1YJ7A

Crystal structure of enteropathogenic e.coli (epec) type iii secretion system protein escj
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
167
structure length
154
Chain Sequence
MKEQLYTGLTEKEANQMQALLLSNDVNVSKEMDKSGNMTLSVAAADFVRAITILNNNGFPKKKFADIEVIFPSPSQENAKINYLKEQDIERLLSKIPGVIDCSVSLNVSSAAVLVISSPEVNLAPSVIQIKNLVKNSVDDLKLENISVVIKSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the molecular platform for type III secretion system assembly.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
molecule keywords escJ
total genus 46
structure length 154
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1530 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Hypothetical protein rpa1041 1yj7A01
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1yj7A02
3VNRA 3DAYA 5BSWA 5BSUA 3NYRA 5K85A 2Y4OA 3NI2A 2WD9A 3B7WA 4OYCA 1T5HX 3FCCA 1MD9A 5BSVA 2P2JA 3LGXA 4RM3A 5GTDA 4OXIA 3E7WA 4R0MA 3LAXA 2P2BA 1MDFA 2QW0X 5BUQA 2MKYA 4DG9A 2QVZX 3DLPX 1LCIA 5K8FA 5IFIA 3GPCA 3DHVA 4R1MA 1YJ7A 4PZPA 5KEIA 4G36A 3RG2A 2P20A 2QVXX 3VNSA 4RMNA 5BSTA 2Y27A 3L8CA 4GXQA 2P2QA 1PG4A 4R1LA 3ETCA 4D57A 2D1TA 4W4MA 4IZ6A 5DV9A 5BSMA 3EQ6A 4FUTA 4GS5A 2Y4NA 4FUQA 5BUSA 4DG8A 4D4IA 3C5EA 1BA3A 4RVOA 2VZEA 5E7QA 2V7BA 4EATA 4G37A 4RVNA 3E7XA 4U5YD 2D1SA 3R44A 1MDBA 3CW8X 5BURA 4RLQA 1ULTA 2P2MA 3A9UA 4RM2A 3VNQA 4ISBA 4ZJZA 2D1QA 3NYQA 3LNVA 2VSQA 3PBKA 5JRHA 3A9VA 2QVYX 3FCEA 3G7SA 1RY2A 1PG3A 2D1RA 4IR7A 4D4GA 3KXWA 1T5DX 3CW9A 1AMUA 4RLFA 5KYVA 2P2FA 5KYTA 5BSRA 4D56A 4WV3A 4GXRA 3IPLA
chains in the Genus database with same CATH superfamily
3M32B 1R8PA 4JI8F 3P45B 3M2VB 4AL5A 4C8OA 3D7SB 4BS2A 2NXCA 3DOLA 4RWWA 2VQEF 1SQEA 3TA1A 2B0GA 2N4DA 3MPWA 4LREA 1YI2S 2K7JA 2IHR1 4CNYA 4RX6A 3HT3A 1OJ4A 1NZ8A 3P8BB 4DPUA 4USMA 4B3OB 1QWIA 4NRUA 2HRUA 2F8MA 4CO3A 3JSMB 1WKLA 4DQQA 4DJBA 5DG9A 3Q22A 5KFPA 2VPZB 3SQGA 5C25A 2L08A 2QA4G 3OT9A 2M5HA 4TNOA 3LUYA 4Y2KA 3L3CA 4LFBF 5BUQA 4OL8A 1NRKA 5A8WA 4ECWA 1VYAA 4JI0F 1C2PA 2FTRA 5IT4A 3MFIA 5IFIA 4NYOA 2VJUA 1MNEA 2DR6A 3QJLA 2BQRA 4F4AA 4JI3J 1VRQC 2BKPA 5HROB 2FHJD 3EPIA 2CG8A 2R7WA 3CQ1A 4PZPA 4JI0C 5KEIA 2K1RB 4CLZA 3RG2A 3ZTOA 3OL7A 1XS3A 2RKIA 4MKVA 1E6YB 1WNEA 1JKHB 2Q1LA 3E01A 2AJFE 2AZ3A 2BXJA 3VCDA 3ULHA 2LU1A 2G1DA 1L5UA 4F2RA 1X0FA 2ZZMA 1S6UA 2E7XA 1AZSB 2AT1B 4MTPA 5E0OA 5BYQA 5KFLA 1NM2A 1MN9A 1R27B 2K06A 2LQJA 3FSYA 4UOHA 5HJXA 3GQCA 1S1VB 2COLA 1V60A 1X4CA 4WF9Q 2R2TA 1L2FA 1VQYA 3M2RB 3NLCA 2P6TA 3CSKA 2JRSA 3O5TB 4X66J 1REVB 5A8RB 1U1RA 2DNNA 3D6HB 3AJDA 2BMBA 1QD1A 3GFXA 4FYVB 4QJVA 1F60B 4UUWA 3UE2A 4C6AA 1JK9B 2IJRA 3JAMU 4MIAA 3G6VA 2B9YA 2YPYA 2D1QA 1QVGR 3CDUA 4HDHA 4BC9A 4Q2MA 5F3ZA 1Q86T 3PKMA 4JI4C 4MYUA 2BW7A 2KJWA 3AODA 2MXYA 4K4TA 1QSSA 2H9ZA 2G0IA 1VK3A 4OHWA 2CPYA 2A18A 1PC5A 3GFZA 4P52A 3KHLA 5EX0A 1PAEX 1T03B 2UVWA 1BA3A 4CO1A 3ILLA 2XNRA 3M2UB 1LW0B 2K3KA 4K2JA 3R9LA 1H2VZ 4WU2A 5HSPA 1VQOS 4B9UA 3PW4A 3GG1A 3I4PA 2MZJA 5A8WB 4X84A 2YNGA 2R8IA 4QCLA 1Q8LA 1RTDA 2HURA 1P4EA 1CQMA 1SXLA 1JNZB 1DTQA 5F8HA 4F4YA 4ZLNA 4RBVA 2UUBF 4W90B 1MLAA 4JYAJ 2JFKA 2KHCA 3MCNA 4JI7C 1T02A 1RE1B 2CNOB 2F9DA 2H4YB 3NWGA 3CUNA 2ZWPA 4X4QA 1VI7A 3DM2B 2H48B 2EKNA 1UKKA 4KHRA 2GHWA 2KT5A 3QT8A 3TX8A 2HK3A 4DPTA 4XX2A 2ZVSA 2YWHA 4I67A 1WF1A 1RAJA 5ETVA 1CVJA 4PUHA 2H4WB 3BR8A 2XR1A 3GB0A 2J5AA 2R9LA 2QA2A 3K5OA 4C8MA 3EE3A 4ZPAA 2EBGA 3DRPB 5KFZA 4J9KA 4DV0F 4DR1F 5A0YA 2M0GB 5A0YB 3M8ZA 3CEDA 4QPTA 1AB8A 1Q1KA 5CABA 2BRKA 4Y2MA 1P7LA 3GKUA 4MH4A 4NXNC 4MKAA 3MURP 2OELA 4J37A 3ENWA 2QVYX 3DOMB 4B3MF 4YHHC 2LQ8A 1NKBA 1JLEA 4C8LA 5DG7A 1GXTA 4E8UA 2FVPA 2XMMA 4DL5A 1G3OA 3I55S 2LDIA 4ZJOA 5C7PA 4F4KA 5CAAA 4PUGA 3IR6B 2QLWA 1RT1B 3JYTB 1K0VA 3UCUP 2QGFB 4ED1A 2NPFA 4NASA 5D4LA 1XHJA 1DTQB 5E2QA 2C2EA 2GMHA 3T19A 3HHDA 3PYGA 4J9MA 5H9EJ 3PHTA 3KHRA 1TK8A 2QLJB 2RNEA 3LGHA 1RDRA 4PG5A 1TTHB 5L8RC 1S1UB 3IMLA 4HPVA 1TAUA 3ETMA 2A0FB 2DYAA 2HKEA 3AXMA 2QEXS 2J7WA 1N5VA 4B3RC 3CCLS 1M1HA 2ACYA 3PJWA 1N54B 4M5NA 2F9JA 4ED8A 1OSCA 3BH6B 3HZEA 2MPUA 4YB1P 3FCCA 4V1Ak 5D0GA 3OVSA 2XQCA 1WHWA 4C3MA 2MKSA 5D4PA 4X62F 4QR2A 2FVQA 4O3OA 4C0BA 4ECZA 5LXYA 4GKJF 1WELA 1XRCA 1EETB 2DT9A 3J80U 3J81j 1XMOJ 3CCES 5DDOC 4DCOB 2W25A 4CLLA 2MKYA 2MKHA 1UW9A 3M2RA 2IRYA 4OI1A 1FHTA 3UD5A 3UI3A 1HBUA 2YCBA 1HNVA 2LP4A 2W01A 3MM7B 1KOOA 2HNDA 3ZZZA 1QSYA 4NXNJ 2MCQA 3CD5A 4HHUA 1WG5A 1IBMF 4KHPC 1AZSA 1PAUB 4UOFA 2ATWA 1RKIA 3LH2S 4NCAA 2V6AA 3HSDA 4X64F 1OIAA 3IRWP 3RRKA 1ZA1B 2V67A 4Z2XA 2XCPA 1SJFA 2AJ2A 2OPRB 2M4MA 2RKIB 4DUTA 2UUBJ 2KYXA 1ZB9A 2V4JA 2JMPA 4RMNA 3S6EA 2XO6A 5D4OA 4OJ3A 3T1YF 1G6BA 4LUBA 4PG7A 4UQTA 3UNYA 4U67Q 4PEOA 1LWCB 2VPYB 4OI3A 4TVAB 4DN9A 4EZ6A 1QUPA 4DR2J 1Q7YT 2RHSB 4YB5A 1DY3A 1BE4A 1BGXT 1RZMA 2HHUA 2E1PA 4OYBA 3UOWA 1FTRA 2WVBA 3OFEA 4Q0BB 2CPDA 1FRMA 3POTA 5SZTA 4E0DA 1XIQA 4UOCA 4KO0B 1N48A 4LF4C 1TK0A 3BV8A 4FUTA 4CH7A 3SCKE 1UVJA 4K4YA 2KFNA 4WFYA 4GS5A 2F4VC 2Z51A 1U02A 3CJKB 4OZ3A 5A2QY 3NWRA 3D54A 2XY7A 2G2YA 1NJYA 2FJVA 3QAUA 4L73A 2HVZA 4C7QA 3VTIA 4TU9A 4X4TA 1DLOB 3C14A 4NZ7A 2ZOFA 3DMJA 3LP2A 2Y1JA 1RA7A 4Z7CA 4J9PA 2VU5A 1U6ZA 1HI8A 2OSQA 3LALA 4ECVA 2CJ9A 4F8RA 2YWKA 3BO2A 5HVFA 2CNKB 3FVYA 3SIPB 3LGMA 4EUVA 1RWOB 1TQLA 3SO4A 1Y3JA 2FC9A 3UDCA 3FMWA 1UFLA 2VQFJ 3QRPA 2DIUA 4I2PA 4LBHA 4QYRA 3A1YG 3OTDA 4C2MA 5CD4H 1QY7A 2H5IB 4MIBA 2G13A 3GMGA 4KKOA 2B8PA 2NXNA 5B0DA 4YY3F 3BGUA 2MMAB 4HT7A 2D28C 3NG8A 4M5DB 4L76A 1HQ2A 4JP8A 2E5IA 2DXFA 5K8PA 4LFCJ 1SH3A 3MM5A 3P5BP 1ICEB 4CH0S 5HLFA 4PUOA 1UVNA 2HFZA 2MDAA 4IYQA 4R25A 2PA3A 1SUQA 3MEKA 3HK2A 4RW4A 1PO6A 5D8HB 3PIPQ 1X7VA 3AJ1A 1GTHA 4UF4A 2XGPA 4DQPA 2PMWA 2AW0A 1IB8A 1WI8A 3I31A 4M5HA 2BQUA 2HNZB 2IY5B 3ZZ0A 1CS4B 4BBYA 3A9VA 4UY8T 4CT8A 4DX5A 5AE2A 2XY6A 4J9RA 1XNRC 2XYPB 3MDFA 2X3DA 4HI1A 4D4GA 1S1TB 1TELA 4L2ZA 1EQMA 4LRDA 3C6TA 3CCMS 4ZIWA 4A8QA 1Q8BA 4RW6B 2XI3A 4DL7A 2VIHA 1X9SA 2Z2LA 2CA9A 3GU0A 5E3QA 5A2QD 1VLAA 1YJRA 2QN6B 1J5OB 3KXDA 1TV6B 3BDPA 1HWKA 2OEMA 2OSRA 2M88A 4YDXA 3SSRA 3CXCR 3E7WA 1S4EA 3ZO7A 3M6VA 4JV2A 4Q45A 1RT7B 3M8YA 1RT5A 1V3RA 4NOHA 4WWSA 1XMQJ 1L3KA 4R5PB 1SC3B 4B9MA 1NK4A 4KYZA 1FVSA 1RK8A 3B82A 1VC0A 3ZZUA 1SH0A 5I4MA 2FHMA 4ES1A 5IXUA 1BC6A 1HNIA 5HANA 3DGPA 2KO1A 5F0UA 4FBUA 3V4MA 2BR0A 3I0RB 2Z56B 3PHEA 4I2PB 1UJ5A 3F73A 3MMBB 4B9TA 2HRYA 2BZ2A 5KFVA 2HHWA 4ED4A 2Z2MA 2KM8C 4NLPA 2C2OB 5K8OA 4ED5A 4WXOA 1UA1A 1MXBA 3V2UC 4B3TC 1M90T 4LFCC 2HW3A 4Q7AA 3CJRA 3DMJB 2MZQA 4ANDA 4OYOA 2BUNA 1NSAA 3N28A 5DRKA 1X8DA 3MD1A 1HWJA 3UCGA 4Y6IA 2VG6A 1IKYA 2DO0A 4AE5A 4JV5C 2XSFA 4LFAC 1HBNB 2QFIA 4CLUA 3CDEA 2DTJA 3OFHA 3IN5A 2XULA 4QWCA 4M94A 4AQYF 3VNSA 4DQRA 1EP4A 1RCOB 2B51A 1R31A 1TZ0A 2MHNA 5KFNA 3BQ1A 5LMNF 4WBFA 2PEHA 3HHLD 1AUSL 2BABA 3R8YA 2P2QA 1GMWA 5G0RB 1ULRA 4PRFA 4TU8A 4F3OA 3O1LA 1D9AA 4C8YA 1HPZB 1RHKB 1UZDA 4DV6F 4MK7A 1U48A 3IBFB 4IZ6A 2N7CA 1FEEA 2CJXB 4GC6A 1WEXA 2DGSA 1RBOB 5IC4B 2EXUA 2YWGA 1S1WB 4GO7X 4K4UA 3LNOA 2W2QP 3HSJA 3MM9A 2C1EB 3D6MB 4XPCA 4XO0A 2R2RA 4NXMC 4X65J 2EVZA 2VG5A 2OPRA 3DGPB 3VALA 2A3JA 2QTWA 4ZPBA 5M2RA 3RBXA 3TUJC 5KT2A 5GAEU 2OD4A 4RJVA 2QV6A 2MQOA 1TKTA 3T5KA 2W8KA 4DR2F 1SC6A 3V4IA 5DJBA 3EGZA 3C5EA 2VZEA 3G8QA 2V7BA 1JOSA 4OI4A 4CYUB 4BLGA 1WH9A 1CJKA 1N34C 3BEGB 4BSZA 3R5BA 3IWLA 4ZVTB 2FJXA 4AXJA 1FRXA 4ILRA 1S1XA 1Q0NA 2F3JA 3I0SB 4FYXB 1IR0A 2E29A 7FD1A 4DPWA 4YMEA 1UVIA 4IO1A 5C2CA 2D1SA 3KLEA 3R44A 5BR8C 2ZKTA 1KQSR 1NDCA 2RMLA 3L9ZA 5BURA 5BYSA 4J9UE 4ODJA 1HNWC 2QLBB 4ANCA 3KK2A 2UUCJ 2ILYA 2OEJA 4CTAA 1LKZA 1DQ8A 3DRSB 5MLCV 4K4XA 1MWZA 2ALZA 1RWWB 5EGYA 1EAYC 3UDEA 3OLAA 3MMAA 2R8KA 1VRUB 3QSYB 1VQMS 1H2UX 3Q2TC 2C2KB 3T5JA 4DR7C 1WSVA 1IR1A 2VUGA 3I9V9 5B08A 3OV7A 2FJWA 4IRKA 2DO4A 3A26A 3DLJA 3JYTA 2L3MA 3IR5B 3VZIA 1WTBA 2HS3A 5L1LA 1RTHA 2V5HG 4QWEA 2Z30B 1NPRA 3DHXA 3BSNA 2AYAA 1NK9A 1RCXB 3OBIA 2B4VA 2BJEA 4MH8A 8AT1B 3MD3A 4CLSA 5HBMB 5K20B 5J2PB 4QZVB 4DSFA 2UXDF 2E7GA 3V6JA 3CIZA 4KE5A 1U4BA 3LP1A 1AUDA 3DOMA 2HSEB 3KHHA 3CJ5A 5HK4A 3WZ0A 1GPMA 2A2CA 4CZCA 1HBOA 3MECB 4JI6F 1QM9A 3MCSA 2J0QD 3I82A 1RGVA 2ZDPA 4CCHA 2GHVC 3GE9A 2ABYA 1YK9A 1U1LA 2FIUA 2O3DA 1VBXA 1XJWB 1VQ6S 1XNRF 5BSUA 3TEGA 1FRLA 5KFWA 4NLQA 3PEJA 3KJFB 3DNCA 4KSEB 2HS4A 1B3TA 4DFJA 2DNRA 1VQKS 1PU1A 4NCGB 1U47A 3TA0A 1RHJB 5F8MA 2ZJRQ 3JQKA 4LVOP 2VFSA 4DU7A 4ZHRB 4RW8B 3LF0A 4DV4F 3DLKA 1B0VA 2GNKA 3RR8A 1NJXA 2ZZTA 4JV1A 2P5VA 1FTCA 2BJOA 1R6VA 1VRTB 4GMKA 4NX9A 5B0EA 1HBMB 1PJ7A 1R6YA 3OUYA 1LK7A 3V6KA 1N34J 1P1TA 1X5OA 2HFUA 1NK8A 4O3SA 2BE9B 1OPZA 2QZ8A 2R2UA 3NNCA 1W2BR 3FKBA 3T9NA 1TL1B 3BGLA 1QTNB 3FBBA 3KWMA 2V4QA 1NK0A 4HACB 4DHVA 4QWDA 5J1PA 4HH0A 3AY0A 5BSTA 4GKKJ 2UUCC 2W7AA 1NH8A 2YKPA 1KHVA 2LA4A 8RUCA 1N6QB 4WTOB 3DU6A 3TARA 2DNHA 3QIDA 3AQOA 1IBLJ 2FY1A 1PG4A 1NDKA 4LMZA 2EFOA 1U2RA 3JSYA 4O44B 4O44A 5E3CA 4ZVFA 2I6WA 1U09A 2EK6A 1K44A 1H72C 3VAMA 5K5MA 4LF4F 3E2EA 3I5BA 2VL1A 4OJGA 2QMWA 2HK2A 3FBEA 3S7RA 3TI0A 1UAWA 1GX5A 3KG4A 4B9SA 4DS5A 3OVAA 4L3KA 2B4OA 1OPIA 2NLWA 2O67A 4H4OA 1F5AA 2OTLS 5BUSA 1RT6A 1WC6A 4LSNA 1QSLA 4LF5J 1FLOA 2ACMA 2AV5A 2ROEA 3CW2C 3D4JA 4EATA 3W64A 4JI3F 4NXMJ 4M5MA 3O2EA 3EGVA 1HBMA 4JB8B 5C24A 3OUYB 4MTNA 4OYPA 3TX0A 1O8BA 3HHLB 5LMUF 3D5MA 3TDEA 2E66A 2AEFA 3SV4A 4KT0C 4J7CA 4N7TA 1LFPA 4X64C 4DR4C 2I38A 3MM5B 4ZHRA 3BPSP 3MZIA 3K5PA 1APSA 2EPIA 1F3VA 1GX6A 4OZLA 1YTYA 1NB2A 4OYXA 4EEYA 3UN3A 4KJIA 2VFVA 1VIXA 3DXSX 4OZNA 3OJSA 1JLBA 4IRCA 3PW5A 1MMDA 3Q8PB 3EMTA 2M5YA 3RGIA 3VHQA 1SJRA 2POKA 2QG9B 3GSIA 4IG0A 2AX0A 1UETA 4PXEA 2AD9A 3T1YC 3EERA 3DC2A 1KQKA 3W5YA 5LXRA 1X9WA 4PWDB 1MSWD 1TL7A 3H7HB 4ZIVA 5J2MA 1CULA 2OPSB 4IH7A 2FY8A 4RWXA 2IRXA 1VBZA 3NYQA 2NUUG 3HD2A 1RT4B 4X62J 1YWXA 4H4MB 4YR3A 2XM3A 1U6BA 4L6V3 5GAHU 2XYGB 1LW2A 4YR0A 4N76A 2B8QA 2HPUA 1MMNA 5B0AA 3EZOA 4CO0A 2BRLA 1ZTTA 2E5HA 2CQHA 2I0XA 3N4WA 1SKUB 1J5EC 3LP0B 2APOA 3FC9A 5B09A 1RYRA 5L38A 4DR5J 1RYSA 3M8PA 1C0TB 4MK8A 2XO7A 3J7YI 4DL2A 3R2CJ 5IQQA 2ZDOA 2OMLA 1SV5B 1UFWA 3VAFA 2W2OP 1AMUA 5KYVA 2P2FA 1NHVA 1N36J 2VOPA 2JVOA 3HXMA 2VBXA 4ZCLA 2CQ3A 3A3NB 2CPZA 3N5BA 3ZTQA 3FCHA 1KVIA 5DM6Q 4GKKC 3RW7A 2CU6A 1FK9B 4F4XA 1S57A 2F65A 3BYPA 1IBKF 3R2DJ 3M8WA 3OTOJ 4N56A 4FXDA 3CD0A 4J9LA 3CCUS 4FYWB 1FKOA 3CJ8A 2Z8QA 1MD9A 3MPYA 1X4DA 2D9PA 2LYVA 4HVZA 3EGWB 4WP3A 2QA4S 1B7YB 4OI0A 4W92B 1SJQA 5F3TA 3S8SA 1IKWA 1UKUA 3FQKA 3G8TA 4P7TA 2XBPA 1ZAXA 1QE1A 4CLWA 2DHSA 1XNRJ 2ZFHA 2R7OA 3DLGA 2K2PA 3O8WA 4IUFA 3AHPA 1HBUB 2N4CA 4I1TA 5KFTA 3R7SB 2CG4A 4O4RA 2DNZA 4ELUA 3R5CA 1VEHA 3DLPX 2DEJA 2LLZA 1RTJA 2QMXA 1VGYA 1BQXA 2C3UA 3CC7S 2Q43A 4HH1A 2RQMA 2HLUA 2L48A 3THPA 5AE1A 1PIEA 2LXFA 3H20A 3QFHA 3TUIC 1ULTA 2P20A 1E6YA 2FJBB 2XMWA 4C11B 1NLKL 3H8YA 2K1RA 3BGRA 4RUCA 1CJVA 1XMBA 3W5XA 4BDPA 4XTTA 2QSFA 2C22A 3Q24A 1N0VC 1Q7LB 5KG1A 1KN6A 4OYIA 2BKOA 2WW8A 2W9BA 4TQRA 4LFCF 1V26A 2XZTB 3DDKA 3FEYB 1R0CB 2NUHA 1VCTA 2DH7A 2V8GA 3PM9A 1S6OA 4A47A 3PZPA 4TY8A 2ZH6A 2KKHA 3HT0A 4NLTA 3PX4A 3PX6A 1L3UA 1VQPS 3DHWC 2EK1A 3CCRS 3TUFA 2HNYA 4DV2J 3HSZA 1RLDA 4RPFA 2IIHA 2M70A 2QL7B 3IFEA 3UR0A 3SDEA 1NDPA 1DARA 1S6PA 1V6HA 4NYZA 3DRYA 1RWUA 2N82B 1M1KT 2B9WA 3W9HA 2YKQA 4NEYA 3FK4A 3CC4S 2Y4NA 1C4CA 1HBNA 1H74A 5JJBA 2P2CB 1UVMA 2CZ4A 2Y8YA 3H42A 2GAHC 2VBZA 1IWAA 1KKHA 3M30A 4WJBA 1VHFA 2DGWA 1M5PC 3W2WB 5IT0A 4LVNP 2NSBA 3TJ8A 3TR3A 4JI1C 1GQEA 3D9BA 5F41A 4JI4F 4QW9A 3K17A 2XEXA 3QWUA 1Q5VA 2YY3A 4GKJJ 3KG0A 5HJYA 5E7OB 2JVRA 1HMVA 3QO9B 1NEEA 4LQ9A 1FDBA 4OHZA 2ZHBA 2LEBA 3GSDA 2IM2A 3HFVA 3K8WA 2J0SD 3P96A 1ELOA 2E44A 2QRRA 4LFBC 3RZAA 3TZZA 4KTQA 1WACA 1TVRB 3HI9A 3P4UB 4NWBA 3QAEA 3N2QA 3IC1A 2D69A 2VKZG 3QBCA 5EWFA 1JJHA 5DM7Q 4B3TJ 2DGVA 2CPEA 2FGOA 3ADAC 1F0XA 2J9CA 5FLXU 4ZVUB 5AJ3J 2E5LJ 1KC8T 1FO1A 5D0RA 5JRHA 2JX2A 4CLPA 1RT2B 1UMJA 3CWJA 3M9MB 4OHVA 3GIRA 2UUWA 1FFGB 3RU0A 4X4NA 1UJ4A 2CKWA 3C6TB 1P27B 4J5OA 1T03A 3NRBA 1LFWA 3RG6A 1U45A 1T5DX 1GXLA 1VC5A 3TUPA 1I5OB 3NAIA 2XMVA 2RDJA 1C0UA 3JXOA 1VISA 3OTEA 2RF2A 4DFMA 3HFKA 4IFYB 2DNKA 3UN2A 3KJVB 1AT1B 4GXRA 3FCVA 1RWNB 4F02A 1UW4A 2F8HA 3QLHB 1LNQA 1SCJB 2XSJA 3GYXB 1N5QA 4IFYA 1VOMA 4QPXA 2ATCB 2PMHA 4NA1A 5L1JA 5ITHA 1ZH5A 2JC1A 4FNIA 4DSJA 3OR2A 1RU1A 1RWVB 4LSLA 5D4NA 2RQCA 1NK5A 4LF6C 4LF7J 2HAFA 3FDSA 1JLFB 2R3VA 3OFFA 1S49A 3AOAA 4KGVB 4DL6A 5ETSA 3L09A 1U8SA 4LF8F 4OX9J 5HQLA 2MJNA 3TAMB 3W2VB 1HQUB 3A8EA 3PRVA 2XS7A 5GTDA 5DV9A 1WI6A 4WKYA 1YRXA 1QDUB 4PCQA 4DR3F 3CCQS 4OLOA 1FESA 1LWFA 4ZLLA 3LAMA 2BKNA 4KHMA 1NKEA 3MWBA 2WVFA 5IT9Y 4LF8C 2HZAA 2J0XA 3A4IA 4HT5A 1N33J 5CQGA 4QIVA 4QQBA 3VVTA 4WK3A 5K8MA 1N56A 1IBMC 3FBFA 3BYRA 1HLWA 3VQSA 3PROC 1P9YA 3PRBA 5A1IA 2AIRB 4ZDNA 2I5JB 3UPFA 2VJVA 3HCXA 2V9WA 1WOPA 2HVIA 2F4FA 2IFXA 3HVWA 2FHKA 3IO1A 3HM9A 2MM9A 2VFRA 4TQSA 2W4PA 2R42A 3A13A 5EHHA 2XS5A 2OPQA 2ZC4A 5KFJA 3OTOC 2CPXA 5L1KA 1V3ZA 1I94C 1HD0A 1A0OB 1RISA 3MCMA 2MSTA 2YKMA 3ENVA 3V81A 3QT6A 5DS7A 1NU4A 4D57A 1O5JA 5H9UA 1S7HA 1FRKA 5I42A 4FVMA 5D0EA 1NB7A 2GX8A 2ZEJA 3T1AA 3SEOA 4EZ9A 5C42A 3VF0B 1H98A 3PX0A 5ETOA 2KYZA 5KFSA 1NHUA 4J9OA 1PILA 2MLXA 3AA9A 1UWBA 2P9CA 5RUBA 4XDCA 4RVOA 2DNGA 5ETPA 2OO4A 2DYJA 3JAMD 2WVEA 4CNZA 4CDIA 3Q0AA 2RQ4A 4NLVA 1EARA 1ZM9A 1RA6A 2FQQB 4I69A 4IOCQ 1YX2A 2HHHF 5A1GA 1NJWA 3H0PA 4H4KA 1RI7A 3D28A 3NCRA 4M5LA 4U7CA 4TYAA 4DV2F 2R8JA 4FXWA 4E2FB 4YHHF 4B3MC 1RXOB 1S97A 5F8NA 4GC7A 3OR1B 2J76E 1VK8A 2D9OA 2P9EA 3M8QA 4DCPB 4C48A 1R43A 2H5EA 3PYEA 1FWLA 4DV0J 4DR1J 1ACMB 2NZ4A 2HJGA 1KNZA 4KTVA 3GR1A 1MXCA 1EB0A 1MXAA 5B7WA 4H54A 4DV0C 4DR1C 4TXSA 2YKAA 2AJ0A 3D3CJ 1Y3KA 4RLQA 4XIUA 1F5CA 3A9UA 4USUA 5GVQA 1FNXH 3RAMA 4LBIA 2AYBA 1KWMA 1YDLA 4DS4A 4WZQA 3AFGA 1M5SA 3FRYA 1PKUA 2HNDB 3VNQA 3AA8A 3US5A 4JI2C 2ROPA 1RKJA 4X4OA 1S1XB 3IMQJ 4ITSA 4DZ6A 4JYAF 2RB7A 4KQZA 1R89A 2EGTA 2NYIA 4MKBA 3UFCX 4CI0B 5KTQA 4O0NA 3X3UA 1Q95G 4FXVA 2GJIA 4JI4J 2YX4A 2OBVA 2YH0A 1X4FA 2RAQA 4GRSA 4IQMA 1YLXA 1C0TA 3D66A 3LO3A 1UWBB 4BCAA 4X4SA 4Y00A 3GV5B 3RAXA 1FCAA 4KR0B 4PZVA 5ADZA 5F9LA 4Q43A 1X4AA 2YBVA 1NCLA 3FJ2A 3OR1A 2AZ1A 4OZ2A 3MEEA 3W62A 3KLFB 4DUZJ 3RYLA 2GFFA 1WF2A 1CJTB 3NOCA 3M9OB 3DRPA 3TUZC 1WC1A 3EUNA 3Q2SC 4FKYA 4PWDA 3DAYA 1TU0B 3V81B 1FFSB 2GV1A 3NYRA 2RJZA 2IMOA 3D3BJ 3PFOA 4HL9A 3TVKA 3PV8A 1MROB 2E1MC 2FLNA 4LQ3A 2HHXA 2H65B 4DPOA 1HNZJ 1RB0A 2D27A 4FS2A 4K5SA 3TVYA 3UNGC 4L74A 3CPWR 4DSEA 4JI8C 4USVA 1IM6A 1RBLA 3F56A 1SIWB 4M5IA 3GIKA 3AT1B 3M6XA 1DQ9A 1V3SA 3OSNA 1RBAA 4NA2A 1TMJA 2WSEC 4B3SF 1QM4A 4OXIA 1XTZA 1MU2A 1N0UA 1OY9A 3WIUA 1OO0B 5GAEI 4Q44A 2AWZA 2KDOA 1XQIA 4LR8A 1CULB 2ADBA 2J7KA 1QAXA 2VG7A 4FZVA 2XHCA 4ED3A 2E9TA 1EZZB 2ZH1A 1HYSA 1BY9A 4ZKAA 2MKJA 4OX9F 5IQ6A 1YJ7A 4PPDA 3Q8YA 1IKVA 5HMXA 1SKWA 5IT9D 5AT1B 4I6AA 2BJ1A 1R7IA 3BKFA 1YJ9S 1R8AA 1EIYB 2VH7A 2YNIA 3DM2A 1NAQA 4H4OB 3MR6A 2Y8WA 2JH3A 3CCVS 1JLFA 3C3LA 2AEJA 1U24A 4GVLA 2R8GA 4LSLB 5IV3A 1ZAWA 3NXZA 1FDDA 2I8EA 4Z7YA 3R7NB 3Q8UA 4DSIA 2HFNA 3FEZA 5ETTA 3DRRA 3C19A 2A6OA 4DV3C 3N0VA 4HLBA 4QYZJ 4X64J 3K5NA 1HQEA 4JI1F 1UEUA 4DR6C 1VHIA 1J5OA 1N6QA 3TRGA 3DDIA 3AOBA 3J7YU 3BS9A 1HARA 3A3OB 3ONQA 1YSJA 1NPPA 3J80Y 3QZ8A 3JB9k 2ZHOA 3MPUB 1GT8A 1W2IA 3KFWX 5D0HA 1IBLF 1PBAA 2V8DA 4LF5F 2R7UA 3KNGA 1XMQF 4WIQA 4ETXA 2W4DA 3BM7A 5T8SA 2VA2A 1KTQA 3IR7B 4FN5A 3QT7A 1KONA 3QRQA 3PJ9A 2KZFA 1FDAA 5L9XA 4X66C 4IRDA 2B4PA 3PNIA 3V5RA 2VC0A 4URQU 4F4WA 1QAIA 1N52B 4NI2A 1RQ0A 1L3SA 3C16A 4DR7J 4G37A 3KJVA 3G82A 3R5GA 3HD1A 1JLQB 4DQIA 4HI2A 3JSMA 4DV7F 4YB7A 2EFVA 1FXLA 2ASDA 3WX8A 2CYYA 3JSRA 1OY6A 1D1UA 4V19X 3GONA 3QT5A 2EI5A 3KHGA 2AGOA 2PI4A 4HKQA 5LMUC 4PYAA 1WDTA 4JI0J 3HHNB 3PY8A 1LWEA 3BO3A 3Q23A 5LMUJ 1RT2A 4IR7A 1SIZA 3M1VB 3WQPA 3TNVA 4CLKA 4OI2A 1CC7A 3M2VA 5HATA 3CC2S 2MKCA 2HZVA 1FX4A 3IBCB 1WF0A 1XN9A 3M8RA 2H54B 1R8BA 4ICLB 3TW0A 1BQNA 4UZCA 2FYXA 2ZNYA 2RU3A 3PESA 4ZN1A 3W9IA 3G86A 1I51B 3TZWA 1O51A 2JEFA 2NQPA 5FDLA 2HRTA 2ERRA 1R8CA 2G2ZA 2G0CA 3OLBA 4A8WA 1VBKA 2UUAC 1TVRA 2DCUB 1DQAA 2Q79A 2YQ1A 3B4DA 4I6YA 3CQ2A 1H7WA 4ZA1A 2HQ3A 2UUCF 2IA6A 1XC9A 2HIQA 3D2WA 4IR9A 2ZD1A 2ZOMA 5DG8A 2UP1A 2MZSA 3SDEB 4L3NA 3L4BC 2YX1A 4OZ1A 2MSSA 4ZP7A 4FYDA 3ITHA 2ZNZA 4J9SA 3CW8X 5C5JA 2HNYB 5GAHI 1X0PA 4RW9B 3OXLA 4PABA 4UW2A 4ZJLA 2PFDA 1FX2A 5AXMA 4RNFA 5E41A 3J81U 4Q0BA 1SI9A 5ETMA 5IWAF 1LWXA 1TMMA 2BJ3A 2J6TA 4ID8A 3E51A 2ATLA 2RH3A 4Q5VA 1LWCA 1TL3B 4ZVRB 2E7VA 2KRRA 3D0GE 4LRFA 3MM8A 2C28A 3QJJA 1SPBP 3KG1A 4CIOA 2E7WA 5MAOA 3B7WA 2UXCC 4F3MA 3B54A 2V94A 2IC3A 2N3OA 2D1CA 4KY3A 1M0SA 4L72B 2UUTA 4QR1A 2P2JA 3TQIA 2VPXB 2WONB 4IQXA 2Y1RI 2GIFA 3KLEB 5KFRA 3RAQA 4ILMA 2IRUA 3W61A 2LXIA 2JEJA 2R7SA 2BANB 3I0SA 1CLFA 2RD5C 3CDAA 4ZVHA 2AU0A 4J90A 4XAKA 1L3TA 3OHAA 1HNVB 4WZMA 2V8HA 3AB4B 3LANA 1WSRA 4CM0A 5HMZA 4FS1A 4DLEA 3EICA 5E3RA 4R1MA 2WAQD 4CTAB 4DCVA 1LQ9A 2GMJA 3PACA 1TKTB 4NYPA 3MTJA 3DI6A 2D3ZA 2GMLA 5DZ6A 3KK3B 1CQNA 3UZ0A 3JSBA 4JV5F 4JI6C 5CH7B 4E98A 1DBDA 1U25A 3L8CA 4GVBB 3CJEA 3OJUA 2E5GA 2KB2A 2NPIA 2B6AB 2K8GA 5H1SV 3DLHA 4NLXA 4J91A 1N36C 1M5HA 2X1FA 5CYQA 1ZPVA 1YJTA 2B7CB 3LPEA 5DLGA 3W8GA 4A46A 2CQIA 3AF6A 4CYUA 1KBRA 2XMAA 2KT3A 1WWHA 2Y0SD 3E3XA 2NSCA 2AJ4A 4YFUA 4DI6A 1D09B 2CWKA 4CO5A 1TP7A 2V8PA 3RBEA 1QAJA 2GO8A 4IR1A 1EQ0A 1T9XA 1KLNA 2E9ZA 1J5EJ 4CO4A 1T9UA 1C1CB 2VG5B 2J6SA 1K47A 2MQ8A 2QX0A 3A12A 2DR5A 1UCNA 2XMTA 1FRIA 3CD7A 4LF2A 1FKPA 3DCAA 4DV5J 3U02A 2CFXA 4RUBA 3U1LA 3GV7B 3VZHA 3ISNC 1LW2B 2MLZA 3TYTA 2FHJA 2U2FA 4DX6A 3F0NA 1N8RT 1N4LA 1B0TA 3N9UC 1S0MA 3N6MA 2XC9A 2BA9A 2BH1X 5CZVA 3MUMP 3GJQB 3KLVA 1F6TA 2H5JB 5LL6d 4ZMMA 3BO4A 2YX7A 3MF5A 3MOZA 1QUVA 2XMUA 5IC6B 5LOQA 1XMOF 4Z37A 4Y34A 4ZVPB 2IAJA 4N8NA 4P73A 3R1HA 1M5VC 2BW2A 1PJ5A 3CCTA 2SXLA 2Y1LB 4K7QA 4DN0A 2CPFA 3N6LA 2B9EA 4DR4J 3TANA 1N5TA 2NYHA 4G1QB 3O6QA 3PFEA 1JLQA 4FDFA 5K14A 2VZ9A 3PW0A 5E3AA 1U2FA 3S82A 2D74B 2XTJP 3C16B 2DY9A 3O44A 1K8AT 3PO5A 3ILIA 4R8UB 3LNVA 4ICLA 2DBBA 4L7IA 1EKSA 2FPHX 1ZA2B 2UXCF 3CQ3A 3HO1A 2MZTA 4OLPA 3T1YJ 4M5JA 5SUHA 3E8OA 3MOJB 1LW0A 3QRRA 2NXJA 3TZXA 1UPMB 1PG3A 2VBWA 3CO0P 3QMQA 3SZ2A 2CZVC 1T7PA 3H2LA 5DQHA 3DGVA 2ZH3A 1G4CA 2AP6A 3QGPA 4DV6J 3NGSA 1N5YB 3DN9A 4DMZA 2XB2D 4NLUA 4JUZA 2DKOB 3RBZA 1WJ9A 2VFTA 2KG0A 3OL8A 2QL5B 1U7LA 2IM3A 2PA8D 2FC8A 4FNHA 4PAAA 1JLGB 5AE3A 3FGVA 1D9FA 4D56A 2AJQA 5F8JA 3SSQA 1HHTP 1TV6A 5C24B 3OPKA 5HLFB 4LFAF 1S4FA 4EYHB 5KFIA 2LDYA 4QWBA 4O3QA 3I56S 2GJFA 2D3OR 5K85A 5ETLA 2Y4OA 4DCSA 4OX8A 1S77D 3FEXB 2W4CA 1YRTA 4CM2A 3SMZA 3CGIA 2KZMA 1ZM3A 2M9KA 1NHKL 4FYYB 1Y10A 4ELVA 2HEKA 4NEZA 3AJ2A 2ZJPQ 3C6UA 2CXCA 5KT6A 4K4VA 2HQFA 3AB2B 4DU8A 1HW8A 4ZLJA 3UEBA 5DDPC 5KG0A 2EC0A 1TAQA 4R8UA 3QPIA 1QLNA 5ETKA 5HQMA 2K7KA 4P7VA 2EW9A 1KVKA 1IN0A 3G8SA 5J2NA 2R7QA 5C25B 4G1QA 2K3IA 3WC0A 5K8FA 2YNHB 1NPKA 2HS0A 2Z57B 3M05A 3NGRA 3MMCA 4G1IA 3SCJE 4DV7C 1M5OC 1Q8IA 2GIRA 4QU7A 1SH2A 2LEAA 1ZOTA 5B0BA 3CCJS 4DFKA 3CJKA 4DR3J 2XYHB 3DYAA 5KFUA 4F50A 2F4VJ 3ZZPA 4EU0A 5IWAJ 1FDNA 3GJTB 3IEVA 3DOLB 1MG7A 4Q2LA 2HVEA 2V4RA 3SCLE 4ZVEA 3SI8A 4Q8EA 1RHRB 1JMTA 1M1GA 4MK9A 5KFBA 3T5HA 1HNWF 1XMQC 2QYCA 1FJGF 2DHMA 4TY9A 1RTIA 4RBTA 4LF5C 2CPJA 3Q8VA 3HVTA 1K1SA 3AAWB 2GGPA 1FKPB 4RW8A 5DDQC 5HP1B 1YKWA 5FIIA 5LSRA 5HL7Q 3IAS9 1TKZB 1RT3B 2BJ8A 2CIMA 1S6PB 2DHGA 3O3LA 2E9RX 1N32C 2VONA 2BV3A 1BQMA 3ZNUA 3ZNJ1 5HBMA 4JOUA 1F3FA 2X1AA 3POTB 2AKWB 3RB0A 3C46A 2DY1A 2PDAA 5EWEA 3FFIB 3MEDA 4YHHJ 1PG5B 5CA5A 1VQ7S 4WFBQ 2W9CB 3I5CA 4OYAA 1T9TA 1FD2A 1GH8A 4LF8J 2MLYA 3D67A 1S79A 2NS1B 3EVOA 4CT9A 2B6AA 1XMOC 1E6VA 3E7XA 1VJQA 2L9WA 2R7TA 1IQZA 1CJVB 1YIJS 2I2YA 3C6UB 3PG9A 4QWAA 3DRSA 1TH5A 3QZ7A 2AF6A 4C11A 2DNOA 4HHJA 4WFNQ 2QSWA 3D1HA 4RKUC 2CVEA 4ERDA 3FZ2A 1NZAA 1R0BG 1Y5NB 4DXLA 2VHGA 3THVA 2ZC3A 1C1BA 4DPXA 5JMNA 2V2ZA 2ZBCA 2J9EA 1Y00A 1B64A 2KHDA 4A8OA 3H4BA 1RWKB 4K0KF 1XNQJ 2F4VF 2OLWA 1EHWA 5LSOA 6AT1B 5F8IA 1I94F 1NDLA 4B3SJ 3IRXB 4K4WA 1S9FA 3J81D 3IGNA 3KMSA 2ZBPA 3HKWA 5IM0A 3PDNA 3L95X 4RNHA 1NMEB 3FBCA 3TP2A 3GV8B 4DSLA 1N2FA 2LVWA 2W2PP 2WVCA 4O4GB 2BM1A 1HNWJ 2NR0A 1IUJA 2MEWA 4LR7A 4P2SA 1I6JA 1T3NA 4IH5A 5H9FK 4MMOA 1FJ7A 2WHOA 2HFOA 1JXEA 2XMJA 4TLRA 4U95A 4WKRA 3SFGA 2QMUB 3C15A 3TOQA 3NKYA 3CW9A 3ELHA 3K8VA 1NKCA 1E6VB 2C2NA 3KMQA 4M95A 4TPSB 1W7WA 4NPOA 3RUBL 3GJSB 4YY3J 2LA6A 4C8KA 1Q53A 2PIIA 3MR5A 2MQNA 4DUYF 1UP1A 3TQEA 5THWA 4B9LA 3FQLA 2Y9HA 1BHNA 4ALZA 2RE1A 4EO6A 3K2YA 5A8KB 3I96A 2XWYA 3LPYA 4LFAJ 3T3FA 2J7UA 2XG8A 1EP4B 3HX9A 4J9QA 1JNRB 4J9NA 3WC2A 2PI5A 2XS2A 1UJ6A 2LEPA 1UZHA 1HW9A 2FVCA 2RUSA 2A10A 3G2XA 3LP0A 3CB4A 4NL5A 4YB6A 3W63A 5GAGU 5KG6A 2MY7A 4UOGA 2VQEJ 2E5JA 2XLKA 1ZZNA 4PXBA 2FDNA 3K59A 2CNLB 4JI1J 1GXUA 2ZBIA 5BJRA 3T1HF 1BQNB 2G9OA 4LR9A 3K57A 4QIWD 2LQBA 4DG9A 3TO8A 4JI2J 5KFGA 4QOTA 3MPDA 1I3OB 1S0VA 3SXLA 4IG0B 1QAYA 3OXFA 3T6BA 1V5VA 3UR3C 2HGMA 3AQPA 3HVAA 4RNOA 1SL2A 3UO0A 2AEMA 2AHOB 4FVCA 1XRBA 1VLYA 3I87A 3TZYA 1KFSA 2VD3A 4NLOA 1ZAVA 4A4JA 4C8ZA 5KT5A 1USPB 2GVDA 1RWPB 2EFGA 4ENOA 3DFEA 3Q8RB 3GFYA 2XLJA 3MR3A 2VPWB 1SJ4P 3GZ7A 5D6GA 3T5LA 2DNMA 4PPZA 1OQ3A 4NLDA 3GCWP 5JXSA 3W5ZA 4X2BA 4I2QB 5T8TA 2XSJB 3KKFA 1S0NA 4YQWA 1KR4A 4YY3C 2C3PA 4KIAA 1JXLA 2D1TA 2LMIA 4F67A 4DV1C 1UEKA 1RHMB 4P2MA 3IWNC 1Z2LA 3IP0A 3MR2A 2RSQA 2WBRA 3BB5A 2UXBF 2CY1A 1WHYA 1IXKA 3E01B 4RW6A 2F5GA 2X3GA 2HQGA 1TFYA 5IT9U 1HNZC 3A4TA 2BOPA 3ZZOA 3KLGA 2KG1A 2HQIA 1FJGJ 2V63A 1KP6A 3IS9B 3H25A 4C9DA 2ZM6C 2DNYA 3V6HA 2DGXA 2GC8A 1RWMB 1A7GE 1IWGA 1HNXF 2HNZA 1RACB 4WPAA 1X31C 2DD8S 2B43A 5J2QA 1RT7A 2RRBA 4PG8A 2IJNA 3UN5A 4V19J 5DDRC 1S1VA 3PIOQ 4MFBA 5HN0A 3K6RA 3RV2A 4DUZC 3NGTA 4EI2A 3BH7B 2EFPA 1FFWB 2DNQA 2QYGA 3GJRB 3R3TA 4FPRA 2PMZD 2UUAF 2KU7A 2G4BA 2E5LC 1SQGA 2M7SA 1YZ6A 4P10A 3OVBA 1TKXB 4C3KA 4DBQA 3DXBA 1RABB 1JQGA 2VV5A 2C3OA 3NAHA 1DTTB 1WEZA 1MWYA 3OFGA 4M5DA 1BXNA 2HMIB 3DHVA 2BE7D 3H4DA 2DHAA 4KTTA 5KFHA 4K59A 1T9YA 3PTWA 4CLTA 1IKVB 2JL9A 1WC0A 4LJMA 1G7CB 1PBUA 1TL5A 2H3EB 1CS4A 3EXCX 4USTA 3NL0A 4DR3C 3QIPB 1H2TZ 4ID5B 2UXDJ 2VG7B 1HYSB 4ED6A 4IO9Q 4AT1B 3HKZD 1FI4A 1SUQB 4I64A 2ROGA 2XNQA 4ZVSB 2HWIA 4ATNA 4EBEA 4PUOB 3JQJA 2NCLA 1DLOA 3C14B 5GADI 2FVRA 3UCZP 3KLHB 2UV8A 3PO4A 4OZ0A 2D1RA 5DGAA 2HWTA 3QGIA 5LM7E 3H2VE 2EBEA 1GMUA 4UQGA 2MJUA 1CJUB 2HFSA 1CJUA 1KQGB 4Y28C 3J81Y 4PROC 1TL4A 2HBYB 3HP6A 4X66F 1X4BA 1Q5YA 3ZC4A 3G96A 2F7VA 2KFYA 2MQMA 3G71S 3CNQP 1OYEA 3THTA 1RAAB 6FD1A 4X4PA 1BWEA 4FF4A 2P6SA 5FDLB 5BSRA 3KUHA 4OYZA 1S10A 4WV3A 3R5AA 1LOUA 1CJTA 2E1CA 4ZPDA 3W65A 3IPLA 3MEGB 2WCXA 2JWNA 4A8XA 2MGZA 3MEEB 1RAGB 1B0PA 3ETOA 2CVIA 2OD6A 4P74A 2HGNA 4USHA 2KH9A 1S6QA 5EWGA 3ZZYA 2W9BB 3GR0A 4DR6F 3L7OA 3MCOA 4B02A 3LTOA 4OMFG 4WTYA 4C0OC 2KL8A 3V6DB 2OPLA 2WD9A 4BWJA 4MAKA 2C2ZB 1GMWD 4I4BA 3R97A 3U7JA 2J9DA 4BHQA 5J2PA 1T5HX 3QGGA 1IBMJ 3TAPA 2VQEC 3AOCA 9ATCB 1ZYQA 4N41A 1VR6A 2CRLA 3BBBA 4P2FA 1FNMA 4IFVB 5JVGQ 2KFZA 1LXNA 2P9GA 4DV7J 3CJ3A 1FE0A 1JX4A 2IVFB 4YP3A 3D1QA 3VVUA 2GVZA 3SQOP 2LQ9A 1V5IB 5CYQB 2QVZX 2VB6A 1WC3A 4ZPTR 4RU9A 2YQ0A 5J2QB 1LCIA 4OV6A 1RTZA 3GPCA 1T05B 4OX9C 2YWFA 3PCOB 5D77A 1Y9OA 2VASA 1SL0A 4F2SA 1XR7A 1GNKA 3HULA 4G6VB 2IM0A 4KC5A 5F0WA 1SQFA 4JV5J 3KK2B 1DFDA 2KZ0A 2UU9C 2BJ9A 3KK3A 4DV4J 4QIEA 4IDKB 1Q16B 5LJ5Y 3GILA 2WB4A 1ZPWX 1S12A 3MR7A 4P72A 4G65A 4DZDA 5DLFA 1JJ2R 4Q8FA 1X4HA 2IJFA 4EWTA 3ISZA 4C0HA 2WSFC 3BBCA 3M8QB 2DPLA 4GXQA 1X4EA 3Q86A 4MIWA 2MZRA 1RAEB 1RTJB 1HQEB 4LBPA 2MKKA 1SC4B 2KM8B 3LUSA 4A48A 3CT9A 3VAHA 2AQ4A 2JEGA 2RILA 3FMBA 4NA3A 3QSIA 1GFWB 2CQ1A 3NS5A 5LT5A 4JI7F 1VDHA 5BSMA 5I3UA 3OXGA 4B08A 4EO8A 1RT1A 1HWUA 2RIJA 4IG3A 5A2QU 4UUXA 5A6WA 3D68A 1JLCB 4DLGA 4AL7A 2C2MB 2BYCA 3PYDA 1USPA 2IBKA 3LQVA 4JI5J 1FKOB 4JV0A 1XR5A 5M2UA 2HBQB 3HSGA 3MM9B 2X1BA 1EGAA 3ZFVA 2FD2A 1S9GA 1JLEB 4U96A 3MM8B 4DV1J 1R8HA 3M4XA 4F26A 2ASLA 4M1KA 2FLOA 1K73T 5I42B 1FXDA 2ZBQA 3GP9A 4ZJQA 4B9VA 1NO8A 3EX7B 1IVZA 1P4EC 3EVMA 4WS9A 2ZVIA 2IM1A 2KJVA 4H4MA 2CXEA 2PEBA 5K9FA 3R5JB 2RHQB 2OPSA 2UVUA 2OFHX 3BN7A 3RTVA 1NUEA 3H5YA 4RW9A 1MU2B 1IM4A 4RUHA 2VBYA 2MY8A 1YGYA 1N5YA 2KTQA 3OTCA 1IBCB 3M8PB 3NP5A 4JYAC 1JLBB 4LF9J 2RQKA 2NXEA 2KVQE 4JI2F 3EJMA 5D78A 4LF9C 3CJ2A 4KRWA 2KZZA 1U49A 2NCKL 2YPZA 4OYWA 3W9JA 4O0IA 2ZH7A 1CEZA 3IEUA 3M8SA 3MAQA 1DZ5A 1ZBTA 1V25A 1KKGA 1T9VA 3QATA 2DNPA 4OYMA 4HTJA 3IGVA 4WFZA 1IBKC 2GHPA 3G7SA 2YNFB 3N79A 3C15B 3PRDA 4I68A 3ZZTA 1AXQA 3TAMA 4LFBJ 4LF6J 1AFJA 1RY2A 2R4FA 1RT6B 4LSNB 1DURA 1PJ6A 2DGUA 1HKAA 3R6GB 4R0EA 4F25A 4DX7A 2BDPA 2F1FA 3J7Z5 1DTTA 2Q6CA 1S0OA 2AMCB 5DO2A 2OJ3A 2IPOB 3VGTA 3OR2B 3TR5A 1PGZA 1B99A 1TKXA 1P6TA 3R5DA 2RRNA 4OX7A 4CO2A 5L1IA 1RLCL 2UUAJ 2GA7A 2L9DA 3G82B 2GQ2A 4WP8A 2CUYA 3UQSA 1S76D 2UXCJ 4D3GA 3QLHA 5CYJA 4Y2IA 4NI2B 1H38A 1VBYA 3P49B 4AL6A 1VS3A 4DG1A 1RTDB 6FDRA 5L9NA 2ASJA 2M8DB 2QLXA 2RF2B 1U26A 4KGMA 4UTGA 2B9XA 1RAHB 1G1XA 1U0HA 2IDEA 4DV5F 1TUGB 2DGQA 5FJ4A 4RL1A 3CIMA 1W26A 2JJ4D 2WOMA 4URSA 1U0SA 2LKZA 2R2SA 2ZH8A 5E5NA 2V34A 3ILJA 5BSVA 1G2EA 1GK8A 3RRHA 3OTOF 3GIIA 1Y5IB 4I7FA 1JWWA 1VC6A 3EPGA 4FTFA 3K89A 1PYSB 1ZB8A 1WD6A 1FERA 2JSXA 2P2BA 4PQAA 1REVA 1W25A 4QIGA 2Y1IA 4LRCA 1VRTA 1KRPA 3A8IA 1RWXB 2GVZB 1U1OA 4DL4A 4WIIA 2Z4PA 1Z2ZA 4KBIA 4P71A 4UY85 4K4SA 3LOUA 2EFNA 2GS8A 2B5JA 1YVFA 3O2IA 3PJXA 1EX8A 2VKRA 4IH6A 4ETZA 5CCMA 1P8GA 2W8LA 4NE9C 2GVDB 1JKHA 4JI7J 1WKKA 2MTLA 3NCPA 4HACA 3H59A 3H2UB 4KKOB 2YNIB 4WFXA 2B7BB 2RRAA 1YJUA 2PGCA 2Z58B 3BSCA 3KUEA 4PHTA 3NCQA 4UZBA 3MUVP 4ZCMA 2OPLB 4JI3C 2CAJA 2YWBA 2XZWA 4ZOSA 4HDGA 2RDIA 4DR6J 5J1EB 2V2QA 3M32A 3PYFA 4AFFA 1O9TA 4ZPVR 4C97A 2W24A 4ER8A 1JLAA 3W2WA 1HNZF 4XK8C 4DR5F 3C2PA 3H98A 1ZM4A 3ZTSA 1B7FA 2YKOA 4DV5C 4BC7A 1NK6A 1H73A 4K5RA 3VQTA 3J80D 4I9FA 3A3PB 1N32J 1PYTA 1T3OA 1UA0A 4OZJA 2DRAA 1I94J 4DUZF 4RU2A 4Y3CA 1J2VA 3KNAA 2HFVA 4CWBA 2Q66A 3BN4A 4FUQA 4I9GA 2MHEA 3FSIA 2CPHA 2QJ3A 4OIXA 4C4WA 4D4IA 3UVJA 1HNXC 4CP5A 3NMRA 2CNNB 4OI6A 4JI5C 2OUGA 3I5AA 1X5TA 2CADA 2AX1A 2YQ3A 3GCXP 4TY8B 1SJ3P 2JLFA 1M5KC 5J2NB 5HAOA 1X5SA 2E8FA 5FLXD 1H3DA 4YR2A 3DOKA 4ZCKA 3PW2A 3HDSA 1Q82T 4NOZA 2G1HA 1BD6A 1R0AA 1XRAA 5KFKA 2DCLA 3CJSA 5HVHA 1VRUA 2CQ4A 3AD8C 1LV5A 4ID5A 3TQ1A 2G2OA 4C8NA 3UWTA 1WG1A 4U5YD 1GEHA 2YWEA 4KGXB 4I7FB 2BE2A 2DITA 5KT7A 5GAGI 3LP1B 4P2XA 4DV1F 3KOAA 2F63A 5KG5A 5ETQA 2EG2A 2GJ2A 4KV8A 2F40A 4O4GA 3ENAA 3GIJA 5D15A 1YZ7A 2F8EX 2QA1A 1T8EA 2HMIA 1O90A 2P2MA 3F44A 2DPJA 1VIOA 4OX6A 2FHOB 1U0HB 1RTHB 1VQ4S 4LF9F 1K0TA 4RM3A 4DV4C 2BOAA 2ILZA 2YWWA 3KK1A 1KS2A 1SJ1A 4DV3J 3MXHP 4DG1B 2HHTA 4P6QA 5KFFA 3R6LB 3MAHA 3NS7B 4WXWA 4PYDA 4A8YA 1D0EA 4B3MJ 3K0JA 1M6XA 4LE5A 4KPYA 2MQQA 2AYEA 1SL1A 3CF5Q 4PXCA 3FCEA 1OMSA 2HWHA 3VGVA 1CPZA 1C1BB 5U47A 2WSCC 3KLGB 4NLWA 3GIMA 4TN2A 2ZM6J 5E33A 1CG2A 1WG4A 2DRDA 4MJKA 7FDRA 1XR6A 5KFMA 2MKIA 4DSKA 3T1HC 4CLYA 2OP5A 3IWXA 4U7UK 4NMXA 3MM6A 3KYLA 1YHQS 1ZTWA 2KXHA 3BPDA 1FUGA 3SSSA 3TJ9A 5HMYA 2ASYA 2BJ7A 4X65F 4ZS6A 4BWMA 4DQSA 2CDRB 1HPZA 3UX3A 2M52A 2OFGX 1D9DA 1HR0J 3JTNA 4LF7F 1KQFB 2A2DA 5K14B 4QYZK 3GYGA 1F9HA 1SV5A 4N47A 2ZJQQ 2DB1A 2DR9A 3NGKA 3NI2A 5H9FJ 3V4IB 5D3GB 3G4SS 2DR7A 2QIFA 1V9OA 1NSKL 1PYOB 1FXRA 3JS9A 3CMQA 4NDNA 3A8KA 2YVSA 1RT3A 2P02A 1TKZA 4ES2A 3LGXA 4TLQA 2HQCA 2DR8A 3QO9A 3WBZA 4YEAA 4PG4A 5DGBA 4F4ZA 5HP1A 2M5OA 2ZUAA 2NREA 2MYFA 5GMEA 2XY5A 3S01A 1RJJA 2XWXA 2OPPA 4F3QA 2QC3A 3HVRA 4X65C 2UU9F 1RHQB 3CCZA 5KFQA 2W7PA 3H40A 2ZH4A 2OPQB 4ECSA 3PR4A 2E8EA 3EVWA 4A8FA 5BR8F 2PE8A 4NLSA 5KT3A 3SFUA 1F5BA 4GKKF 3LAKA 4ANEA 1VQ5S 2PN2A 4NMLA 3BQ0A 1FEHA 2BACA 3DYAB 1C1CA 4ECUA 3HZGA 4K0KC 2WTFA 4ZN3A 2PC6A 2KRBA 2VFUA 4ZP6A 1X4GA 2VG6B 3F41A 1ZZFA 2RVJA 3G87A 2D3UA 4OQJA 5FD1A 1FRHA 4ZCIA 2J0WA 5JUMA 5BXIA 5GADU 4R5PA 1N5SA 1NXIA 3N6NA 4KFBB 3JAMY 1YRUA 2VDHA 5G4DA 1U2CA 3D6FB 1KEKA 3V6DA 1FWKA 4I56A 1LWFB 3SYZA 4RW7B 1GTEA 5H9EK 4OYCA 3TEHB 1A9NB 1S9GB 3EQ6A 1WHXA 4EGLA 2LCWA 2JC0A 3HJVA 1HI0P 2HLTA 1N88A 2J6UA 1HNIB 2RUGA 1FVQA 2DEIA 3U27A 2GAGC 1RUSA 4ZP9A 2KDNA 2KXFA 4DCTA 2VQFF 2FZCB 5J1NA 4IG3B 2Z0GA 4WCEQ 4AXIA 1UPPA 1SKRA 1MMLA 1Q4RA 2DISA 2E1AA 3GPAA 3NMAA 3PBKA 3ICLA 3UW1A 5IM0B 2AJ1A 2HVDA 4KHPJ 2ASBA 1WC4A 4LRBA 1HIYA 5IV4A 2Z2YB 2YKNB 1N32F 1RAFB 4CLFA 2DNLA 2JDJA 4DF4A 3DLGB 4KGKA 1SB6A 3FCWA 4ES3A 1JLGA 3J7ZT 2ZWOA 1J5EF 1NH7A 4DFPA 2D41A 3RB6A 4RVNA 1LEOA 1BLUA 1QE1B 4ZPCA 1U1QA 1XNQC 1T9WA 1IKWB 4WYLA 1S72S 1VFJA 1MDBA 1XWLA 4IDKA 4O23A 1HR0F 4M8LA 4J9VA 4MYTA 4DL3A 3KLIA 2CPIA 3UDLA 3NY0A 3ILOA 2AGQA 1JXVA 1TK5A 1N33F 4G36A 5HROA 4AUKA 1S5ZA 1YJNS 4ZPWR 1YJVA 2DXEA 2X1GA 4FKXA 1T05A 1IBKJ 2OI2A 2J8AA 1S6QB 2V69A 1FD8A 4NZ0A 3QQCD 4HYKA 3B8HA 2MGZB 3NBPA 4ECRA 4ZITA 2GCFA 4N5SA 2JEIA 3DLKB 2DH8A 3DOKB 4H4KC 5E3PA 5B0GA 2WBMA 3LP2B 3ZXWA 3VAJA 4ECYA 2YH1A 3M7VA 2RT3A 5LSLA 1MW7A 2FJDB 2WK4A 3JTPA 5LMNJ 1QTMA 4RNMA 1T94A 1Q78A 2HZCA 2DHXA 1VJWA 3CCWA 3IG1B 4NCGA 1U6FA 2XI2A 2HHVA 2FJAB 1CBKA 3EDRB 2AYGA 1LXJA 3RR7A 1BQMB 4MKYA 1M6XC 2FVSA 2CQPA 4RR5A 5LJ3Y 2X51A 4NZ6A 5EUHA 2IAJB 2VC1A 2AYMA 2HQDA 3RW6A 4P9SA 2V8VA 1HMVB 1XK8A 2WB1D 5BR8J 1KD1T 2I9SA 3KJQB 2ZM6F 3NNHA 1O92A 3Q83A 1KFDA 4ECQA 2FZKB 1K9MT 5CYMB 2GGPB 4RLFA 2H1YA 1TUWA 4HHHA 3N54B 3UDVA 2DHHA 4ZVGA 1HBOB 1JLAB 3CDBA 4DEZA 1TL7B 5J2MB 5CYMA 1H0HB 3UD4P 4OHYA 3NGUA 1CC8A 2JZ5A 3MMJA 2C42A 4F0KA 3M30B 5J1EA 3LWMA 4DF8A 3OL6A 1P9QC 1VQLS 2HYIB 2CDQA 3CO9A 2DGTA 3VV2B 4OHXA 1FF2A 3R9WA 1LWEB 5GMDA 3IM9A 4KAIA 2JLGA 1WTFA 2W1BA 3KLIB 4KPCA 4FF2A 2KI2A 5AXKA 4F36A 4TU7A 4NLRA 3I9ZA 3HPOA 2ZHAA 1UWDA 4K0BA 5DETA 3K58A 1Q8KA 2DXDA 4U8YA 1HH2P 1O93A 2ZH9A 4KO0A 4N8OA 1Z1ZA 2JLEA 2XZDB 4G1PA 2OTJS 3N5FA 3MMCB 3BDEA 4LIWA 1HD1A 1TFWA 1PA4A 2N3LA 3BR9A 5CZXA 3LW5C 2EEYA 2QW0X 2VDIA 2ADCA 4MFBB 2JNJA 2ZE2B 3HHLA 2PT7G 1RADB 1MKYA 3R1LA 1UEVA 3QIPA 4M63A 2QFJA 3L7PA 3BKUA 3VR1A 1XERA 3IXQA 1IJFB 1WHVA 3BZQA 2DJWA 2CQ2A 2PSZA 4GVBA 2V4JB 2DGOA 4LIRA 1T95A 1HL6A 2EC2A 3SBMA 2PN6A 4QBUA 1S7IA 1PCAA 1Y5LB 3RJMB 4P75A 2PO4A 5KFOA 4EBCA 3CMES 3VGUA 3D0IE 4USWA 3I32A 1WOSA 1O0PA 4FP9A 4QIFA 2XMKA 4ZP8A 4ZVOB 5KAKA 4AQYJ 3TAQA 1FJGC 5HMWA 4PWUA 3PEHA 4R1LA 1K1QA 3L7UA 4DCUA 1NBEB 4LSZB 2BVZA 2BEFA 4R0JA 5A76A 1PSDA 4KFBA 2MQPA 1ZM2A 4CH1A 5CXTA 2MMYA 1B70B 3HMJG 1EETA 2QO3A 3IS9A 1KLMA 2CQGA 3PVXA 1Y4ZB 3QNWB 4PG6A 3W66A 4DUYC 1WOOA 3I4HX 3CDWA 4DCJB 3EZ5A 2CZ9A 2MB0B 1MN7A 2UXBC 3Q89A 4DR7F 1WF3A 4USIA 2IC3B 1JJ4A 2PD1A 4C98A 1S9EB 1TL1A 4DG8A 3P5TL 1TUVA 4RO0A 3IBWA 4Y0FA 5E7QA 4L75A 4RW7A 3X1LB 2G0JA 1ZS6A 1BWVA 3T9ZA 2UXDC 2IDLA 4I6WA 1KTVA 5IZHA 2GIQA 2J9DE 2NXUA 4K8RA 3BJYA 2HGLA 3R27A 5IOLA 3CMAS 2LECA 3CULA 2CQ0A 3ET6A 1T0TV 1VQ8S 1UVKA 1ITPA 1I1GA 4PKDB 3NPDA 4EK2A 1VQSA 1WDDA 3C66A 4WP9A 3VAGA 4D3HA 2D3O1 1HWIA 1XNQF 1H7XA 3QWPA 5T41A 2KVIA 2O01C 2CJKA 2RDDA 2ZD1B 3T6JA 1XEZA 4DWIA 1OQ6A 4U7UD 4WE1B 4KH0B 4RM2A 3J7A1 1YBAA 2R7VA 2CQDA 3H90A 1NJZA 3WHIA 1WORA 4GKJC 2E5LF 1U8WA 1RT4A 2FJEB 2OPPB 2HHPA 2V0NA 5BYRA 2CJQA 3U1MA 4URGA 2R8HA 2YNGB 3VAKA 1NY8A 4DX8H 2V2KA 3KDNA 4ISBA 3MMBA 2XLIA 2VF3A 2CWXA 1UWAA 1SBRA 3M1VA 1FKAF 4WYWA 3I0RA 4I0WA 3MM6B 3HJFA 2UZAA 2VICA 2UXBJ 5EX3A 4W98A 4DV6C 3JTOA 1S9EA 1UL3A 3NOGA 4DUYJ 1N34F 4X4VA 3K5MA 5A19A 4F0MA 1J27A 5A8KA 1AROP 4ZK7M 2W9AA 2QL8A 3AF5A 1NSPA 3GG0A 1HHSA 4QR0A 1JLCA 4HTIA 5HQ8A 4EBDA 2E8CA 3I07A 2UV8G 4DR2C 4KB7A 3HHLC 5AJ3F 5I3UB 1RT5B 1KLMB 4YOEA 4Y65A 5JVHQ 3R9XA 4RNNA 1URRA 3ET6B 4AQYC 1VQ9S 1IR2A 3B78A 1UFKA 2B56A 4N77A 3G6YA 2OIHA 3N01A 3B6BA 5A8RA 4JM1A 2IYIA 3DLLQ 5GMKa 4ILLA 1HA1A 3IM8A 3VNRA 3BSOA 3D0HE 1VMBA 4NLGA 2ZOGA 3CJ4A 1RHUB 2GW8A 4NXNF 3AH6A 5C2GA 2WRMA 4B9NA 3CD6S 4YN3B 4HEA9 4ZVQB 4F0HA 4K50A 3I08A 5IWAC 4JI6J 3GFHA 4USJC 5LMNC 1OWXA 2E1RA 4A8KA 2M2BA 3MAAB 5B0FA 2R7XA 3DKDA 1R3NA 2OKQA 1RAIB 4U8VA 3UD3P 4NXMF 2PROA 4R0MA 2KT2A 4RW4B 3HFZB 1URNA 1MDFA 5DZ7A 3S1TA 2HBZB 2DRBA 2PT0A 2Y3YA 1NNDA 1CJKB 1P1LA 1QJHA 3TA2A 2XGQA 1IQTA 3DLEB 2RS8A 4KGZB 2OEKA 1X5PA 1AA1B 2O5DA 1D8YA 2OMOA 3SCIE 3RB3A 1IKXA 2V9KA 4IFVA 3UVJB 2KN4A 4DV3F 2EFQA 3RB4A 4LF7C 5KG4A 2UUBC 2WONA 4B3RJ 2LXUA 2QLFB 3NNAA 4B3TF 2ZKUA 2QVXX 3HF5A 1YJWS 2ZUGA 4XDDA 3TWZA 4IOAQ 1HHQA 3I6PA 3JQMA 1SC1B 4Y2CA 3ZTPA 1YBUA 2U1AA 5C42B 2BQ3A 4GO5X 2DVIA 1S1WA 3LGNA 4XPEA 3CTRA 2HIYA 3HVTB 3G6XA 2CJBA 3M6WA 5KG3A 1N33C 3FZBA 2WZ1A 4CRJA 4U6PA 5EN1A 3BKTA 4FBTA 3P3DA 3W3SA 3ETCA 1HR0C 1WC5A 4C3LA 2YKMB 2FB0A 2ZE2A 3QYYA 1FA0A 2Z2ZA 3ISND 4PWWA 4W4MA 3SQGB 3FFIA 2Q6BA 3MEDB 3WX4A 4RZRA 3OSPA 3KUGA 1U1PA 3EGNA 2C3MA 2OAUA 3GWCA 5HO4A 4OZ5A 3ZTRA 4O3RA 4B3OA 4K0KJ 4ED7A 4ECXA 3AD9C 2B4UA 2V50A 4USKA 1YQHA 2D7SA 4LF4J 5FLXY 2EKYA 5HI7A 2I5JA 3FUYA 3Q8QB 3T1HJ 1HNXJ 7AT1B 1IKYB 2BX6A 3U1NA 1MROA 4QU6A 1NSQA 3KLHA 1YBTA 3W7BA 2CJAA 3KDOA 1ML8A 3NS6A 1C4AA 2LU2A 3DLBA 3QFWA 2FUG9 2H51B 3WDOA 2DPIA 3DRXA 2ALYB 2IMWP 2YXLA 3W1YC 3DU5A 3MECA 2O1PA 2XHWA 4FF3A 2HHSA 3Q8SB 5A6PA 4S0MA 4PR6A 2HHQA 4OJ1A 4TKTA 1A6LA 2D7VA 3EM1A 4UT4A 2C2RA 3W2VA 3H5SA 4NRTA 3MHYA 3WIVA 2WOMB 2HHHJ 3CE8A 3MGJA 1LQLA 2B5JB 1FNOA 1IKXB 2LQ5A 1Z4UA 1O6XA 3EZUA 3IG1A 2YNHA 3EYZA 1TKDA 3DLEA 4L4QA 4ELTA 3LWLA 1QVFR 4LF1A 1XBWA 4PQUB 5KFAA 3GYNA 3OTBA 4O3PA 3W8PA 5KG2A 4B3SC 3G9CA 1AYEA 4NLYA 4ED0A 2VSQA 3NBPB 4F04B 2MZ1A 3OW2R 3MMAB 3RBDA 3MUTP 2ZITA 2DH9A 2IVMA 1TR0A 3BSAA 3CVKA 3MAAA 4U9RA 2FZGB 5T7LA 2WP0C 2IVYA 1HFEL 1U1MA 5LCIA 1F2GA 3AXKA 2EG1A 1AW0A 2V68A 2XCAA 2HVHA 2GO9A 2JNVA 1X9MA 1S1TA 5KOXA 4X4RA 2GQQA 3H2TA 1HWLA 1FT8A 2X7IA 4DDFA 3KLFA 5I3QA 4F7VA 1WKJA 1NK7A 5F8GA 3QJPA 5KFDA 5KYTA 1PC4A 2I1RA 2L9NA 1GAOA 1UTAA 2VOOA 1Y11A 3H5XA 1HI1A 4M5KA 2C3YA 2YKNA 1CSJA 3HHEA 3P6YC 3DDNA 3W60A 4RUAA 1KHWA 3DRRB 2HBRB 4I2QA 5BSWA 4HR2A 2CQCA 1VQNS 4YUDA 2M3DA 4IKAA 9RUBA 3T41A 5KFCA 2GZOA 4FPIA 3EWGA 1ZETA 1D3WA 2FLPA 4IOBA 2KXNB 1SKSA 2V2VA 1S99A 2IBOA 1RG9A 3G6ES 1X60A 3BGFA 3OHBA 5CD4A 1JB0C 3M9NB 1N36F 3J7AN 3D1OA 5ETNA 4JBCA 2JFDA 2O66A 2YNFA 5M2PA 1WCJA 2ZZNA 1DHMA 1U1KA 4G3IA 2UU9J 3BBFA 1WEYA 3KJNB 1SVDA 3QGHA 1FWPA 4JI8J 3MI7X 4X62C 2ZBRA 1MWQA 3BREA 3OL9A 3LAXA 1D8ZA 4O3NA 5KFXA 1F1BB 1FRJA 3TJAA 4DPYA 5KFYA 1Y7PA 5AXLA 5B0CA 4YDDB 1AFIA 3KXWA 4RBUA 2CQBA 5G0RA 3IAM9 3D6TB 1EKRA 3OQ2A 2MQLA 3EDQB 1H6KX 2W2NP 3OD2A 1Q79A 1RAOA 4EFAC 1YITS 4KHPF 3FRZA 4WE1A 5T14A 4WFAQ 1DJ0A 3M6UA 3K5LA 3UX2A 1NJIT 2IYGA 1GMVA 2QE5A 4A8MP 1REGX 4DOZA 2Y27A 3HHKA 1DRZA 5D3GA 2HHHC 1L3VA 3VGSA 5EDWA 4X4UA 1U1NA 4NCBA 3BF4A 1F2HA 5F8LA 3AD7C 2FLLA 1F9FA 2JHEA 2DK2A 1YG0A 1LK5A 3MTKA 1KOHA 4WK1A 4QW8A 3ZZRA 2QT7A 5IFMA 1KSPA 4B3RF 2PFFB 3M2UA 5I3PA 2A1BA 5HVGA 3R7BB 3MFHA 3CJ0A 4A8SA 2BBEA 2VQFC 2EWHA 3FNNA 3B4MA 1HQUA 2JOQA 1ROFA 2GQCA 3BGRB 3CCSS 3NGDA 4EMDA 2M8HA 3BGOP 4ECTA 3PXGa 1Q81T 2UVVA 2J8SA 3PR5B 4DV2C 3IA0A 1WUUA 4DL0C 2BM0A 8ATCB 3SV3A 4CQ1A 5KG7A 2R7RA 4ED2A 2A6MA 3EXYA 3PW7A 1KDNA 5T7LB 4JI5F 5CHCB 1OS5A 5L46A 3CJQA 1KVJA 3MM7A 2DIVA 4LRAA 3KTQA 1RP5A 2BJDA 2RU9A 3IRXA 3PKYA 2RS2A 1IJEB 2E0GA 1VLOA 1BUXA 1B4SA 1EJ7L 2VA3A 2LFVA 3C8YA 4PQUA 2BANA 4DR4F 1JIHA 4AD6A 1C0UB 5CCLA 2HAIA 2FGCA 3DI6B 4KH1B 4DR5C 2WVDA 1S48A 5L39A 3H5UA 5DQGA 4KV8B 1T11A 5K8NA 3ENQA 5F9NA 4OFZA 2B3TB 4MT1A 4PUIA 2YWCA 2CJYB 5DQIA 1TL3A 5KFEA 2UVRA 5ETRA 4FF1A 4K4ZA 1S1UA 1FJCA 1FK9A 1S59A 2W7OA 2QL9B 2WW4A 4ZJZA 1K0RA 2N7YA 2HG4A 3NEKA 1OYDA 3MPVA 3VAIA 3K7RA 4OJHA 4AYBD 1UVLA 3GLJA 4LF6F 5KT4A 2L41A 2P8IA 3KK1B 3HLUA 1DAXA 4TYBA 2W9CA 3CJTA 1RU2A 3TVZA 5IS2A 3ITHB 1BMQB 4YS2A 1JJCB 5AXNA 2W2MP 3LA0A 1Y0HA 4OV1A 3FSXA 4LT6A 5KOWA 2ONFA 2VODA 4WU3A 4PXDA 4K2XA 1FJEB 3A25A 4RLEA 2C2DA 2YTCA 2Y0BB 2BE2B 1FE4A 1F9EB 2IA0A 1OY8A 2OHDA 3A8JA 4Y2AA 3VWSA 2NZCA 2ZH2A 4EYIB 1RSCA 3RRGA 1NYEA 2AGPA 2Q3PA 3MEGA 3BQ2A 1R0AB 3GTYX 4M5GA 2ZH5A 1RTIB 2OGUA 1IBLC 4B17A 1OSDA 2OH2A 4ZLPA
chains in the Genus database with same CATH topology
4GKKC 5K85A 2Y4OA 4DCSA 3NI2A 4NDNA 1MD9A 1I94C 2P02A 3LGXA 1QWIA 2CXCA 5BUQA 3DLPX 5K8FA 5IFIA 4G1IA 3DHVA 2E8EA 4PZPA 5KEIA 4DV7C 4JI0C 3RG2A 5AE1A 2PN2A 2P20A 4K0KC 3IEVA 1V26A 1XMQC 4LF5C 5DV9A 3TUFA 3EQ6A 4BC9A 4JI4C 1N32C 1FJGC 2Y4NA 4DCTA 1BA3A 2ASBA 4RVNA 1XMOC 3E7XA 1XNQC 1MDBA 4JI7C 1ULTA 4LFBC 4XX2A 3N2QA 2XR1A 1P7LA 3J81D 4MH4A 3GKUA 4NXNC 3PBKA 3L95X 5JRHA 2QVYX 4LE5A 4YHHC 1N2FA 4IR7A 3KXWA 1T5DX 1O92A 3CW9A 4RLFA 4GXRA 3N54B 4HPVA 3IMLA 3R9WA 4B3RC 4LF6C 4OYCA 3FCCA 4X65C 4K0BA 1O93A 1HH2P 5GTDA 1XRCA 1PA4A 4R0MA 5CZXA 2QW0X 2MKYA 2YCBA 2PT7G 4DG9A 4LF8C 1MKYA 3A4IA 4KHPC 1IBMC 3PROC 2ATWA 1XRBA 4G36A 5A1IA 1USPB 1ZB9A 2JMPA 4RMNA 3OTOC 4R1LA 4DCUA 5T8TA 4YY3C 4D57A 2D1TA 5H9UA 3UOWA 4DV1C 4DUYC 4LF4C 2CY1A 2UXBC 4FUTA 1WF3A 4GS5A 2F4VC 1HNZC 4DG8A 4RVOA 2DYJA 2ZM6C 2OO4A 3JAMD 5E7QA 5A1GA 1L2FA 2UXDC 3RV2A 4DUZC 4B3MC 3NPDA 3SO4A 2HJGA 4KTVA 3GR1A 1MXCA 1MXAA 3CW8X 4DV0C 4DR1C 4KTTA 4RLQA 2D28C 3A9UA 4RM2A 4DR3C 3VNQA 4ISBA 4JI2C 4GKJC 2D1QA 2EGTA 3A9VA 4BBYA 2OBVA 5AE2A 1XNRC 2D1RA 4D4GA 4DV6C 4BCAA 5A19A 4PROC 5ADZA 2QL8A 3AF5A 2E8CA 3I07A 5A2QD 1VLAA 4DR2C 5BSRA 3R9XA 4WV3A 4AQYC 3IPLA 3E7WA 4JM1A 3VNRA 3ETOA 3DAYA 3NYRA 3GR0A 2OPLA 2WD9A 2D27A 2WP0C 1T5HX 5IWAC 3I08A 4RM3A 5LMNC 1QM4A 4OXIA 2PROA 1MDFA 1MXBA 4B3TC 4LFCC 2QVZX 1LCIA 3GPCA 4OX9C 1YJ7A 5IT9D 4JI8C 4LF7C 4LFAC 2UUBC 2UU9C 2QVXX 3VNSA 2DPLA 4GXQA 2P2QA 1N33C 3LUSA 3ETCA 1HR0C 4W4MA 4IZ6A 4DR6C 5BSMA 4TPSB 4NXMC 1USPA 4JI1C 4L2ZA 1EGAA 2E5LC 5T8SA 3C5EA 2VZEA 2KZFA 2V7BA 1JOSA 1ML8A 4X66C 4WS9A 1N34C 4BSZA 4G37A 4DV3C 2D7VA 5BR8C 2D1SA 3R44A 5BURA 4ODJA 5LMUC 4JYAC 1HNWC 1LQLA 4LF9C 4L4QA 3IEUA 4B3SC 1V25A 1KKGA 2VSQA 3PESA 4DR7C 2VQEC 1IBKC 2AYAA 2UUAC 3G7SA 1RY2A 2E7GA 3H2TA 1GPMA 5FLXD 5KYTA 5BSWA 5BSUA 1UKKA 1RG9A 3B7WA 2UXCC 3TQIA 5BSVA 2P2JA 4FTFA 4X62C 4JV5C 1ZB8A 3LAXA 2P2BA 2BJOA 4R1MA 1WH9A 4DCVA 4PHTA 4JI6C 3UZ0A 5BSTA 2Y27A 3L8CA 2HHHC 2UUCC 3CJEA 2OPLB 4JI3C 2YWBA 1PG4A 1N36C 1O9TA 3AF6A 4DV5C 4BC7A 3J80D 4I9FA 4FUQA 4I9GA 5BUSA 4DV2C 4D4IA 1HNXC 4JI5C 4EATA 2E8FA 4MTNA 3TDEA 4NOZA 2E0GA 2BH1X 1XRAA 5CZVA 4DR4C 4X64C 4U5YD 4DR5C 1O90A 2P2MA 2YWCA 3T1YC 4DV4C 3EERA 4ZJZA 2VQFC 1K0RA 3S82A 3NYQA 4L7IA 3LNVA 3FCEA 1J5EC 2ONFA 1PG3A 3T1HC 1NYEA 1AMUA 5KYVA 1FUGA 2P2FA 5AE3A 4D56A 1IBLC 4ZLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VNR A;  3DAY A;  5BSW A;  5BSU A;  3NYR A;  5K85 A;  2Y4O A;  3NI2 A;  2WD9 A;  3B7W A;  4OYC A;  1T5H X;  3FCC A;  1MD9 A;  5BSV A;  2P2J A;  3LGX A;  4RM3 A;  5GTD A;  4OXI A;  3E7W A;  4R0M A;  3LAX A;  2P2B A;  1MDF A;  2QW0 X;  5BUQ A;  2MKY A;  4DG9 A;  2QVZ X;  3DLP X;  1LCI A;  5K8F A;  5IFI A;  3GPC A;  3DHV A;  4R1M A;  1YJ7 A;  4PZP A;  5KEI A;  4G36 A;  3RG2 A;  2P20 A;  2QVX X;  3VNS A;  4RMN A;  5BST A;  2Y27 A;  3L8C A;  4GXQ A;  2P2Q A;  1PG4 A;  4R1L A;  3ETC A;  4D57 A;  2D1T A;  4W4M A;  4IZ6 A;  5DV9 A;  5BSM A;  3EQ6 A;  4FUT A;  4GS5 A;  2Y4N A;  4FUQ A;  5BUS A;  4DG8 A;  4D4I A;  3C5E A;  1BA3 A;  4RVO A;  2VZE A;  5E7Q A;  2V7B A;  4EAT A;  4G37 A;  4RVN A;  3E7X A;  4U5Y D;  2D1S A;  3R44 A;  1MDB A;  3CW8 X;  5BUR A;  4RLQ A;  1ULT A;  2P2M A;  3A9U A;  4RM2 A;  3VNQ A;  4ISB A;  4ZJZ A;  2D1Q A;  3NYQ A;  3LNV A;  2VSQ A;  3PBK A;  5JRH A;  3A9V A;  2QVY X;  3FCE A;  3G7S A;  1RY2 A;  1PG3 A;  2D1R A;  4IR7 A;  4D4G A;  3KXW A;  1T5D X;  3CW9 A;  1AMU A;  4RLF A;  5KYV A;  2P2F A;  5KYT A;  5BSR A;  4D56 A;  4WV3 A;  4GXR A;  3IPL A; 
#chains in the Genus database with same CATH topology
 3M32 B;  1R8P A;  4JI8 F;  3P45 B;  3M2V B;  4AL5 A;  4C8O A;  3D7S B;  4BS2 A;  2NXC A;  3DOL A;  4RWW A;  2VQE F;  1SQE A;  3TA1 A;  2B0G A;  2N4D A;  3MPW A;  4LRE A;  1YI2 S;  2K7J A;  2IHR 1;  4CNY A;  4RX6 A;  3HT3 A;  1OJ4 A;  1NZ8 A;  3P8B B;  4DPU A;  4USM A;  4B3O B;  1QWI A;  4NRU A;  2HRU A;  2F8M A;  4CO3 A;  3JSM B;  1WKL A;  4DQQ A;  4DJB A;  5DG9 A;  3Q22 A;  5KFP A;  2VPZ B;  3SQG A;  5C25 A;  2L08 A;  2QA4 G;  3OT9 A;  2M5H A;  4TNO A;  3LUY A;  4Y2K A;  3L3C A;  4LFB F;  5BUQ A;  4OL8 A;  1NRK A;  5A8W A;  4ECW A;  1VYA A;  4JI0 F;  1C2P A;  2FTR A;  5IT4 A;  3MFI A;  5IFI A;  4NYO A;  2VJU A;  1MNE A;  2DR6 A;  3QJL A;  2BQR A;  4F4A A;  4JI3 J;  1VRQ C;  2BKP A;  5HRO B;  2FHJ D;  3EPI A;  2CG8 A;  2R7W A;  3CQ1 A;  4PZP A;  4JI0 C;  5KEI A;  2K1R B;  4CLZ A;  3RG2 A;  3ZTO A;  3OL7 A;  1XS3 A;  2RKI A;  4MKV A;  1E6Y B;  1WNE A;  1JKH B;  2Q1L A;  3E01 A;  2AJF E;  2AZ3 A;  2BXJ A;  3VCD A;  3ULH A;  2LU1 A;  2G1D A;  1L5U A;  4F2R A;  1X0F A;  2ZZM A;  1S6U A;  2E7X A;  1AZS B;  2AT1 B;  4MTP A;  5E0O A;  5BYQ A;  5KFL A;  1NM2 A;  1MN9 A;  1R27 B;  2K06 A;  2LQJ A;  3FSY A;  4UOH A;  5HJX A;  3GQC A;  1S1V B;  2COL A;  1V60 A;  1X4C A;  4WF9 Q;  2R2T A;  1L2F A;  1VQY A;  3M2R B;  3NLC A;  2P6T A;  3CSK A;  2JRS A;  3O5T B;  4X66 J;  1REV B;  5A8R B;  1U1R A;  2DNN A;  3D6H B;  3AJD A;  2BMB A;  1QD1 A;  3GFX A;  4FYV B;  4QJV A;  1F60 B;  4UUW A;  3UE2 A;  4C6A A;  1JK9 B;  2IJR A;  3JAM U;  4MIA A;  3G6V A;  2B9Y A;  2YPY A;  2D1Q A;  1QVG R;  3CDU A;  4HDH A;  4BC9 A;  4Q2M A;  5F3Z A;  1Q86 T;  3PKM A;  4JI4 C;  4MYU A;  2BW7 A;  2KJW A;  3AOD A;  2MXY A;  4K4T A;  1QSS A;  2H9Z A;  2G0I A;  1VK3 A;  4OHW A;  2CPY A;  2A18 A;  1PC5 A;  3GFZ A;  4P52 A;  3KHL A;  5EX0 A;  1PAE X;  1T03 B;  2UVW A;  1BA3 A;  4CO1 A;  3ILL A;  2XNR A;  3M2U B;  1LW0 B;  2K3K A;  4K2J A;  3R9L A;  1H2V Z;  4WU2 A;  5HSP A;  1VQO S;  4B9U A;  3PW4 A;  3GG1 A;  3I4P A;  2MZJ A;  5A8W B;  4X84 A;  2YNG A;  2R8I A;  4QCL A;  1Q8L A;  1RTD A;  2HUR A;  1P4E A;  1CQM A;  1SXL A;  1JNZ B;  1DTQ A;  5F8H A;  4F4Y A;  4ZLN A;  4RBV A;  2UUB F;  4W90 B;  1MLA A;  4JYA J;  2JFK A;  2KHC A;  3MCN A;  4JI7 C;  1T02 A;  1RE1 B;  2CNO B;  2F9D A;  2H4Y B;  3NWG A;  3CUN A;  2ZWP A;  4X4Q A;  1VI7 A;  3DM2 B;  2H48 B;  2EKN A;  1UKK A;  4KHR A;  2GHW A;  2KT5 A;  3QT8 A;  3TX8 A;  2HK3 A;  4DPT A;  4XX2 A;  2ZVS A;  2YWH A;  4I67 A;  1WF1 A;  1RAJ A;  5ETV A;  1CVJ A;  4PUH A;  2H4W B;  3BR8 A;  2XR1 A;  3GB0 A;  2J5A A;  2R9L A;  2QA2 A;  3K5O A;  4C8M A;  3EE3 A;  4ZPA A;  2EBG A;  3DRP B;  5KFZ A;  4J9K A;  4DV0 F;  4DR1 F;  5A0Y A;  2M0G B;  5A0Y B;  3M8Z A;  3CED A;  4QPT A;  1AB8 A;  1Q1K A;  5CAB A;  2BRK A;  4Y2M A;  1P7L A;  3GKU A;  4MH4 A;  4NXN C;  4MKA A;  3MUR P;  2OEL A;  4J37 A;  3ENW A;  2QVY X;  3DOM B;  4B3M F;  4YHH C;  2LQ8 A;  1NKB A;  1JLE A;  4C8L A;  5DG7 A;  1GXT A;  4E8U A;  2FVP A;  2XMM A;  4DL5 A;  1G3O A;  3I55 S;  2LDI A;  4ZJO A;  5C7P A;  4F4K A;  5CAA A;  4PUG A;  3IR6 B;  2QLW A;  1RT1 B;  3JYT B;  1K0V A;  3UCU P;  2QGF B;  4ED1 A;  2NPF A;  4NAS A;  5D4L A;  1XHJ A;  1DTQ B;  5E2Q A;  2C2E A;  2GMH A;  3T19 A;  3HHD A;  3PYG A;  4J9M A;  5H9E J;  3PHT A;  3KHR A;  1TK8 A;  2QLJ B;  2RNE A;  3LGH A;  1RDR A;  4PG5 A;  1TTH B;  5L8R C;  1S1U B;  3IML A;  4HPV A;  1TAU A;  3ETM A;  2A0F B;  2DYA A;  2HKE A;  3AXM A;  2QEX S;  2J7W A;  1N5V A;  4B3R C;  3CCL S;  1M1H A;  2ACY A;  3PJW A;  1N54 B;  4M5N A;  2F9J A;  4ED8 A;  1OSC A;  3BH6 B;  3HZE A;  2MPU A;  4YB1 P;  3FCC A;  4V1A k;  5D0G A;  3OVS A;  2XQC A;  1WHW A;  4C3M A;  2MKS A;  5D4P A;  4X62 F;  4QR2 A;  2FVQ A;  4O3O A;  4C0B A;  4ECZ A;  5LXY A;  4GKJ F;  1WEL A;  1XRC A;  1EET B;  2DT9 A;  3J80 U;  3J81 j;  1XMO J;  3CCE S;  5DDO C;  4DCO B;  2W25 A;  4CLL A;  2MKY A;  2MKH A;  1UW9 A;  3M2R A;  2IRY A;  4OI1 A;  1FHT A;  3UD5 A;  3UI3 A;  1HBU A;  2YCB A;  1HNV A;  2LP4 A;  2W01 A;  3MM7 B;  1KOO A;  2HND A;  3ZZZ A;  1QSY A;  4NXN J;  2MCQ A;  3CD5 A;  4HHU A;  1WG5 A;  1IBM F;  4KHP C;  1AZS A;  1PAU B;  4UOF A;  2ATW A;  1RKI A;  3LH2 S;  4NCA A;  2V6A A;  3HSD A;  4X64 F;  1OIA A;  3IRW P;  3RRK A;  1ZA1 B;  2V67 A;  4Z2X A;  2XCP A;  1SJF A;  2AJ2 A;  2OPR B;  2M4M A;  2RKI B;  4DUT A;  2UUB J;  2KYX A;  1ZB9 A;  2V4J A;  2JMP A;  4RMN A;  3S6E A;  2XO6 A;  5D4O A;  4OJ3 A;  3T1Y F;  1G6B A;  4LUB A;  4PG7 A;  4UQT A;  3UNY A;  4U67 Q;  4PEO A;  1LWC B;  2VPY B;  4OI3 A;  4TVA B;  4DN9 A;  4EZ6 A;  1QUP A;  4DR2 J;  1Q7Y T;  2RHS B;  4YB5 A;  1DY3 A;  1BE4 A;  1BGX T;  1RZM A;  2HHU A;  2E1P A;  4OYB A;  3UOW A;  1FTR A;  2WVB A;  3OFE A;  4Q0B B;  2CPD A;  1FRM A;  3POT A;  5SZT A;  4E0D A;  1XIQ A;  4UOC A;  4KO0 B;  1N48 A;  4LF4 C;  1TK0 A;  3BV8 A;  4FUT A;  4CH7 A;  3SCK E;  1UVJ A;  4K4Y A;  2KFN A;  4WFY A;  4GS5 A;  2F4V C;  2Z51 A;  1U02 A;  3CJK B;  4OZ3 A;  5A2Q Y;  3NWR A;  3D54 A;  2XY7 A;  2G2Y A;  1NJY A;  2FJV A;  3QAU A;  4L73 A;  2HVZ A;  4C7Q A;  3VTI A;  4TU9 A;  4X4T A;  1DLO B;  3C14 A;  4NZ7 A;  2ZOF A;  3DMJ A;  3LP2 A;  2Y1J A;  1RA7 A;  4Z7C A;  4J9P A;  2VU5 A;  1U6Z A;  1HI8 A;  2OSQ A;  3LAL A;  4ECV A;  2CJ9 A;  4F8R A;  2YWK A;  3BO2 A;  5HVF A;  2CNK B;  3FVY A;  3SIP B;  3LGM A;  4EUV A;  1RWO B;  1TQL A;  3SO4 A;  1Y3J A;  2FC9 A;  3UDC A;  3FMW A;  1UFL A;  2VQF J;  3QRP A;  2DIU A;  4I2P A;  4LBH A;  4QYR A;  3A1Y G;  3OTD A;  4C2M A;  5CD4 H;  1QY7 A;  2H5I B;  4MIB A;  2G13 A;  3GMG A;  4KKO A;  2B8P A;  2NXN A;  5B0D A;  4YY3 F;  3BGU A;  2MMA B;  4HT7 A;  2D28 C;  3NG8 A;  4M5D B;  4L76 A;  1HQ2 A;  4JP8 A;  2E5I A;  2DXF A;  5K8P A;  4LFC J;  1SH3 A;  3MM5 A;  3P5B P;  1ICE B;  4CH0 S;  5HLF A;  4PUO A;  1UVN A;  2HFZ A;  2MDA A;  4IYQ A;  4R25 A;  2PA3 A;  1SUQ A;  3MEK A;  3HK2 A;  4RW4 A;  1PO6 A;  5D8H B;  3PIP Q;  1X7V A;  3AJ1 A;  1GTH A;  4UF4 A;  2XGP A;  4DQP A;  2PMW A;  2AW0 A;  1IB8 A;  1WI8 A;  3I31 A;  4M5H A;  2BQU A;  2HNZ B;  2IY5 B;  3ZZ0 A;  1CS4 B;  4BBY A;  3A9V A;  4UY8 T;  4CT8 A;  4DX5 A;  5AE2 A;  2XY6 A;  4J9R A;  1XNR C;  2XYP B;  3MDF A;  2X3D A;  4HI1 A;  4D4G A;  1S1T B;  1TEL A;  4L2Z A;  1EQM A;  4LRD A;  3C6T A;  3CCM S;  4ZIW A;  4A8Q A;  1Q8B A;  4RW6 B;  2XI3 A;  4DL7 A;  2VIH A;  1X9S A;  2Z2L A;  2CA9 A;  3GU0 A;  5E3Q A;  5A2Q D;  1VLA A;  1YJR A;  2QN6 B;  1J5O B;  3KXD A;  1TV6 B;  3BDP A;  1HWK A;  2OEM A;  2OSR A;  2M88 A;  4YDX A;  3SSR A;  3CXC R;  3E7W A;  1S4E A;  3ZO7 A;  3M6V A;  4JV2 A;  4Q45 A;  1RT7 B;  3M8Y A;  1RT5 A;  1V3R A;  4NOH A;  4WWS A;  1XMQ J;  1L3K A;  4R5P B;  1SC3 B;  4B9M A;  1NK4 A;  4KYZ A;  1FVS A;  1RK8 A;  3B82 A;  1VC0 A;  3ZZU A;  1SH0 A;  5I4M A;  2FHM A;  4ES1 A;  5IXU A;  1BC6 A;  1HNI A;  5HAN A;  3DGP A;  2KO1 A;  5F0U A;  4FBU A;  3V4M A;  2BR0 A;  3I0R B;  2Z56 B;  3PHE A;  4I2P B;  1UJ5 A;  3F73 A;  3MMB B;  4B9T A;  2HRY A;  2BZ2 A;  5KFV A;  2HHW A;  4ED4 A;  2Z2M A;  2KM8 C;  4NLP A;  2C2O B;  5K8O A;  4ED5 A;  4WXO A;  1UA1 A;  1MXB A;  3V2U C;  4B3T C;  1M90 T;  4LFC C;  2HW3 A;  4Q7A A;  3CJR A;  3DMJ B;  2MZQ A;  4AND A;  4OYO A;  2BUN A;  1NSA A;  3N28 A;  5DRK A;  1X8D A;  3MD1 A;  1HWJ A;  3UCG A;  4Y6I A;  2VG6 A;  1IKY A;  2DO0 A;  4AE5 A;  4JV5 C;  2XSF A;  4LFA C;  1HBN B;  2QFI A;  4CLU A;  3CDE A;  2DTJ A;  3OFH A;  3IN5 A;  2XUL A;  4QWC A;  4M94 A;  4AQY F;  3VNS A;  4DQR A;  1EP4 A;  1RCO B;  2B51 A;  1R31 A;  1TZ0 A;  2MHN A;  5KFN A;  3BQ1 A;  5LMN F;  4WBF A;  2PEH A;  3HHL D;  1AUS L;  2BAB A;  3R8Y A;  2P2Q A;  1GMW A;  5G0R B;  1ULR A;  4PRF A;  4TU8 A;  4F3O A;  3O1L A;  1D9A A;  4C8Y A;  1HPZ B;  1RHK B;  1UZD A;  4DV6 F;  4MK7 A;  1U48 A;  3IBF B;  4IZ6 A;  2N7C A;  1FEE A;  2CJX B;  4GC6 A;  1WEX A;  2DGS A;  1RBO B;  5IC4 B;  2EXU A;  2YWG A;  1S1W B;  4GO7 X;  4K4U A;  3LNO A;  2W2Q P;  3HSJ A;  3MM9 A;  2C1E B;  3D6M B;  4XPC A;  4XO0 A;  2R2R A;  4NXM C;  4X65 J;  2EVZ A;  2VG5 A;  2OPR A;  3DGP B;  3VAL A;  2A3J A;  2QTW A;  4ZPB A;  5M2R A;  3RBX A;  3TUJ C;  5KT2 A;  5GAE U;  2OD4 A;  4RJV A;  2QV6 A;  2MQO A;  1TKT A;  3T5K A;  2W8K A;  4DR2 F;  1SC6 A;  3V4I A;  5DJB A;  3EGZ A;  3C5E A;  2VZE A;  3G8Q A;  2V7B A;  1JOS A;  4OI4 A;  4CYU B;  4BLG A;  1WH9 A;  1CJK A;  1N34 C;  3BEG B;  4BSZ A;  3R5B A;  3IWL A;  4ZVT B;  2FJX A;  4AXJ A;  1FRX A;  4ILR A;  1S1X A;  1Q0N A;  2F3J A;  3I0S B;  4FYX B;  1IR0 A;  2E29 A;  7FD1 A;  4DPW A;  4YME A;  1UVI A;  4IO1 A;  5C2C A;  2D1S A;  3KLE A;  3R44 A;  5BR8 C;  2ZKT A;  1KQS R;  1NDC A;  2RML A;  3L9Z A;  5BUR A;  5BYS A;  4J9U E;  4ODJ A;  1HNW C;  2QLB B;  4ANC A;  3KK2 A;  2UUC J;  2ILY A;  2OEJ A;  4CTA A;  1LKZ A;  1DQ8 A;  3DRS B;  5MLC V;  4K4X A;  1MWZ A;  2ALZ A;  1RWW B;  5EGY A;  1EAY C;  3UDE A;  3OLA A;  3MMA A;  2R8K A;  1VRU B;  3QSY B;  1VQM S;  1H2U X;  3Q2T C;  2C2K B;  3T5J A;  4DR7 C;  1WSV A;  1IR1 A;  2VUG A;  3I9V 9;  5B08 A;  3OV7 A;  2FJW A;  4IRK A;  2DO4 A;  3A26 A;  3DLJ A;  3JYT A;  2L3M A;  3IR5 B;  3VZI A;  1WTB A;  2HS3 A;  5L1L A;  1RTH A;  2V5H G;  4QWE A;  2Z30 B;  1NPR A;  3DHX A;  3BSN A;  2AYA A;  1NK9 A;  1RCX B;  3OBI A;  2B4V A;  2BJE A;  4MH8 A;  8AT1 B;  3MD3 A;  4CLS A;  5HBM B;  5K20 B;  5J2P B;  4QZV B;  4DSF A;  2UXD F;  2E7G A;  3V6J A;  3CIZ A;  4KE5 A;  1U4B A;  3LP1 A;  1AUD A;  3DOM A;  2HSE B;  3KHH A;  3CJ5 A;  5HK4 A;  3WZ0 A;  1GPM A;  2A2C A;  4CZC A;  1HBO A;  3MEC B;  4JI6 F;  1QM9 A;  3MCS A;  2J0Q D;  3I82 A;  1RGV A;  2ZDP A;  4CCH A;  2GHV C;  3GE9 A;  2ABY A;  1YK9 A;  1U1L A;  2FIU A;  2O3D A;  1VBX A;  1XJW B;  1VQ6 S;  1XNR F;  5BSU A;  3TEG A;  1FRL A;  5KFW A;  4NLQ A;  3PEJ A;  3KJF B;  3DNC A;  4KSE B;  2HS4 A;  1B3T A;  4DFJ A;  2DNR A;  1VQK S;  1PU1 A;  4NCG B;  1U47 A;  3TA0 A;  1RHJ B;  5F8M A;  2ZJR Q;  3JQK A;  4LVO P;  2VFS A;  4DU7 A;  4ZHR B;  4RW8 B;  3LF0 A;  4DV4 F;  3DLK A;  1B0V A;  2GNK A;  3RR8 A;  1NJX A;  2ZZT A;  4JV1 A;  2P5V A;  1FTC A;  2BJO A;  1R6V A;  1VRT B;  4GMK A;  4NX9 A;  5B0E A;  1HBM B;  1PJ7 A;  1R6Y A;  3OUY A;  1LK7 A;  3V6K A;  1N34 J;  1P1T A;  1X5O A;  2HFU A;  1NK8 A;  4O3S A;  2BE9 B;  1OPZ A;  2QZ8 A;  2R2U A;  3NNC A;  1W2B R;  3FKB A;  3T9N A;  1TL1 B;  3BGL A;  1QTN B;  3FBB A;  3KWM A;  2V4Q A;  1NK0 A;  4HAC B;  4DHV A;  4QWD A;  5J1P A;  4HH0 A;  3AY0 A;  5BST A;  4GKK J;  2UUC C;  2W7A A;  1NH8 A;  2YKP A;  1KHV A;  2LA4 A;  8RUC A;  1N6Q B;  4WTO B;  3DU6 A;  3TAR A;  2DNH A;  3QID A;  3AQO A;  1IBL J;  2FY1 A;  1PG4 A;  1NDK A;  4LMZ A;  2EFO A;  1U2R A;  3JSY A;  4O44 B;  4O44 A;  5E3C A;  4ZVF A;  2I6W A;  1U09 A;  2EK6 A;  1K44 A;  1H72 C;  3VAM A;  5K5M A;  4LF4 F;  3E2E A;  3I5B A;  2VL1 A;  4OJG A;  2QMW A;  2HK2 A;  3FBE A;  3S7R A;  3TI0 A;  1UAW A;  1GX5 A;  3KG4 A;  4B9S A;  4DS5 A;  3OVA A;  4L3K A;  2B4O A;  1OPI A;  2NLW A;  2O67 A;  4H4O A;  1F5A A;  2OTL S;  5BUS A;  1RT6 A;  1WC6 A;  4LSN A;  1QSL A;  4LF5 J;  1FLO A;  2ACM A;  2AV5 A;  2ROE A;  3CW2 C;  3D4J A;  4EAT A;  3W64 A;  4JI3 F;  4NXM J;  4M5M A;  3O2E A;  3EGV A;  1HBM A;  4JB8 B;  5C24 A;  3OUY B;  4MTN A;  4OYP A;  3TX0 A;  1O8B A;  3HHL B;  5LMU F;  3D5M A;  3TDE A;  2E66 A;  2AEF A;  3SV4 A;  4KT0 C;  4J7C A;  4N7T A;  1LFP A;  4X64 C;  4DR4 C;  2I38 A;  3MM5 B;  4ZHR A;  3BPS P;  3MZI A;  3K5P A;  1APS A;  2EPI A;  1F3V A;  1GX6 A;  4OZL A;  1YTY A;  1NB2 A;  4OYX A;  4EEY A;  3UN3 A;  4KJI A;  2VFV A;  1VIX A;  3DXS X;  4OZN A;  3OJS A;  1JLB A;  4IRC A;  3PW5 A;  1MMD A;  3Q8P B;  3EMT A;  2M5Y A;  3RGI A;  3VHQ A;  1SJR A;  2POK A;  2QG9 B;  3GSI A;  4IG0 A;  2AX0 A;  1UET A;  4PXE A;  2AD9 A;  3T1Y C;  3EER A;  3DC2 A;  1KQK A;  3W5Y A;  5LXR A;  1X9W A;  4PWD B;  1MSW D;  1TL7 A;  3H7H B;  4ZIV A;  5J2M A;  1CUL A;  2OPS B;  4IH7 A;  2FY8 A;  4RWX A;  2IRX A;  1VBZ A;  3NYQ A;  2NUU G;  3HD2 A;  1RT4 B;  4X62 J;  1YWX A;  4H4M B;  4YR3 A;  2XM3 A;  1U6B A;  4L6V 3;  5GAH U;  2XYG B;  1LW2 A;  4YR0 A;  4N76 A;  2B8Q A;  2HPU A;  1MMN A;  5B0A A;  3EZO A;  4CO0 A;  2BRL A;  1ZTT A;  2E5H A;  2CQH A;  2I0X A;  3N4W A;  1SKU B;  1J5E C;  3LP0 B;  2APO A;  3FC9 A;  5B09 A;  1RYR A;  5L38 A;  4DR5 J;  1RYS A;  3M8P A;  1C0T B;  4MK8 A;  2XO7 A;  3J7Y I;  4DL2 A;  3R2C J;  5IQQ A;  2ZDO A;  2OML A;  1SV5 B;  1UFW A;  3VAF A;  2W2O P;  1AMU A;  5KYV A;  2P2F A;  1NHV A;  1N36 J;  2VOP A;  2JVO A;  3HXM A;  2VBX A;  4ZCL A;  2CQ3 A;  3A3N B;  2CPZ A;  3N5B A;  3ZTQ A;  3FCH A;  1KVI A;  5DM6 Q;  4GKK C;  3RW7 A;  2CU6 A;  1FK9 B;  4F4X A;  1S57 A;  2F65 A;  3BYP A;  1IBK F;  3R2D J;  3M8W A;  3OTO J;  4N56 A;  4FXD A;  3CD0 A;  4J9L A;  3CCU S;  4FYW B;  1FKO A;  3CJ8 A;  2Z8Q A;  1MD9 A;  3MPY A;  1X4D A;  2D9P A;  2LYV A;  4HVZ A;  3EGW B;  4WP3 A;  2QA4 S;  1B7Y B;  4OI0 A;  4W92 B;  1SJQ A;  5F3T A;  3S8S A;  1IKW A;  1UKU A;  3FQK A;  3G8T A;  4P7T A;  2XBP A;  1ZAX A;  1QE1 A;  4CLW A;  2DHS A;  1XNR J;  2ZFH A;  2R7O A;  3DLG A;  2K2P A;  3O8W A;  4IUF A;  3AHP A;  1HBU B;  2N4C A;  4I1T A;  5KFT A;  3R7S B;  2CG4 A;  4O4R A;  2DNZ A;  4ELU A;  3R5C A;  1VEH A;  3DLP X;  2DEJ A;  2LLZ A;  1RTJ A;  2QMX A;  1VGY A;  1BQX A;  2C3U A;  3CC7 S;  2Q43 A;  4HH1 A;  2RQM A;  2HLU A;  2L48 A;  3THP A;  5AE1 A;  1PIE A;  2LXF A;  3H20 A;  3QFH A;  3TUI C;  1ULT A;  2P20 A;  1E6Y A;  2FJB B;  2XMW A;  4C11 B;  1NLK L;  3H8Y A;  2K1R A;  3BGR A;  4RUC A;  1CJV A;  1XMB A;  3W5X A;  4BDP A;  4XTT A;  2QSF A;  2C22 A;  3Q24 A;  1N0V C;  1Q7L B;  5KG1 A;  1KN6 A;  4OYI A;  2BKO A;  2WW8 A;  2W9B A;  4TQR A;  4LFC F;  1V26 A;  2XZT B;  3DDK A;  3FEY B;  1R0C B;  2NUH A;  1VCT A;  2DH7 A;  2V8G A;  3PM9 A;  1S6O A;  4A47 A;  3PZP A;  4TY8 A;  2ZH6 A;  2KKH A;  3HT0 A;  4NLT A;  3PX4 A;  3PX6 A;  1L3U A;  1VQP S;  3DHW C;  2EK1 A;  3CCR S;  3TUF A;  2HNY A;  4DV2 J;  3HSZ A;  1RLD A;  4RPF A;  2IIH A;  2M70 A;  2QL7 B;  3IFE A;  3UR0 A;  3SDE A;  1NDP A;  1DAR A;  1S6P A;  1V6H A;  4NYZ A;  3DRY A;  1RWU A;  2N82 B;  1M1K T;  2B9W A;  3W9H A;  2YKQ A;  4NEY A;  3FK4 A;  3CC4 S;  2Y4N A;  1C4C A;  1HBN A;  1H74 A;  5JJB A;  2P2C B;  1UVM A;  2CZ4 A;  2Y8Y A;  3H42 A;  2GAH C;  2VBZ A;  1IWA A;  1KKH A;  3M30 A;  4WJB A;  1VHF A;  2DGW A;  1M5P C;  3W2W B;  5IT0 A;  4LVN P;  2NSB A;  3TJ8 A;  3TR3 A;  4JI1 C;  1GQE A;  3D9B A;  5F41 A;  4JI4 F;  4QW9 A;  3K17 A;  2XEX A;  3QWU A;  1Q5V A;  2YY3 A;  4GKJ J;  3KG0 A;  5HJY A;  5E7O B;  2JVR A;  1HMV A;  3QO9 B;  1NEE A;  4LQ9 A;  1FDB A;  4OHZ A;  2ZHB A;  2LEB A;  3GSD A;  2IM2 A;  3HFV A;  3K8W A;  2J0S D;  3P96 A;  1ELO A;  2E44 A;  2QRR A;  4LFB C;  3RZA A;  3TZZ A;  4KTQ A;  1WAC A;  1TVR B;  3HI9 A;  3P4U B;  4NWB A;  3QAE A;  3N2Q A;  3IC1 A;  2D69 A;  2VKZ G;  3QBC A;  5EWF A;  1JJH A;  5DM7 Q;  4B3T J;  2DGV A;  2CPE A;  2FGO A;  3ADA C;  1F0X A;  2J9C A;  5FLX U;  4ZVU B;  5AJ3 J;  2E5L J;  1KC8 T;  1FO1 A;  5D0R A;  5JRH A;  2JX2 A;  4CLP A;  1RT2 B;  1UMJ A;  3CWJ A;  3M9M B;  4OHV A;  3GIR A;  2UUW A;  1FFG B;  3RU0 A;  4X4N A;  1UJ4 A;  2CKW A;  3C6T B;  1P27 B;  4J5O A;  1T03 A;  3NRB A;  1LFW A;  3RG6 A;  1U45 A;  1T5D X;  1GXL A;  1VC5 A;  3TUP A;  1I5O B;  3NAI A;  2XMV A;  2RDJ A;  1C0U A;  3JXO A;  1VIS A;  3OTE A;  2RF2 A;  4DFM A;  3HFK A;  4IFY B;  2DNK A;  3UN2 A;  3KJV B;  1AT1 B;  4GXR A;  3FCV A;  1RWN B;  4F02 A;  1UW4 A;  2F8H A;  3QLH B;  1LNQ A;  1SCJ B;  2XSJ A;  3GYX B;  1N5Q A;  4IFY A;  1VOM A;  4QPX A;  2ATC B;  2PMH A;  4NA1 A;  5L1J A;  5ITH A;  1ZH5 A;  2JC1 A;  4FNI A;  4DSJ A;  3OR2 A;  1RU1 A;  1RWV B;  4LSL A;  5D4N A;  2RQC A;  1NK5 A;  4LF6 C;  4LF7 J;  2HAF A;  3FDS A;  1JLF B;  2R3V A;  3OFF A;  1S49 A;  3AOA A;  4KGV B;  4DL6 A;  5ETS A;  3L09 A;  1U8S A;  4LF8 F;  4OX9 J;  5HQL A;  2MJN A;  3TAM B;  3W2V B;  1HQU B;  3A8E A;  3PRV A;  2XS7 A;  5GTD A;  5DV9 A;  1WI6 A;  4WKY A;  1YRX A;  1QDU B;  4PCQ A;  4DR3 F;  3CCQ S;  4OLO A;  1FES A;  1LWF A;  4ZLL A;  3LAM A;  2BKN A;  4KHM A;  1NKE A;  3MWB A;  2WVF A;  5IT9 Y;  4LF8 C;  2HZA A;  2J0X A;  3A4I A;  4HT5 A;  1N33 J;  5CQG A;  4QIV A;  4QQB A;  3VVT A;  4WK3 A;  5K8M A;  1N56 A;  1IBM C;  3FBF A;  3BYR A;  1HLW A;  3VQS A;  3PRO C;  1P9Y A;  3PRB A;  5A1I A;  2AIR B;  4ZDN A;  2I5J B;  3UPF A;  2VJV A;  3HCX A;  2V9W A;  1WOP A;  2HVI A;  2F4F A;  2IFX A;  3HVW A;  2FHK A;  3IO1 A;  3HM9 A;  2MM9 A;  2VFR A;  4TQS A;  2W4P A;  2R42 A;  3A13 A;  5EHH A;  2XS5 A;  2OPQ A;  2ZC4 A;  5KFJ A;  3OTO C;  2CPX A;  5L1K A;  1V3Z A;  1I94 C;  1HD0 A;  1A0O B;  1RIS A;  3MCM A;  2MST A;  2YKM A;  3ENV A;  3V81 A;  3QT6 A;  5DS7 A;  1NU4 A;  4D57 A;  1O5J A;  5H9U A;  1S7H A;  1FRK A;  5I42 A;  4FVM A;  5D0E A;  1NB7 A;  2GX8 A;  2ZEJ A;  3T1A A;  3SEO A;  4EZ9 A;  5C42 A;  3VF0 B;  1H98 A;  3PX0 A;  5ETO A;  2KYZ A;  5KFS A;  1NHU A;  4J9O A;  1PIL A;  2MLX A;  3AA9 A;  1UWB A;  2P9C A;  5RUB A;  4XDC A;  4RVO A;  2DNG A;  5ETP A;  2OO4 A;  2DYJ A;  3JAM D;  2WVE A;  4CNZ A;  4CDI A;  3Q0A A;  2RQ4 A;  4NLV A;  1EAR A;  1ZM9 A;  1RA6 A;  2FQQ B;  4I69 A;  4IOC Q;  1YX2 A;  2HHH F;  5A1G A;  1NJW A;  3H0P A;  4H4K A;  1RI7 A;  3D28 A;  3NCR A;  4M5L A;  4U7C A;  4TYA A;  4DV2 F;  2R8J A;  4FXW A;  4E2F B;  4YHH F;  4B3M C;  1RXO B;  1S97 A;  5F8N A;  4GC7 A;  3OR1 B;  2J76 E;  1VK8 A;  2D9O A;  2P9E A;  3M8Q A;  4DCP B;  4C48 A;  1R43 A;  2H5E A;  3PYE A;  1FWL A;  4DV0 J;  4DR1 J;  1ACM B;  2NZ4 A;  2HJG A;  1KNZ A;  4KTV A;  3GR1 A;  1MXC A;  1EB0 A;  1MXA A;  5B7W A;  4H54 A;  4DV0 C;  4DR1 C;  4TXS A;  2YKA A;  2AJ0 A;  3D3C J;  1Y3K A;  4RLQ A;  4XIU A;  1F5C A;  3A9U A;  4USU A;  5GVQ A;  1FNX H;  3RAM A;  4LBI A;  2AYB A;  1KWM A;  1YDL A;  4DS4 A;  4WZQ A;  3AFG A;  1M5S A;  3FRY A;  1PKU A;  2HND B;  3VNQ A;  3AA8 A;  3US5 A;  4JI2 C;  2ROP A;  1RKJ A;  4X4O A;  1S1X B;  3IMQ J;  4ITS A;  4DZ6 A;  4JYA F;  2RB7 A;  4KQZ A;  1R89 A;  2EGT A;  2NYI A;  4MKB A;  3UFC X;  4CI0 B;  5KTQ A;  4O0N A;  3X3U A;  1Q95 G;  4FXV A;  2GJI A;  4JI4 J;  2YX4 A;  2OBV A;  2YH0 A;  1X4F A;  2RAQ A;  4GRS A;  4IQM A;  1YLX A;  1C0T A;  3D66 A;  3LO3 A;  1UWB B;  4BCA A;  4X4S A;  4Y00 A;  3GV5 B;  3RAX A;  1FCA A;  4KR0 B;  4PZV A;  5ADZ A;  5F9L A;  4Q43 A;  1X4A A;  2YBV A;  1NCL A;  3FJ2 A;  3OR1 A;  2AZ1 A;  4OZ2 A;  3MEE A;  3W62 A;  3KLF B;  4DUZ J;  3RYL A;  2GFF A;  1WF2 A;  1CJT B;  3NOC A;  3M9O B;  3DRP A;  3TUZ C;  1WC1 A;  3EUN A;  3Q2S C;  4FKY A;  4PWD A;  3DAY A;  1TU0 B;  3V81 B;  1FFS B;  2GV1 A;  3NYR A;  2RJZ A;  2IMO A;  3D3B J;  3PFO A;  4HL9 A;  3TVK A;  3PV8 A;  1MRO B;  2E1M C;  2FLN A;  4LQ3 A;  2HHX A;  2H65 B;  4DPO A;  1HNZ J;  1RB0 A;  2D27 A;  4FS2 A;  4K5S A;  3TVY A;  3UNG C;  4L74 A;  3CPW R;  4DSE A;  4JI8 C;  4USV A;  1IM6 A;  1RBL A;  3F56 A;  1SIW B;  4M5I A;  3GIK A;  3AT1 B;  3M6X A;  1DQ9 A;  1V3S A;  3OSN A;  1RBA A;  4NA2 A;  1TMJ A;  2WSE C;  4B3S F;  1QM4 A;  4OXI A;  1XTZ A;  1MU2 A;  1N0U A;  1OY9 A;  3WIU A;  1OO0 B;  5GAE I;  4Q44 A;  2AWZ A;  2KDO A;  1XQI A;  4LR8 A;  1CUL B;  2ADB A;  2J7K A;  1QAX A;  2VG7 A;  4FZV A;  2XHC A;  4ED3 A;  2E9T A;  1EZZ B;  2ZH1 A;  1HYS A;  1BY9 A;  4ZKA A;  2MKJ A;  4OX9 F;  5IQ6 A;  1YJ7 A;  4PPD A;  3Q8Y A;  1IKV A;  5HMX A;  1SKW A;  5IT9 D;  5AT1 B;  4I6A A;  2BJ1 A;  1R7I A;  3BKF A;  1YJ9 S;  1R8A A;  1EIY B;  2VH7 A;  2YNI A;  3DM2 A;  1NAQ A;  4H4O B;  3MR6 A;  2Y8W A;  2JH3 A;  3CCV S;  1JLF A;  3C3L A;  2AEJ A;  1U24 A;  4GVL A;  2R8G A;  4LSL B;  5IV3 A;  1ZAW A;  3NXZ A;  1FDD A;  2I8E A;  4Z7Y A;  3R7N B;  3Q8U A;  4DSI A;  2HFN A;  3FEZ A;  5ETT A;  3DRR A;  3C19 A;  2A6O A;  4DV3 C;  3N0V A;  4HLB A;  4QYZ J;  4X64 J;  3K5N A;  1HQE A;  4JI1 F;  1UEU A;  4DR6 C;  1VHI A;  1J5O A;  1N6Q A;  3TRG A;  3DDI A;  3AOB A;  3J7Y U;  3BS9 A;  1HAR A;  3A3O B;  3ONQ A;  1YSJ A;  1NPP A;  3J80 Y;  3QZ8 A;  3JB9 k;  2ZHO A;  3MPU B;  1GT8 A;  1W2I A;  3KFW X;  5D0H A;  1IBL F;  1PBA A;  2V8D A;  4LF5 F;  2R7U A;  3KNG A;  1XMQ F;  4WIQ A;  4ETX A;  2W4D A;  3BM7 A;  5T8S A;  2VA2 A;  1KTQ A;  3IR7 B;  4FN5 A;  3QT7 A;  1KON A;  3QRQ A;  3PJ9 A;  2KZF A;  1FDA A;  5L9X A;  4X66 C;  4IRD A;  2B4P A;  3PNI A;  3V5R A;  2VC0 A;  4URQ U;  4F4W A;  1QAI A;  1N52 B;  4NI2 A;  1RQ0 A;  1L3S A;  3C16 A;  4DR7 J;  4G37 A;  3KJV A;  3G82 A;  3R5G A;  3HD1 A;  1JLQ B;  4DQI A;  4HI2 A;  3JSM A;  4DV7 F;  4YB7 A;  2EFV A;  1FXL A;  2ASD A;  3WX8 A;  2CYY A;  3JSR A;  1OY6 A;  1D1U A;  4V19 X;  3GON A;  3QT5 A;  2EI5 A;  3KHG A;  2AGO A;  2PI4 A;  4HKQ A;  5LMU C;  4PYA A;  1WDT A;  4JI0 J;  3HHN B;  3PY8 A;  1LWE A;  3BO3 A;  3Q23 A;  5LMU J;  1RT2 A;  4IR7 A;  1SIZ A;  3M1V B;  3WQP A;  3TNV A;  4CLK A;  4OI2 A;  1CC7 A;  3M2V A;  5HAT A;  3CC2 S;  2MKC A;  2HZV A;  1FX4 A;  3IBC B;  1WF0 A;  1XN9 A;  3M8R A;  2H54 B;  1R8B A;  4ICL B;  3TW0 A;  1BQN A;  4UZC A;  2FYX A;  2ZNY A;  2RU3 A;  3PES A;  4ZN1 A;  3W9I A;  3G86 A;  1I51 B;  3TZW A;  1O51 A;  2JEF A;  2NQP A;  5FDL A;  2HRT A;  2ERR A;  1R8C A;  2G2Z A;  2G0C A;  3OLB A;  4A8W A;  1VBK A;  2UUA C;  1TVR A;  2DCU B;  1DQA A;  2Q79 A;  2YQ1 A;  3B4D A;  4I6Y A;  3CQ2 A;  1H7W A;  4ZA1 A;  2HQ3 A;  2UUC F;  2IA6 A;  1XC9 A;  2HIQ A;  3D2W A;  4IR9 A;  2ZD1 A;  2ZOM A;  5DG8 A;  2UP1 A;  2MZS A;  3SDE B;  4L3N A;  3L4B C;  2YX1 A;  4OZ1 A;  2MSS A;  4ZP7 A;  4FYD A;  3ITH A;  2ZNZ A;  4J9S A;  3CW8 X;  5C5J A;  2HNY B;  5GAH I;  1X0P A;  4RW9 B;  3OXL A;  4PAB A;  4UW2 A;  4ZJL A;  2PFD A;  1FX2 A;  5AXM A;  4RNF A;  5E41 A;  3J81 U;  4Q0B A;  1SI9 A;  5ETM A;  5IWA F;  1LWX A;  1TMM A;  2BJ3 A;  2J6T A;  4ID8 A;  3E51 A;  2ATL A;  2RH3 A;  4Q5V A;  1LWC A;  1TL3 B;  4ZVR B;  2E7V A;  2KRR A;  3D0G E;  4LRF A;  3MM8 A;  2C28 A;  3QJJ A;  1SPB P;  3KG1 A;  4CIO A;  2E7W A;  5MAO A;  3B7W A;  2UXC C;  4F3M A;  3B54 A;  2V94 A;  2IC3 A;  2N3O A;  2D1C A;  4KY3 A;  1M0S A;  4L72 B;  2UUT A;  4QR1 A;  2P2J A;  3TQI A;  2VPX B;  2WON B;  4IQX A;  2Y1R I;  2GIF A;  3KLE B;  5KFR A;  3RAQ A;  4ILM A;  2IRU A;  3W61 A;  2LXI A;  2JEJ A;  2R7S A;  2BAN B;  3I0S A;  1CLF A;  2RD5 C;  3CDA A;  4ZVH A;  2AU0 A;  4J90 A;  4XAK A;  1L3T A;  3OHA A;  1HNV B;  4WZM A;  2V8H A;  3AB4 B;  3LAN A;  1WSR A;  4CM0 A;  5HMZ A;  4FS1 A;  4DLE A;  3EIC A;  5E3R A;  4R1M A;  2WAQ D;  4CTA B;  4DCV A;  1LQ9 A;  2GMJ A;  3PAC A;  1TKT B;  4NYP A;  3MTJ A;  3DI6 A;  2D3Z A;  2GML A;  5DZ6 A;  3KK3 B;  1CQN A;  3UZ0 A;  3JSB A;  4JV5 F;  4JI6 C;  5CH7 B;  4E98 A;  1DBD A;  1U25 A;  3L8C A;  4GVB B;  3CJE A;  3OJU A;  2E5G A;  2KB2 A;  2NPI A;  2B6A B;  2K8G A;  5H1S V;  3DLH A;  4NLX A;  4J91 A;  1N36 C;  1M5H A;  2X1F A;  5CYQ A;  1ZPV A;  1YJT A;  2B7C B;  3LPE A;  5DLG A;  3W8G A;  4A46 A;  2CQI A;  3AF6 A;  4CYU A;  1KBR A;  2XMA A;  2KT3 A;  1WWH A;  2Y0S D;  3E3X A;  2NSC A;  2AJ4 A;  4YFU A;  4DI6 A;  1D09 B;  2CWK A;  4CO5 A;  1TP7 A;  2V8P A;  3RBE A;  1QAJ A;  2GO8 A;  4IR1 A;  1EQ0 A;  1T9X A;  1KLN A;  2E9Z A;  1J5E J;  4CO4 A;  1T9U A;  1C1C B;  2VG5 B;  2J6S A;  1K47 A;  2MQ8 A;  2QX0 A;  3A12 A;  2DR5 A;  1UCN A;  2XMT A;  1FRI A;  3CD7 A;  4LF2 A;  1FKP A;  3DCA A;  4DV5 J;  3U02 A;  2CFX A;  4RUB A;  3U1L A;  3GV7 B;  3VZH A;  3ISN C;  1LW2 B;  2MLZ A;  3TYT A;  2FHJ A;  2U2F A;  4DX6 A;  3F0N A;  1N8R T;  1N4L A;  1B0T A;  3N9U C;  1S0M A;  3N6M A;  2XC9 A;  2BA9 A;  2BH1 X;  5CZV A;  3MUM P;  3GJQ B;  3KLV A;  1F6T A;  2H5J B;  5LL6 d;  4ZMM A;  3BO4 A;  2YX7 A;  3MF5 A;  3MOZ A;  1QUV A;  2XMU A;  5IC6 B;  5LOQ A;  1XMO F;  4Z37 A;  4Y34 A;  4ZVP B;  2IAJ A;  4N8N A;  4P73 A;  3R1H A;  1M5V C;  2BW2 A;  1PJ5 A;  3CCT A;  2SXL A;  2Y1L B;  4K7Q A;  4DN0 A;  2CPF A;  3N6L A;  2B9E A;  4DR4 J;  3TAN A;  1N5T A;  2NYH A;  4G1Q B;  3O6Q A;  3PFE A;  1JLQ A;  4FDF A;  5K14 A;  2VZ9 A;  3PW0 A;  5E3A A;  1U2F A;  3S82 A;  2D74 B;  2XTJ P;  3C16 B;  2DY9 A;  3O44 A;  1K8A T;  3PO5 A;  3ILI A;  4R8U B;  3LNV A;  4ICL A;  2DBB A;  4L7I A;  1EKS A;  2FPH X;  1ZA2 B;  2UXC F;  3CQ3 A;  3HO1 A;  2MZT A;  4OLP A;  3T1Y J;  4M5J A;  5SUH A;  3E8O A;  3MOJ B;  1LW0 A;  3QRR A;  2NXJ A;  3TZX A;  1UPM B;  1PG3 A;  2VBW A;  3CO0 P;  3QMQ A;  3SZ2 A;  2CZV C;  1T7P A;  3H2L A;  5DQH A;  3DGV A;  2ZH3 A;  1G4C A;  2AP6 A;  3QGP A;  4DV6 J;  3NGS A;  1N5Y B;  3DN9 A;  4DMZ A;  2XB2 D;  4NLU A;  4JUZ A;  2DKO B;  3RBZ A;  1WJ9 A;  2VFT A;  2KG0 A;  3OL8 A;  2QL5 B;  1U7L A;  2IM3 A;  2PA8 D;  2FC8 A;  4FNH A;  4PAA A;  1JLG B;  5AE3 A;  3FGV A;  1D9F A;  4D56 A;  2AJQ A;  5F8J A;  3SSQ A;  1HHT P;  1TV6 A;  5C24 B;  3OPK A;  5HLF B;  4LFA F;  1S4F A;  4EYH B;  5KFI A;  2LDY A;  4QWB A;  4O3Q A;  3I56 S;  2GJF A;  2D3O R;  5K85 A;  5ETL A;  2Y4O A;  4DCS A;  4OX8 A;  1S77 D;  3FEX B;  2W4C A;  1YRT A;  4CM2 A;  3SMZ A;  3CGI A;  2KZM A;  1ZM3 A;  2M9K A;  1NHK L;  4FYY B;  1Y10 A;  4ELV A;  2HEK A;  4NEZ A;  3AJ2 A;  2ZJP Q;  3C6U A;  2CXC A;  5KT6 A;  4K4V A;  2HQF A;  3AB2 B;  4DU8 A;  1HW8 A;  4ZLJ A;  3UEB A;  5DDP C;  5KG0 A;  2EC0 A;  1TAQ A;  4R8U A;  3QPI A;  1QLN A;  5ETK A;  5HQM A;  2K7K A;  4P7V A;  2EW9 A;  1KVK A;  1IN0 A;  3G8S A;  5J2N A;  2R7Q A;  5C25 B;  4G1Q A;  2K3I A;  3WC0 A;  5K8F A;  2YNH B;  1NPK A;  2HS0 A;  2Z57 B;  3M05 A;  3NGR A;  3MMC A;  4G1I A;  3SCJ E;  4DV7 C;  1M5O C;  1Q8I A;  2GIR A;  4QU7 A;  1SH2 A;  2LEA A;  1ZOT A;  5B0B A;  3CCJ S;  4DFK A;  3CJK A;  4DR3 J;  2XYH B;  3DYA A;  5KFU A;  4F50 A;  2F4V J;  3ZZP A;  4EU0 A;  5IWA J;  1FDN A;  3GJT B;  3IEV A;  3DOL B;  1MG7 A;  4Q2L A;  2HVE A;  2V4R A;  3SCL E;  4ZVE A;  3SI8 A;  4Q8E A;  1RHR B;  1JMT A;  1M1G A;  4MK9 A;  5KFB A;  3T5H A;  1HNW F;  1XMQ C;  2QYC A;  1FJG F;  2DHM A;  4TY9 A;  1RTI A;  4RBT A;  4LF5 C;  2CPJ A;  3Q8V A;  3HVT A;  1K1S A;  3AAW B;  2GGP A;  1FKP B;  4RW8 A;  5DDQ C;  5HP1 B;  1YKW A;  5FII A;  5LSR A;  5HL7 Q;  3IAS 9;  1TKZ B;  1RT3 B;  2BJ8 A;  2CIM A;  1S6P B;  2DHG A;  3O3L A;  2E9R X;  1N32 C;  2VON A;  2BV3 A;  1BQM A;  3ZNU A;  3ZNJ 1;  5HBM A;  4JOU A;  1F3F A;  2X1A A;  3POT B;  2AKW B;  3RB0 A;  3C46 A;  2DY1 A;  2PDA A;  5EWE A;  3FFI B;  3MED A;  4YHH J;  1PG5 B;  5CA5 A;  1VQ7 S;  4WFB Q;  2W9C B;  3I5C A;  4OYA A;  1T9T A;  1FD2 A;  1GH8 A;  4LF8 J;  2MLY A;  3D67 A;  1S79 A;  2NS1 B;  3EVO A;  4CT9 A;  2B6A A;  1XMO C;  1E6V A;  3E7X A;  1VJQ A;  2L9W A;  2R7T A;  1IQZ A;  1CJV B;  1YIJ S;  2I2Y A;  3C6U B;  3PG9 A;  4QWA A;  3DRS A;  1TH5 A;  3QZ7 A;  2AF6 A;  4C11 A;  2DNO A;  4HHJ A;  4WFN Q;  2QSW A;  3D1H A;  4RKU C;  2CVE A;  4ERD A;  3FZ2 A;  1NZA A;  1R0B G;  1Y5N B;  4DXL A;  2VHG A;  3THV A;  2ZC3 A;  1C1B A;  4DPX A;  5JMN A;  2V2Z A;  2ZBC A;  2J9E A;  1Y00 A;  1B64 A;  2KHD A;  4A8O A;  3H4B A;  1RWK B;  4K0K F;  1XNQ J;  2F4V F;  2OLW A;  1EHW A;  5LSO A;  6AT1 B;  5F8I A;  1I94 F;  1NDL A;  4B3S J;  3IRX B;  4K4W A;  1S9F A;  3J81 D;  3IGN A;  3KMS A;  2ZBP A;  3HKW A;  5IM0 A;  3PDN A;  3L95 X;  4RNH A;  1NME B;  3FBC A;  3TP2 A;  3GV8 B;  4DSL A;  1N2F A;  2LVW A;  2W2P P;  2WVC A;  4O4G B;  2BM1 A;  1HNW J;  2NR0 A;  1IUJ A;  2MEW A;  4LR7 A;  4P2S A;  1I6J A;  1T3N A;  4IH5 A;  5H9F K;  4MMO A;  1FJ7 A;  2WHO A;  2HFO A;  1JXE A;  2XMJ A;  4TLR A;  4U95 A;  4WKR A;  3SFG A;  2QMU B;  3C15 A;  3TOQ A;  3NKY A;  3CW9 A;  3ELH A;  3K8V A;  1NKC A;  1E6V B;  2C2N A;  3KMQ A;  4M95 A;  4TPS B;  1W7W A;  4NPO A;  3RUB L;  3GJS B;  4YY3 J;  2LA6 A;  4C8K A;  1Q53 A;  2PII A;  3MR5 A;  2MQN A;  4DUY F;  1UP1 A;  3TQE A;  5THW A;  4B9L A;  3FQL A;  2Y9H A;  1BHN A;  4ALZ A;  2RE1 A;  4EO6 A;  3K2Y A;  5A8K B;  3I96 A;  2XWY A;  3LPY A;  4LFA J;  3T3F A;  2J7U A;  2XG8 A;  1EP4 B;  3HX9 A;  4J9Q A;  1JNR B;  4J9N A;  3WC2 A;  2PI5 A;  2XS2 A;  1UJ6 A;  2LEP A;  1UZH A;  1HW9 A;  2FVC A;  2RUS A;  2A10 A;  3G2X A;  3LP0 A;  3CB4 A;  4NL5 A;  4YB6 A;  3W63 A;  5GAG U;  5KG6 A;  2MY7 A;  4UOG A;  2VQE J;  2E5J A;  2XLK A;  1ZZN A;  4PXB A;  2FDN A;  3K59 A;  2CNL B;  4JI1 J;  1GXU A;  2ZBI A;  5BJR A;  3T1H F;  1BQN B;  2G9O A;  4LR9 A;  3K57 A;  4QIW D;  2LQB A;  4DG9 A;  3TO8 A;  4JI2 J;  5KFG A;  4QOT A;  3MPD A;  1I3O B;  1S0V A;  3SXL A;  4IG0 B;  1QAY A;  3OXF A;  3T6B A;  1V5V A;  3UR3 C;  2HGM A;  3AQP A;  3HVA A;  4RNO A;  1SL2 A;  3UO0 A;  2AEM A;  2AHO B;  4FVC A;  1XRB A;  1VLY A;  3I87 A;  3TZY A;  1KFS A;  2VD3 A;  4NLO A;  1ZAV A;  4A4J A;  4C8Z A;  5KT5 A;  1USP B;  2GVD A;  1RWP B;  2EFG A;  4ENO A;  3DFE A;  3Q8R B;  3GFY A;  2XLJ A;  3MR3 A;  2VPW B;  1SJ4 P;  3GZ7 A;  5D6G A;  3T5L A;  2DNM A;  4PPZ A;  1OQ3 A;  4NLD A;  3GCW P;  5JXS A;  3W5Z A;  4X2B A;  4I2Q B;  5T8T A;  2XSJ B;  3KKF A;  1S0N A;  4YQW A;  1KR4 A;  4YY3 C;  2C3P A;  4KIA A;  1JXL A;  2D1T A;  2LMI A;  4F67 A;  4DV1 C;  1UEK A;  1RHM B;  4P2M A;  3IWN C;  1Z2L A;  3IP0 A;  3MR2 A;  2RSQ A;  2WBR A;  3BB5 A;  2UXB F;  2CY1 A;  1WHY A;  1IXK A;  3E01 B;  4RW6 A;  2F5G A;  2X3G A;  2HQG A;  1TFY A;  5IT9 U;  1HNZ C;  3A4T A;  2BOP A;  3ZZO A;  3KLG A;  2KG1 A;  2HQI A;  1FJG J;  2V63 A;  1KP6 A;  3IS9 B;  3H25 A;  4C9D A;  2ZM6 C;  2DNY A;  3V6H A;  2DGX A;  2GC8 A;  1RWM B;  1A7G E;  1IWG A;  1HNX F;  2HNZ A;  1RAC B;  4WPA A;  1X31 C;  2DD8 S;  2B43 A;  5J2Q A;  1RT7 A;  2RRB A;  4PG8 A;  2IJN A;  3UN5 A;  4V19 J;  5DDR C;  1S1V A;  3PIO Q;  4MFB A;  5HN0 A;  3K6R A;  3RV2 A;  4DUZ C;  3NGT A;  4EI2 A;  3BH7 B;  2EFP A;  1FFW B;  2DNQ A;  2QYG A;  3GJR B;  3R3T A;  4FPR A;  2PMZ D;  2UUA F;  2KU7 A;  2G4B A;  2E5L C;  1SQG A;  2M7S A;  1YZ6 A;  4P10 A;  3OVB A;  1TKX B;  4C3K A;  4DBQ A;  3DXB A;  1RAB B;  1JQG A;  2VV5 A;  2C3O A;  3NAH A;  1DTT B;  1WEZ A;  1MWY A;  3OFG A;  4M5D A;  1BXN A;  2HMI B;  3DHV A;  2BE7 D;  3H4D A;  2DHA A;  4KTT A;  5KFH A;  4K59 A;  1T9Y A;  3PTW A;  4CLT A;  1IKV B;  2JL9 A;  1WC0 A;  4LJM A;  1G7C B;  1PBU A;  1TL5 A;  2H3E B;  1CS4 A;  3EXC X;  4UST A;  3NL0 A;  4DR3 C;  3QIP B;  1H2T Z;  4ID5 B;  2UXD J;  2VG7 B;  1HYS B;  4ED6 A;  4IO9 Q;  4AT1 B;  3HKZ D;  1FI4 A;  1SUQ B;  4I64 A;  2ROG A;  2XNQ A;  4ZVS B;  2HWI A;  4ATN A;  4EBE A;  4PUO B;  3JQJ A;  2NCL A;  1DLO A;  3C14 B;  5GAD I;  2FVR A;  3UCZ P;  3KLH B;  2UV8 A;  3PO4 A;  4OZ0 A;  2D1R A;  5DGA A;  2HWT A;  3QGI A;  5LM7 E;  3H2V E;  2EBE A;  1GMU A;  4UQG A;  2MJU A;  1CJU B;  2HFS A;  1CJU A;  1KQG B;  4Y28 C;  3J81 Y;  4PRO C;  1TL4 A;  2HBY B;  3HP6 A;  4X66 F;  1X4B A;  1Q5Y A;  3ZC4 A;  3G96 A;  2F7V A;  2KFY A;  2MQM A;  3G71 S;  3CNQ P;  1OYE A;  3THT A;  1RAA B;  6FD1 A;  4X4P A;  1BWE A;  4FF4 A;  2P6S A;  5FDL B;  5BSR A;  3KUH A;  4OYZ A;  1S10 A;  4WV3 A;  3R5A A;  1LOU A;  1CJT A;  2E1C A;  4ZPD A;  3W65 A;  3IPL A;  3MEG B;  2WCX A;  2JWN A;  4A8X A;  2MGZ A;  3MEE B;  1RAG B;  1B0P A;  3ETO A;  2CVI A;  2OD6 A;  4P74 A;  2HGN A;  4USH A;  2KH9 A;  1S6Q A;  5EWG A;  3ZZY A;  2W9B B;  3GR0 A;  4DR6 F;  3L7O A;  3MCO A;  4B02 A;  3LTO A;  4OMF G;  4WTY A;  4C0O C;  2KL8 A;  3V6D B;  2OPL A;  2WD9 A;  4BWJ A;  4MAK A;  2C2Z B;  1GMW D;  4I4B A;  3R97 A;  3U7J A;  2J9D A;  4BHQ A;  5J2P A;  1T5H X;  3QGG A;  1IBM J;  3TAP A;  2VQE C;  3AOC A;  9ATC B;  1ZYQ A;  4N41 A;  1VR6 A;  2CRL A;  3BBB A;  4P2F A;  1FNM A;  4IFV B;  5JVG Q;  2KFZ A;  1LXN A;  2P9G A;  4DV7 J;  3CJ3 A;  1FE0 A;  1JX4 A;  2IVF B;  4YP3 A;  3D1Q A;  3VVU A;  2GVZ A;  3SQO P;  2LQ9 A;  1V5I B;  5CYQ B;  2QVZ X;  2VB6 A;  1WC3 A;  4ZPT R;  4RU9 A;  2YQ0 A;  5J2Q B;  1LCI A;  4OV6 A;  1RTZ A;  3GPC A;  1T05 B;  4OX9 C;  2YWF A;  3PCO B;  5D77 A;  1Y9O A;  2VAS A;  1SL0 A;  4F2S A;  1XR7 A;  1GNK A;  3HUL A;  4G6V B;  2IM0 A;  4KC5 A;  5F0W A;  1SQF A;  4JV5 J;  3KK2 B;  1DFD A;  2KZ0 A;  2UU9 C;  2BJ9 A;  3KK3 A;  4DV4 J;  4QIE A;  4IDK B;  1Q16 B;  5LJ5 Y;  3GIL A;  2WB4 A;  1ZPW X;  1S12 A;  3MR7 A;  4P72 A;  4G65 A;  4DZD A;  5DLF A;  1JJ2 R;  4Q8F A;  1X4H A;  2IJF A;  4EWT A;  3ISZ A;  4C0H A;  2WSF C;  3BBC A;  3M8Q B;  2DPL A;  4GXQ A;  1X4E A;  3Q86 A;  4MIW A;  2MZR A;  1RAE B;  1RTJ B;  1HQE B;  4LBP A;  2MKK A;  1SC4 B;  2KM8 B;  3LUS A;  4A48 A;  3CT9 A;  3VAH A;  2AQ4 A;  2JEG A;  2RIL A;  3FMB A;  4NA3 A;  3QSI A;  1GFW B;  2CQ1 A;  3NS5 A;  5LT5 A;  4JI7 F;  1VDH A;  5BSM A;  5I3U A;  3OXG A;  4B08 A;  4EO8 A;  1RT1 A;  1HWU A;  2RIJ A;  4IG3 A;  5A2Q U;  4UUX A;  5A6W A;  3D68 A;  1JLC B;  4DLG A;  4AL7 A;  2C2M B;  2BYC A;  3PYD A;  1USP A;  2IBK A;  3LQV A;  4JI5 J;  1FKO B;  4JV0 A;  1XR5 A;  5M2U A;  2HBQ B;  3HSG A;  3MM9 B;  2X1B A;  1EGA A;  3ZFV A;  2FD2 A;  1S9G A;  1JLE B;  4U96 A;  3MM8 B;  4DV1 J;  1R8H A;  3M4X A;  4F26 A;  2ASL A;  4M1K A;  2FLO A;  1K73 T;  5I42 B;  1FXD A;  2ZBQ A;  3GP9 A;  4ZJQ A;  4B9V A;  1NO8 A;  3EX7 B;  1IVZ A;  1P4E C;  3EVM A;  4WS9 A;  2ZVI A;  2IM1 A;  2KJV A;  4H4M A;  2CXE A;  2PEB A;  5K9F A;  3R5J B;  2RHQ B;  2OPS A;  2UVU A;  2OFH X;  3BN7 A;  3RTV A;  1NUE A;  3H5Y A;  4RW9 A;  1MU2 B;  1IM4 A;  4RUH A;  2VBY A;  2MY8 A;  1YGY A;  1N5Y A;  2KTQ A;  3OTC A;  1IBC B;  3M8P B;  3NP5 A;  4JYA C;  1JLB B;  4LF9 J;  2RQK A;  2NXE A;  2KVQ E;  4JI2 F;  3EJM A;  5D78 A;  4LF9 C;  3CJ2 A;  4KRW A;  2KZZ A;  1U49 A;  2NCK L;  2YPZ A;  4OYW A;  3W9J A;  4O0I A;  2ZH7 A;  1CEZ A;  3IEU A;  3M8S A;  3MAQ A;  1DZ5 A;  1ZBT A;  1V25 A;  1KKG A;  1T9V A;  3QAT A;  2DNP A;  4OYM A;  4HTJ A;  3IGV A;  4WFZ A;  1IBK C;  2GHP A;  3G7S A;  2YNF B;  3N79 A;  3C15 B;  3PRD A;  4I68 A;  3ZZT A;  1AXQ A;  3TAM A;  4LFB J;  4LF6 J;  1AFJ A;  1RY2 A;  2R4F A;  1RT6 B;  4LSN B;  1DUR A;  1PJ6 A;  2DGU A;  1HKA A;  3R6G B;  4R0E A;  4F25 A;  4DX7 A;  2BDP A;  2F1F A;  3J7Z 5;  1DTT A;  2Q6C A;  1S0O A;  2AMC B;  5DO2 A;  2OJ3 A;  2IPO B;  3VGT A;  3OR2 B;  3TR5 A;  1PGZ A;  1B99 A;  1TKX A;  1P6T A;  3R5D A;  2RRN A;  4OX7 A;  4CO2 A;  5L1I A;  1RLC L;  2UUA J;  2GA7 A;  2L9D A;  3G82 B;  2GQ2 A;  4WP8 A;  2CUY A;  3UQS A;  1S76 D;  2UXC J;  4D3G A;  3QLH A;  5CYJ A;  4Y2I A;  4NI2 B;  1H38 A;  1VBY A;  3P49 B;  4AL6 A;  1VS3 A;  4DG1 A;  1RTD B;  6FDR A;  5L9N A;  2ASJ A;  2M8D B;  2QLX A;  2RF2 B;  1U26 A;  4KGM A;  4UTG A;  2B9X A;  1RAH B;  1G1X A;  1U0H A;  2IDE A;  4DV5 F;  1TUG B;  2DGQ A;  5FJ4 A;  4RL1 A;  3CIM A;  1W26 A;  2JJ4 D;  2WOM A;  4URS A;  1U0S A;  2LKZ A;  2R2S A;  2ZH8 A;  5E5N A;  2V34 A;  3ILJ A;  5BSV A;  1G2E A;  1GK8 A;  3RRH A;  3OTO F;  3GII A;  1Y5I B;  4I7F A;  1JWW A;  1VC6 A;  3EPG A;  4FTF A;  3K89 A;  1PYS B;  1ZB8 A;  1WD6 A;  1FER A;  2JSX A;  2P2B A;  4PQA A;  1REV A;  1W25 A;  4QIG A;  2Y1I A;  4LRC A;  1VRT A;  1KRP A;  3A8I A;  1RWX B;  2GVZ B;  1U1O A;  4DL4 A;  4WII A;  2Z4P A;  1Z2Z A;  4KBI A;  4P71 A;  4UY8 5;  4K4S A;  3LOU A;  2EFN A;  2GS8 A;  2B5J A;  1YVF A;  3O2I A;  3PJX A;  1EX8 A;  2VKR A;  4IH6 A;  4ETZ A;  5CCM A;  1P8G A;  2W8L A;  4NE9 C;  2GVD B;  1JKH A;  4JI7 J;  1WKK A;  2MTL A;  3NCP A;  4HAC A;  3H59 A;  3H2U B;  4KKO B;  2YNI B;  4WFX A;  2B7B B;  2RRA A;  1YJU A;  2PGC A;  2Z58 B;  3BSC A;  3KUE A;  4PHT A;  3NCQ A;  4UZB A;  3MUV P;  4ZCM A;  2OPL B;  4JI3 C;  2CAJ A;  2YWB A;  2XZW A;  4ZOS A;  4HDG A;  2RDI A;  4DR6 J;  5J1E B;  2V2Q A;  3M32 A;  3PYF A;  4AFF A;  1O9T A;  4ZPV R;  4C97 A;  2W24 A;  4ER8 A;  1JLA A;  3W2W A;  1HNZ F;  4XK8 C;  4DR5 F;  3C2P A;  3H98 A;  1ZM4 A;  3ZTS A;  1B7F A;  2YKO A;  4DV5 C;  4BC7 A;  1NK6 A;  1H73 A;  4K5R A;  3VQT A;  3J80 D;  4I9F A;  3A3P B;  1N32 J;  1PYT A;  1T3O A;  1UA0 A;  4OZJ A;  2DRA A;  1I94 J;  4DUZ F;  4RU2 A;  4Y3C A;  1J2V A;  3KNA A;  2HFV A;  4CWB A;  2Q66 A;  3BN4 A;  4FUQ A;  4I9G A;  2MHE A;  3FSI A;  2CPH A;  2QJ3 A;  4OIX A;  4C4W A;  4D4I A;  3UVJ A;  1HNX C;  4CP5 A;  3NMR A;  2CNN B;  4OI6 A;  4JI5 C;  2OUG A;  3I5A A;  1X5T A;  2CAD A;  2AX1 A;  2YQ3 A;  3GCX P;  4TY8 B;  1SJ3 P;  2JLF A;  1M5K C;  5J2N B;  5HAO A;  1X5S A;  2E8F A;  5FLX D;  1H3D A;  4YR2 A;  3DOK A;  4ZCK A;  3PW2 A;  3HDS A;  1Q82 T;  4NOZ A;  2G1H A;  1BD6 A;  1R0A A;  1XRA A;  5KFK A;  2DCL A;  3CJS A;  5HVH A;  1VRU A;  2CQ4 A;  3AD8 C;  1LV5 A;  4ID5 A;  3TQ1 A;  2G2O A;  4C8N A;  3UWT A;  1WG1 A;  4U5Y D;  1GEH A;  2YWE A;  4KGX B;  4I7F B;  2BE2 A;  2DIT A;  5KT7 A;  5GAG I;  3LP1 B;  4P2X A;  4DV1 F;  3KOA A;  2F63 A;  5KG5 A;  5ETQ A;  2EG2 A;  2GJ2 A;  4KV8 A;  2F40 A;  4O4G A;  3ENA A;  3GIJ A;  5D15 A;  1YZ7 A;  2F8E X;  2QA1 A;  1T8E A;  2HMI A;  1O90 A;  2P2M A;  3F44 A;  2DPJ A;  1VIO A;  4OX6 A;  2FHO B;  1U0H B;  1RTH B;  1VQ4 S;  4LF9 F;  1K0T A;  4RM3 A;  4DV4 C;  2BOA A;  2ILZ A;  2YWW A;  3KK1 A;  1KS2 A;  1SJ1 A;  4DV3 J;  3MXH P;  4DG1 B;  2HHT A;  4P6Q A;  5KFF A;  3R6L B;  3MAH A;  3NS7 B;  4WXW A;  4PYD A;  4A8Y A;  1D0E A;  4B3M J;  3K0J A;  1M6X A;  4LE5 A;  4KPY A;  2MQQ A;  2AYE A;  1SL1 A;  3CF5 Q;  4PXC A;  3FCE A;  1OMS A;  2HWH A;  3VGV A;  1CPZ A;  1C1B B;  5U47 A;  2WSC C;  3KLG B;  4NLW A;  3GIM A;  4TN2 A;  2ZM6 J;  5E33 A;  1CG2 A;  1WG4 A;  2DRD A;  4MJK A;  7FDR A;  1XR6 A;  5KFM A;  2MKI A;  4DSK A;  3T1H C;  4CLY A;  2OP5 A;  3IWX A;  4U7U K;  4NMX A;  3MM6 A;  3KYL A;  1YHQ S;  1ZTW A;  2KXH A;  3BPD A;  1FUG A;  3SSS A;  3TJ9 A;  5HMY A;  2ASY A;  2BJ7 A;  4X65 F;  4ZS6 A;  4BWM A;  4DQS A;  2CDR B;  1HPZ A;  3UX3 A;  2M52 A;  2OFG X;  1D9D A;  1HR0 J;  3JTN A;  4LF7 F;  1KQF B;  2A2D A;  5K14 B;  4QYZ K;  3GYG A;  1F9H A;  1SV5 A;  4N47 A;  2ZJQ Q;  2DB1 A;  2DR9 A;  3NGK A;  3NI2 A;  5H9F J;  3V4I B;  5D3G B;  3G4S S;  2DR7 A;  2QIF A;  1V9O A;  1NSK L;  1PYO B;  1FXR A;  3JS9 A;  3CMQ A;  4NDN A;  3A8K A;  2YVS A;  1RT3 A;  2P02 A;  1TKZ A;  4ES2 A;  3LGX A;  4TLQ A;  2HQC A;  2DR8 A;  3QO9 A;  3WBZ A;  4YEA A;  4PG4 A;  5DGB A;  4F4Z A;  5HP1 A;  2M5O A;  2ZUA A;  2NRE A;  2MYF A;  5GME A;  2XY5 A;  3S01 A;  1RJJ A;  2XWX A;  2OPP A;  4F3Q A;  2QC3 A;  3HVR A;  4X65 C;  2UU9 F;  1RHQ B;  3CCZ A;  5KFQ A;  2W7P A;  3H40 A;  2ZH4 A;  2OPQ B;  4ECS A;  3PR4 A;  2E8E A;  3EVW A;  4A8F A;  5BR8 F;  2PE8 A;  4NLS A;  5KT3 A;  3SFU A;  1F5B A;  4GKK F;  3LAK A;  4ANE A;  1VQ5 S;  2PN2 A;  4NML A;  3BQ0 A;  1FEH A;  2BAC A;  3DYA B;  1C1C A;  4ECU A;  3HZG A;  4K0K C;  2WTF A;  4ZN3 A;  2PC6 A;  2KRB A;  2VFU A;  4ZP6 A;  1X4G A;  2VG6 B;  3F41 A;  1ZZF A;  2RVJ A;  3G87 A;  2D3U A;  4OQJ A;  5FD1 A;  1FRH A;  4ZCI A;  2J0W A;  5JUM A;  5BXI A;  5GAD U;  4R5P A;  1N5S A;  1NXI A;  3N6N A;  4KFB B;  3JAM Y;  1YRU A;  2VDH A;  5G4D A;  1U2C A;  3D6F B;  1KEK A;  3V6D A;  1FWK A;  4I56 A;  1LWF B;  3SYZ A;  4RW7 B;  1GTE A;  5H9E K;  4OYC A;  3TEH B;  1A9N B;  1S9G B;  3EQ6 A;  1WHX A;  4EGL A;  2LCW A;  2JC0 A;  3HJV A;  1HI0 P;  2HLT A;  1N88 A;  2J6U A;  1HNI B;  2RUG A;  1FVQ A;  2DEI A;  3U27 A;  2GAG C;  1RUS A;  4ZP9 A;  2KDN A;  2KXF A;  4DCT A;  2VQF F;  2FZC B;  5J1N A;  4IG3 B;  2Z0G A;  4WCE Q;  4AXI A;  1UPP A;  1SKR A;  1MML A;  1Q4R A;  2DIS A;  2E1A A;  3GPA A;  3NMA A;  3PBK A;  3ICL A;  3UW1 A;  5IM0 B;  2AJ1 A;  2HVD A;  4KHP J;  2ASB A;  1WC4 A;  4LRB A;  1HIY A;  5IV4 A;  2Z2Y B;  2YKN B;  1N32 F;  1RAF B;  4CLF A;  2DNL A;  2JDJ A;  4DF4 A;  3DLG B;  4KGK A;  1SB6 A;  3FCW A;  4ES3 A;  1JLG A;  3J7Z T;  2ZWO A;  1J5E F;  1NH7 A;  4DFP A;  2D41 A;  3RB6 A;  4RVN A;  1LEO A;  1BLU A;  1QE1 B;  4ZPC A;  1U1Q A;  1XNQ C;  1T9W A;  1IKW B;  4WYL A;  1S72 S;  1VFJ A;  1MDB A;  1XWL A;  4IDK A;  4O23 A;  1HR0 F;  4M8L A;  4J9V A;  4MYT A;  4DL3 A;  3KLI A;  2CPI A;  3UDL A;  3NY0 A;  3ILO A;  2AGQ A;  1JXV A;  1TK5 A;  1N33 F;  4G36 A;  5HRO A;  4AUK A;  1S5Z A;  1YJN S;  4ZPW R;  1YJV A;  2DXE A;  2X1G A;  4FKX A;  1T05 A;  1IBK J;  2OI2 A;  2J8A A;  1S6Q B;  2V69 A;  1FD8 A;  4NZ0 A;  3QQC D;  4HYK A;  3B8H A;  2MGZ B;  3NBP A;  4ECR A;  4ZIT A;  2GCF A;  4N5S A;  2JEI A;  3DLK B;  2DH8 A;  3DOK B;  4H4K C;  5E3P A;  5B0G A;  2WBM A;  3LP2 B;  3ZXW A;  3VAJ A;  4ECY A;  2YH1 A;  3M7V A;  2RT3 A;  5LSL A;  1MW7 A;  2FJD B;  2WK4 A;  3JTP A;  5LMN J;  1QTM A;  4RNM A;  1T94 A;  1Q78 A;  2HZC A;  2DHX A;  1VJW A;  3CCW A;  3IG1 B;  4NCG A;  1U6F A;  2XI2 A;  2HHV A;  2FJA B;  1CBK A;  3EDR B;  2AYG A;  1LXJ A;  3RR7 A;  1BQM B;  4MKY A;  1M6X C;  2FVS A;  2CQP A;  4RR5 A;  5LJ3 Y;  2X51 A;  4NZ6 A;  5EUH A;  2IAJ B;  2VC1 A;  2AYM A;  2HQD A;  3RW6 A;  4P9S A;  2V8V A;  1HMV B;  1XK8 A;  2WB1 D;  5BR8 J;  1KD1 T;  2I9S A;  3KJQ B;  2ZM6 F;  3NNH A;  1O92 A;  3Q83 A;  1KFD A;  4ECQ A;  2FZK B;  1K9M T;  5CYM B;  2GGP B;  4RLF A;  2H1Y A;  1TUW A;  4HHH A;  3N54 B;  3UDV A;  2DHH A;  4ZVG A;  1HBO B;  1JLA B;  3CDB A;  4DEZ A;  1TL7 B;  5J2M B;  5CYM A;  1H0H B;  3UD4 P;  4OHY A;  3NGU A;  1CC8 A;  2JZ5 A;  3MMJ A;  2C42 A;  4F0K A;  3M30 B;  5J1E A;  3LWM A;  4DF8 A;  3OL6 A;  1P9Q C;  1VQL S;  2HYI B;  2CDQ A;  3CO9 A;  2DGT A;  3VV2 B;  4OHX A;  1FF2 A;  3R9W A;  1LWE B;  5GMD A;  3IM9 A;  4KAI A;  2JLG A;  1WTF A;  2W1B A;  3KLI B;  4KPC A;  4FF2 A;  2KI2 A;  5AXK A;  4F36 A;  4TU7 A;  4NLR A;  3I9Z A;  3HPO A;  2ZHA A;  1UWD A;  4K0B A;  5DET A;  3K58 A;  1Q8K A;  2DXD A;  4U8Y A;  1HH2 P;  1O93 A;  2ZH9 A;  4KO0 A;  4N8O A;  1Z1Z A;  2JLE A;  2XZD B;  4G1P A;  2OTJ S;  3N5F A;  3MMC B;  3BDE A;  4LIW A;  1HD1 A;  1TFW A;  1PA4 A;  2N3L A;  3BR9 A;  5CZX A;  3LW5 C;  2EEY A;  2QW0 X;  2VDI A;  2ADC A;  4MFB B;  2JNJ A;  2ZE2 B;  3HHL A;  2PT7 G;  1RAD B;  1MKY A;  3R1L A;  1UEV A;  3QIP A;  4M63 A;  2QFJ A;  3L7P A;  3BKU A;  3VR1 A;  1XER A;  3IXQ A;  1IJF B;  1WHV A;  3BZQ A;  2DJW A;  2CQ2 A;  2PSZ A;  4GVB A;  2V4J B;  2DGO A;  4LIR A;  1T95 A;  1HL6 A;  2EC2 A;  3SBM A;  2PN6 A;  4QBU A;  1S7I A;  1PCA A;  1Y5L B;  3RJM B;  4P75 A;  2PO4 A;  5KFO A;  4EBC A;  3CME S;  3VGU A;  3D0I E;  4USW A;  3I32 A;  1WOS A;  1O0P A;  4FP9 A;  4QIF A;  2XMK A;  4ZP8 A;  4ZVO B;  5KAK A;  4AQY J;  3TAQ A;  1FJG C;  5HMW A;  4PWU A;  3PEH A;  4R1L A;  1K1Q A;  3L7U A;  4DCU A;  1NBE B;  4LSZ B;  2BVZ A;  2BEF A;  4R0J A;  5A76 A;  1PSD A;  4KFB A;  2MQP A;  1ZM2 A;  4CH1 A;  5CXT A;  2MMY A;  1B70 B;  3HMJ G;  1EET A;  2QO3 A;  3IS9 A;  1KLM A;  2CQG A;  3PVX A;  1Y4Z B;  3QNW B;  4PG6 A;  3W66 A;  4DUY C;  1WOO A;  3I4H X;  3CDW A;  4DCJ B;  3EZ5 A;  2CZ9 A;  2MB0 B;  1MN7 A;  2UXB C;  3Q89 A;  4DR7 F;  1WF3 A;  4USI A;  2IC3 B;  1JJ4 A;  2PD1 A;  4C98 A;  1S9E B;  1TL1 A;  4DG8 A;  3P5T L;  1TUV A;  4RO0 A;  3IBW A;  4Y0F A;  5E7Q A;  4L75 A;  4RW7 A;  3X1L B;  2G0J A;  1ZS6 A;  1BWV A;  3T9Z A;  2UXD C;  2IDL A;  4I6W A;  1KTV A;  5IZH A;  2GIQ A;  2J9D E;  2NXU A;  4K8R A;  3BJY A;  2HGL A;  3R27 A;  5IOL A;  3CMA S;  2LEC A;  3CUL A;  2CQ0 A;  3ET6 A;  1T0T V;  1VQ8 S;  1UVK A;  1ITP A;  1I1G A;  4PKD B;  3NPD A;  4EK2 A;  1VQS A;  1WDD A;  3C66 A;  4WP9 A;  3VAG A;  4D3H A;  2D3O 1;  1HWI A;  1XNQ F;  1H7X A;  3QWP A;  5T41 A;  2KVI A;  2O01 C;  2CJK A;  2RDD A;  2ZD1 B;  3T6J A;  1XEZ A;  4DWI A;  1OQ6 A;  4U7U D;  4WE1 B;  4KH0 B;  4RM2 A;  3J7A 1;  1YBA A;  2R7V A;  2CQD A;  3H90 A;  1NJZ A;  3WHI A;  1WOR A;  4GKJ C;  2E5L F;  1U8W A;  1RT4 A;  2FJE B;  2OPP B;  2HHP A;  2V0N A;  5BYR A;  2CJQ A;  3U1M A;  4URG A;  2R8H A;  2YNG B;  3VAK A;  1NY8 A;  4DX8 H;  2V2K A;  3KDN A;  4ISB A;  3MMB A;  2XLI A;  2VF3 A;  2CWX A;  1UWA A;  1SBR A;  3M1V A;  1FKA F;  4WYW A;  3I0R A;  4I0W A;  3MM6 B;  3HJF A;  2UZA A;  2VIC A;  2UXB J;  5EX3 A;  4W98 A;  4DV6 C;  3JTO A;  1S9E A;  1UL3 A;  3NOG A;  4DUY J;  1N34 F;  4X4V A;  3K5M A;  5A19 A;  4F0M A;  1J27 A;  5A8K A;  1ARO P;  4ZK7 M;  2W9A A;  2QL8 A;  3AF5 A;  1NSP A;  3GG0 A;  1HHS A;  4QR0 A;  1JLC A;  4HTI A;  5HQ8 A;  4EBD A;  2E8C A;  3I07 A;  2UV8 G;  4DR2 C;  4KB7 A;  3HHL C;  5AJ3 F;  5I3U B;  1RT5 B;  1KLM B;  4YOE A;  4Y65 A;  5JVH Q;  3R9X A;  4RNN A;  1URR A;  3ET6 B;  4AQY C;  1VQ9 S;  1IR2 A;  3B78 A;  1UFK A;  2B56 A;  4N77 A;  3G6Y A;  2OIH A;  3N01 A;  3B6B A;  5A8R A;  4JM1 A;  2IYI A;  3DLL Q;  5GMK a;  4ILL A;  1HA1 A;  3IM8 A;  3VNR A;  3BSO A;  3D0H E;  1VMB A;  4NLG A;  2ZOG A;  3CJ4 A;  1RHU B;  2GW8 A;  4NXN F;  3AH6 A;  5C2G A;  2WRM A;  4B9N A;  3CD6 S;  4YN3 B;  4HEA 9;  4ZVQ B;  4F0H A;  4K50 A;  3I08 A;  5IWA C;  4JI6 J;  3GFH A;  4USJ C;  5LMN C;  1OWX A;  2E1R A;  4A8K A;  2M2B A;  3MAA B;  5B0F A;  2R7X A;  3DKD A;  1R3N A;  2OKQ A;  1RAI B;  4U8V A;  3UD3 P;  4NXM F;  2PRO A;  4R0M A;  2KT2 A;  4RW4 B;  3HFZ B;  1URN A;  1MDF A;  5DZ7 A;  3S1T A;  2HBZ B;  2DRB A;  2PT0 A;  2Y3Y A;  1NND A;  1CJK B;  1P1L A;  1QJH A;  3TA2 A;  2XGQ A;  1IQT A;  3DLE B;  2RS8 A;  4KGZ B;  2OEK A;  1X5P A;  1AA1 B;  2O5D A;  1D8Y A;  2OMO A;  3SCI E;  3RB3 A;  1IKX A;  2V9K A;  4IFV A;  3UVJ B;  2KN4 A;  4DV3 F;  2EFQ A;  3RB4 A;  4LF7 C;  5KG4 A;  2UUB C;  2WON A;  4B3R J;  2LXU A;  2QLF B;  3NNA A;  4B3T F;  2ZKU A;  2QVX X;  3HF5 A;  1YJW S;  2ZUG A;  4XDD A;  3TWZ A;  4IOA Q;  1HHQ A;  3I6P A;  3JQM A;  1SC1 B;  4Y2C A;  3ZTP A;  1YBU A;  2U1A A;  5C42 B;  2BQ3 A;  4GO5 X;  2DVI A;  1S1W A;  3LGN A;  4XPE A;  3CTR A;  2HIY A;  3HVT B;  3G6X A;  2CJB A;  3M6W A;  5KG3 A;  1N33 C;  3FZB A;  2WZ1 A;  4CRJ A;  4U6P A;  5EN1 A;  3BKT A;  4FBT A;  3P3D A;  3W3S A;  3ETC A;  1HR0 C;  1WC5 A;  4C3L A;  2YKM B;  2FB0 A;  2ZE2 A;  3QYY A;  1FA0 A;  2Z2Z A;  3ISN D;  4PWW A;  4W4M A;  3SQG B;  3FFI A;  2Q6B A;  3MED B;  3WX4 A;  4RZR A;  3OSP A;  3KUG A;  1U1P A;  3EGN A;  2C3M A;  2OAU A;  3GWC A;  5HO4 A;  4OZ5 A;  3ZTR A;  4O3R A;  4B3O A;  4K0K J;  4ED7 A;  4ECX A;  3AD9 C;  2B4U A;  2V50 A;  4USK A;  1YQH A;  2D7S A;  4LF4 J;  5FLX Y;  2EKY A;  5HI7 A;  2I5J A;  3FUY A;  3Q8Q B;  3T1H J;  1HNX J;  7AT1 B;  1IKY B;  2BX6 A;  3U1N A;  1MRO A;  4QU6 A;  1NSQ A;  3KLH A;  1YBT A;  3W7B A;  2CJA A;  3KDO A;  1ML8 A;  3NS6 A;  1C4A A;  2LU2 A;  3DLB A;  3QFW A;  2FUG 9;  2H51 B;  3WDO A;  2DPI A;  3DRX A;  2ALY B;  2IMW P;  2YXL A;  3W1Y C;  3DU5 A;  3MEC A;  2O1P A;  2XHW A;  4FF3 A;  2HHS A;  3Q8S B;  5A6P A;  4S0M A;  4PR6 A;  2HHQ A;  4OJ1 A;  4TKT A;  1A6L A;  2D7V A;  3EM1 A;  4UT4 A;  2C2R A;  3W2V A;  3H5S A;  4NRT A;  3MHY A;  3WIV A;  2WOM B;  2HHH J;  3CE8 A;  3MGJ A;  1LQL A;  2B5J B;  1FNO A;  1IKX B;  2LQ5 A;  1Z4U A;  1O6X A;  3EZU A;  3IG1 A;  2YNH A;  3EYZ A;  1TKD A;  3DLE A;  4L4Q A;  4ELT A;  3LWL A;  1QVF R;  4LF1 A;  1XBW A;  4PQU B;  5KFA A;  3GYN A;  3OTB A;  4O3P A;  3W8P A;  5KG2 A;  4B3S C;  3G9C A;  1AYE A;  4NLY A;  4ED0 A;  2VSQ A;  3NBP B;  4F04 B;  2MZ1 A;  3OW2 R;  3MMA B;  3RBD A;  3MUT P;  2ZIT A;  2DH9 A;  2IVM A;  1TR0 A;  3BSA A;  3CVK A;  3MAA A;  4U9R A;  2FZG B;  5T7L A;  2WP0 C;  2IVY A;  1HFE L;  1U1M A;  5LCI A;  1F2G A;  3AXK A;  2EG1 A;  1AW0 A;  2V68 A;  2XCA A;  2HVH A;  2GO9 A;  2JNV A;  1X9M A;  1S1T A;  5KOX A;  4X4R A;  2GQQ A;  3H2T A;  1HWL A;  1FT8 A;  2X7I A;  4DDF A;  3KLF A;  5I3Q A;  4F7V A;  1WKJ A;  1NK7 A;  5F8G A;  3QJP A;  5KFD A;  5KYT A;  1PC4 A;  2I1R A;  2L9N A;  1GAO A;  1UTA A;  2VOO A;  1Y11 A;  3H5X A;  1HI1 A;  4M5K A;  2C3Y A;  2YKN A;  1CSJ A;  3HHE A;  3P6Y C;  3DDN A;  3W60 A;  4RUA A;  1KHW A;  3DRR B;  2HBR B;  4I2Q A;  5BSW A;  4HR2 A;  2CQC A;  1VQN S;  4YUD A;  2M3D A;  4IKA A;  9RUB A;  3T41 A;  5KFC A;  2GZO A;  4FPI A;  3EWG A;  1ZET A;  1D3W A;  2FLP A;  4IOB A;  2KXN B;  1SKS A;  2V2V A;  1S99 A;  2IBO A;  1RG9 A;  3G6E S;  1X60 A;  3BGF A;  3OHB A;  5CD4 A;  1JB0 C;  3M9N B;  1N36 F;  3J7A N;  3D1O A;  5ETN A;  4JBC A;  2JFD A;  2O66 A;  2YNF A;  5M2P A;  1WCJ A;  2ZZN A;  1DHM A;  1U1K A;  4G3I A;  2UU9 J;  3BBF A;  1WEY A;  3KJN B;  1SVD A;  3QGH A;  1FWP A;  4JI8 J;  3MI7 X;  4X62 C;  2ZBR A;  1MWQ A;  3BRE A;  3OL9 A;  3LAX A;  1D8Z A;  4O3N A;  5KFX A;  1F1B B;  1FRJ A;  3TJA A;  4DPY A;  5KFY A;  1Y7P A;  5AXL A;  5B0C A;  4YDD B;  1AFI A;  3KXW A;  4RBU A;  2CQB A;  5G0R A;  3IAM 9;  3D6T B;  1EKR A;  3OQ2 A;  2MQL A;  3EDQ B;  1H6K X;  2W2N P;  3OD2 A;  1Q79 A;  1RAO A;  4EFA C;  1YIT S;  4KHP F;  3FRZ A;  4WE1 A;  5T14 A;  4WFA Q;  1DJ0 A;  3M6U A;  3K5L A;  3UX2 A;  1NJI T;  2IYG A;  1GMV A;  2QE5 A;  4A8M P;  1REG X;  4DOZ A;  2Y27 A;  3HHK A;  1DRZ A;  5D3G A;  2HHH C;  1L3V A;  3VGS A;  5EDW A;  4X4U A;  1U1N A;  4NCB A;  3BF4 A;  1F2H A;  5F8L A;  3AD7 C;  2FLL A;  1F9F A;  2JHE A;  2DK2 A;  1YG0 A;  1LK5 A;  3MTK A;  1KOH A;  4WK1 A;  4QW8 A;  3ZZR A;  2QT7 A;  5IFM A;  1KSP A;  4B3R F;  2PFF B;  3M2U A;  5I3P A;  2A1B A;  5HVG A;  3R7B B;  3MFH A;  3CJ0 A;  4A8S A;  2BBE A;  2VQF C;  2EWH A;  3FNN A;  3B4M A;  1HQU A;  2JOQ A;  1ROF A;  2GQC A;  3BGR B;  3CCS S;  3NGD A;  4EMD A;  2M8H A;  3BGO P;  4ECT A;  3PXG a;  1Q81 T;  2UVV A;  2J8S A;  3PR5 B;  4DV2 C;  3IA0 A;  1WUU A;  4DL0 C;  2BM0 A;  8ATC B;  3SV3 A;  4CQ1 A;  5KG7 A;  2R7R A;  4ED2 A;  2A6M A;  3EXY A;  3PW7 A;  1KDN A;  5T7L B;  4JI5 F;  5CHC B;  1OS5 A;  5L46 A;  3CJQ A;  1KVJ A;  3MM7 A;  2DIV A;  4LRA A;  3KTQ A;  1RP5 A;  2BJD A;  2RU9 A;  3IRX A;  3PKY A;  2RS2 A;  1IJE B;  2E0G A;  1VLO A;  1BUX A;  1B4S A;  1EJ7 L;  2VA3 A;  2LFV A;  3C8Y A;  4PQU A;  2BAN A;  4DR4 F;  1JIH A;  4AD6 A;  1C0U B;  5CCL A;  2HAI A;  2FGC A;  3DI6 B;  4KH1 B;  4DR5 C;  2WVD A;  1S48 A;  5L39 A;  3H5U A;  5DQG A;  4KV8 B;  1T11 A;  5K8N A;  3ENQ A;  5F9N A;  4OFZ A;  2B3T B;  4MT1 A;  4PUI A;  2YWC A;  2CJY B;  5DQI A;  1TL3 A;  5KFE A;  2UVR A;  5ETR A;  4FF1 A;  4K4Z A;  1S1U A;  1FJC A;  1FK9 A;  1S59 A;  2W7O A;  2QL9 B;  2WW4 A;  4ZJZ A;  1K0R A;  2N7Y A;  2HG4 A;  3NEK A;  1OYD A;  3MPV A;  3VAI A;  3K7R A;  4OJH A;  4AYB D;  1UVL A;  3GLJ A;  4LF6 F;  5KT4 A;  2L41 A;  2P8I A;  3KK1 B;  3HLU A;  1DAX A;  4TYB A;  2W9C A;  3CJT A;  1RU2 A;  3TVZ A;  5IS2 A;  3ITH B;  1BMQ B;  4YS2 A;  1JJC B;  5AXN A;  2W2M P;  3LA0 A;  1Y0H A;  4OV1 A;  3FSX A;  4LT6 A;  5KOW A;  2ONF A;  2VOD A;  4WU3 A;  4PXD A;  4K2X A;  1FJE B;  3A25 A;  4RLE A;  2C2D A;  2YTC A;  2Y0B B;  2BE2 B;  1FE4 A;  1F9E B;  2IA0 A;  1OY8 A;  2OHD A;  3A8J A;  4Y2A A;  3VWS A;  2NZC A;  2ZH2 A;  4EYI B;  1RSC A;  3RRG A;  1NYE A;  2AGP A;  2Q3P A;  3MEG A;  3BQ2 A;  1R0A B;  3GTY X;  4M5G A;  2ZH5 A;  1RTI B;  2OGU A;  1IBL C;  4B17 A;  1OSD A;  2OH2 A;  4ZLP A; 
#chains in the Genus database with same CATH homology
 4GKK C;  5K85 A;  2Y4O A;  4DCS A;  3NI2 A;  4NDN A;  1MD9 A;  1I94 C;  2P02 A;  3LGX A;  1QWI A;  2CXC A;  5BUQ A;  3DLP X;  5K8F A;  5IFI A;  4G1I A;  3DHV A;  2E8E A;  4PZP A;  5KEI A;  4DV7 C;  4JI0 C;  3RG2 A;  5AE1 A;  2PN2 A;  2P20 A;  4K0K C;  3IEV A;  1V26 A;  1XMQ C;  4LF5 C;  5DV9 A;  3TUF A;  3EQ6 A;  4BC9 A;  4JI4 C;  1N32 C;  1FJG C;  2Y4N A;  4DCT A;  1BA3 A;  2ASB A;  4RVN A;  1XMO C;  3E7X A;  1XNQ C;  1MDB A;  4JI7 C;  1ULT A;  4LFB C;  4XX2 A;  3N2Q A;  2XR1 A;  1P7L A;  3J81 D;  4MH4 A;  3GKU A;  4NXN C;  3PBK A;  3L95 X;  5JRH A;  2QVY X;  4LE5 A;  4YHH C;  1N2F A;  4IR7 A;  3KXW A;  1T5D X;  1O92 A;  3CW9 A;  4RLF A;  4GXR A;  3N54 B;  4HPV A;  3IML A;  3R9W A;  4B3R C;  4LF6 C;  4OYC A;  3FCC A;  4X65 C;  4K0B A;  1O93 A;  1HH2 P;  5GTD A;  1XRC A;  1PA4 A;  4R0M A;  5CZX A;  2QW0 X;  2MKY A;  2YCB A;  2PT7 G;  4DG9 A;  4LF8 C;  1MKY A;  3A4I A;  4KHP C;  1IBM C;  3PRO C;  2ATW A;  1XRB A;  4G36 A;  5A1I A;  1USP B;  1ZB9 A;  2JMP A;  4RMN A;  3OTO C;  4R1L A;  4DCU A;  5T8T A;  4YY3 C;  4D57 A;  2D1T A;  5H9U A;  3UOW A;  4DV1 C;  4DUY C;  4LF4 C;  2CY1 A;  2UXB C;  4FUT A;  1WF3 A;  4GS5 A;  2F4V C;  1HNZ C;  4DG8 A;  4RVO A;  2DYJ A;  2ZM6 C;  2OO4 A;  3JAM D;  5E7Q A;  5A1G A;  1L2F A;  2UXD C;  3RV2 A;  4DUZ C;  4B3M C;  3NPD A;  3SO4 A;  2HJG A;  4KTV A;  3GR1 A;  1MXC A;  1MXA A;  3CW8 X;  4DV0 C;  4DR1 C;  4KTT A;  4RLQ A;  2D28 C;  3A9U A;  4RM2 A;  4DR3 C;  3VNQ A;  4ISB A;  4JI2 C;  4GKJ C;  2D1Q A;  2EGT A;  3A9V A;  4BBY A;  2OBV A;  5AE2 A;  1XNR C;  2D1R A;  4D4G A;  4DV6 C;  4BCA A;  5A19 A;  4PRO C;  5ADZ A;  2QL8 A;  3AF5 A;  2E8C A;  3I07 A;  5A2Q D;  1VLA A;  4DR2 C;  5BSR A;  3R9X A;  4WV3 A;  4AQY C;  3IPL A;  3E7W A;  4JM1 A;  3VNR A;  3ETO A;  3DAY A;  3NYR A;  3GR0 A;  2OPL A;  2WD9 A;  2D27 A;  2WP0 C;  1T5H X;  5IWA C;  3I08 A;  4RM3 A;  5LMN C;  1QM4 A;  4OXI A;  2PRO A;  1MDF A;  1MXB A;  4B3T C;  4LFC C;  2QVZ X;  1LCI A;  3GPC A;  4OX9 C;  1YJ7 A;  5IT9 D;  4JI8 C;  4LF7 C;  4LFA C;  2UUB C;  2UU9 C;  2QVX X;  3VNS A;  2DPL A;  4GXQ A;  2P2Q A;  1N33 C;  3LUS A;  3ETC A;  1HR0 C;  4W4M A;  4IZ6 A;  4DR6 C;  5BSM A;  4TPS B;  4NXM C;  1USP A;  4JI1 C;  4L2Z A;  1EGA A;  2E5L C;  5T8S A;  3C5E A;  2VZE A;  2KZF A;  2V7B A;  1JOS A;  1ML8 A;  4X66 C;  4WS9 A;  1N34 C;  4BSZ A;  4G37 A;  4DV3 C;  2D7V A;  5BR8 C;  2D1S A;  3R44 A;  5BUR A;  4ODJ A;  5LMU C;  4JYA C;  1HNW C;  1LQL A;  4LF9 C;  4L4Q A;  3IEU A;  4B3S C;  1V25 A;  1KKG A;  2VSQ A;  3PES A;  4DR7 C;  2VQE C;  1IBK C;  2AYA A;  2UUA C;  3G7S A;  1RY2 A;  2E7G A;  3H2T A;  1GPM A;  5FLX D;  5KYT A;  5BSW A;  5BSU A;  1UKK A;  1RG9 A;  3B7W A;  2UXC C;  3TQI A;  5BSV A;  2P2J A;  4FTF A;  4X62 C;  4JV5 C;  1ZB8 A;  3LAX A;  2P2B A;  2BJO A;  4R1M A;  1WH9 A;  4DCV A;  4PHT A;  4JI6 C;  3UZ0 A;  5BST A;  2Y27 A;  3L8C A;  2HHH C;  2UUC C;  3CJE A;  2OPL B;  4JI3 C;  2YWB A;  1PG4 A;  1N36 C;  1O9T A;  3AF6 A;  4DV5 C;  4BC7 A;  3J80 D;  4I9F A;  4FUQ A;  4I9G A;  5BUS A;  4DV2 C;  4D4I A;  1HNX C;  4JI5 C;  4EAT A;  2E8F A;  4MTN A;  3TDE A;  4NOZ A;  2E0G A;  2BH1 X;  1XRA A;  5CZV A;  4DR4 C;  4X64 C;  4U5Y D;  4DR5 C;  1O90 A;  2P2M A;  2YWC A;  3T1Y C;  4DV4 C;  3EER A;  4ZJZ A;  2VQF C;  1K0R A;  3S82 A;  3NYQ A;  4L7I A;  3LNV A;  3FCE A;  1J5E C;  2ONF A;  1PG3 A;  3T1H C;  1NYE A;  1AMU A;  5KYV A;  1FUG A;  2P2F A;  5AE3 A;  4D56 A;  1IBL C;  4ZLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...