4I68 A;  3KLG B;  2DH9 A;  2C3M A;  4Q7A A;  1X0F A;  1VRQ C;  2IA0 A;  2QA4 S;  2R7O A;  1S1V A;  1NK8 A;  2VFU A;  2PEB A;  5KFO A;  3Q8R B;  4ZOS A;  1VK8 A;  1HHS A;  1I94 J;  1UAW A;  1U1O A;  1CJV A;  3CIZ A;  4URQ U;  5DO2 A;  3CCQ S;  2AT1 B;  4OHY A;  2AEJ A;  3TX8 A;  3SQG A;  2J7U A;  1ZPV A;  4ZLN A;  2KM8 B;  2GJI A;  4CLW A;  1HWJ A;  3RBX A;  4K4W A;  3HXM A;  4PXD A;  2OEL A;  4K5R A;  4DR2 J;  3CCT A;  4X65 F;  3OW2 R;  4OHV A;  4WBF A;  4KPC A;  2DRA A;  4JV2 A;  2MKI A;  1RYS A;  3LPY A;  2BEF A;  4C0H A;  4DQQ A;  1R8C A;  4OYP A;  4WZM A;  1JNZ B;  4CTA B;  1Y9O A;  2BKP A;  2F7V A;  3UD4 P;  3HVT B;  4F36 A;  2CJY B;  5K85 A;  2KXF A;  2J9E A;  4DSJ A;  4CLY A;  4N41 A;  3VZH A;  2XLK A;  4Y3C A;  3H98 A;  4AD6 A;  2JFK A;  3RUB L;  4YDX A;  3Q8Q B;  1RHM B;  2N7C A;  4B3M J;  3RBD A;  4GKJ C;  1FO1 A;  2CZ4 A;  4KSE B;  1RWK B;  4DUZ F;  1RAE B;  3TAM A;  4IUF A;  3PAC A;  3OPK A;  4HEA 9;  4O3R A;  3F56 A;  1T02 A;  1E6V B;  1BQX A;  2BRL A;  3W61 A;  4PKD B;  4OYC A;  2VOP A;  1EAY C;  4EO6 A;  2AJQ A;  2UXC C;  2V2V A;  2DRD A;  3O8W A;  1TMJ A;  3C14 B;  4JI2 F;  1R0B G;  2X3D A;  3R1H A;  4R0M A;  4K4T A;  3A4I A;  4WWS A;  5AE1 A;  2OTJ S;  1LW2 A;  3K5O A;  1YI2 S;  5D8H B;  5B7W A;  4Y2K A;  1FFS B;  4O3O A;  4RNH A;  3V6J A;  5A8K B;  1U8W A;  1V5V A;  2VPZ B;  3CC7 S;  3IWN C;  1XRB A;  3ZNU A;  1ML8 A;  4DV2 J;  4EMD A;  3C15 A;  3OVS A;  2D7S A;  4B3R C;  2A18 A;  2LXI A;  3OUY B;  2QLW A;  2YKN B;  1C1B B;  2YKA A;  4UOF A;  4LBP A;  2LU2 A;  1RCO B;  2I9S A;  2C3P A;  4C8Y A;  3DGP A;  4UZC A;  1HNV A;  3TQ1 A;  1VBZ A;  2HUR A;  2PI5 A;  3ELH A;  1OYD A;  4TY8 B;  2LDI A;  3PKM A;  1HNI B;  4YDD B;  2HRT A;  1Q8K A;  4OLO A;  4D4I A;  1B3T A;  4D3G A;  2A2D A;  4XTT A;  1L3K A;  2V4R A;  2EFN A;  3I4P A;  2KRR A;  2Q1L A;  4KYZ A;  2UXB F;  3RU0 A;  5J1E A;  1AZS B;  3PR5 B;  3PNI A;  4CCH A;  1S1X B;  2VC0 A;  2BJO A;  1JLQ A;  2MXY A;  2Z2Z A;  3ILI A;  1LW0 A;  4ETX A;  5IV4 A;  2OUG A;  1N32 C;  2RRA A;  3A1Y G;  3DLK B;  2J5A A;  3EPI A;  3LGX A;  3GJT B;  3DRP B;  2KG0 A;  2RD5 C;  4K4Z A;  2FTR A;  3DOM A;  4DR4 J;  2XYG B;  2MMA B;  1Q4R A;  4KC5 A;  3IEV A;  3OTC A;  1YRT A;  5KFC A;  2WB4 A;  3H0P A;  3IRX B;  1QSY A;  2DXE A;  1K44 A;  2QO3 A;  5KT4 A;  5EUH A;  2KO1 A;  3TR3 A;  1LWC B;  1NHK L;  4V1A k;  2VU5 A;  3MCN A;  3VGU A;  1M5S A;  4U7C A;  1HR0 F;  4YY3 F;  2I6W A;  4TQR A;  2HLU A;  1UVJ A;  1YBT A;  2QGF B;  3M2R B;  2CPD A;  5BYQ A;  4LF2 A;  3AH6 A;  1VQ5 S;  4BWM A;  4CYU B;  3LQV A;  3T1A A;  4ECU A;  4I64 A;  4ETZ A;  4FBU A;  5HAT A;  4HAC A;  2IJR A;  3BGR A;  3M05 A;  2RVJ A;  1AFJ A;  2CA9 A;  3GYG A;  2DR6 A;  2MGZ B;  4MH4 A;  1XR6 A;  1GX5 A;  1XMO F;  4LF5 J;  1VC5 A;  1GPM A;  4B3S J;  3MR6 A;  1UPM B;  4W4M A;  3BSO A;  1ZAV A;  2ZNZ A;  5I42 B;  2OSR A;  2JDJ A;  4DV3 J;  4OFZ A;  3FSI A;  4NI2 A;  5DG8 A;  2CPZ A;  1Z2L A;  1IBL J;  3PJW A;  5CH7 B;  1PYO B;  1BGX T;  1PBU A;  3LAK A;  4J37 A;  3LP0 A;  2C2E A;  2VC1 A;  1Y0H A;  4DLG A;  4AYB D;  3D28 A;  1KVK A;  2B6A B;  2OSQ A;  3LAX A;  1HHQ A;  1Z4U A;  3DXS X;  1FJE B;  4I6A A;  1HKA A;  2EEY A;  4UY8 T;  2XM3 A;  3OL8 A;  1FKO B;  4YOE A;  4OJG A;  2F4V J;  3RB0 A;  3M1V B;  3VQS A;  1GXT A;  4HHH A;  4GKK C;  3O3L A;  3N5F A;  1BWV A;  5GAD I;  4L3N A;  3ILO A;  1J5E C;  2UXD J;  2VFT A;  1KR4 A;  1HWU A;  4ZCL A;  1GTE A;  3LUY A;  3JSB A;  1KON A;  3V4I B;  3CD5 A;  4NOH A;  3L8C A;  4CT8 A;  3B6B A;  2DNR A;  4OZ1 A;  1FJ7 A;  4HTI A;  3ADA C;  3MM5 B;  3PHE A;  1O5J A;  3FQK A;  4K8R A;  5B0D A;  4ELT A;  4L4Q A;  4LF6 J;  4J9N A;  4PAB A;  4F4K A;  3HFV A;  3GLJ A;  3JB9 k;  1RTI A;  4CI0 B;  4X64 J;  1VQ9 S;  2Q3P A;  4J9P A;  2ZJP Q;  4JI8 J;  3TDE A;  2QLJ B;  1MG7 A;  2QN6 B;  1T0T V;  1YWX A;  2IM0 A;  2RQC A;  3HLU A;  3KUH A;  1U1M A;  4HLB A;  4B9V A;  2QL7 B;  2FY1 A;  4DUY C;  4JI3 J;  1JLE A;  1XJW B;  5H9F J;  3TZY A;  3Q89 A;  4NLU A;  3ZTP A;  4WPA A;  5IT4 A;  3CJT A;  1R8H A;  4O3P A;  2DHS A;  1T3O A;  1CUL B;  4KPY A;  4WU3 A;  1DTQ B;  1HNW J;  3T1Y J;  1TV6 B;  5GME A;  4B9N A;  2XMJ A;  3G82 B;  2RDJ A;  4WP8 A;  2AP6 A;  4X66 C;  4ZVH A;  3VGT A;  2OMO A;  1P9Q C;  1DLO B;  2HS3 A;  3DYA A;  2PA8 D;  2AX1 A;  2ALY B;  5A0Y B;  2KTQ A;  5K8N A;  1WKL A;  2E66 A;  5HLF A;  3N5B A;  1S0M A;  4WII A;  3ZZ0 A;  4YQW A;  3ZZR A;  2HHH C;  1XMQ J;  4CM0 A;  3C16 A;  4ZJZ A;  2DNO A;  3D0I E;  4YHH J;  1MXC A;  2GVD A;  1S6O A;  5FII A;  3MEE A;  1MMN A;  2RJZ A;  3PRB A;  4LFB C;  2VFV A;  1OJ4 A;  2V8P A;  3CWJ A;  4FNH A;  4AL6 A;  3M8Q B;  4HTJ A;  4N7T A;  3FRZ A;  3IWX A;  3HX9 A;  2XCA A;  5HAO A;  2WVB A;  4DQS A;  3FCE A;  2M5H A;  3PIO Q;  3I32 A;  5DDO C;  1V6H A;  2KI2 A;  1RTH B;  4H4M A;  2BMB A;  4JYA C;  2UUC J;  3T6B A;  4MK8 A;  1PIL A;  3H5U A;  1M1K T;  4A8S A;  3R7S B;  3DRS A;  3OHA A;  3AB4 B;  4Q2L A;  4WF9 Q;  2MY7 A;  2W4D A;  2VBY A;  2MB0 B;  2AYM A;  1FKA F;  1RAJ A;  2E5I A;  4USV A;  1C4A A;  2DXD A;  3D6F B;  3MM6 B;  3O6Q A;  2MZS A;  4QR2 A;  2RU9 A;  4L2Z A;  2VQF C;  4C3K A;  2IM1 A;  4ED1 A;  4B3T J;  3EZO A;  3VZI A;  2VG6 A;  1HI8 A;  5A1I A;  2HQ3 A;  2UUA F;  3EX7 B;  3RGI A;  3SEO A;  3BF4 A;  5A8W B;  1MNE A;  4YS2 A;  4C2M A;  1RKJ A;  1D8Y A;  3NGS A;  3MR3 A;  3ET6 A;  1VQ8 S;  3PXG a;  4AQY J;  1H2V Z;  2AW0 A;  5KG0 A;  1YG0 A;  4I67 A;  1RB0 A;  4YP3 A;  1NJZ A;  3CCM S;  2E8C A;  2HND A;  1S99 A;  4TKT A;  4PQA A;  5B0C A;  3SZ2 A;  1UWB B;  1JQG A;  2MZ1 A;  4A8O A;  3PV8 A;  4FYX B;  4DL3 A;  3HHK A;  5E3P A;  2WRM A;  1P6T A;  1FJG F;  2RKI B;  3KK3 B;  3U1M A;  4KO0 A;  4ID5 B;  4PG8 A;  4QQB A;  1RAB B;  1RT5 B;  4YFU A;  1SQF A;  2ERR A;  1KQF B;  4DV4 F;  5AE2 A;  4OLP A;  2GJF A;  2JLG A;  4M94 A;  5L1K A;  1WC0 A;  1E6Y A;  1TK0 A;  4NAS A;  2WK4 A;  1KQS R;  1T11 A;  4F2R A;  5C42 A;  2LKZ A;  3HSG A;  1GMW D;  1FF2 A;  1EZZ B;  2KFZ A;  2XG8 A;  1N33 F;  1S77 D;  3C19 A;  4F25 A;  2FJA B;  2NCK L;  3A9V A;  3RTV A;  4ZVU B;  2Z2L A;  1WOO A;  1YJR A;  1NKB A;  3BYR A;  3QWU A;  4OJ1 A;  3QNW B;  3O2I A;  2ABY A;  5CYJ A;  2PT7 G;  2CFX A;  1W2I A;  2DR9 A;  4F7V A;  3QJL A;  4DV5 J;  4ZPT R;  1FRK A;  4DN0 A;  4GXQ A;  1RWO B;  2E5L J;  1FFW B;  1OMS A;  1XWL A;  2HIQ A;  2VG7 B;  5DRK A;  2HVD A;  1LK5 A;  4RNF A;  2L48 A;  3OD2 A;  4R5P A;  2QRR A;  1QAI A;  4DQP A;  5EGY A;  1DTT A;  5F8N A;  2C2M B;  2UU9 F;  5B0A A;  5EX3 A;  1NB7 A;  1PKU A;  4Z7C A;  5GAE I;  4PWD A;  4IQX A;  4DR6 C;  2CQG A;  1C1C B;  2OEM A;  4A8W A;  4AL7 A;  3MED B;  1D09 B;  2B4U A;  3CJR A;  1N2F A;  4L3K A;  3MR7 A;  4U7U K;  3EGV A;  2IPO B;  2Z2Y B;  1CC7 A;  4RW6 A;  5C2C A;  2OHD A;  3FZB A;  2MQN A;  3QGH A;  4RUC A;  1S48 A;  1MRO A;  1WNE A;  3TUJ C;  2D41 A;  1IVZ A;  2EW9 A;  3SSQ A;  3JTN A;  1SH0 A;  1DQ9 A;  2W7A A;  5EWF A;  1VBX A;  2C2R A;  1I1G A;  2PMW A;  3MXH P;  4ZPB A;  4MKY A;  2GO9 A;  2I5J A;  1WHY A;  2XEX A;  3KJQ B;  1JLF B;  1REG X;  1CJT B;  2L9W A;  1S9G A;  3UI3 A;  2E1P A;  3QMQ A;  1A9N B;  3A3O B;  3W9J A;  1M5V C;  1U4B A;  2FZG B;  3PTW A;  4A8K A;  1O6X A;  4DFP A;  1SKR A;  1O0P A;  1EJ7 L;  5AT1 B;  4EGL A;  3N4W A;  1WDD A;  4OYO A;  5HBM B;  1QY7 A;  5BR8 C;  2WD9 A;  3E01 B;  5B08 A;  4NXN F;  5KFA A;  3UO0 A;  2LLZ A;  3UOW A;  1RAD B;  3NG8 A;  4EZ6 A;  1FE0 A;  4P73 A;  1M5P C;  2A1B A;  4WJB A;  3GCW P;  3OV7 A;  3I9V 9;  3US5 A;  3RRH A;  2ILZ A;  3RR8 A;  1N5Q A;  5A2Q U;  3EXY A;  2YKM B;  1H2U X;  4USJ C;  2XWX A;  2B4O A;  3UCG A;  2FHJ D;  3I56 S;  3IXQ A;  3AQO A;  3RAM A;  3KG4 A;  1OYE A;  1MXB A;  1R0A A;  1KVI A;  4B3R F;  2VF3 A;  2BE9 B;  3KK1 B;  3T5L A;  1LK7 A;  1SC4 B;  1U24 A;  2Y1R I;  1VJW A;  2LEB A;  1ZH5 A;  1FWL A;  5ETN A;  1RP5 A;  3UDV A;  1MMD A;  3M30 A;  1TL5 A;  4I2P A;  4LIR A;  1RCX B;  2CVE A;  4L76 A;  3BBF A;  2AGQ A;  4DV1 J;  1I94 C;  4FF1 A;  2RHS B;  2XC9 A;  5T7L B;  2XZT B;  5DGB A;  3QZ8 A;  1IJE B;  2CG4 A;  4ZPV R;  3GG0 A;  4RW9 B;  3EE3 A;  4DCS A;  2HWT A;  4IH5 A;  5IV3 A;  3A25 A;  3SBM A;  3W1Y C;  2E8F A;  1SV5 B;  1RHQ B;  2QMX A;  2UUB J;  5M2P A;  1J5O A;  2V4J A;  3EUN A;  2YH1 A;  2HNY B;  2ZM6 J;  2MZR A;  5B0G A;  1K0R A;  2M4M A;  4DR2 C;  5ITH A;  1UJ4 A;  4O3N A;  1S6Q A;  1KHW A;  1M0S A;  2Y0S D;  4F4A A;  1P4E C;  4DCT A;  4KKO A;  1JJ4 A;  2DIT A;  2C42 A;  1OPZ A;  2CXE A;  2DCU B;  3ENA A;  3GYN A;  4CO1 A;  2ALZ A;  3M32 B;  1F3V A;  2P6S A;  3QZ7 A;  4WKR A;  3AT1 B;  1T03 B;  1NH7 A;  5BYS A;  1XNR J;  3HHE A;  2HVZ A;  3MAQ A;  1URN A;  1VS3 A;  4DUT A;  2XS5 A;  1JOS A;  5AJ3 F;  3TRG A;  2VPY B;  4J9L A;  3DFE A;  3EMT A;  1XN9 A;  2FHK A;  2YNF B;  4B3M C;  4ER8 A;  4HDG A;  5G0R A;  1Y4Z B;  4YY3 J;  4NDN A;  4NZ0 A;  1WG1 A;  3POT B;  4PQU B;  3ISN C;  4LBH A;  3MOJ B;  3HPO A;  1UET A;  1H7W A;  1OS5 A;  4M5J A;  3BGO P;  3Q23 A;  1Q86 T;  4ZK7 M;  4PG4 A;  4X4T A;  1YRX A;  2MST A;  2VZE A;  3AD9 C;  5I3Q A;  5ETQ A;  3W9H A;  4RKU C;  5LMU J;  3D0H E;  3I5B A;  2W9C B;  2MYF A;  3PES A;  4ELU A;  3FKB A;  2CQ0 A;  4PUO A;  3JS9 A;  1U0H A;  4ZJL A;  3WQP A;  4LVO P;  2VG5 A;  4YR0 A;  1RT3 B;  4QIV A;  2GNK A;  3RBZ A;  1LWE B;  1IQT A;  4CLF A;  4K4X A;  3RB3 A;  3SCJ E;  4FPR A;  3QO9 B;  2OPS B;  4IDK A;  5T14 A;  4OHX A;  5IWA C;  1CSJ A;  4LF9 J;  1ZA2 B;  4LF7 F;  4J7C A;  4KHP F;  1FDN A;  2MKS A;  5C25 A;  1RTJ B;  1S0O A;  4K2J A;  5A2Q Y;  5GTD A;  1X4D A;  3LAM A;  4IFV B;  4QR1 A;  1Y3K A;  1NPK A;  3KOA A;  3W5Y A;  4NML A;  4JI7 C;  2V8H A;  3W2W A;  3MPV A;  3W5Z A;  1NK9 A;  3HI9 A;  2NZ4 A;  3G7S A;  4GKK F;  2YWF A;  1J5E F;  5DDR C;  1JLG A;  1R7I A;  4Q43 A;  1WOR A;  3MM9 A;  3RRK A;  3FGV A;  1HW9 A;  5GAH U;  1WEZ A;  1IKY B;  4Y2C A;  1YHQ S;  3DU6 A;  1ZOT A;  3G8Q A;  1TKT B;  1R89 A;  3BBB A;  3DLL Q;  4RWX A;  4I0W A;  3CJK B;  5BSV A;  3G2X A;  4DV7 J;  3CDW A;  3BQ2 A;  1S9E A;  3S01 A;  3BDP A;  1KKG A;  5AXK A;  5BYR A;  2ZVS A;  1KLM A;  5D77 A;  3HK2 A;  1LWF A;  3HFK A;  5FDL B;  4DL5 A;  4F4X A;  5LSL A;  1T94 A;  2HFN A;  4DR7 J;  1TP7 A;  3LOU A;  3SO4 A;  1CJK B;  1IJF B;  3X1L B;  2MMY A;  2AV5 A;  2RNE A;  4QW8 A;  2EGT A;  4DUY F;  4DR1 J;  1PA4 A;  1JLA A;  2V9K A;  2AJ4 A;  2PII A;  2H5I B;  5H9E K;  1YJ7 A;  1K1Q A;  2AGP A;  1M5O C;  4I56 A;  2DY1 A;  2E5G A;  2W2M P;  3TZX A;  4N76 A;  4MH8 A;  2EG1 A;  1FJC A;  2CPJ A;  1SJ4 P;  3LW5 C;  2ZVI A;  2AYB A;  5J2M A;  3UDL A;  5LSO A;  2MQL A;  3QIP B;  2BJ3 A;  2R2S A;  2DHM A;  2HLT A;  1UKU A;  3UWT A;  1V60 A;  1WI8 A;  4S0M A;  3JSM B;  2UP1 A;  2QVX X;  4HPV A;  1Y00 A;  1VEH A;  1X9S A;  4HHJ A;  2PD1 A;  2HSE B;  2IC3 B;  3VAK A;  2X1F A;  5F8J A;  5ETV A;  4LF5 C;  4NRT A;  2HHU A;  2J6U A;  4ECT A;  1HMV A;  4B3S C;  1FCA A;  5JUM A;  2IVY A;  1S7I A;  1FRI A;  1N34 J;  3TA2 A;  5JVH Q;  1FKP A;  1BQM A;  5L39 A;  4DV3 C;  2QMW A;  2NXU A;  4UF4 A;  7AT1 B;  2UVV A;  1IBL C;  1P27 B;  5IXU A;  2F5G A;  3TEH B;  1I5O B;  4ERD A;  2VUG A;  4ZVS B;  2PDA A;  2RDI A;  2MHN A;  3SDE B;  1Z1Z A;  4XK8 C;  3HKZ D;  1WJ9 A;  3PO4 A;  1KFS A;  4TQS A;  4ELV A;  1KLN A;  3DRR A;  3O5T B;  2NYH A;  1YVF A;  4DFM A;  3M9O B;  4Y2I A;  3GIK A;  2YX1 A;  3BO3 A;  2XSJ B;  3TJ9 A;  2W2P P;  1CJU A;  3J7Z 5;  3G6Y A;  2J0W A;  1USP B;  5I3U B;  2XY6 A;  4LF8 J;  3CME S;  3FCH A;  4FDF A;  2UXD C;  2I2Y A;  3PW0 A;  2GQC A;  3BRE A;  3OJS A;  1V9O A;  2GCF A;  4CO5 A;  3O2E A;  3D5M A;  4AL5 A;  2AMC B;  3EER A;  4KFB A;  1JXE A;  5B0B A;  4WKY A;  3NCQ A;  2YTC A;  3K5L A;  3R9X A;  4OI0 A;  2ZC4 A;  3BKU A;  4JI6 F;  5KFQ A;  4LF6 C;  5H1S V;  3AFG A;  4JI1 J;  1O51 A;  3TJ8 A;  1HBO A;  5A76 A;  2UUA J;  2IIH A;  2K1R B;  4NLD A;  4OX7 A;  3KK2 B;  4DSI A;  2JMP A;  4FN5 A;  3S8S A;  4FZV A;  4FF3 A;  2D74 B;  3IR5 B;  1ZB8 A;  4PXE A;  1CG2 A;  1IBM J;  2DPJ A;  2XB2 D;  4JI3 C;  2FLN A;  2FJD B;  4X4R A;  1RGV A;  3MFI A;  2OPR B;  1ZB9 A;  1KS2 A;  1W26 A;  2DGQ A;  3CJ8 A;  1SKU B;  3OXL A;  1UWA A;  2BAB A;  5BSW A;  4P2M A;  2IM3 A;  4OI6 A;  1Y7P A;  1MML A;  3MHY A;  2DXF A;  2EKN A;  5J2Q B;  5A6P A;  4MK7 A;  3MM7 A;  3VHQ A;  3LGH A;  1IKV B;  3GJR B;  2D27 A;  2HGM A;  3DLJ A;  3NY0 A;  4E8U A;  1TFY A;  4PRO C;  5ETR A;  4I7F B;  2D1C A;  4LJM A;  3IMQ J;  2DTJ A;  4NA2 A;  3SQO P;  1TL1 A;  5DLF A;  4ZMM A;  3CJE A;  5BUR A;  1FER A;  3UVJ B;  1LQL A;  5KFE A;  1VQP S;  3T41 A;  2VA3 A;  2HS0 A;  3CD6 S;  1FRX A;  2HNZ B;  1F5A A;  2CRL A;  3H20 A;  5ETS A;  4QJV A;  2F8M A;  1O90 A;  1XMQ C;  3EZU A;  3KLV A;  3OR1 A;  1U2F A;  4YHH C;  4LSZ B;  4W92 B;  4ZPA A;  3CO0 P;  4MMO A;  1JMT A;  3GTY X;  2KM8 C;  3NAI A;  5J2P B;  1PGZ A;  2J6S A;  2DT9 A;  1VIO A;  3D3B J;  5CZV A;  3VGV A;  3W9I A;  1S1V B;  2YNG A;  2RHQ B;  3ETC A;  5C24 A;  4UOG A;  2Q6B A;  1Q8L A;  4ECZ A;  1VIX A;  1CJV B;  5DG7 A;  3Q22 A;  2N4D A;  3CDB A;  1N52 B;  2UUC C;  3K6R A;  1IR1 A;  4OX6 A;  1X5T A;  4TPS B;  4OJH A;  4MT1 A;  1PG3 A;  2HFU A;  3AOC A;  4CLZ A;  1HNZ J;  1RHK B;  4EEY A;  1EHW A;  2ZBC A;  4I9G A;  4OYB A;  4NPO A;  2BE7 D;  1WG4 A;  2MKJ A;  3DLH A;  5L46 A;  2RU3 A;  5LL6 d;  3MUT P;  2FVQ A;  4ZVG A;  3LP1 A;  3SYZ A;  2W2O P;  1L2F A;  5F8L A;  2ZH9 A;  4B3T C;  3GFH A;  4ILL A;  2U1A A;  1RT2 A;  1G6B A;  1UEU A;  5GMK a;  2LEP A;  5IC6 B;  5AXL A;  5K5M A;  1DBD A;  4FYY B;  1K73 T;  2E9T A;  3WDO A;  1IR2 A;  2RAQ A;  1R27 B;  5HAN A;  1ZZN A;  2G9O A;  4J90 A;  1FDB A;  3CSK A;  4AQY C;  2F4F A;  1C4C A;  2DNP A;  3UPF A;  2OAU A;  2K06 A;  4WP3 A;  2V34 A;  4O4G A;  2V6A A;  2BOP A;  1CQN A;  3DOL A;  4JI4 J;  2R2R A;  4GO7 X;  2HFS A;  3VQT A;  3TAM B;  5LMN F;  3CQ2 A;  2ZHB A;  5J2N B;  5KFU A;  1BC6 A;  4MIA A;  1UA1 A;  1YGY A;  2VQE J;  3R7N B;  4GXR A;  5CCM A;  1D9A A;  3N6L A;  1A0O B;  3GG1 A;  3KTQ A;  3VAF A;  2M0G B;  1HQU A;  3LGM A;  3W63 A;  3QFH A;  1GFW B;  4RU2 A;  1JJH A;  2NZC A;  4U8V A;  3BEG B;  4DL0 C;  1T9U A;  2CQI A;  1QD1 A;  1YBA A;  3H40 A;  3QSY B;  4OX9 C;  1LW2 B;  2D3O R;  2WW8 A;  3HD1 A;  1Y11 A;  1WF3 A;  3UR3 C;  1U8S A;  2H65 B;  5DV9 A;  3MEC A;  4FKX A;  3HHL A;  3CUL A;  2CG8 A;  3GJS B;  2XYP B;  1B7Y B;  3K58 A;  5GAG U;  5KFK A;  3PG9 A;  3C15 B;  2YX4 A;  4USM A;  5D6G A;  3AA9 A;  4PUG A;  3I0S A;  5HVF A;  5CXT A;  4QWB A;  1I94 F;  2YWE A;  2QVY X;  4P6Q A;  1SUQ A;  2DGW A;  3DGP B;  1HNV B;  1VLA A;  3DLG A;  1B99 A;  4OYA A;  4USU A;  2KB2 A;  1SB6 A;  5JRH A;  4ZP8 A;  2E5L C;  4HKQ A;  2JJ4 D;  3VWS A;  4A4J A;  2OPQ A;  4DSK A;  5BSU A;  4C8L A;  2XO6 A;  2Y9H A;  2AJ2 A;  4CO2 A;  3AJ1 A;  1PAE X;  4JOU A;  3M2U A;  2W24 A;  4K2X A;  2H3E B;  4KGK A;  3WBZ A;  2QEX S;  4DR2 F;  2IRU A;  1K1S A;  3CMQ A;  5LM7 E;  3DLB A;  2VSQ A;  2AYG A;  4TY9 A;  5KG5 A;  2WVF A;  3KG0 A;  3V81 B;  2QVZ X;  3H42 A;  2KZF A;  1IR0 A;  2YVS A;  5LXR A;  2BM0 A;  1JLQ B;  2B8Q A;  4GS5 A;  1U1P A;  3QID A;  3D1Q A;  1NU4 A;  1LW0 B;  2ZUA A;  3MR5 A;  1AMU A;  1FEE A;  4QW9 A;  2DGV A;  4X65 C;  2LVW A;  8ATC B;  3MD3 A;  1T3N A;  2FGC A;  4QCL A;  2FPH X;  3G9C A;  2XO7 A;  1RJJ A;  3M8R A;  3WC0 A;  1FX2 A;  2J7K A;  4WU2 A;  5KFR A;  4B3M F;  1M1H A;  2A6M A;  1XEZ A;  1DZ5 A;  2LU1 A;  1L3U A;  4KRW A;  3J81 U;  4OJ3 A;  3W62 A;  2FIU A;  1DY3 A;  1IKW A;  5KG4 A;  3UW1 A;  3GV7 B;  3NGR A;  1T95 A;  1TQL A;  4C8K A;  3SV3 A;  4RLQ A;  1GNK A;  2FLL A;  2HHT A;  1IM6 A;  5CHC B;  2OFG X;  3KUG A;  2NCL A;  4HAC B;  4KHR A;  1SQE A;  3BGR B;  3RRG A;  2DR5 A;  4OYW A;  4PZV A;  2JEJ A;  3TQI A;  3D9B A;  5HO4 A;  1FVQ A;  4OYI A;  1SKS A;  2DHH A;  3MCM A;  4Y2M A;  1VRU B;  8RUC A;  3BH6 B;  4BC7 A;  1R0C B;  4F04 B;  1M6X A;  3CJ3 A;  3ZTR A;  1I51 B;  3IAS 9;  2H4W B;  1RE1 B;  1A6L A;  5M2U A;  1TMM A;  3ITH A;  4AUK A;  2LMI A;  4NI2 B;  2QC3 A;  4QWC A;  3WIU A;  4ALZ A;  4DV2 F;  4A8X A;  3CO9 A;  5K8F A;  4K4U A;  1HBU A;  3LP0 B;  3PFE A;  2Y4O A;  2KG1 A;  1KEK A;  1J2V A;  3J7Y U;  1MWZ A;  1Q7L B;  4P75 A;  3IEU A;  1T5D X;  3FCW A;  1NAQ A;  3BS9 A;  2QSF A;  1LWX A;  4DS4 A;  3BH7 B;  3K5M A;  1VQ7 S;  2FJB B;  3QAE A;  1RT1 A;  2R8J A;  1NLK L;  3TI0 A;  3TUF A;  1Q53 A;  4EK2 A;  1N54 B;  1LKZ A;  5CYM A;  4RLF A;  4DV1 C;  4J91 A;  4DSL A;  4ZVR B;  2D1T A;  1UWD A;  1RIS A;  2ZKT A;  1TVR A;  1SCJ B;  1DFD A;  2ZWP A;  3D6H B;  3UDC A;  3CD0 A;  4DX7 A;  4DHV A;  3NNC A;  1RWW B;  2BE2 A;  3DNC A;  2AJ1 A;  3QGP A;  4Q44 A;  2UUB C;  2LQ5 A;  2BX6 A;  2VBW A;  3IRW P;  1LXN A;  2ZM6 C;  2CDQ A;  3TVK A;  4QWD A;  3Q86 A;  4EO8 A;  5T8T A;  1MW7 A;  2FLP A;  4DR4 F;  3T1H J;  2UXB C;  3M4X A;  2FC9 A;  3P3D A;  3D3C J;  4KH0 B;  4DEZ A;  1YJ9 S;  3VNQ A;  3DGV A;  2HRY A;  4GVL A;  1T9W A;  1NDC A;  3R5A A;  3TNV A;  3BO4 A;  1HNX J;  1XNR C;  4CO4 A;  3JQJ A;  4CH0 S;  1NK0 A;  2MTL A;  1R3N A;  1N36 J;  3AD7 C;  1RYR A;  2H5J B;  2KT3 A;  4F50 A;  3PKY A;  1U09 A;  1JLE B;  4X4S A;  4DPT A;  3KHG A;  3M6V A;  4B17 A;  4L74 A;  1Y3J A;  1V3Z A;  4L73 A;  2DBB A;  3CC4 S;  1QUV A;  5CYQ A;  3OTO J;  4YY3 C;  2PN2 A;  2EPI A;  2VIH A;  1EQM A;  4LE5 A;  3B4D A;  3WC2 A;  1PCA A;  2M8D B;  3I0R A;  4W98 A;  3QGG A;  2W8K A;  3VV2 B;  3CPW R;  4LF5 F;  4FXV A;  2HGN A;  2LDY A;  2O5D A;  4TLQ A;  4B3S F;  1HAR A;  1F6T A;  1FE4 A;  1MWQ A;  3J81 Y;  2OEK A;  3Q2T C;  5LMU C;  1QVG R;  4UTG A;  3CC2 S;  2C1E B;  4DV3 F;  3DYA B;  3I96 A;  3QAU A;  4KH1 B;  1VGY A;  3GIR A;  4NL5 A;  4MAK A;  4BC9 A;  4HT5 A;  2BA9 A;  1IBL F;  1XMO C;  5HLF B;  4PUI A;  3HMJ G;  3FDS A;  2Y27 A;  3K17 A;  3OXF A;  5F8M A;  2JZ5 A;  4WXW A;  2DHA A;  2EFQ A;  4ZLP A;  4DQR A;  3TYT A;  3J7Z T;  5F0U A;  1R31 A;  2QA4 G;  1TUV A;  3NS7 B;  3MEE B;  2IFX A;  4LF9 C;  1S6P A;  5L1J A;  2IY5 B;  1SI9 A;  3R8Y A;  1IBC B;  1CEZ A;  2X1G A;  4ECR A;  1HPZ A;  4USK A;  5ETO A;  5E7Q A;  4IR1 A;  3ENQ A;  1UTA A;  1ZBT A;  2W9A A;  3SSR A;  2F4V F;  4H4M B;  1VJQ A;  2ZJR Q;  3QSI A;  5KFN A;  3NMR A;  1XR5 A;  1MDB A;  3JXO A;  3J80 U;  4DPW A;  1P1T A;  3VAG A;  2UXD F;  2K8G A;  2BAN A;  2B9Y A;  4EYI B;  1SJ3 P;  3DRS B;  2O3D A;  2YWH A;  4ZIT A;  4X4Q A;  4PZP A;  5E3A A;  2BJ9 A;  2B9E A;  5HVH A;  5J1N A;  4BWJ A;  4DSF A;  2BBE A;  3UN3 A;  3Q83 A;  3CB4 A;  1VCT A;  2DKO B;  4DV7 C;  3BQ1 A;  3UDE A;  2AEF A;  4LF6 F;  2QL8 A;  4NYZ A;  1KP6 A;  2VG6 B;  3CF5 Q;  5B0F A;  4CH7 A;  3G8S A;  4X64 F;  3R9W A;  4JI8 F;  1FX4 A;  2D3U A;  1WTB A;  4DR7 C;  4O3S A;  2R7T A;  2VB6 A;  3FQL A;  2GZO A;  3CQ1 A;  2QFI A;  1P7L A;  2M52 A;  4Z2X A;  3CCL S;  3ZNJ 1;  3AXM A;  4JI3 F;  5A2Q D;  2N3L A;  3K57 A;  2KDO A;  4QU7 A;  4OZ0 A;  4DQI A;  4NYP A;  1S59 A;  3PIP Q;  2U2F A;  1HNW F;  1JXV A;  1N6Q A;  3OFH A;  3IN5 A;  2COL A;  3T1Y F;  5IQ6 A;  1VRT B;  2AYA A;  2XS7 A;  1L3V A;  1LWC A;  4JV0 A;  1S4E A;  3S82 A;  3T6J A;  1HLW A;  2FC8 A;  3ZXW A;  1X9W A;  3M2R A;  4ZIV A;  2BH1 X;  1MN7 A;  3D6T B;  3K5P A;  2AJF E;  3GYX B;  2CQD A;  4RL1 A;  1X4A A;  3H4D A;  4JUZ A;  3CUN A;  4HH0 A;  1EQ0 A;  3EQ6 A;  2GC8 A;  4NEZ A;  1E6Y B;  1NDP A;  2CUY A;  5IC4 B;  3TW0 A;  4FS1 A;  1XMQ F;  4PXB A;  1V26 A;  2FD2 A;  1KDN A;  1N34 C;  1VDH A;  3TUZ C;  1RWN B;  4YHH F;  1OY6 A;  1V3S A;  3SXL A;  4ED7 A;  2L3M A;  3GV8 B;  4DMZ A;  4CM2 A;  2KVI A;  2WON B;  4DPY A;  2CAJ A;  3N6N A;  5KFJ A;  2BKN A;  3C2P A;  5E7O B;  1HBM A;  2J9C A;  2BQ3 A;  2EC0 A;  4A8F A;  2HQI A;  1NPR A;  1NZA A;  3PDN A;  3VAJ A;  3W66 A;  3OHB A;  3KJV A;  3ULH A;  4A46 A;  2ZH6 A;  2JNJ A;  4ED4 A;  1O8B A;  5D4O A;  2UUC F;  5KT5 A;  2ZBQ A;  4LSN A;  4YN3 B;  3UFC X;  5D0E A;  4OXI A;  4F26 A;  3M6U A;  4FXW A;  2HVE A;  4PXC A;  2B6A A;  2ROG A;  1IBK J;  1S0V A;  1HI0 P;  1WUU A;  3OFE A;  4R5P B;  4ED6 A;  1G2E A;  1DTT B;  1Y5I B;  2ASD A;  2MZT A;  4B3T F;  5IFM A;  4DWI A;  4M8L A;  4PWD B;  2HK3 A;  3P49 B;  4R25 A;  3M6W A;  4DG8 A;  4U9R A;  1KTV A;  3CCV S;  3IWL A;  3DU5 A;  3J80 Y;  3RG6 A;  2IDL A;  2PC6 A;  3QBC A;  4L7I A;  1RLD A;  1MRO B;  5KFB A;  4AQY F;  4L72 B;  3NS6 A;  3AJ2 A;  2EK1 A;  2HIY A;  4RNO A;  1GQE A;  4JI1 C;  3C3L A;  4OYZ A;  2UUA C;  2XZW A;  1KOH A;  1WEL A;  2I5J B;  3R2C J;  1EET A;  3HO1 A;  2D1S A;  2CWX A;  4ECQ A;  1S9G B;  2JHE A;  2VH7 A;  3VVU A;  4IO9 Q;  1SJR A;  4ECV A;  4A8Q A;  4OQJ A;  3FUY A;  2A10 A;  4ECY A;  3P5B P;  4NLW A;  1NO8 A;  3U02 A;  3KHL A;  4J9S A;  2J76 E;  3AOD A;  1FJG C;  3RYL A;  2D7V A;  4TNO A;  3QRR A;  4IG3 A;  2OD4 A;  4A8M P;  1X0P A;  1CS4 A;  4R1M A;  2NSC A;  1OSD A;  2IA6 A;  4W90 B;  1I6J A;  3DOK B;  1SH2 A;  2G0C A;  2ZDP A;  3GII A;  4USH A;  2R7R A;  1PJ5 A;  1RU1 A;  3D1O A;  2B56 A;  4RBT A;  2R7W A;  2A0F B;  2XWY A;  4NLS A;  1XNQ J;  2ZD1 B;  4YEA A;  1PG4 A;  1R0A B;  2W1B A;  5GAD U;  4MKB A;  1FNM A;  3UNG C;  5A0Y A;  5H9E J;  2KH9 A;  5KFP A;  1FT8 A;  2WCX A;  4LFC J;  4FS2 A;  1H6K X;  4DV5 F;  3KKF A;  1ZAW A;  4P9S A;  2QW0 X;  3M30 B;  4Z7Y A;  4RX6 A;  1NJW A;  4RW4 B;  2E5L F;  3PHT A;  4I2P B;  4CO0 A;  2AIR B;  4BS2 A;  1RHR B;  1X31 C;  2XI3 A;  1F2H A;  2IMW P;  2ROE A;  3MGJ A;  1NB2 A;  4ICL A;  4UQG A;  3T9Z A;  2E9Z A;  3BBC A;  3TA0 A;  2RIL A;  4RVN A;  2DYA A;  2J8A A;  4CIO A;  3OLA A;  3FSY A;  4USW A;  4CH1 A;  1RWM B;  2R7S A;  3PYE A;  3PCO B;  4DX8 H;  1J5O B;  4GVB A;  3NOG A;  1IXK A;  1RSC A;  2BW7 A;  5JVG Q;  2UU9 C;  4C9D A;  1R43 A;  4O0N A;  1CPZ A;  2WVC A;  2DO4 A;  4KB7 A;  1WDT A;  1HWI A;  4WE1 A;  4KKO B;  4PHT A;  1WEX A;  1GMU A;  1JIH A;  1VOM A;  2R7Q A;  3KMQ A;  4NLV A;  1NK7 A;  2NLW A;  2J7W A;  2O67 A;  3M2V A;  3B82 A;  2HG4 A;  4OZ5 A;  5K20 B;  1N0V C;  4V19 X;  3JAM U;  1UFK A;  4ILM A;  2G2Z A;  3OVB A;  2Z51 A;  5KFT A;  2BV3 A;  3IM8 A;  1YKW A;  3CCR S;  2CQP A;  1H74 A;  1RA7 A;  4K0K J;  1FXD A;  2NS1 B;  2OGU A;  2ONF A;  1NXI A;  1D0E A;  4JI4 C;  1TEL A;  5E5N A;  2GVZ A;  3CTR A;  4ZLL A;  3QJP A;  5G0R B;  3KYL A;  3CJS A;  1Y5N B;  2CVI A;  2WHO A;  3ISZ A;  2CNL B;  1HWL A;  3R2D J;  4JI0 J;  4GKJ J;  2V8G A;  1JLB A;  2Z8Q A;  2R7X A;  3LH2 S;  3R7B B;  3G87 A;  1K8A T;  2OPP A;  2FHO B;  4TYB A;  4DPO A;  4MK9 A;  2BUN A;  1F5C A;  3KXD A;  1ULR A;  4UST A;  3QWP A;  3MD1 A;  3KK3 A;  5KFX A;  2MZQ A;  4NXN C;  3HCX A;  4PUO B;  2W2Q P;  2Z57 B;  3FCV A;  1U0H B;  5KFS A;  2VG5 B;  1N5Y A;  2E7G A;  2WBR A;  2FZK B;  2J0X A;  1LFP A;  3HHD A;  2E7W A;  3IBW A;  1KTQ A;  1CLF A;  1G3O A;  1NDL A;  4IDK B;  1BD6 A;  3D2W A;  2UXC J;  3ONQ A;  7FDR A;  1S1U B;  1X4H A;  4DPU A;  2ZH4 A;  3U1N A;  3DMJ A;  2MLZ A;  3KUE A;  3MAA A;  5DQG A;  4DFJ A;  5C25 B;  1WHV A;  1WSV A;  2VOO A;  1FEH A;  3G86 A;  5KFY A;  4LF4 J;  3T19 A;  3CW8 X;  4ZHR A;  4MKA A;  5IT9 U;  2JX2 A;  4DV1 F;  1OQ3 A;  3MTJ A;  1WTF A;  3Q24 A;  1RZM A;  4ZCK A;  3W2W B;  1YRU A;  2XSF A;  5GVQ A;  4WTO B;  2BRK A;  3BO2 A;  3C5E A;  2ZZN A;  1JLG B;  2P2C B;  2GV1 A;  2Q6C A;  2UZA A;  1N5S A;  2UUB F;  3MM9 B;  1NKC A;  1RHJ B;  2VHG A;  9ATC B;  3V6D A;  2MCQ A;  1NJY A;  1ICE B;  4C97 A;  2ZM6 F;  5IT0 A;  3B8H A;  3K0J A;  1MU2 A;  4RVO A;  1FHT A;  2P8I A;  1UZD A;  5C5J A;  2F9D A;  1OQ6 A;  3CNQ P;  1S9E B;  1OY8 A;  2MLX A;  2BW2 A;  4QU6 A;  3P96 A;  4ODJ A;  4DL6 A;  1KLM B;  2YPZ A;  5FJ4 A;  4J9V A;  2ADB A;  1LWF B;  3KLE A;  2YQ0 A;  2VAS A;  4Y34 A;  2ASY A;  1FTR A;  1XNR F;  4Q0B A;  3AHP A;  1YK9 A;  1JWW A;  3EVO A;  2KU7 A;  2P2J A;  4ZCI A;  4ZIW A;  2VFR A;  1JLA B;  1N32 J;  2V7B A;  5LSR A;  4EI2 A;  3H4B A;  3EPG A;  1JKH A;  2YQ3 A;  1SL0 A;  3HVA A;  3JSR A;  4DBQ A;  1HH2 P;  2QE5 A;  2V8D A;  1SJF A;  2V69 A;  4E98 A;  2FJX A;  1FFG B;  1WC5 A;  3FSX A;  4EU0 A;  3OT9 A;  4FYD A;  5M2R A;  3R5J B;  2Y8Y A;  5J2M B;  3UX2 A;  2VBZ A;  3JAM Y;  5A19 A;  1S97 A;  4FF4 A;  2E1C A;  1DQA A;  1OIA A;  4DCU A;  5LMU F;  4QOT A;  3GZ7 A;  5D15 A;  1VQK S;  1HD1 A;  2ZDO A;  2J9D A;  3DHX A;  5E3Q A;  1YSJ A;  3C46 A;  1VIS A;  1FWP A;  4P2S A;  4D57 A;  1HMV B;  1ZS6 A;  7FD1 A;  2B7C B;  3AOB A;  2OH2 A;  2PO4 A;  1RTZ A;  2POK A;  3MEK A;  4C8M A;  3A4T A;  3NLC A;  5D0R A;  1BQM B;  4LR9 A;  3NNA A;  1RWP B;  4QPT A;  1WG5 A;  4LF9 F;  4TU9 A;  2RF2 B;  1WD6 A;  2R42 A;  2DD8 S;  2HW3 A;  5KT2 A;  1TK5 A;  3GIL A;  3UNY A;  1SC3 B;  1BQN A;  3MUM P;  3A8E A;  1VHI A;  1V3R A;  2J0S D;  4M5D B;  4LF7 C;  1R8P A;  4ED3 A;  5GAE U;  4U5Y D;  4KHP C;  2G0J A;  2RML A;  5AE3 A;  3Q8P B;  2YKO A;  3KK1 A;  3DRR B;  4QZV B;  4DR5 J;  1S76 D;  5LJ5 Y;  3N2Q A;  2IMO A;  2V5H G;  1SIZ A;  2YWK A;  4OZL A;  1CJU B;  2MDA A;  2P5V A;  1X5P A;  3HF5 A;  4BLG A;  2F1F A;  4DV7 F;  5IT9 Y;  4C98 A;  2R9L A;  5LJ3 Y;  2FVC A;  1FUG A;  1L3T A;  1VQ4 S;  1D1U A;  3L95 X;  2B9W A;  4DG1 A;  1L5U A;  4EBD A;  1Q5Y A;  2E29 A;  4IOC Q;  4DR7 F;  2H48 B;  2HK2 A;  3KDO A;  3MM8 A;  4LT6 A;  1YJV A;  4XDD A;  2C22 A;  3MOZ A;  5DGA A;  4NLQ A;  1S4F A;  4OI3 A;  4ITS A;  2DPL A;  2HNY A;  4DR1 F;  1TK8 A;  4NMX A;  5L8R C;  4ED8 A;  2MLY A;  1T8E A;  3OXG A;  2HBR B;  2DNQ A;  3CCZ A;  3N28 A;  1LEO A;  2NUH A;  2RDD A;  3TAR A;  3M8P B;  2RS2 A;  1QAJ A;  2IRY A;  3MMB A;  1NBE B;  1N36 C;  2ATW A;  3M32 A;  3BN4 A;  3DI6 A;  3W60 A;  1T9X A;  2LA6 A;  3IR7 B;  1T03 A;  3M6X A;  4WFX A;  4RR5 A;  1S49 A;  1G4C A;  3NNH A;  2G1H A;  2E5H A;  3LP2 A;  4JI5 J;  1YQH A;  4LRC A;  3OTO C;  4Y00 A;  4X84 A;  4NZ6 A;  1X8D A;  4PRF A;  3KMS A;  4ED5 A;  4DJB A;  2A3J A;  2ZC3 A;  4M5M A;  2XI2 A;  4DPX A;  3MM7 B;  5K14 A;  2L08 A;  1U49 A;  2E1R A;  2D9P A;  4IO1 A;  4B02 A;  4F2S A;  3BDE A;  1FWK A;  1SPB P;  2YNI B;  3MMC B;  1N34 F;  1TL1 B;  2Z2M A;  4PQU A;  4F4W A;  3KHR A;  1UW9 A;  1EAR A;  3NOC A;  3DC2 A;  4ZVP B;  1FXR A;  4YR3 A;  3TEG A;  1WI6 A;  2MJN A;  3Q0A A;  4X66 J;  3GON A;  5D0H A;  5D4L A;  2C2K B;  2PMZ D;  4LQ3 A;  3C6U B;  2AWZ A;  1SC1 B;  3MPW A;  3RZA A;  5FLX U;  1SL1 A;  2CXC A;  2X1B A;  4LSL B;  4CO3 A;  1PBA A;  5E33 A;  5DZ7 A;  4QBU A;  1RT3 A;  3KDN A;  3HVR A;  1KNZ A;  1AA1 B;  2JOQ A;  1Z2Z A;  3A3P B;  4DX5 A;  4PG6 A;  2GFF A;  1F1B B;  2V50 A;  3RAQ A;  2HHH J;  1HW8 A;  4OIX A;  1NYE A;  5KFH A;  2YNG B;  4IQM A;  4KHM A;  2C3O A;  4GC6 A;  5C24 B;  4LFB J;  3TZW A;  2H5E A;  1NJI T;  2HZC A;  1Q8I A;  1OSC A;  5HRO A;  3DHV A;  2V9W A;  1TKZ A;  4DL7 A;  2AJ0 A;  2HKE A;  3V6H A;  4Q8E A;  4ANE A;  3GCX P;  3GR1 A;  4DF8 A;  4J9R A;  4LF8 F;  3ZFV A;  2DK2 A;  4RO0 A;  5ETP A;  2CPF A;  2FJE B;  4JYA J;  4XAK A;  3G8T A;  4GC7 A;  2FUG 9;  3J81 D;  1UVN A;  2R7V A;  4QYZ K;  4WFY A;  4HDH A;  4O4R A;  1UVL A;  2PFF B;  4B08 A;  2HZA A;  2H54 B;  5K8P A;  1NKE A;  1GK8 A;  3LP1 B;  4TN2 A;  3MEG A;  5GAG I;  5EWG A;  4JI1 F;  2GW8 A;  1WWH A;  3DDI A;  3GPA A;  2M3D A;  1FK9 A;  5CQG A;  2JC0 A;  4TLR A;  2XLI A;  4C48 A;  5DDP C;  2MPU A;  1IBM F;  3VNS A;  1RTD A;  3OSN A;  3CDA A;  2XR1 A;  4JI6 C;  1NY8 A;  2YKQ A;  3OTD A;  3MDF A;  3OL9 A;  3H2U B;  2D28 C;  4DL4 A;  2HFO A;  2EXU A;  4RU9 A;  3DOL B;  2W01 A;  2OML A;  4C7Q A;  3FBB A;  3PRD A;  1WEY A;  4ZCM A;  4DG9 A;  2KJW A;  3FBE A;  1M5H A;  3HSJ A;  1FD2 A;  1S6U A;  2G2Y A;  1KFD A;  1TH5 A;  2CQH A;  2XQC A;  2DGT A;  9RUB A;  4JB8 B;  3W2V A;  5LCI A;  4RW7 A;  1HQE A;  2JRS A;  4O0I A;  1RDR A;  2OBV A;  4Y28 C;  1HQU B;  3QT8 A;  2HVH A;  3QIP A;  3IS9 A;  1Q0N A;  2V67 A;  2ZH8 A;  3WX4 A;  3E2E A;  4K4S A;  4NOZ A;  3ENW A;  2IC3 A;  3NBP A;  3QJJ A;  3BPS P;  4G1P A;  4FTF A;  3UN2 A;  3HHL B;  2EFO A;  4AFF A;  2DGU A;  3OTB A;  3W5X A;  3LA0 A;  5F8G A;  4IZ6 A;  1PIE A;  2ZIT A;  1RT4 B;  4I6W A;  4DSE A;  4LRD A;  3I0S B;  2V2Z A;  1NHV A;  2ZJQ Q;  1PC5 A;  2YWB A;  1SUQ B;  3E51 A;  2CPY A;  4FUQ A;  2A2C A;  3FCC A;  4CP5 A;  1FA0 A;  2AF6 A;  3BGL A;  3MR2 A;  2QT7 A;  3SV4 A;  3NCP A;  3CQ3 A;  2OPQ B;  3SCI E;  3TVY A;  3TAQ A;  1HNZ F;  3M2U B;  1XTZ A;  1WAC A;  3PW4 A;  5KG2 A;  1I3O B;  3F41 A;  3RW6 A;  2GAH C;  2I8E A;  4V19 J;  3VNR A;  3KNG A;  3I55 S;  2CJK A;  3L9Z A;  3OQ2 A;  3J7Y I;  4FKY A;  5D0G A;  2M2B A;  4F02 A;  1PJ7 A;  1TL3 A;  5SZT A;  2IVM A;  3P45 B;  2MQ8 A;  4C11 A;  2DNZ A;  3QFW A;  2UUT A;  4DR6 J;  1UMJ A;  4LMZ A;  1RWV B;  2NXC A;  5DQI A;  2XMM A;  1FRH A;  2IM2 A;  4WK3 A;  4R0E A;  3BN7 A;  2K2P A;  1TUG B;  3J7A N;  1QVF R;  1X4B A;  3H2L A;  2AHO B;  2HHQ A;  4NXM J;  4JI4 F;  3T5K A;  2M5O A;  2XGQ A;  1IKW B;  2K1R A;  5AXM A;  2RH3 A;  1REV A;  4MIW A;  3SSS A;  3TZZ A;  3TUP A;  4IR9 A;  3CVK A;  3JYT A;  2VQE F;  1BXN A;  4OYX A;  3HSD A;  3HHN B;  4RUA A;  1HL6 A;  1SC6 A;  2KN4 A;  1WCJ A;  1QLN A;  4HH1 A;  1G1X A;  2OPR A;  1DHM A;  5LMN C;  4DXL A;  5BR8 J;  2JWN A;  4K0B A;  5D78 A;  1U1N A;  1S79 A;  4MKV A;  2GHV C;  4ES1 A;  1EB0 A;  3JTP A;  1GT8 A;  3J80 D;  2F3J A;  3PR4 A;  2MQP A;  4OZ3 A;  4OHW A;  3ITH B;  4JV1 A;  3BR8 A;  1ROF A;  2HMI B;  3V5R A;  2HBZ B;  4I7F A;  1VR6 A;  1A7G E;  2OO4 A;  3CD7 A;  2R8I A;  3OL7 A;  2VDI A;  3OL6 A;  2RRB A;  4MFB A;  1XC9 A;  4NLT A;  4EUV A;  1U47 A;  2ZH1 A;  2BJE A;  3DXB A;  2BQR A;  1S1T A;  5D3G A;  1HA1 A;  1SXL A;  3RV2 A;  4USI A;  4LFC C;  2E8E A;  1QSL A;  1TKD A;  3G6V A;  3OTE A;  3ZC4 A;  1YZ6 A;  1RT1 B;  2J8S A;  3ETM A;  4LFA J;  4CRJ A;  2VD3 A;  1M90 T;  2M8H A;  3X3U A;  5J2P A;  3R97 A;  4DCP B;  3TA1 A;  3T3F A;  3TAP A;  2V68 A;  2UVU A;  1TVR B;  4RUH A;  3DDN A;  3OR2 A;  1GMW A;  4A47 A;  4B3O A;  1DUR A;  2DNG A;  3RG2 A;  2BE2 B;  4AT1 B;  1UJ6 A;  3CMA S;  2WP0 C;  4ES3 A;  4G1Q A;  1YJU A;  3A3N B;  5FD1 A;  5IQQ A;  1K47 A;  5B0E A;  4XPE A;  2JC1 A;  3VGS A;  2RQM A;  2XMV A;  2YCB A;  4HR2 A;  4ENO A;  3HZE A;  4D3H A;  3HT3 A;  1FDD A;  4X4U A;  3NI2 A;  4ZN3 A;  3EDR B;  3VCD A;  1H73 A;  3W3S A;  1S57 A;  4TVA B;  1S0N A;  3DLE A;  3B7W A;  3NKY A;  2HQF A;  2OPL A;  4I69 A;  3C6T A;  4KAI A;  5DG9 A;  4OX8 A;  2QIF A;  1YLX A;  3K5N A;  1UA0 A;  2AYE A;  4K0K C;  1U1Q A;  4RNM A;  3N6M A;  5CYQ B;  4G1I A;  1VLY A;  5IZH A;  2R8H A;  1RAG B;  2ZBP A;  4KTT A;  3I0R B;  4LUB A;  1VMB A;  4CNY A;  2B3T B;  4JI0 C;  5D4N A;  5HMW A;  5KYT A;  5HQ8 A;  4FBT A;  4JBC A;  3AQP A;  2GMH A;  3T5H A;  4NCB A;  1X5S A;  2I1R A;  3M9M B;  1H72 C;  5KFV A;  4DI6 A;  1Y5L B;  3P4U B;  1GMV A;  5J2N A;  2UV8 A;  6FDR A;  4EBE A;  5E3C A;  4URS A;  3CCU S;  4B9L A;  1Q78 A;  1BHN A;  3OBI A;  1GAO A;  3HKW A;  4P72 A;  1ZM4 A;  4F0H A;  1W2B R;  5ETK A;  4OMF G;  3UN5 A;  2P2F A;  2W4C A;  2MEW A;  5KFG A;  1S6P B;  2V2Q A;  1N8R T;  2RS8 A;  4DV2 C;  5KFI A;  3VVT A;  3U1L A;  2ZZM A;  4Y6I A;  4ECX A;  1HPZ B;  5IWA J;  1S1W A;  2RE1 A;  4LF4 C;  2HHP A;  2CJX B;  3BKF A;  4EBC A;  4X4V A;  2MKC A;  2W9B A;  4B9M A;  3F44 A;  3KLI A;  4K59 A;  3ZZU A;  2IYG A;  4IG0 A;  2HHV A;  4N8O A;  4IFY A;  3DM2 A;  1KSP A;  4RWW A;  3MUR P;  1WF2 A;  3OJU A;  2BAN B;  3MWB A;  3KLF B;  1Q16 B;  2FZC B;  4PWW A;  4NA1 A;  4JI7 J;  1EP4 A;  3EXC X;  4WYW A;  2FHJ A;  1NSK L;  1ZM2 A;  5I3P A;  3UQS A;  1PO6 A;  1C0U A;  2P2M A;  2E44 A;  3LAL A;  3N79 A;  2Y3Y A;  2MJU A;  2PEH A;  3THP A;  2CZ9 A;  4ZVT B;  3T1H F;  1PSD A;  5L1I A;  4KR0 B;  1HIY A;  2D3O 1;  4I4B A;  2QMU B;  2D3Z A;  3FC9 A;  3U7J A;  2GGP A;  1RAA B;  2HFZ A;  2E1M C;  1XRA A;  4NRU A;  4JV5 J;  4YUD A;  3R5D A;  1HNX F;  2BOA A;  3IBC B;  3N9U C;  2ZFH A;  2R2U A;  2HFV A;  3V81 A;  5JXS A;  1N36 F;  4DR4 C;  4DV6 J;  4KE5 A;  3OVA A;  4H4K C;  4DFK A;  2XHW A;  1HBN A;  1AUS L;  3GJQ B;  1RHU B;  1CVJ A;  3GR0 A;  3GSI A;  3MMA B;  1FRJ A;  3DKD A;  3GQC A;  3MFH A;  3L7U A;  2QYC A;  3OTO F;  1N6Q B;  3CCS S;  1Q1K A;  1NRK A;  2FB0 A;  3CW2 C;  4K7Q A;  4GO5 X;  1S9F A;  2CPX A;  1BWE A;  2HGL A;  4JP8 A;  3QT5 A;  3ISN D;  2ASJ A;  3HUL A;  1WKK A;  3E7X A;  3CJ2 A;  1GXL A;  4IR7 A;  2MHE A;  3PRO C;  1DQ8 A;  5BUQ A;  4NCG A;  4KV8 A;  1X4G A;  4ES2 A;  3MCS A;  2QL9 B;  4KGZ B;  1VQS A;  1RT6 A;  2K7J A;  2LFV A;  1VK3 A;  1XIQ A;  2R4F A;  2M88 A;  1NM2 A;  4NX9 A;  3THV A;  1VRU A;  5A8R A;  1PJ6 A;  1Q7Y T;  4M5H A;  2KZ0 A;  5G4D A;  3H5Y A;  1FNO A;  5KG3 A;  1U1L A;  2H9Z A;  4WTY A;  1HBM B;  3AOA A;  3RR7 A;  4DZ6 A;  1S12 A;  3KJV B;  3HP6 A;  3KXW A;  2LA4 A;  3NMA A;  2KDN A;  4FVM A;  3CCW A;  3QPI A;  2ZZT A;  1X4C A;  4LSN B;  1QUP A;  2YQ1 A;  2CJB A;  1FRM A;  2HQD A;  4Q5V A;  4U95 A;  4DR5 C;  3JAM D;  1SQG A;  4IKA A;  4OI1 A;  2F4V C;  2ZNY A;  1SL2 A;  2ZWO A;  2NXE A;  2AEM A;  1N5V A;  2QTW A;  1F60 B;  2IJN A;  2QA2 A;  2QL5 B;  2OD6 A;  1UVI A;  2EI5 A;  2B8P A;  1YJW S;  4ED0 A;  2B5J A;  3MTK A;  2CU6 A;  4TU8 A;  3FFI A;  5KOX A;  1NME B;  2GMJ A;  4C8O A;  4P2X A;  2LXF A;  1GTH A;  2IAJ A;  3FMW A;  5KFD A;  4RNN A;  4YR2 A;  4CLT A;  2W8L A;  2V0N A;  4WFB Q;  1URR A;  4E0D A;  1ZPW X;  2ROP A;  2ZH3 A;  2DH7 A;  4X64 C;  5F9L A;  4JI8 C;  1N48 A;  1R6Y A;  1T5H X;  1TAQ A;  4QWE A;  4CWB A;  4O23 A;  1EET B;  4M5K A;  2E7X A;  3I9Z A;  3OLB A;  2CQB A;  2YH0 A;  2APO A;  4RZR A;  1Q79 A;  2JH3 A;  1RBA A;  2DHX A;  3A8K A;  2CPE A;  3IG1 A;  3UR0 A;  1FXL A;  1L3S A;  1HNW C;  2QG9 B;  4JI5 C;  4U67 Q;  2DGS A;  3T1Y C;  2G13 A;  4F8R A;  2KRB A;  5HMX A;  1P4E A;  2XS2 A;  3A13 A;  3R5B A;  5IT9 D;  4R8U B;  4IG3 B;  3PEJ A;  5F8I A;  1CS4 B;  4FF2 A;  2AZ3 A;  3DCA A;  2FJW A;  3MPY A;  3NP5 A;  4CLL A;  2RQK A;  2F8E X;  2JVO A;  3TR5 A;  4DR3 J;  1YIT S;  3GIJ A;  2DY9 A;  1R8A A;  3I5A A;  4F3Q A;  4NYO A;  4XIU A;  1ZA1 B;  3S6E A;  1KD1 T;  2UV8 G;  3O44 A;  3HJV A;  2W7P A;  5BST A;  5T41 A;  2LEC A;  4NLO A;  4O44 A;  3LPE A;  3N0V A;  1ZTT A;  5KFM A;  3HM9 A;  3GKU A;  3FJ2 A;  1EGA A;  1FDA A;  4I2Q A;  1FES A;  5LXY A;  2P9E A;  5EHH A;  1FNX H;  2GO8 A;  1ZYQ A;  4YME A;  1IBK F;  3R1L A;  4YB5 A;  1J27 A;  2KZZ A;  1RY2 A;  1EX8 A;  2V4Q A;  2DGO A;  2NSB A;  3ZZP A;  4ICL B;  3A9U A;  2G0I A;  5SUH A;  3NGT A;  3SQG B;  4H4O A;  4DV0 J;  3SIP B;  3SCK E;  1XS3 A;  3GFZ A;  4EZ9 A;  4RW8 A;  3PY8 A;  4F3M A;  4GVB B;  4DU8 A;  1C0T A;  3RJM B;  5HN0 A;  3UCU P;  3QLH A;  4X2B A;  1S5Z A;  4TXS A;  3B78 A;  2C28 A;  2N4C A;  2VPW B;  2NYI A;  1F5B A;  3QGI A;  4WE1 B;  3FEZ A;  4X4N A;  4KT0 C;  1VLO A;  2EFG A;  1NSP A;  2PGC A;  3M2V B;  4ILR A;  4PYA A;  3ILJ A;  4A8Y A;  1LOU A;  5HP1 A;  3KLH A;  5BJR A;  4CQ1 A;  4F4Y A;  3WX8 A;  1SIW B;  1RWU A;  4ED2 A;  4MYU A;  4UUX A;  3QYY A;  3LNO A;  2YKP A;  1KRP A;  4ZVO B;  3H59 A;  2V63 A;  3BYP A;  4KGM A;  2FVS A;  4WFN Q;  4G3I A;  4QIW D;  2IYI A;  2GVZ B;  2PE8 A;  2CQ4 A;  3KG1 A;  2E1A A;  4ZA1 A;  3CJ5 A;  2ZE2 A;  2VIC A;  1JLB B;  3PW7 A;  2OPP B;  5D4P A;  4WV3 A;  4IYQ A;  3N54 B;  2G4B A;  5BXI A;  1T05 A;  1TL7 A;  1VRT A;  2AX0 A;  1FVS A;  2QZ8 A;  2KKH A;  1CBK A;  1U02 A;  2RUG A;  1CC8 A;  1N5Y B;  1IKX A;  1YZ7 A;  1HQ2 A;  1U6Z A;  3AXK A;  4H4K A;  3NL0 A;  2Y4N A;  1LCI A;  3M8Z A;  1IM4 A;  1XNQ F;  1RT7 A;  2VBX A;  1IUJ A;  1RAF B;  1VC0 A;  4N77 A;  4WS9 A;  1NDK A;  3D1H A;  2BDP A;  4I9F A;  2F8H A;  5KT3 A;  3DMJ B;  4C4W A;  2DYJ A;  3CCE S;  4LFC F;  4HT7 A;  1DAX A;  3MAA B;  5KFL A;  4PUH A;  2UVW A;  2ZEJ A;  4OX9 J;  1X4E A;  1QTN B;  2BJ8 A;  2HHW A;  4X62 J;  4ZHR B;  4P10 A;  2F63 A;  4ZN1 A;  3LTO A;  5E3R A;  3H25 A;  2NXN A;  4FP9 A;  1U2C A;  1X5O A;  2WON A;  4DV5 C;  3TJA A;  2BJD A;  2EFP A;  2GA7 A;  5EX0 A;  3VR1 A;  5L9N A;  1RUS A;  3GB0 A;  2KVQ E;  3V6D B;  2DCL A;  3IML A;  2XYH B;  2QLF B;  4WP9 A;  1MU2 B;  4RLE A;  1VQN S;  3SFG A;  4LBI A;  1N4L A;  4J9U E;  2W4P A;  4OZN A;  1RBO B;  4F0M A;  2LQB A;  2CNK B;  3D68 A;  4K5S A;  5IM0 A;  3RB4 A;  1T9Y A;  2Y1L B;  3UE2 A;  5J1E B;  3UD5 A;  5HMY A;  3KLE B;  2IBO A;  5IOL A;  2Z58 B;  5T8S A;  2BXJ A;  4P74 A;  3ZZO A;  4Q0B B;  3CW9 A;  1NK4 A;  4EAT A;  5HJX A;  3DOM B;  3PFO A;  2HRU A;  4LR8 A;  3VAM A;  1JLC A;  2JLE A;  3FVY A;  1R8B A;  5E0O A;  1KQG B;  1GX6 A;  4X65 J;  4ANC A;  3QRQ A;  3G6X A;  1JKH B;  2L9N A;  4NXM C;  4LRB A;  4K0K F;  2EK6 A;  1NSQ A;  1Q8B A;  3Q8S B;  4QYR A;  1MWY A;  3CCJ S;  2RQ4 A;  2MSS A;  2HWH A;  3HJF A;  3WIV A;  4ZP7 A;  1V5I B;  2WAQ D;  3P8B B;  5FLX D;  2L41 A;  4P71 A;  1RLC L;  4JI0 F;  4GKJ F;  2H51 B;  2DHG A;  2WOM A;  4OV6 A;  1RK8 A;  2IJF A;  2Y0B B;  2P9G A;  1DAR A;  4P7T A;  2H1Y A;  3MCO A;  1IN0 A;  1UKK A;  4Q2M A;  2MKH A;  3V6K A;  4QYZ J;  1NK6 A;  4DCJ B;  1QE1 A;  3I5C A;  3H8Y A;  4NLR A;  1X7V A;  2MY8 A;  1BY9 A;  2ZH7 A;  4F3O A;  4DUZ J;  3IBF B;  4FXD A;  4OZ2 A;  2BQU A;  2UXC F;  4HYK A;  2X3G A;  3EWG A;  3IGN A;  1TKX A;  3CJQ A;  3JSY A;  2YNH A;  4AXJ A;  2KHD A;  2DNY A;  3SCL E;  1HYS A;  3AY0 A;  3DOK A;  3GPC A;  1RAC B;  4LF4 F;  3PZP A;  4ATN A;  5L1L A;  1BQN B;  2V8V A;  3BM7 A;  1YJT A;  1YX2 A;  4JI2 J;  2R3V A;  2EBE A;  1RAH B;  2HJG A;  2ZD1 A;  3NWR A;  6FD1 A;  5A1G A;  1P9Y A;  1N56 A;  2AU0 A;  2YXL A;  1WC3 A;  3N01 A;  5A6W A;  2M5Y A;  1KVJ A;  2RUS A;  4LFA C;  2OFH X;  1Y10 A;  3KLG A;  2E9R X;  3SMZ A;  3D7S B;  2B7B B;  4NZ7 A;  2ILY A;  2EFV A;  2WW4 A;  2P2Q A;  4FNI A;  4RW4 A;  4KGV B;  1XHJ A;  1T7P A;  1D8Z A;  4UW2 A;  2CJA A;  3VAL A;  4I1T A;  1RQ0 A;  2FJV A;  4J9M A;  2PI4 A;  1K0T A;  1IQZ A;  4M5N A;  5L38 A;  3EJM A;  1WHW A;  3A26 A;  5CD4 H;  4DG1 B;  3W7B A;  3RB6 A;  2I0X A;  1UVM A;  2IRX A;  2UUW A;  3L7P A;  2CQC A;  3MM8 B;  3CE8 A;  1RAO A;  2C2Z B;  3DRY A;  2VJU A;  4UQT A;  1K9M T;  2XMA A;  1JJ2 R;  2HHS A;  1FLO A;  1RTI B;  1N32 F;  2VZ9 A;  3PRV A;  2ASB A;  1U1K A;  3EGN A;  2UXB J;  3Q8Y A;  4CLK A;  1VBY A;  4EWT A;  2XZD B;  1VC6 A;  1RG9 A;  1KKH A;  2QA1 A;  3MMB B;  4C3L A;  1QTM A;  2I38 A;  1RKI A;  2MZJ A;  3DI6 B;  2YWW A;  4CTA A;  3HVT A;  4WZQ A;  4PWU A;  3BSA A;  1MN9 A;  4UT4 A;  1C2P A;  4WXO A;  3MI7 X;  4PCQ A;  5RUB A;  3LP2 B;  4DZD A;  1AT1 B;  4R1L A;  3DN9 A;  2O1P A;  2QV6 A;  1PYT A;  3GV5 B;  4GMK A;  5K14 B;  4RJV A;  3LO3 A;  4Q8F A;  1MDF A;  2DEJ A;  1HR0 J;  2JSX A;  4LVN P;  3VTI A;  4ZVE A;  1TTH B;  2UVR A;  2LXU A;  3K89 A;  4J5O A;  1R6V A;  1NK5 A;  1B7F A;  3G71 S;  2CKW A;  1LV5 A;  2H4Y B;  2DPI A;  2R8K A;  1E6V A;  2GHW A;  3DAY A;  1KOO A;  1SKW A;  4XO0 A;  5HSP A;  3J7A 1;  1D9F A;  2LEA A;  1PYS B;  3C16 B;  1WH9 A;  5DS7 A;  1YDL A;  2GVD B;  2PRO A;  3B54 A;  2FVR A;  3C14 A;  5KT6 A;  1XMO J;  2KZM A;  4N56 A;  2DNK A;  1RBL A;  3D6M B;  1U25 A;  4RPF A;  4LIW A;  3AF6 A;  3K8V A;  1P8G A;  1S1U A;  5C2G A;  3K8W A;  5KFZ A;  5MLC V;  1LNQ A;  4DR5 F;  1NZ8 A;  2CWK A;  5A8K A;  2IBK A;  1SH3 A;  2KT2 A;  2Z0G A;  2MM9 A;  3Q2S C;  3GWC A;  5THW A;  5HRO B;  2N82 B;  1TKZ B;  2XGP A;  2FDN A;  4QIG A;  3OUY A;  4U6P A;  2JVR A;  2YKN A;  1H3D A;  3F0N A;  3TOQ A;  1C1B A;  3BZQ A;  2ZOM A;  1GH8 A;  4ECS A;  4LRE A;  2M70 A;  1UL3 A;  2WZ1 A;  1JX4 A;  2DH8 A;  1HFE L;  4L75 A;  1YTY A;  4M63 A;  4WK1 A;  3D4J A;  2ZH2 A;  4X4P A;  2HAI A;  2XNQ A;  2BKO A;  4TY8 A;  2VL1 A;  4KBI A;  3BB5 A;  1HNI A;  5J1P A;  3H7H B;  2E7V A;  4Y0F A;  3MEG B;  1WSR A;  4NCA A;  3L3C A;  2PA3 A;  5ADZ A;  2MQM A;  4ZPC A;  2D9O A;  5DM6 Q;  1NPP A;  3CJ4 A;  1ZET A;  2HBQ B;  2AKW B;  1H7X A;  4PAA A;  1FK9 B;  1P1L A;  1UJ5 A;  1PU1 A;  4JV5 C;  2R8G A;  2JFD A;  1HD0 A;  4PPD A;  4CZC A;  1ELO A;  4BDP A;  3ET6 B;  5HVG A;  1H98 A;  3I6P A;  3NCR A;  1RTD B;  1AZS A;  1S1X A;  3UEB A;  2XY5 A;  4LF1 A;  2G2O A;  4DV6 C;  5B09 A;  1TFW A;  4DR1 C;  1RU2 A;  5ETT A;  3GP9 A;  2HND B;  3DLK A;  3VAI A;  4E2F B;  3DRP A;  3R5G A;  3PW5 A;  2DNL A;  1Q82 T;  1EKR A;  5CCL A;  4JI5 F;  2MKY A;  3HDS A;  6AT1 B;  3NWG A;  1O93 A;  3IRX A;  4KO0 B;  4R0J A;  2R2T A;  4HL9 A;  3G4S S;  2BZ2 A;  1LQ9 A;  3HHL C;  1UZH A;  3CED A;  3C66 A;  3EIC A;  4ZDN A;  2VON A;  4M95 A;  4DCO B;  1VQY A;  3LNV A;  4I6Y A;  4FPI A;  2B51 A;  3W2V B;  1LXJ A;  4RW7 B;  1HQE B;  4MTN A;  2B0G A;  4CYU A;  3NGU A;  2HWI A;  3AA8 A;  4X66 F;  5I4M A;  1X9M A;  2VKR A;  3E3X A;  3IS9 B;  4IOA Q;  2QSW A;  1U2R A;  1S7H A;  1WOS A;  3TP2 A;  2X51 A;  3TVZ A;  5C42 B;  3SI8 A;  4DU7 A;  3BSC A;  5CD4 A;  3M8W A;  2MGZ A;  4LRA A;  4C6A A;  4D4G A;  1AW0 A;  3NBP B;  5EN1 A;  4FYV B;  1FI4 A;  4N47 A;  3F73 A;  2ZOF A;  4MIB A;  1YJN S;  1QM9 A;  2KT5 A;  4AE5 A;  2BJ7 A;  2EWH A;  2HHH F;  2QJ3 A;  4M5G A;  3OFG A;  5I42 A;  4NLG A;  4Q45 A;  1XMB A;  1APS A;  2P02 A;  1VFJ A;  3IA0 A;  3LAN A;  3UX3 A;  4LFB F;  1N0U A;  4AXI A;  2G1D A;  2YX7 A;  1TL4 A;  1YBU A;  2RF2 A;  3JQK A;  1EKS A;  1LFW A;  5KG1 A;  2J9D E;  2YBV A;  5KAK A;  3ZTQ A;  2DNH A;  4XPC A;  2D1Q A;  1ULT A;  3EGZ A;  4M5D A;  2DGX A;  3W8G A; 
#chains in the Genus database with same CATH homology
 4G37 A;  2VZE A;  1QM4 A;  4RLQ A;  3NPD A;  1XRA A;  3PES A;  2D27 A;  2AYA A;  4LF8 C;  4PRO C;  2ONF A;  1N36 C;  1N33 C;  4JI4 C;  2ATW A;  3TQI A;  3S82 A;  4DR4 C;  3AF5 A;  3CJE A;  5BUR A;  4BC7 A;  1LQL A;  2BH1 X;  3GR0 A;  5BSR A;  3LAX A;  5IWA C;  3A9V A;  3OTO C;  4BCA A;  2ASB A;  3EQ6 A;  1O90 A;  5KYV A;  2PT7 G;  1XMQ C;  3PBK A;  4NXN C;  4YHH C;  1RG9 A;  5GTD A;  1V26 A;  5K8F A;  2E7G A;  1N34 C;  4GXQ A;  3I07 A;  2Y4O A;  1QWI A;  5LMN C;  4GKK C;  4JI7 C;  5CZV A;  3NYR A;  4D56 A;  1IBM C;  1J5E C;  3E7X A;  4K0B A;  3G7S A;  3IEU A;  3ETC A;  1T5D X;  4IR7 A;  4BBY A;  3PRO C;  5BUQ A;  4WV3 A;  4R1L A;  3L8C A;  3N54 B;  3J80 D;  3TUF A;  2CXC A;  2UUC C;  1MDF A;  4RLF A;  3NYQ A;  3CW8 X;  4DV1 C;  3UZ0 A;  2OO4 A;  3E7W A;  4DR6 C;  2D1T A;  4OXI A;  4TPS B;  2Y4N A;  1LCI A;  4L4Q A;  1PG3 A;  5BSV A;  2CY1 A;  1NYE A;  1N2F A;  4FUT A;  5K85 A;  1KKG A;  4WS9 A;  4I9G A;  3TDE A;  3RV2 A;  4LFC C;  4I9F A;  3C5E A;  4XX2 A;  2E8E A;  2DYJ A;  3DAY A;  3I08 A;  2UUB C;  1L2F A;  5BUS A;  3DHV A;  4B3T C;  4GKJ C;  3SO4 A;  3KXW A;  1WH9 A;  2ZM6 C;  2PRO A;  4DR3 C;  4DUZ C;  3GR1 A;  3H2T A;  4DUY C;  5T8T A;  2EGT A;  1O9T A;  4RVO A;  4DG8 A;  5KEI A;  1PA4 A;  2UXB C;  1O92 A;  3AF6 A;  4DR5 C;  1YJ7 A;  3JAM D;  3J81 D;  4DV5 C;  5H9U A;  4ODJ A;  4AQY C;  3VNQ A;  2F4V C;  1MXA A;  4L7I A;  3RG2 A;  1XNR C;  4OYC A;  2YWC A;  4JI1 C;  5BR8 C;  2WD9 A;  2UXC C;  2WP0 C;  2UUA C;  4X66 C;  4JI2 C;  3ETO A;  3IML A;  2P2J A;  1BA3 A;  4JM1 A;  4R0M A;  3UOW A;  3A4I A;  4G36 A;  2D1S A;  5AE1 A;  2QVX X;  2V7B A;  2YCB A;  4HPV A;  3VNS A;  2XR1 A;  4JI6 C;  4DV0 C;  4YY3 C;  2PN2 A;  1MKY A;  3LUS A;  1HH2 P;  4LE5 A;  3NI2 A;  4LF5 C;  1XRB A;  5T8S A;  4GXR A;  1ML8 A;  2D28 C;  2HHH C;  4B3S C;  4ZJZ A;  1HNZ C;  1IBK C;  3DLP X;  1MXC A;  3CW9 A;  5ADZ A;  4X64 C;  3B7W A;  4JI8 C;  5CZX A;  4EAT A;  4B3R C;  1MXB A;  2OPL A;  1T5H X;  4LFB C;  1FJG C;  5A19 A;  4DV3 C;  5LMU C;  2D7V A;  4DG9 A;  1V25 A;  4JV5 C;  4DCU A;  4RM3 A;  4OX9 C;  1IBL C;  4K0K C;  4R1M A;  1WF3 A;  4BC9 A;  3FCE A;  4RM2 A;  4G1I A;  4NXM C;  1XMO C;  5DV9 A;  2Y27 A;  4DV6 C;  4KTT A;  4DR1 C;  1USP A;  4D57 A;  3T1H C;  4ZLP A;  4JYA C;  4JI0 C;  5FLX D;  5KYT A;  2OBV A;  1HNW C;  4JI5 C;  4D4I A;  1I94 C;  4LF9 C;  3T1Y C;  1PG4 A;  2OPL B;  2MKY A;  1HNX C;  2QVY X;  5IT9 D;  1O93 A;  4DCS A;  1XRC A;  1UKK A;  1VLA A;  5E7Q A;  4NOZ A;  1MD9 A;  2E0G A;  2E8F A;  4FTF A;  2BJO A;  5JRH A;  3R44 A;  2E5L C;  4L2Z A;  2VQF C;  2QW0 X;  2P2B A;  5BSU A;  3LNV A;  1USP B;  2P20 A;  4BSZ A;  1N32 C;  4IZ6 A;  1MDB A;  4MTN A;  4LF7 C;  3LGX A;  2P2F A;  2UXD C;  5A1I A;  4U5Y D;  4KHP C;  1K0R A;  4ISB A;  4DR2 C;  5AE3 A;  4KTV A;  2VQE C;  2YWB A;  4DCV A;  4DCT A;  3IEV A;  4PZP A;  4DV2 C;  2VSQ A;  5BST A;  4RVN A;  4FUQ A;  3FCC A;  3EER A;  3N2Q A;  4LF4 C;  1HR0 C;  4D4G A;  3GPC A;  2QVZ X;  2KZF A;  3R9X A;  3GKU A;  4GS5 A;  5IFI A;  4LF6 C;  1EGA A;  2E8C A;  2D1R A;  5BSM A;  4DV7 C;  1AMU A;  4X65 C;  2QL8 A;  2HJG A;  2P02 A;  1JOS A;  2JMP A;  5A1G A;  1RY2 A;  2UU9 C;  3R9W A;  1ZB8 A;  1FUG A;  4DR7 C;  4PHT A;  4B3M C;  4LFA C;  3VNR A;  3L95 X;  4RMN A;  3IPL A;  3A9U A;  4X62 C;  4JI3 C;  4MH4 A;  2P2M A;  1P7L A;  1XNQ C;  4NDN A;  4DV4 C;  2D1Q A;  1ZB9 A;  5A2Q D;  2P2Q A;  1GPM A;  1ULT A;  5AE2 A;  2DPL A;  5BSW A;  4W4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...