1YJ9I

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1yj9I00
2NXNB 4IOCF 1VQ6I 5GAEJ 1ACIA 2QA4I 4IOAF 5DM6F 1VQNI 2OTJI 1S72I 3CF5F 2JQ7A 1YJ9I 1FOYA 1VQ4I 3PIOF 3G4SI 2E36A 3CCLI 1VQOI 1VQ8I 3PIPF 1YHQI 5GADJ 2ZJRF 1QA6A 5DM7F 5GAGJ 3CCQI 1YJNI 1YIJI 1VQMI 3CMEI 3CCVI 2ZJPF 4IO9F 1VQLI 3CCJI 2E35A 2OTLI 5JVGF 1Y39A 1HC8A 2K3FA 3J7ZI 3G6EI 3G71I 3CD6I 1VQKI 4UY8I 1VQ9I 3CJTB 2ZJQF 3I56I 3CCEI 2FOWA 2QEXI 1VQ5I 3CC2I 1MMSA 3CCRI 3J7YJ 1FOWA 3CCMI 3CMAI 4V19K 2H8WA 5GAHJ 1YITI 2E34A 1YJWI 1FOXA 1VQPI 3DLLF 1YI2I 3CC4I 1VQ7I 3I55I 3CCUI 3CC7I 3CCSI
chains in the Genus database with same CATH superfamily
1P2FA 4JK1X 4IF4A 4AWXB 2ZXJA 1OPCA 1BM9A 2CQNA 3GF2A 2HDCA 4II2A 3SZTA 4BQNA 5L3CA 2EWNA 2KRCA 2V26A 6PAXA 3O8GA 1OCTC 4PFOA 4AIHA 3WGIA 1XMAA 3G73A 3CMMA 1XSDA 3GFJA 1BW6A 2EFPA 3GXOA 2LY9A 2Y2ZA 3LFUA 4II3A 2B0LA 4RB2C 2OCEA 2VBWA 3OOPA 5DD4A 2XSDC 1USSA 3NWTA 4F7ZA 3A0BC 3F9KA 4UUTA 2G9WA 2VQCA 3ISPA 2OQRA 1UAAA 2RAEA 3RDIA 3OYHA 4B3XA 2YS9A 3E3VA 1CF7A 3JRCA 2GXAA 2CMPA 2CQ7A 4XMYA 4KYWA 2CV1A 4KT6A 3SEQA 5TISC 3ZMSA 2P5KA 2DFFA 3HOWJ 1J5YA 2KRFA 4HPQA 3KIOA 1UELB 5B1BH 4WK8F 3J80Z 5ICGA 2O5RA 1SVMA 4OU0A 5F04A 2ZXWH 1XPXA 1PUFB 1P92A 3AL0C 4EGYA 3CUQC 1TW2A 5FFXA 1Z9CA 5JI6A 4AYBA 2IP2A 1H9GA 2WV1A 3SQNA 3GX4X 3LSIA 3KE2A 4XLNF 3ZPLA 1Z67A 3DV8A 3CCVI 2R5ZA 2L9RA 3ZQLA 2WA0A 5TRDA 4BKXA 3OS2A 2D2WA 3H9GA 2WB1A 1MNMC 1HC8A 4PJ0C 4A0XA 1UG0A 4KUMA 2PMUA 2E1NA 3K9TA 4QPOA 1QQIA 3S93A 4UY8I 2FF4A 5J4VA 3GO5A 1BA5A 2E60A 5BOXA 1ZTRA 2H6BA 4CCNA 2RQPA 3AG2H 2R7TA 2R7SA 3L09A 4D7NA 2E2HJ 2D5VA 2DA3A 4XBFA 3ZMVA 4V19K 1MBFA 3K2ZA 1TW3A 4XM3A 5CJ9A 1AKHA 3FXLA 1AA7A 4A5MA 3HTUA 4CCJA 3S15J 2LSOA 2JA8J 2LP0A 4N4OB 2CFXA 4YIIA 2PX9A 2IS6A 4RAZA 1Z6TA 3TW6A 2M1BA 3NWSA 1W4MA 1YX5A 3I71A 3QP5A 1RRJA 2IW5A 4IHTA 3N05A 2C6YA 2P8TA 4AIDA 4DZJA 4U0YA 1QHGA 2LY1A 4MEYF 5E8GA 2Z16A 2M4GA 3CTAA 1ZQ3P 4IX7A 3TMOA 1IRGA 1J9IA 2K9LA 1U0JA 2M7BA 1IG7A 5EGOB 4JX6A 4BJ5C 2Y31A 3HRMA 5FLXK 5DS9A 1A6QA 1TT0A 2EQRA 4D9JA 2NRAC 3I58A 2E2JJ 2VODA 3GTQJ 2CQXA 3DQVC 3KPHA 3A0HC 4A3DJ 3EETA 2E71A 4KDPA 4OAZA 5F1RA 2XPWA 4XN0A 1R5GA 3JRGA 1ZG1A 1T2KA 3FXMA 3G4SI 3K1NA 1MBHA 4PCQA 3WTZA 3LNQA 4LD5A 5HLIA 3GLXA 4XRSG 2FOKA 2K9NA 2D1HA 3OSGA 3R0AA 2OD5A 2CQKA 1ZG3A 2QSGX 3QYEA 1GVDA 3F8BA 3M07A 4E70A 1WHUA 3OSFA 1ETVA 1PUFA 3ONQA 2QM3A 3CP8A 4D7MA 1FOKA 2VJJA 4GYGA 4X0GA 2Y69H 2A6EF 4ESBA 3A02A 1AOYA 5KVRA 3BZCA 5HLTA 3CCJI 1WVRA 3JRBA 4F91B 2DMTA 2EA2A 1MH4A 2MBFA 2X1CA 3P7NA 4ZZLA 1D5VA 4LK1F 3OMYA 5E18F 2GXBA 2R7OA 2VN2A 1O3SA 2LBFB 2XRLA 5FKMA 2F5EA 2IXSA 2DFHA 4ZYDA 1HBXG 1EF4A 2NVYJ 4WXCA 3HOSA 3GEZA 5HS9A 2W48A 1VQ9I 5J8FA 3CCYA 1JUPA 1TLHB 2FOWA 3PNYA 4KMUX 3ZP5A 1I39A 3BR1A 4A93J 2PEXA 5B5EC 4XRSA 3I3LA 2ZXHA 3OY9A 3D0SA 2OZUA 3LSMA 2O7OA 4MFEA 3HOXJ 3CCMI 3TEDA 1FIAA 1WQ2A 5E20A 4V2GA 3V7SA 3FBNB 4RM3A 3P9IA 1YITI 2AQEA 3R6SA 1U5TC 3G3ZA 4XQFA 3F8CA 1OCZH 1JKRC 2WC2A 3OWTA 2ZNYA 4GFBA 4RB3C 1TWFJ 1QZYA 3OYFA 3DKXA 3DWLE 1B9NA 2NYXA 5BPIA 4I01A 2QKMB 3I55I 5HLGA 2GIVA 2KT0A 1QVTA 4IHVA 2L9NA 2DFIA 4PJLA 1R22A 2QZ8A 1RZ4A 4ZTFA 3PNVA 4M74A 2EINH 2HQ5A 1A35A 1S8NA 1LDKB 2FNAA 5EGOA 2STWA 1MJBA 1WJFA 2W24A 2E1OA 2BE5F 4LK0F 4BL0B 1TWHJ 4HA8A 2E1CA 3I5UA 4GRIA 1O57A 4B44A 3HHGA 3CF5F 2M4KA 3ML6A 2CH0A 4MO7A 1ON2A 4YG2F 4IQJA 3OS1A 3KZYA 4O6JA 3DP7A 4NB5A 2HQNA 2CJJA 5IYBJ 2O9LA 4XN3A 2ZO4A 2LOOA 4OAYA 4XLCA 2DOAA 3PIPF 2M0MA 1LKXA 2X51A 4C9YA 2ZMEB 1HSJA 3HB9A 3Q3SA 2A05A 5DCFA 2XAUA 2DOEA 4MGRA 3U1DA 3Q9VA 5F0FA 4A3IJ 4RGRA 5EDNA 5AIPA 2DA2A 5B3SH 1CQTA 3J7AY 1FBUA 4QIWN 1TQMA 2JUCA 4G9YA 4IHYA 1ETYA 1OLTA 1A36A 3HOZJ 3BC8A 3E1SA 2CQQA 2BXYA 3QOPA 5IOZA 3S3NA 4CZZA 4L0ZB 2EPFA 5BQTA 1P9QC 4WX9A 2E35A 2OTLI 4E7SA 2CUJA 3QQAA 1TZLA 2LBFA 2BY0A 2WAFA 2K3FA 4G6QA 4BXFA 2GLOA 2OUMA 1IZ1A 2KIQA 2XIGA 3IRQA 3MKYB 1R1UA 3G1MA 4NBQA 3RQIA 1S29A 3GTJJ 2VKVA 3ZOBA 2DOFA 3JRDA 1PP8F 1NH3A 3OYDA 2F5DA 3M1EA 3MVPA 3CCRI 3GUDA 2LRDA 3I64A 1B72B 5J1YA 5JHUA 3TDZC 1DDNA 2QLZA 2X6OA 2DMQA 2R7UA 2QQ9A 3RPUD 2CUEA 1S7OA 2VASA 5E3LA 4KISA 1YI2I 2KQRA 2GAUA 4F55A 4XLHA 2VE8A 2A5WA 2IBDA 4K2EA 1PYVA 4RAYA 2XV4S 2VJIA 1X3WB 2NS7A 2XAGA 3ZN0A 2XAHA 3S17J 1FTZA 1D1CA 3SFZA 4MNUA 2VC0A 2R4GA 1SD7A 3TW7A 4NUBA 1S7EA 3E5QA 3CO7C 2LK2A 4UVBA 3U21A 2WY8Q 4M71A 4EVIA 5ILVA 2JTVA 4CSWA 4ZYAA 1JHFA 1V5FA 3WGGA 3ZQQA 3T0YA 1F4KA 4LIVA 5CVRA 4HF1A 4M6VA 4UV8A 5FKKA 3GZ6A 2L02A 2ZFUA 1JHHA 2ZSIB 2K7LA 4E7JA 1IJWC 1BI1A 3WE2A 2PMHA 1MH3A 4JX5A 3J81K 3JRAA 2W4SA 3ZXSA 1UHSA 3WTTC 2NOJB 2ZCWA 3CJNA 1FP1D 3SFIA 3FXUA 4CO8A 3CDHA 1SEUA 2DPDA 2R7XA 3HYIA 3IH4A 5EZGA 3PFIA 3M8EA 3HZJA 4PJMA 4G7HF 2JA5J 2ZMEA 2VXDA 4ZYGA 5A2QK 2HZTA 1YHQI 1WPKA 5EJCA 2O6GE 4LOCA 4HNTA 1MNDA 3CESA 2P5LC 2FBIA 4BYYA 2EZLA 5H20A 1Z21A 2ADUA 4LITA 1ZRCA 3X2QH 2XVCA 2VQLA 1XGMA 2GBYA 3CDIA 2LREA 4KIFA 3IWZA 3K7AJ 1ZKGA 5GPCA 5ICEA 1XDUA 2IVMA 3KYCB 4RAFA 5E3OA 3W2WA 3DBLB 3PQKA 2AHQA 3OIOA 2B9SA 1HDPA 2KLOA 1TWCJ 2COMA 1VZ0A 3QOEA 4XSXF 4ENNA 4DIQA 4LG0B 3FX3A 2JJ7A 5F0HA 3UKGA 3OYBA 1T8IA 1TNSA 5J47A 4BE0A 2EV5A 2QSFX 3QYBA 1NG6A 3IH3A 2K85A 4XIDA 2AQFA 4L9VA 2ELHA 1Y1WJ 1IN8A 3H36A 1FBQA 2XGCA 4BY1J 5LLQA 1YOVB 5LEKA 4L5EA 5DUIA 1EH6A 2AS5F 5L3EA 1H8AC 1FP2A 1QU3A 1F36A 4I7HA 2E7WA 5TGTA 2YSRA 1B72A 3VOEA 5E17F 2IGNA 5B66C 4BXXJ 5DCMB 2BHZA 1U9OA 3SZPA 2H8WA 2L54A 1BI0A 5D4RA 2JA6J 1Z91A 1UZCA 2GA2A 2EK5A 2M7AA 3N4MA 4U7DA 4HAMA 4XKCA 3OYIA 3LWFA 1UHWA 1YYVA 3RCOA 3QU3A 3QPSA 1IUFA 1GV5A 4ANJA 2HEOA 2G7UA 1R6RA 3PSFA 1LE8B 1WZ2A 3V7CA 3VDXA 3L2QA 2CUZA 1TQPA 4MFDA 5JVTA 1OJLA 1T38A 2JT1A 2X1DA 3KP2A 4RB0A 5EEHA 1LDDA 3UR3C 3QRFF 4G8XA 2R93J 1XC5A 1MJAA 3DTKA 4KFCA 3E6DA 1GUUA 3HC7A 3HL2A 2FUG2 1FTTA 3MEXA 5GAEJ 2R0QC 1WKMA 5C4JJ 4I02A 1T95A 4FASD 1OCPA 3LSPA 2IGKA 3ZQCA 2MFZA 2ZNZA 3KZIC 4E7HA 2NVXJ 2Y0SN 4OINF 1K79A 3S3MA 1I1GA 4ZJZA 3BJAA 4FE4A 2MYSA 1APLC 3S3OA 2LKXA 3BPVA 4R8HA 1U9NA 1FOYA 4NDLA 1I3QJ 5EF6A 4JBAA 4M6XA 4BQOA 1K4SA 1WI9A 1ZGJA 4A5NA 1N77A 4ZH4F 1WWXA 4XICA 1J09A 1PP7U 3GTLJ 4XK4A 5HS8A 4Q4ZF 4LG3A 1JGGA 4FISA 3K4LA 3B6AA 2KPMA 4KIGA 1I1SA 3HUGB 3RIRA 1JUMA 4EJOA 1QA6A 5J8CA 4W1UA 1JJ8C 2DYSH 2MSYA 1T56A 3LSGA 1HA8A 1QO0D 1MNEA 1OCCH 3MZ8A 2KHMA 3TO9A 4PGHA 3GTMJ 3DKWA 2DMNA 1TL8A 3JTHA 4KITB 5LRRA 1FYKA 1R36A 3COAC 1TTYA 3ASOH 1FEXA 2JRMA 5L3BA 2IPQX 2BXZA 3DCFA 3MKZA 1W7PD 1IDYA 2HS5A 3R0JA 3VPRA 2CUFA 4DYQA 3ZN1A 2MABA 3HTSB 4MQVA 1YTYA 3FHNA 2VT3A 1UG2A 5C44J 2DDBA 1KU7A 1XGSA 1VQKI 5J1UA 1ITYA 2VB6A 3L2CA 2ZJQF 3WTSC 5JHFA 3FKIJ 4OIRF 2ZKZA 2QEXI 1D0YA 3H1CA 2K02A 4L9NA 1TBXA 1A04A 5DCMA 3F8NA 2Y0SA 1DPRA 1U5TB 2LC2A 4WXDA 3PUBA 3ECHA 1ZR4A 3E5UA 3BR5A 3DBHB 4EJWA 2BGCA 3M8FA 5M5XJ 4ON0A 1MMGA 3I53A 3WG7H 4OIOF 1LE8A 2AXTC 2MW8A 2B63J 1ETKA 3REOA 1WJEA 1GT0C 2EB7A 2STTA 5K7HA 3CP2A 5FD6A 1QNTA 2ISYA 3IRRA 3SDGA 2KRHA 2P7VB 2O8XA 2VIXA 1HKQA 3JW4A 4AUXA 2JK3A 2R7QA 3FHZA 2CYYA 4ESJA 1HOMA 1P7JA 4HRIA 1IRFA 4IQ4A 1BC8C 4ZTJA 2G0EA 4PUSA 1D0ZA 5CVJA 1OYYA 2PLYA 3EYYA 2H6CA 3LFKA 1Z3YA 4HLXA 3JAMZ 1LUJB 3CMYA 1BJAA 3K70D 4GO1A 2VXZA 2EIMH 5FLMJ 1OKRA 1Q1HA 2P6TA 3FXKA 3HUGA 2EIKH 2LKPA 1IV6A 4RA2A 2CGPA 1FSHA 3ZQIA 3GZNB 3JREA 1SMTA 3KP7A 2BVMA 3WTXC 2M8EA 2VLAA 4A3KJ 1SFEA 3S2DJ 1WCMJ 2CFOA 2JRTA 1OISA 2NS0A 4G6DA 3CCQI 1U8RA 2ICWG 1BL0A 1YW9A 4BXUA 4XLFA 4A3LJ 2VPLA 4OMZA 2QSHX 5K7ZA 1YIJI 1DUXC 1S6LA 2LG4A 2RNJA 4HV5A 2J5OA 3IP4B 2QQAA 2JPCA 3LSRA 3FM5A 4D5FA 1SFUA 4IKFA 1O7LA 3C7JA 4D5CA 2BOLA 1I6XA 2E1MB 1JJ6C 1R5HA 4LJZF 1MGTA 2XF5A 1SAXA 3K4MA 3C2GA 1JKPC 3T8TA 4AIKA 3BTCA 5FFZA 4EQQA 1H9TA 2FXAA 3E6BA 3KLOA 5J3LA 4KMFA 4RGUA 3FIWA 3T8RA 3SHFA 5HLHA 3LMMA 4G7ZF 3MAJA 2LF8A 2ESNA 4CCKA 5H6QA 3TOBA 4A3JJ 1U5TA 2DA4A 1QPMA 3U1KA 4CUGA 1X1PA 1X3UA 1DGWY 2I5UA 3FXJA 2WTEA 5IT9Z 4R79A 4IEJA 4CYDA 3K1PA 1IN7A 2M0CA 1U78A 3ZMZA 2FRHA 1WJCA 3GTOJ 2FNPA 2XSJC 1IF1A 3OV8A 2XB5A 4QSHA 1RR8C 4LGWA 4DQ2A 3ROUA 3OYNA 1IGNA 2DA7A 4HF0A 4I0BA 3KP5A 2DA5A 3E6CC 2MC4A 1MMDA 4HX8A 1D8KA 1GVJA 1K83J 3S2HJ 4HBLA 5CVVA 1S72I 1P4WA 4CCOA 5DDGA 1RR7A 3DU6A 3BQYA 1VQ4I 2HYFA 2HOTA 1LJ9A 2CU7A 2HKXA 1V5EA 4KN7X 3TO7A 4JX4A 3PIOF 3LOCA 3M9AA 4I2OA 1R1VA 3HSFA 2XAFA 3FM3A 4HEA2 2XGXA 4KT5C 4B43A 3H3UA 2JZYA 3O8HA 2ESHA 1TT5B 4YFNF 3GBGA 2VQGA 3LSTA 1LDJA 9ANTA 3UNGC 5BMZA 4A3GJ 2IGOA 1SANA 1W0UA 3I59B 2PJPA 3WG9A 2M9HA 1KU9A 1WJBA 2HWVA 4HZFA 5E1XA 1D8JA 1BC7C 1A6IA 4F52A 2EFWA 4D0PA 2CRGA 4XLAA 3DU5A 4NQWB 4KNYA 5F27A 1BI2A 1AHDP 3AAFA 2K9SA 2N8GA 3DTIA 4S0HB 1LFUP 1X1DA 3DPTA 2UV1A 2X9DA 5BS6A 2KKOA 3HRTA 3E7LA 1RPWA 1V4RA 4FETA 4BDZA 1JKOC 1FZPB 1IN4A 2GWRA 1R58A 2G7HA 3C1DA 1T98A 3W6KB 4U0VA 2ID3A 3SEZA 4ABZA 2DFEA 3I56I 5LGNA 2X0LA 1ZLKA 3I9V2 2K27A 1S7AA 1B9MA 2GOXB 3JSPA 1I3AA 1LPQA 3PJRA 4WWCA 4O3MA 1ETOA 5KAIC 1HDDC 4Y33A 1YFHA 3NAUA 5JFRA 3GFIA 1XGOA 3EPZA 3SXYA 5GPAA 3OOUA 1E3OC 4BACA 1VQPI 1QZZA 1MKMA 1PDNC 3IKTA 1KU2A 2DA6A 1FIPA 2X48A 3ZQHA 2DDAA 4GGGA 4C3HJ 2DT6A 3CCSI 3HDDA 4QPQA 2HDDA 2A68F 3I4MJ 2AO9A 2VOPA 5LHGA 2NXNB 4M3BA 1HW5A 3FXQA 4BEHB 4BBSJ 2IS4A 2D1VA 1FMWA 4P1WA 1OMIA 1LQ1A 1IUYA 1H0MA 1VQNI 1T6SA 3GCMA 1X58A 4J01A 4HYEA 1X19A 2FBHA 2DODA 5HODA 1JTYA 2FBKA 3ZQFA 3KYLA 2IGMA 4BBRJ 4CA0A 2ECBA 1IXRC 3RQ4A 3N97A 2EILH 2KISA 4DYRA 3BG7A 5CVUA 2XPUA 1ETQA 2OC6A 3DF8A 5M3FJ 2EFOA 2R7DA 3C2BA 2ACJA 1POGA 4UB8C 1VTNC 1SC7A 4PSXA 2ME6A 1XDSA 3I59A 1F5TA 5L3GA 2M30A 3KEYA 4F3QA 2L5QA 4AM3A 1ON1A 3IWFA 5D5WB 3O6BB 2I8DA 2Z5UA 2LF7A 3HM5A 3ZMUA 5FO5A 1C0WA 1QBJA 3RKQA 3Q0VA 3RKYA 2NVQJ 1ZELA 1Y8QB 3DEEA 3BT9A 5E3NA 2DI3A 1YX3A 4NQWA 2P6SA 4Y7NJ 4Z2YA 4B8XA 1R9TJ 1PVEA 4A3BJ 1OR7C 1QGPA 1VQLI 2XF6A 4M3GA 2CW0F 2FQ3A 3KCCA 4XKVA 3DFGA 2X85A 3CJQB 3BR0A 4FX0A 3R60A 5DD8A 4B47A 4Z6YA 1QHHD 5K7FA 1XB4A 3WTYC 1E3PA 1MW7A 2PBIA 2VL8A 3PNTA 3M8JA 4NC7A 2F4OB 5IY5H 1U2WA 1VI0A 3KEQA 3J7YJ 3Q9SA 3OYCA 2KFDA 2FU4A 1L0OC 2LLKA 4U88A 4HSRA 2CV2A 2PN6A 2RGVA 1WH7A 2A69F 2TRTA 5HOOA 3L2RA 2P7CB 4HF2A 5C4XJ 2HVSA 1JXSA 3LAJA 2NNYA 3DEWA 5FGMA 1ZARA 1O3QA 2L7KA 3JAMK 4UUSB 4EM0B 3MFKA 1ERDA 4MLOA 2E1MC 2P81A 2XKOA 1WI3A 4IHSA 1OYIA 1UHMA 3KP6A 1K7AA 3FKJA 3R61A 1B59A 3VODA 2JUGA 3JR9A 3OS0A 1H88C 2QGUA 3EUHA 5H6RA 4A6DA 4BEHA 1FLIA 3D5LA 5DV5A 2CW7A 4DBRA 2ZJ2A 2V79A 3MQ0A 5FD5A 4IOAF 4EM1A 1YS7A 3VYSB 3PSIA 4FX4A 2O3FA 3H35A 4TV7A 1FX7A 1T33A 3TKYA 4CDGA 3HOYJ 3HRUA 5JLXA 3BDDA 3D5RC 3H0DA 2FEZA 3LSHA 3V8KA 2JQ7A 2JVHA 2XGDA 1MBEA 4YIRX 3GTGJ 4M3EA 1K6OA 3BR2A 3BR3A 4FCYA 2XGEA 3FMSA 4I0AA 3RPQA 2X6YA 1STZA 1S3JA 3QU6A 5GADJ 4QLCU 4U0WA 3IAS2 3J80K 1R7JA 2LVSA 3OYAA 3W6VA 4IRHA 2OA4A 2RC4A 3G1OA 1G8XA 1FT9A 2V9VA 3WE3A 2RN7A 1TWGJ 2VONA 2GIZA 5IT9K 4U87A 5C3EJ 3F0CA 2KDOA 2L7ZA 3B6CA 2ZJPF 1FWZA 5KCMA 3C3WA 5J4YA 1NG7A 1MD0A 1MMNA 1Y1VJ 3CF2A 5K5RA 3RI4A 1P6RA 5EEGA 3F8MA 1R4NB 3V8JA 5BPDA 3CLQA 5J6XA 1ZYRF 1V54H 4GYIA 1HKSA 4RLFA 2HYJA 3G71I 2MLKA 2OZ6A 3A1YA 2F5FA 3EDPA 4HNUA 2ECCA 2RKHA 4BHBA 1NHAA 1G3SA 3NARA 3BTLA 4A6EA 1YRNB 3CC2I 1A31A 2NNNA 1HF0A 5CLSA 3FZVA 2UWMA 1XN7A 4RGXA 4AIJA 1IV8A 1UB9A 3E5XA 3W3CA 4CYCB 1N78A 2M3AA 3S14J 4OIQF 2DA1A 4L9JA 4I98B 1X3ZB 2UXXA 3L2WA 2R7ZJ 1FYLA 4BUPA 1R1TA 4UUSA 1MBKA 3DPLC 4C3JJ 1WGXA 1WFXA 4FE7A 1KZHA 4DYCA 3LAPA 4IXAA 3HEFA 1PUEE 1JUSA 5KK1A 4E6KG 2HOAA 3U9GA 2YU3A 2HPIA 5E3MA 3K70C 1FPQA 3H5AA 5CVIA 4BU2A 2HR3A 4CH7A 2BVLA 4FTHA 3S32A 4EGZA 3Q0UA 2E5ZA 3ZR8X 4P55A 5DM6F 5FKNA 1JKQC 1HCRA 1R23A 4A3MJ 2OV7A 2Q2EB 2E19A 1KA8A 4RM2A 2K9QA 5FLXZ 3L2VA 1G3YA 4HNVA 2OQGA 5D8LB 3ZMDA 5K5QA 4HOBA 3WGHA 1EA3A 2W84A 3FF5A 4C3IJ 4U7BA 4N9IA 2V9PA 1MJ9A 2L7MP 1KGSA 1K78B 1Z77A 2GXGA 3O3KA 2QUFA 4Q5SF 2CSOA 1SFKA 4IVNA 1GV2A 3AG4H 3NEUA 1EH8A 2E7XA 3E0JB 2HQAA 2KJCA 2Q0OA 2BY1A 3EUHC 3E97A 4ZC3A 2XROA 3KZZA 4YFKF 5CQGA 1MIJA 1ZH5A 2DAOA 1HKTA 3HJEA 1R4MB 1SD6A 1XCVA 4LMYA 4LLLA 1YIOA 2E2IJ 1RKWA 1AU7A 1D5YA 1KYZA 1VQMI 2LTPA 5EG0B 1GLNA 4BNCA 1SFOJ 2R7RA 3P9CA 3F23A 2MD0A 4X1EA 4XRFA 4NHJA 3SDBA 1L3LA 2KMUA 1W5SA 1Z6RA 3V8LA 1REPC 3BWGA 4V2FA 3RJPA 2OU2A 5IYDJ 1YS6A 1MZBA 3M1CA 1KYWA 1FYMA 2L2OA 2WAEA 2XUBA 2XDVA 2QVOA 1YE9A 1YRNA 1OCRH 1Z0XA 1BJZA 2PQ8A 1MMSA 3IAM2 2KZVA 2EZKA 2V7FA 1ENHA 5BNGA 4CYCA 4LLNA 4LG0A 4KA4A 2DTRA 1TP4A 3SJMA 5HVQC 3KETA 3OR2C 1K61A 3F21A 2EFNA 4MIMA 3S1QJ 4ZZDA 4F92B 2PI0A 1GXQA 3M4OJ 3LL7A 4ENJA 1RUOA 2GA1A 2IA1A 2HYGD 3JCUC 4M3FA 4RDUA 2WY7Q 3QODA 5ERIA 3ASNH 3ZCOA 3KEOA 1X4OA 1U8BA 2H27A 1Z05A 2ME0A 2WAQN 4MEXF 1J7KA 2EBIA 1V5GA 1G2HA 1ZLJA 4M72A 3JTGA 4YEJA 2A5YB 2NS8A 4GCVA 2MA3A 4M73A 4BAYA 4A12A 4IL6C 3FMQA 2X6XA 3WTWC 2QA4I 3IH2A 1BR4A 2OPTA 4W97A 2Q2EA 5IP7J 3LQQA 4PZJA 4P96A 3LA7A 4ETSA 1X2MA 2GZWA 1ZRDA 2HOSA 2YR2A 3DEUA 3B02A 3GZ5A 2H8RA 4NNJA 1P4AA 2H94A 2KJBA 4CCLA 1YJ9I 3PQJA 1JT0A 5EYRA 3WHBA 1K78A 4ZDOA 5ICCA 4LB5A 1JI8A 2NAZA 2RREA 2HVRA 2E36A 3GTPJ 2O61A 3QP6A 2WADA 1JGSA 2R5YB 3ABUA 4AU7A 2HQRA 3BY6A 3PM1A 3FXRA 3H92A 1YJNI 3GMEA 4L5JA 3WU2C 4CICA 5LHIA 2CV0A 2QKLB 3BJ6A 2M5WA 1RNLA 5LRSA 3RZOJ 1G3WA 4FQGA 5EG0A 2HFHA 3TOAA 3CUOA 1ZN2A 3CMEI 3G1LA 3L7WA 5FRMA 1ONVA 2MLGA 2ETHA 5GTIC 3ESWB 3RPUA 3HIFA 5EEAA 3H5RA 3LA3A 3HGGA 4WF2A 2A07F 2UXNA 3MN2A 2WAQA 1OFCX 2JSPA 4NC8A 3K4BA 2DMPA 5B1AH 1ZR2A 3DLAA 1UFMA 4B09A 2PFBA 3KX2A 3WU1B 2DTZA 2LMDA 4E7ZA 5E8IA 1IN6A 1HW1A 1UJ8A 4G94A 3KLNA 4J19A 1EJ9A 2LDUA 3GW2A 1F9NA 2YX4A 4A2UA 4DNCA 3BG6A 1K4TA 3I4NJ 3K2AA 4OIPF 2Y30A 2DJNA 4M3DA 4RGSA 3HOVJ 3D1NI 1I50J 5IPAA 2DCEA 3VYTB 5JLWA 3MD2A 2HTJA 1U3EM 3CC4I 1FNNA 3V42A 5HS7A 2HGCA 4BQQA 1MDMB 2Z33A 2V1XA 4MTEA 4H4KC 1ULYA 4HDUA 1RKTA 2FX0A 3HBLA 2BZTA 1MSEC 1EH7A 1E2XA 3VYUB 2A3SA 4XOTA 2GOMA 3RYPA 1ACIA 2FA5A 3OL3A 4B3AA 2JMWA 2KZGA 3H9QA 1EKEA 1FBSA 4HW0A 2VT2A 4AVZA 2K86A 1DQUA 1T08B 1RIOH 4AD9A 2A6HF 2OTJI 1KQ9A 5IOYA 1HLVA 1B1BA 1TC3C 1JT6A 2P5VA 3CZ6A 2QWWA 1BN5A 3BTJA 4BHCA 4PFPA 3ZQGA 1Q1VA 2ID6A 4KJZA 2Y48A 1IXCA 1LEAA 2BEOA 1W7PB 2KIMA 2VJ4A 1SFXA 5F1JA 3J81Z 1J75A 3SZGA 4A0ZA 5LFAA 1J2XA 1SD4A 4WCGA 5M5YJ 2R5YA 4CGZA 2H1LA 3O2PE 3J7AO 2FMYA 3I0TA 2V1UA 2IA0A 2HNHA 4PSWA 2WV0A 1FJLA 1FMVA 5A2QZ 5DM7F 2MGQA 1KQ0A 1ODDA 4Q47A 3HGYA 1XTAA 4EJTA 1GXPA 2QBYB 2P0WA 3MZHA 2Y75A 4A0YA 5ED4A 1Z3XA 3CDLA 2XHKA 1OR7A 4BDYA 3EUKL 4A3FJ 2DO7A 3ERED 4HLYA 4I09A 3L2UA 2H1KA 3OYGA 2M8GX 4MQ9F 2M34A 2Z9OA 1B6AA 5FKOA 3PFYA 5K1YA 2YX7A 4XORA 3F3XA 3ZGKA 3CO6C 4EATA 2R7VA 5KHDA 1USTA 3BG9A 1HXDA 2F4IA 1TQIA 3Q5FA 4Y3OA 3VFZA 1O7FA 1ETXA 1WH5A 1K6YA 4LLGF 2OF7A 2V6EA 1BOAA 2OJED 3KYDB 1DP7P 4HQEA 3DPUA 4DW6A 4P5OA 2B7EA 1KONA 4DOZA 4BY7J 2DLLA 3F6OA 3QPLA 2LY2A 1YG2A 2HZDA 1DP3A 1FOXA 1IN5A 4N9HA 2F6CA 2M2EA 2YUSA 3LSJA 2A61A 2FMLA 3L9FA 5GTHC 1S9HA 2DJIA 2HXOA 1Y6IA 5HDGA 3ZMTA 4H0EA 1ZG5A 3OYLA 2H09A 1MDMA 3KFWX 1YLFA 3K4KA 4AVPA 4S05A 1MSFC 4UVAA 1IW7F 3ECOA 5KNLA 2CW8A 2P4WA 1QZEA 5LGUA 2Y9ZA 2X1EA 3GFMA 3MZYA 1VF9A 4RLQA 3GFLA 3QAHA 2K9MA 4IPAA 2BW3B 5IYCJ 2OAZA 3H9JA 1GDTA 1LFPA 5M5WJ 2W57A 1XD7A 1RETA 2W1OA 3TGNA 5KAFC 2D45A 3BQZA 5FB2A 4XL9A 2RNGA 1LB2A 4DBQA 5D6EA 1W36D 3HXLA 2A6TA 1R00A 1BW5A 3JRHA 3WU0A 1OCOH 3GLLA 1Y0NA 1BR1A 2W00A 1I27A 5J1RA 1MMAA 1W7PA 4PJNA 4RMNA 4XOPA 5F6FA 3OYMA 4Y52J 4DZPA 2JA2A 3V7RA 3BR6A 2OBPA 2CG4A 3VSLA 4UXNA 3H0GJ 2VBXA 3S8PA 4EJVA 4XLEA 1DU0A 2XF7A 4IHXA 2KIUA 4BE2A 1P4XA 2VKHA 3T5XA 1TNTA 3A4CA 2W25A 3OL4A 5F08A 5L3FA 1ZRFA 2CWEA 1DU6A 4G6TB 1RC9A 5EZHA 1X1BA 2BBYA 3BG3A 4BQAA 1W5CC 5GAGJ 2LKSA 4R1HA 2QBYA 3F72A 5D5XB 3F22A 3ABTA 4A69C 2FQ4A 1WJAA 5J40A 1QVUA 2RQQA 1SD5A 1CGPA 3MCZA 3V4GA 2FD5A 3EUAA 1J59A 3W2VA 1TWAJ 3K4CA 4IJAA 4C2MJ 2XAJA 4D1QA 1FC3A 2F4MB 1KU3A 3CLOA 3FISA 5HNHA 5LHHA 1W1WE 1B4AA 4KN4X 2ISZA 2L01A 3AG1H 3ZRGA 3G6EI 4BH9A 4NC6A 3E6MA 3S1RJ 5LD2C 2ZC2A 3S2WA 2NVTJ 1R71A 3BTIA 2VC1A 3I54A 2DT5A 1ZHFA 4PDKA 3RYRA 1IAWA 4CHUA 5LEJA 2BY2A 3CCEI 1DPUA 2VPRA 2RDPA 4FHTA 1VQ5I 1QRYA 4IRIA 4BJTA 4JQFA 1FOWA 2BYVE 3ABLH 2ZBKA 4KICA 1VFCA 1AWCA 2IAIA 4HG2A 3R4KA 4IZZA 1G59A 1MBGA 1WRJA 2JN6A 2DYRH 2EIJH 3IKVA 4ITVA 4YELA 1YJWI 3VWBA 2QYOA 3VB2A 4UNOA 3PO3J 4I76A 3DLLF 2VQHA 3H3ZA 5D4SA 3ZQ7A 2BHYA 1IO2A 1BOBA 1ORKA 2L4MA 3ELKA 2VE9A 3FWEA 5CPRB 5HNFA 3CJRB 3CCUI 5E1ZB 3HHHA 2L7FP 2PJRB 1E0EA 1UMQA 5ICFA 3QPHA 1B8IB 2BW3A 1X1CA 1V55H 2VKEA 1FY7A 1O3TA 5FKLA 4ENMA 1JE8A 2FSWA 4WXHA 2X4HA 4E7LA 2LR8A 4G12A 1I5ZA 2BV6A 2IS1A 4RBOA 5DTDA 3HKZN 3PUFA 2K3PA 2IA2A 3TL4X 2IS2A 2R92J 4Q48A 2EFQA 5HDKA 4BGDA 3S1MJ 2COBA 2HKOA 4DGWB 3FXOA 4PGGA 2XB0X 1WSUA 3GTKJ 4L0YB 2CS3A 1U6GA 2JA7J 2HDWA 1X4PA 1RESA 2L9VA 2WWYA 5LGTA 1OYWA 3IL2A 4ZDPA 1GHCA 5H2FC 4CCMA 3QPTA 1MBJA 3BJOA 1VQOI 1O4XA 1O3RA 5JR3A 1VQ8I 2L3DA 3DXJF 3WODF 4HV6A 2DW4A 2XC7A 2ZJRF 4JYKA 4P9UA 4FT8A 2Z1DA 4XONA 2QQ8A 1KQ8A 2O03A 2V1DA 1G4DA 2EV0A 2K4JA 4ASNA 1IRZA 5CYVA 4IHWA 4UHTA 1G6NA 2KL4A 5IP6A 3A03A 1BI3A 4XR6A 3HRSA 2PMZN 5JVGF 1Y39A 5FLVA 1F1ZA 3HPGA 3NQOA 2O8KA 2F2EA 3S16J 3TBIA 5IP9J 4A3CJ 4GXOA 5FRNA 3TQNA 4HX4A 3BCAA 2V9KA 1LFBA 2FJ1A 4XRMA 4P9FA 3PO2J 1YO5C 4C2UA 2DN0A 3CJTB 4BHPA 1DGRM 3BP8A 2CO5A 3OYJA 2YPRA 1J0RA 3HKZA 2LH9A 3JRIA 1N75A 1Y0UA 4ENKA 4AC0A 2IRFG 4J00A 2JPBA 2MH9A 1D0XA 5GAHJ 4JP0A 3EYIA 1NTCA 1XX5A 2DQLA 2R7WA 3M3YJ 4BJ6C 1E17A 4JOMA 2QENA 1R49A 2LFBA 4IRGA 4M6YA 4B4CA 5M3MJ 2R3SA 1SAUA 2Z99A 1HW2A 2AXLA 2EZHA 3DTEA 4E7KA 1VQ7I 2W85A 4RS8A 2L4AA 2PJRA 4N4NB 4YIFA 1IC8A 2F5CA 3C18A 4OMYA 3CC7I 5CKTA 1SVOA 4HDVA 4LFUA 1B8IA 1IDZA 2JVGA 3H3VK 1F43A 3OR1C 1FSEA 2QF7A 1UCRA 3QYFA 4L5IA 3K0LA 5D5VB 3A01B 4L18B 3ERMA 3FDYA 2XRNA 4LIUA 1T0FA 4C30A 2KDZA 5D5UB 3K69A 1M1EB 4Y17A 1BIBA 3BCBA 3RSNA 2DBBA 3AL0B 2R7FA 3F8FA 3CUQB 2VOOA 2PMZA 1V3FA 4HX7A 4OOIA 3L00A 2VBZA 2MH2A 2ELKA 5D8KB 1T39A 3L1PA 1WJ5A 4MTDA 2MD5A 2XKPA 5HDNA 1RUNA 1OQYA 5GP9A 2GQQA 4UB6C 3BROA 2DMUA 3ABMH 3CCLI 5IT3A 4M9ZA 4ZYHA 3G2BA 3MKWB 3NRVA 3WTUC 3BZ6A 5AIQA 3HG9A 2M45A 4O5VA 2NVUB 3LA2A 3RKXA 1D1BA 3SYTA 4M9SA 2F48A 2DQRA 3Q0WA 3OIQA 2F5VA 2DK8A 1XSXA 4BE1A 4UVCA 4B1RA 1BR2A 1LVAA 2IEKA 4BS9A 3HSEA 3VEPA 3FK7A 3RZDJ 3DKYA 2O0YA 4KIBA 4HSTA 4IO9F 3AG3H 3HPHA 2HXIA 3F6VA 4ZYEA 1H89C 2ZFWA 1ZREA 1SMYF 4QWQA 2DU9A 4A3EJ 4XKBA 1BIAA 2TDXA 1XG1A 2WBMA 1RI7A 2NOGA 2Q1ZB 4DJAA 2LD5A 2V6CA 3RKWA 5ILSA 2W7NA 4I6ZA 2VKDA 3HOTA 1QPIA 3K1MA 3D5SC 3K4NA 4RAGA 1G3TA 4B48A 1IXSB 2KP6A 2IJLA 5FJ8J 1ZK8A 3C2HA 1XMXA 4ZDLA 1HSTA 2HTSA 3TDUC 3OYKA 1LEBA 3OIPA 4S04A 5AONA 1W5TA 4X6AJ 4PK4A 4LB6B 4EJUA 1ZAOA 2PG4A 2HPMA 4CZCA 3IV5A 1YW8A 3TP0A 5F0CA 2M87A 4Y15A 1W0TA 1S5LC 4XNFA 2YU9J 4EMSA 4G7OF 4YFXF 1X2NA 4XLPF 2V1NA 2VBYA 2XPVA 3AFHA 4Y13A 2JWTA 1E3HA 5FROA 1YQAA 1YW7A 2Z2SB 2ZXIA 4EV0A 2JSCA 3LQRA 1LNWA 3FK6A 3I4PA 3A01A 2LNBA 3BPXA 4IOCF 1ZGWA 1VQ6I 3B73A 2EZIA 5D6FA 1XCBA 2X6WA 2W82A 1D3YA 1NK3P 2VJ5A 3K10A 4PJJA 3MMYB 2HI3A 4HQMA 4F93B 3CUQA 3MWMA 2ZB9A 1SVLA 3K6GA 3GYHX 2L0KA 5DEQA 2HOEA 2HU9A 3HSRA 3M7GA 4OWRB 5E1WA 1Z7UA 3BOQA 4E4HA 1EV7A 2EA4A 2RVCA 4M9XA 3P9KA 3ABKH 3WTVC 1WJDA 1Z7LA 2DPUA 1XGNA 2EJRA 3P5JA 3AKZA 2DK5A 2MG4A 1CF7B 1PJRA 2GM4A 3K4JA 4L9TA 2MC3A 1HQCA 2UUZA 3U2RA 1NK2P 4MHGA 4Y4RA 2ZMEC 1XS9A 3JSOA 1T0FC 4N0BA 2UZKA 1Y8RB 2DXIA 2K4BA 2XAQA 3T1BA 2KIFA 2L9SA 1Z1DA 3IHUA 3VSKA 3KP3A 2I10A 3KP4A 2ZSHB 2VI6A 1R5ID 3IC7A 3WHCA 3FBIB 3W6JB 3A2KA 3GVAA 2TCTA 2VUMJ 3QWLA 2R5ZB 4I99C 4C2TA 1A5JA 5F64A 3W2AA 3BLYA 3BG5A 3LSKA 5L3DA 1IRXA 5TJJA 2BY3A 3H5NA 3FMRA 2DT7B 2QQBA 2QCOA 1I6HJ 3J7ZI 2J5PA 2K40A 3TP3A 1N25A 4E7IA 1X1AA 2LYCA 3CD6I 4YRVA 3JRFA 4CXFA 2XASA 3EQLF 5E79C 3MKLA 3S1NJ 3IUOA 1Y56A 1BBYA 3RTRA 3TO6A 3DBRB 5CQEA 1VNDA 2Y0MA 2E5NA 4XKWA 2FE3A 3GWZA 2EV6A 3CMAI 1ZGAA 2ELJA 3ULQB 1LVKA 3PL8A 3HOUJ 1XMKA 2E34A 4ESFA 2Z3YA 2RV8A 1AKHB 1ETWA 2K5CA 3CQZJ 3BZKA 2V4JC 4EEFG 5LBQA 2EH3A 2OCCH 5ILUA 4AYBN 4RB1A 1W36C 1D1AA 5DUKA 4XSZF 1JTXA 4UV9A 2Q8KA 5K5OA 4QTRA 2HVQA 2IT0A 1XSVA 4GDFA 4EM2A 2Y9YA 5DYMA 3OYEA 1P7IA 3VYRB 2WB1N 4UUVA
chains in the Genus database with same CATH topology
2NXNB 4IOCF 1VQ6I 5GAEJ 1ACIA 2QA4I 4IOAF 5DM6F 1VQNI 2OTJI 1S72I 3CF5F 2JQ7A 1YJ9I 1FOYA 1VQ4I 3PIOF 3G4SI 2E36A 3CCLI 1VQOI 1VQ8I 3PIPF 1YHQI 5GADJ 2ZJRF 1QA6A 5DM7F 5GAGJ 3CCQI 1YJNI 1YIJI 1VQMI 3CMEI 3CCVI 2ZJPF 4IO9F 1VQLI 3CCJI 2E35A 2OTLI 5JVGF 1Y39A 1HC8A 2K3FA 3J7ZI 3G6EI 3G71I 3CD6I 1VQKI 4UY8I 1VQ9I 3CJTB 2ZJQF 3I56I 3CCEI 2FOWA 2QEXI 1VQ5I 3CC2I 1MMSA 3CCRI 3J7YJ 1FOWA 3CCMI 3CMAI 4V19K 2H8WA 5GAHJ 1YITI 2E34A 1YJWI 1FOXA 1VQPI 3DLLF 1YI2I 3CC4I 1VQ7I 3I55I 3CCUI 3CC7I 3CCSI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NXN B;  4IOC F;  1VQ6 I;  5GAE J;  1ACI A;  2QA4 I;  4IOA F;  5DM6 F;  1VQN I;  2OTJ I;  1S72 I;  3CF5 F;  2JQ7 A;  1YJ9 I;  1FOY A;  1VQ4 I;  3PIO F;  3G4S I;  2E36 A;  3CCL I;  1VQO I;  1VQ8 I;  3PIP F;  1YHQ I;  5GAD J;  2ZJR F;  1QA6 A;  5DM7 F;  5GAG J;  3CCQ I;  1YJN I;  1YIJ I;  1VQM I;  3CME I;  3CCV I;  2ZJP F;  4IO9 F;  1VQL I;  3CCJ I;  2E35 A;  2OTL I;  5JVG F;  1Y39 A;  1HC8 A;  2K3F A;  3J7Z I;  3G6E I;  3G71 I;  3CD6 I;  1VQK I;  4UY8 I;  1VQ9 I;  3CJT B;  2ZJQ F;  3I56 I;  3CCE I;  2FOW A;  2QEX I;  1VQ5 I;  3CC2 I;  1MMS A;  3CCR I;  3J7Y J;  1FOW A;  3CCM I;  3CMA I;  4V19 K;  2H8W A;  5GAH J;  1YIT I;  2E34 A;  1YJW I;  1FOX A;  1VQP I;  3DLL F;  1YI2 I;  3CC4 I;  1VQ7 I;  3I55 I;  3CCU I;  3CC7 I;  3CCS I; 
#chains in the Genus database with same CATH topology
 1P2F A;  4JK1 X;  4IF4 A;  4AWX B;  2ZXJ A;  1OPC A;  1BM9 A;  2CQN A;  3GF2 A;  2HDC A;  4II2 A;  3SZT A;  4BQN A;  5L3C A;  2EWN A;  2KRC A;  2V26 A;  6PAX A;  3O8G A;  1OCT C;  4PFO A;  4AIH A;  3WGI A;  1XMA A;  3G73 A;  3CMM A;  1XSD A;  3GFJ A;  1BW6 A;  2EFP A;  3GXO A;  2LY9 A;  2Y2Z A;  3LFU A;  4II3 A;  2B0L A;  4RB2 C;  2OCE A;  2VBW A;  3OOP A;  5DD4 A;  2XSD C;  1USS A;  3NWT A;  4F7Z A;  3A0B C;  3F9K A;  4UUT A;  2G9W A;  2VQC A;  3ISP A;  2OQR A;  1UAA A;  2RAE A;  3RDI A;  3OYH A;  4B3X A;  2YS9 A;  3E3V A;  1CF7 A;  3JRC A;  2GXA A;  2CMP A;  2CQ7 A;  4XMY A;  4KYW A;  2CV1 A;  4KT6 A;  3SEQ A;  5TIS C;  3ZMS A;  2P5K A;  2DFF A;  3HOW J;  1J5Y A;  2KRF A;  4HPQ A;  3KIO A;  1UEL B;  5B1B H;  4WK8 F;  3J80 Z;  5ICG A;  2O5R A;  1SVM A;  4OU0 A;  5F04 A;  2ZXW H;  1XPX A;  1PUF B;  1P92 A;  3AL0 C;  4EGY A;  3CUQ C;  1TW2 A;  5FFX A;  1Z9C A;  5JI6 A;  4AYB A;  2IP2 A;  1H9G A;  2WV1 A;  3SQN A;  3GX4 X;  3LSI A;  3KE2 A;  4XLN F;  3ZPL A;  1Z67 A;  3DV8 A;  3CCV I;  2R5Z A;  2L9R A;  3ZQL A;  2WA0 A;  5TRD A;  4BKX A;  3OS2 A;  2D2W A;  3H9G A;  2WB1 A;  1MNM C;  1HC8 A;  4PJ0 C;  4A0X A;  1UG0 A;  4KUM A;  2PMU A;  2E1N A;  3K9T A;  4QPO A;  1QQI A;  3S93 A;  4UY8 I;  2FF4 A;  5J4V A;  3GO5 A;  1BA5 A;  2E60 A;  5BOX A;  1ZTR A;  2H6B A;  4CCN A;  2RQP A;  3AG2 H;  2R7T A;  2R7S A;  3L09 A;  4D7N A;  2E2H J;  2D5V A;  2DA3 A;  4XBF A;  3ZMV A;  4V19 K;  1MBF A;  3K2Z A;  1TW3 A;  4XM3 A;  5CJ9 A;  1AKH A;  3FXL A;  1AA7 A;  4A5M A;  3HTU A;  4CCJ A;  3S15 J;  2LSO A;  2JA8 J;  2LP0 A;  4N4O B;  2CFX A;  4YII A;  2PX9 A;  2IS6 A;  4RAZ A;  1Z6T A;  3TW6 A;  2M1B A;  3NWS A;  1W4M A;  1YX5 A;  3I71 A;  3QP5 A;  1RRJ A;  2IW5 A;  4IHT A;  3N05 A;  2C6Y A;  2P8T A;  4AID A;  4DZJ A;  4U0Y A;  1QHG A;  2LY1 A;  4MEY F;  5E8G A;  2Z16 A;  2M4G A;  3CTA A;  1ZQ3 P;  4IX7 A;  3TMO A;  1IRG A;  1J9I A;  2K9L A;  1U0J A;  2M7B A;  1IG7 A;  5EGO B;  4JX6 A;  4BJ5 C;  2Y31 A;  3HRM A;  5FLX K;  5DS9 A;  1A6Q A;  1TT0 A;  2EQR A;  4D9J A;  2NRA C;  3I58 A;  2E2J J;  2VOD A;  3GTQ J;  2CQX A;  3DQV C;  3KPH A;  3A0H C;  4A3D J;  3EET A;  2E71 A;  4KDP A;  4OAZ A;  5F1R A;  2XPW A;  4XN0 A;  1R5G A;  3JRG A;  1ZG1 A;  1T2K A;  3FXM A;  3G4S I;  3K1N A;  1MBH A;  4PCQ A;  3WTZ A;  3LNQ A;  4LD5 A;  5HLI A;  3GLX A;  4XRS G;  2FOK A;  2K9N A;  2D1H A;  3OSG A;  3R0A A;  2OD5 A;  2CQK A;  1ZG3 A;  2QSG X;  3QYE A;  1GVD A;  3F8B A;  3M07 A;  4E70 A;  1WHU A;  3OSF A;  1ETV A;  1PUF A;  3ONQ A;  2QM3 A;  3CP8 A;  4D7M A;  1FOK A;  2VJJ A;  4GYG A;  4X0G A;  2Y69 H;  2A6E F;  4ESB A;  3A02 A;  1AOY A;  5KVR A;  3BZC A;  5HLT A;  3CCJ I;  1WVR A;  3JRB A;  4F91 B;  2DMT A;  2EA2 A;  1MH4 A;  2MBF A;  2X1C A;  3P7N A;  4ZZL A;  1D5V A;  4LK1 F;  3OMY A;  5E18 F;  2GXB A;  2R7O A;  2VN2 A;  1O3S A;  2LBF B;  2XRL A;  5FKM A;  2F5E A;  2IXS A;  2DFH A;  4ZYD A;  1HBX G;  1EF4 A;  2NVY J;  4WXC A;  3HOS A;  3GEZ A;  5HS9 A;  2W48 A;  1VQ9 I;  5J8F A;  3CCY A;  1JUP A;  1TLH B;  2FOW A;  3PNY A;  4KMU X;  3ZP5 A;  1I39 A;  3BR1 A;  4A93 J;  2PEX A;  5B5E C;  4XRS A;  3I3L A;  2ZXH A;  3OY9 A;  3D0S A;  2OZU A;  3LSM A;  2O7O A;  4MFE A;  3HOX J;  3CCM I;  3TED A;  1FIA A;  1WQ2 A;  5E20 A;  4V2G A;  3V7S A;  3FBN B;  4RM3 A;  3P9I A;  1YIT I;  2AQE A;  3R6S A;  1U5T C;  3G3Z A;  4XQF A;  3F8C A;  1OCZ H;  1JKR C;  2WC2 A;  3OWT A;  2ZNY A;  4GFB A;  4RB3 C;  1TWF J;  1QZY A;  3OYF A;  3DKX A;  3DWL E;  1B9N A;  2NYX A;  5BPI A;  4I01 A;  2QKM B;  3I55 I;  5HLG A;  2GIV A;  2KT0 A;  1QVT A;  4IHV A;  2L9N A;  2DFI A;  4PJL A;  1R22 A;  2QZ8 A;  1RZ4 A;  4ZTF A;  3PNV A;  4M74 A;  2EIN H;  2HQ5 A;  1A35 A;  1S8N A;  1LDK B;  2FNA A;  5EGO A;  2STW A;  1MJB A;  1WJF A;  2W24 A;  2E1O A;  2BE5 F;  4LK0 F;  4BL0 B;  1TWH J;  4HA8 A;  2E1C A;  3I5U A;  4GRI A;  1O57 A;  4B44 A;  3HHG A;  3CF5 F;  2M4K A;  3ML6 A;  2CH0 A;  4MO7 A;  1ON2 A;  4YG2 F;  4IQJ A;  3OS1 A;  3KZY A;  4O6J A;  3DP7 A;  4NB5 A;  2HQN A;  2CJJ A;  5IYB J;  2O9L A;  4XN3 A;  2ZO4 A;  2LOO A;  4OAY A;  4XLC A;  2DOA A;  3PIP F;  2M0M A;  1LKX A;  2X51 A;  4C9Y A;  2ZME B;  1HSJ A;  3HB9 A;  3Q3S A;  2A05 A;  5DCF A;  2XAU A;  2DOE A;  4MGR A;  3U1D A;  3Q9V A;  5F0F A;  4A3I J;  4RGR A;  5EDN A;  5AIP A;  2DA2 A;  5B3S H;  1CQT A;  3J7A Y;  1FBU A;  4QIW N;  1TQM A;  2JUC A;  4G9Y A;  4IHY A;  1ETY A;  1OLT A;  1A36 A;  3HOZ J;  3BC8 A;  3E1S A;  2CQQ A;  2BXY A;  3QOP A;  5IOZ A;  3S3N A;  4CZZ A;  4L0Z B;  2EPF A;  5BQT A;  1P9Q C;  4WX9 A;  2E35 A;  2OTL I;  4E7S A;  2CUJ A;  3QQA A;  1TZL A;  2LBF A;  2BY0 A;  2WAF A;  2K3F A;  4G6Q A;  4BXF A;  2GLO A;  2OUM A;  1IZ1 A;  2KIQ A;  2XIG A;  3IRQ A;  3MKY B;  1R1U A;  3G1M A;  4NBQ A;  3RQI A;  1S29 A;  3GTJ J;  2VKV A;  3ZOB A;  2DOF A;  3JRD A;  1PP8 F;  1NH3 A;  3OYD A;  2F5D A;  3M1E A;  3MVP A;  3CCR I;  3GUD A;  2LRD A;  3I64 A;  1B72 B;  5J1Y A;  5JHU A;  3TDZ C;  1DDN A;  2QLZ A;  2X6O A;  2DMQ A;  2R7U A;  2QQ9 A;  3RPU D;  2CUE A;  1S7O A;  2VAS A;  5E3L A;  4KIS A;  1YI2 I;  2KQR A;  2GAU A;  4F55 A;  4XLH A;  2VE8 A;  2A5W A;  2IBD A;  4K2E A;  1PYV A;  4RAY A;  2XV4 S;  2VJI A;  1X3W B;  2NS7 A;  2XAG A;  3ZN0 A;  2XAH A;  3S17 J;  1FTZ A;  1D1C A;  3SFZ A;  4MNU A;  2VC0 A;  2R4G A;  1SD7 A;  3TW7 A;  4NUB A;  1S7E A;  3E5Q A;  3CO7 C;  2LK2 A;  4UVB A;  3U21 A;  2WY8 Q;  4M71 A;  4EVI A;  5ILV A;  2JTV A;  4CSW A;  4ZYA A;  1JHF A;  1V5F A;  3WGG A;  3ZQQ A;  3T0Y A;  1F4K A;  4LIV A;  5CVR A;  4HF1 A;  4M6V A;  4UV8 A;  5FKK A;  3GZ6 A;  2L02 A;  2ZFU A;  1JHH A;  2ZSI B;  2K7L A;  4E7J A;  1IJW C;  1BI1 A;  3WE2 A;  2PMH A;  1MH3 A;  4JX5 A;  3J81 K;  3JRA A;  2W4S A;  3ZXS A;  1UHS A;  3WTT C;  2NOJ B;  2ZCW A;  3CJN A;  1FP1 D;  3SFI A;  3FXU A;  4CO8 A;  3CDH A;  1SEU A;  2DPD A;  2R7X A;  3HYI A;  3IH4 A;  5EZG A;  3PFI A;  3M8E A;  3HZJ A;  4PJM A;  4G7H F;  2JA5 J;  2ZME A;  2VXD A;  4ZYG A;  5A2Q K;  2HZT A;  1YHQ I;  1WPK A;  5EJC A;  2O6G E;  4LOC A;  4HNT A;  1MND A;  3CES A;  2P5L C;  2FBI A;  4BYY A;  2EZL A;  5H20 A;  1Z21 A;  2ADU A;  4LIT A;  1ZRC A;  3X2Q H;  2XVC A;  2VQL A;  1XGM A;  2GBY A;  3CDI A;  2LRE A;  4KIF A;  3IWZ A;  3K7A J;  1ZKG A;  5GPC A;  5ICE A;  1XDU A;  2IVM A;  3KYC B;  4RAF A;  5E3O A;  3W2W A;  3DBL B;  3PQK A;  2AHQ A;  3OIO A;  2B9S A;  1HDP A;  2KLO A;  1TWC J;  2COM A;  1VZ0 A;  3QOE A;  4XSX F;  4ENN A;  4DIQ A;  4LG0 B;  3FX3 A;  2JJ7 A;  5F0H A;  3UKG A;  3OYB A;  1T8I A;  1TNS A;  5J47 A;  4BE0 A;  2EV5 A;  2QSF X;  3QYB A;  1NG6 A;  3IH3 A;  2K85 A;  4XID A;  2AQF A;  4L9V A;  2ELH A;  1Y1W J;  1IN8 A;  3H36 A;  1FBQ A;  2XGC A;  4BY1 J;  5LLQ A;  1YOV B;  5LEK A;  4L5E A;  5DUI A;  1EH6 A;  2AS5 F;  5L3E A;  1H8A C;  1FP2 A;  1QU3 A;  1F36 A;  4I7H A;  2E7W A;  5TGT A;  2YSR A;  1B72 A;  3VOE A;  5E17 F;  2IGN A;  5B66 C;  4BXX J;  5DCM B;  2BHZ A;  1U9O A;  3SZP A;  2H8W A;  2L54 A;  1BI0 A;  5D4R A;  2JA6 J;  1Z91 A;  1UZC A;  2GA2 A;  2EK5 A;  2M7A A;  3N4M A;  4U7D A;  4HAM A;  4XKC A;  3OYI A;  3LWF A;  1UHW A;  1YYV A;  3RCO A;  3QU3 A;  3QPS A;  1IUF A;  1GV5 A;  4ANJ A;  2HEO A;  2G7U A;  1R6R A;  3PSF A;  1LE8 B;  1WZ2 A;  3V7C A;  3VDX A;  3L2Q A;  2CUZ A;  1TQP A;  4MFD A;  5JVT A;  1OJL A;  1T38 A;  2JT1 A;  2X1D A;  3KP2 A;  4RB0 A;  5EEH A;  1LDD A;  3UR3 C;  3QRF F;  4G8X A;  2R93 J;  1XC5 A;  1MJA A;  3DTK A;  4KFC A;  3E6D A;  1GUU A;  3HC7 A;  3HL2 A;  2FUG 2;  1FTT A;  3MEX A;  5GAE J;  2R0Q C;  1WKM A;  5C4J J;  4I02 A;  1T95 A;  4FAS D;  1OCP A;  3LSP A;  2IGK A;  3ZQC A;  2MFZ A;  2ZNZ A;  3KZI C;  4E7H A;  2NVX J;  2Y0S N;  4OIN F;  1K79 A;  3S3M A;  1I1G A;  4ZJZ A;  3BJA A;  4FE4 A;  2MYS A;  1APL C;  3S3O A;  2LKX A;  3BPV A;  4R8H A;  1U9N A;  1FOY A;  4NDL A;  1I3Q J;  5EF6 A;  4JBA A;  4M6X A;  4BQO A;  1K4S A;  1WI9 A;  1ZGJ A;  4A5N A;  1N77 A;  4ZH4 F;  1WWX A;  4XIC A;  1J09 A;  1PP7 U;  3GTL J;  4XK4 A;  5HS8 A;  4Q4Z F;  4LG3 A;  1JGG A;  4FIS A;  3K4L A;  3B6A A;  2KPM A;  4KIG A;  1I1S A;  3HUG B;  3RIR A;  1JUM A;  4EJO A;  1QA6 A;  5J8C A;  4W1U A;  1JJ8 C;  2DYS H;  2MSY A;  1T56 A;  3LSG A;  1HA8 A;  1QO0 D;  1MNE A;  1OCC H;  3MZ8 A;  2KHM A;  3TO9 A;  4PGH A;  3GTM J;  3DKW A;  2DMN A;  1TL8 A;  3JTH A;  4KIT B;  5LRR A;  1FYK A;  1R36 A;  3COA C;  1TTY A;  3ASO H;  1FEX A;  2JRM A;  5L3B A;  2IPQ X;  2BXZ A;  3DCF A;  3MKZ A;  1W7P D;  1IDY A;  2HS5 A;  3R0J A;  3VPR A;  2CUF A;  4DYQ A;  3ZN1 A;  2MAB A;  3HTS B;  4MQV A;  1YTY A;  3FHN A;  2VT3 A;  1UG2 A;  5C44 J;  2DDB A;  1KU7 A;  1XGS A;  1VQK I;  5J1U A;  1ITY A;  2VB6 A;  3L2C A;  2ZJQ F;  3WTS C;  5JHF A;  3FKI J;  4OIR F;  2ZKZ A;  2QEX I;  1D0Y A;  3H1C A;  2K02 A;  4L9N A;  1TBX A;  1A04 A;  5DCM A;  3F8N A;  2Y0S A;  1DPR A;  1U5T B;  2LC2 A;  4WXD A;  3PUB A;  3ECH A;  1ZR4 A;  3E5U A;  3BR5 A;  3DBH B;  4EJW A;  2BGC A;  3M8F A;  5M5X J;  4ON0 A;  1MMG A;  3I53 A;  3WG7 H;  4OIO F;  1LE8 A;  2AXT C;  2MW8 A;  2B63 J;  1ETK A;  3REO A;  1WJE A;  1GT0 C;  2EB7 A;  2STT A;  5K7H A;  3CP2 A;  5FD6 A;  1QNT A;  2ISY A;  3IRR A;  3SDG A;  2KRH A;  2P7V B;  2O8X A;  2VIX A;  1HKQ A;  3JW4 A;  4AUX A;  2JK3 A;  2R7Q A;  3FHZ A;  2CYY A;  4ESJ A;  1HOM A;  1P7J A;  4HRI A;  1IRF A;  4IQ4 A;  1BC8 C;  4ZTJ A;  2G0E A;  4PUS A;  1D0Z A;  5CVJ A;  1OYY A;  2PLY A;  3EYY A;  2H6C A;  3LFK A;  1Z3Y A;  4HLX A;  3JAM Z;  1LUJ B;  3CMY A;  1BJA A;  3K70 D;  4GO1 A;  2VXZ A;  2EIM H;  5FLM J;  1OKR A;  1Q1H A;  2P6T A;  3FXK A;  3HUG A;  2EIK H;  2LKP A;  1IV6 A;  4RA2 A;  2CGP A;  1FSH A;  3ZQI A;  3GZN B;  3JRE A;  1SMT A;  3KP7 A;  2BVM A;  3WTX C;  2M8E A;  2VLA A;  4A3K J;  1SFE A;  3S2D J;  1WCM J;  2CFO A;  2JRT A;  1OIS A;  2NS0 A;  4G6D A;  3CCQ I;  1U8R A;  2ICW G;  1BL0 A;  1YW9 A;  4BXU A;  4XLF A;  4A3L J;  2VPL A;  4OMZ A;  2QSH X;  5K7Z A;  1YIJ I;  1DUX C;  1S6L A;  2LG4 A;  2RNJ A;  4HV5 A;  2J5O A;  3IP4 B;  2QQA A;  2JPC A;  3LSR A;  3FM5 A;  4D5F A;  1SFU A;  4IKF A;  1O7L A;  3C7J A;  4D5C A;  2BOL A;  1I6X A;  2E1M B;  1JJ6 C;  1R5H A;  4LJZ F;  1MGT A;  2XF5 A;  1SAX A;  3K4M A;  3C2G A;  1JKP C;  3T8T A;  4AIK A;  3BTC A;  5FFZ A;  4EQQ A;  1H9T A;  2FXA A;  3E6B A;  3KLO A;  5J3L A;  4KMF A;  4RGU A;  3FIW A;  3T8R A;  3SHF A;  5HLH A;  3LMM A;  4G7Z F;  3MAJ A;  2LF8 A;  2ESN A;  4CCK A;  5H6Q A;  3TOB A;  4A3J J;  1U5T A;  2DA4 A;  1QPM A;  3U1K A;  4CUG A;  1X1P A;  1X3U A;  1DGW Y;  2I5U A;  3FXJ A;  2WTE A;  5IT9 Z;  4R79 A;  4IEJ A;  4CYD A;  3K1P A;  1IN7 A;  2M0C A;  1U78 A;  3ZMZ A;  2FRH A;  1WJC A;  3GTO J;  2FNP A;  2XSJ C;  1IF1 A;  3OV8 A;  2XB5 A;  4QSH A;  1RR8 C;  4LGW A;  4DQ2 A;  3ROU A;  3OYN A;  1IGN A;  2DA7 A;  4HF0 A;  4I0B A;  3KP5 A;  2DA5 A;  3E6C C;  2MC4 A;  1MMD A;  4HX8 A;  1D8K A;  1GVJ A;  1K83 J;  3S2H J;  4HBL A;  5CVV A;  1S72 I;  1P4W A;  4CCO A;  5DDG A;  1RR7 A;  3DU6 A;  3BQY A;  1VQ4 I;  2HYF A;  2HOT A;  1LJ9 A;  2CU7 A;  2HKX A;  1V5E A;  4KN7 X;  3TO7 A;  4JX4 A;  3PIO F;  3LOC A;  3M9A A;  4I2O A;  1R1V A;  3HSF A;  2XAF A;  3FM3 A;  4HEA 2;  2XGX A;  4KT5 C;  4B43 A;  3H3U A;  2JZY A;  3O8H A;  2ESH A;  1TT5 B;  4YFN F;  3GBG A;  2VQG A;  3LST A;  1LDJ A;  9ANT A;  3UNG C;  5BMZ A;  4A3G J;  2IGO A;  1SAN A;  1W0U A;  3I59 B;  2PJP A;  3WG9 A;  2M9H A;  1KU9 A;  1WJB A;  2HWV A;  4HZF A;  5E1X A;  1D8J A;  1BC7 C;  1A6I A;  4F52 A;  2EFW A;  4D0P A;  2CRG A;  4XLA A;  3DU5 A;  4NQW B;  4KNY A;  5F27 A;  1BI2 A;  1AHD P;  3AAF A;  2K9S A;  2N8G A;  3DTI A;  4S0H B;  1LFU P;  1X1D A;  3DPT A;  2UV1 A;  2X9D A;  5BS6 A;  2KKO A;  3HRT A;  3E7L A;  1RPW A;  1V4R A;  4FET A;  4BDZ A;  1JKO C;  1FZP B;  1IN4 A;  2GWR A;  1R58 A;  2G7H A;  3C1D A;  1T98 A;  3W6K B;  4U0V A;  2ID3 A;  3SEZ A;  4ABZ A;  2DFE A;  3I56 I;  5LGN A;  2X0L A;  1ZLK A;  3I9V 2;  2K27 A;  1S7A A;  1B9M A;  2GOX B;  3JSP A;  1I3A A;  1LPQ A;  3PJR A;  4WWC A;  4O3M A;  1ETO A;  5KAI C;  1HDD C;  4Y33 A;  1YFH A;  3NAU A;  5JFR A;  3GFI A;  1XGO A;  3EPZ A;  3SXY A;  5GPA A;  3OOU A;  1E3O C;  4BAC A;  1VQP I;  1QZZ A;  1MKM A;  1PDN C;  3IKT A;  1KU2 A;  2DA6 A;  1FIP A;  2X48 A;  3ZQH A;  2DDA A;  4GGG A;  4C3H J;  2DT6 A;  3CCS I;  3HDD A;  4QPQ A;  2HDD A;  2A68 F;  3I4M J;  2AO9 A;  2VOP A;  5LHG A;  2NXN B;  4M3B A;  1HW5 A;  3FXQ A;  4BEH B;  4BBS J;  2IS4 A;  2D1V A;  1FMW A;  4P1W A;  1OMI A;  1LQ1 A;  1IUY A;  1H0M A;  1VQN I;  1T6S A;  3GCM A;  1X58 A;  4J01 A;  4HYE A;  1X19 A;  2FBH A;  2DOD A;  5HOD A;  1JTY A;  2FBK A;  3ZQF A;  3KYL A;  2IGM A;  4BBR J;  4CA0 A;  2ECB A;  1IXR C;  3RQ4 A;  3N97 A;  2EIL H;  2KIS A;  4DYR A;  3BG7 A;  5CVU A;  2XPU A;  1ETQ A;  2OC6 A;  3DF8 A;  5M3F J;  2EFO A;  2R7D A;  3C2B A;  2ACJ A;  1POG A;  4UB8 C;  1VTN C;  1SC7 A;  4PSX A;  2ME6 A;  1XDS A;  3I59 A;  1F5T A;  5L3G A;  2M30 A;  3KEY A;  4F3Q A;  2L5Q A;  4AM3 A;  1ON1 A;  3IWF A;  5D5W B;  3O6B B;  2I8D A;  2Z5U A;  2LF7 A;  3HM5 A;  3ZMU A;  5FO5 A;  1C0W A;  1QBJ A;  3RKQ A;  3Q0V A;  3RKY A;  2NVQ J;  1ZEL A;  1Y8Q B;  3DEE A;  3BT9 A;  5E3N A;  2DI3 A;  1YX3 A;  4NQW A;  2P6S A;  4Y7N J;  4Z2Y A;  4B8X A;  1R9T J;  1PVE A;  4A3B J;  1OR7 C;  1QGP A;  1VQL I;  2XF6 A;  4M3G A;  2CW0 F;  2FQ3 A;  3KCC A;  4XKV A;  3DFG A;  2X85 A;  3CJQ B;  3BR0 A;  4FX0 A;  3R60 A;  5DD8 A;  4B47 A;  4Z6Y A;  1QHH D;  5K7F A;  1XB4 A;  3WTY C;  1E3P A;  1MW7 A;  2PBI A;  2VL8 A;  3PNT A;  3M8J A;  4NC7 A;  2F4O B;  5IY5 H;  1U2W A;  1VI0 A;  3KEQ A;  3J7Y J;  3Q9S A;  3OYC A;  2KFD A;  2FU4 A;  1L0O C;  2LLK A;  4U88 A;  4HSR A;  2CV2 A;  2PN6 A;  2RGV A;  1WH7 A;  2A69 F;  2TRT A;  5HOO A;  3L2R A;  2P7C B;  4HF2 A;  5C4X J;  2HVS A;  1JXS A;  3LAJ A;  2NNY A;  3DEW A;  5FGM A;  1ZAR A;  1O3Q A;  2L7K A;  3JAM K;  4UUS B;  4EM0 B;  3MFK A;  1ERD A;  4MLO A;  2E1M C;  2P81 A;  2XKO A;  1WI3 A;  4IHS A;  1OYI A;  1UHM A;  3KP6 A;  1K7A A;  3FKJ A;  3R61 A;  1B59 A;  3VOD A;  2JUG A;  3JR9 A;  3OS0 A;  1H88 C;  2QGU A;  3EUH A;  5H6R A;  4A6D A;  4BEH A;  1FLI A;  3D5L A;  5DV5 A;  2CW7 A;  4DBR A;  2ZJ2 A;  2V79 A;  3MQ0 A;  5FD5 A;  4IOA F;  4EM1 A;  1YS7 A;  3VYS B;  3PSI A;  4FX4 A;  2O3F A;  3H35 A;  4TV7 A;  1FX7 A;  1T33 A;  3TKY A;  4CDG A;  3HOY J;  3HRU A;  5JLX A;  3BDD A;  3D5R C;  3H0D A;  2FEZ A;  3LSH A;  3V8K A;  2JQ7 A;  2JVH A;  2XGD A;  1MBE A;  4YIR X;  3GTG J;  4M3E A;  1K6O A;  3BR2 A;  3BR3 A;  4FCY A;  2XGE A;  3FMS A;  4I0A A;  3RPQ A;  2X6Y A;  1STZ A;  1S3J A;  3QU6 A;  5GAD J;  4QLC U;  4U0W A;  3IAS 2;  3J80 K;  1R7J A;  2LVS A;  3OYA A;  3W6V A;  4IRH A;  2OA4 A;  2RC4 A;  3G1O A;  1G8X A;  1FT9 A;  2V9V A;  3WE3 A;  2RN7 A;  1TWG J;  2VON A;  2GIZ A;  5IT9 K;  4U87 A;  5C3E J;  3F0C A;  2KDO A;  2L7Z A;  3B6C A;  2ZJP F;  1FWZ A;  5KCM A;  3C3W A;  5J4Y A;  1NG7 A;  1MD0 A;  1MMN A;  1Y1V J;  3CF2 A;  5K5R A;  3RI4 A;  1P6R A;  5EEG A;  3F8M A;  1R4N B;  3V8J A;  5BPD A;  3CLQ A;  5J6X A;  1ZYR F;  1V54 H;  4GYI A;  1HKS A;  4RLF A;  2HYJ A;  3G71 I;  2MLK A;  2OZ6 A;  3A1Y A;  2F5F A;  3EDP A;  4HNU A;  2ECC A;  2RKH A;  4BHB A;  1NHA A;  1G3S A;  3NAR A;  3BTL A;  4A6E A;  1YRN B;  3CC2 I;  1A31 A;  2NNN A;  1HF0 A;  5CLS A;  3FZV A;  2UWM A;  1XN7 A;  4RGX A;  4AIJ A;  1IV8 A;  1UB9 A;  3E5X A;  3W3C A;  4CYC B;  1N78 A;  2M3A A;  3S14 J;  4OIQ F;  2DA1 A;  4L9J A;  4I98 B;  1X3Z B;  2UXX A;  3L2W A;  2R7Z J;  1FYL A;  4BUP A;  1R1T A;  4UUS A;  1MBK A;  3DPL C;  4C3J J;  1WGX A;  1WFX A;  4FE7 A;  1KZH A;  4DYC A;  3LAP A;  4IXA A;  3HEF A;  1PUE E;  1JUS A;  5KK1 A;  4E6K G;  2HOA A;  3U9G A;  2YU3 A;  2HPI A;  5E3M A;  3K70 C;  1FPQ A;  3H5A A;  5CVI A;  4BU2 A;  2HR3 A;  4CH7 A;  2BVL A;  4FTH A;  3S32 A;  4EGZ A;  3Q0U A;  2E5Z A;  3ZR8 X;  4P55 A;  5DM6 F;  5FKN A;  1JKQ C;  1HCR A;  1R23 A;  4A3M J;  2OV7 A;  2Q2E B;  2E19 A;  1KA8 A;  4RM2 A;  2K9Q A;  5FLX Z;  3L2V A;  1G3Y A;  4HNV A;  2OQG A;  5D8L B;  3ZMD A;  5K5Q A;  4HOB A;  3WGH A;  1EA3 A;  2W84 A;  3FF5 A;  4C3I J;  4U7B A;  4N9I A;  2V9P A;  1MJ9 A;  2L7M P;  1KGS A;  1K78 B;  1Z77 A;  2GXG A;  3O3K A;  2QUF A;  4Q5S F;  2CSO A;  1SFK A;  4IVN A;  1GV2 A;  3AG4 H;  3NEU A;  1EH8 A;  2E7X A;  3E0J B;  2HQA A;  2KJC A;  2Q0O A;  2BY1 A;  3EUH C;  3E97 A;  4ZC3 A;  2XRO A;  3KZZ A;  4YFK F;  5CQG A;  1MIJ A;  1ZH5 A;  2DAO A;  1HKT A;  3HJE A;  1R4M B;  1SD6 A;  1XCV A;  4LMY A;  4LLL A;  1YIO A;  2E2I J;  1RKW A;  1AU7 A;  1D5Y A;  1KYZ A;  1VQM I;  2LTP A;  5EG0 B;  1GLN A;  4BNC A;  1SFO J;  2R7R A;  3P9C A;  3F23 A;  2MD0 A;  4X1E A;  4XRF A;  4NHJ A;  3SDB A;  1L3L A;  2KMU A;  1W5S A;  1Z6R A;  3V8L A;  1REP C;  3BWG A;  4V2F A;  3RJP A;  2OU2 A;  5IYD J;  1YS6 A;  1MZB A;  3M1C A;  1KYW A;  1FYM A;  2L2O A;  2WAE A;  2XUB A;  2XDV A;  2QVO A;  1YE9 A;  1YRN A;  1OCR H;  1Z0X A;  1BJZ A;  2PQ8 A;  1MMS A;  3IAM 2;  2KZV A;  2EZK A;  2V7F A;  1ENH A;  5BNG A;  4CYC A;  4LLN A;  4LG0 A;  4KA4 A;  2DTR A;  1TP4 A;  3SJM A;  5HVQ C;  3KET A;  3OR2 C;  1K61 A;  3F21 A;  2EFN A;  4MIM A;  3S1Q J;  4ZZD A;  4F92 B;  2PI0 A;  1GXQ A;  3M4O J;  3LL7 A;  4ENJ A;  1RUO A;  2GA1 A;  2IA1 A;  2HYG D;  3JCU C;  4M3F A;  4RDU A;  2WY7 Q;  3QOD A;  5ERI A;  3ASN H;  3ZCO A;  3KEO A;  1X4O A;  1U8B A;  2H27 A;  1Z05 A;  2ME0 A;  2WAQ N;  4MEX F;  1J7K A;  2EBI A;  1V5G A;  1G2H A;  1ZLJ A;  4M72 A;  3JTG A;  4YEJ A;  2A5Y B;  2NS8 A;  4GCV A;  2MA3 A;  4M73 A;  4BAY A;  4A12 A;  4IL6 C;  3FMQ A;  2X6X A;  3WTW C;  2QA4 I;  3IH2 A;  1BR4 A;  2OPT A;  4W97 A;  2Q2E A;  5IP7 J;  3LQQ A;  4PZJ A;  4P96 A;  3LA7 A;  4ETS A;  1X2M A;  2GZW A;  1ZRD A;  2HOS A;  2YR2 A;  3DEU A;  3B02 A;  3GZ5 A;  2H8R A;  4NNJ A;  1P4A A;  2H94 A;  2KJB A;  4CCL A;  1YJ9 I;  3PQJ A;  1JT0 A;  5EYR A;  3WHB A;  1K78 A;  4ZDO A;  5ICC A;  4LB5 A;  1JI8 A;  2NAZ A;  2RRE A;  2HVR A;  2E36 A;  3GTP J;  2O61 A;  3QP6 A;  2WAD A;  1JGS A;  2R5Y B;  3ABU A;  4AU7 A;  2HQR A;  3BY6 A;  3PM1 A;  3FXR A;  3H92 A;  1YJN I;  3GME A;  4L5J A;  3WU2 C;  4CIC A;  5LHI A;  2CV0 A;  2QKL B;  3BJ6 A;  2M5W A;  1RNL A;  5LRS A;  3RZO J;  1G3W A;  4FQG A;  5EG0 A;  2HFH A;  3TOA A;  3CUO A;  1ZN2 A;  3CME I;  3G1L A;  3L7W A;  5FRM A;  1ONV A;  2MLG A;  2ETH A;  5GTI C;  3ESW B;  3RPU A;  3HIF A;  5EEA A;  3H5R A;  3LA3 A;  3HGG A;  4WF2 A;  2A07 F;  2UXN A;  3MN2 A;  2WAQ A;  1OFC X;  2JSP A;  4NC8 A;  3K4B A;  2DMP A;  5B1A H;  1ZR2 A;  3DLA A;  1UFM A;  4B09 A;  2PFB A;  3KX2 A;  3WU1 B;  2DTZ A;  2LMD A;  4E7Z A;  5E8I A;  1IN6 A;  1HW1 A;  1UJ8 A;  4G94 A;  3KLN A;  4J19 A;  1EJ9 A;  2LDU A;  3GW2 A;  1F9N A;  2YX4 A;  4A2U A;  4DNC A;  3BG6 A;  1K4T A;  3I4N J;  3K2A A;  4OIP F;  2Y30 A;  2DJN A;  4M3D A;  4RGS A;  3HOV J;  3D1N I;  1I50 J;  5IPA A;  2DCE A;  3VYT B;  5JLW A;  3MD2 A;  2HTJ A;  1U3E M;  3CC4 I;  1FNN A;  3V42 A;  5HS7 A;  2HGC A;  4BQQ A;  1MDM B;  2Z33 A;  2V1X A;  4MTE A;  4H4K C;  1ULY A;  4HDU A;  1RKT A;  2FX0 A;  3HBL A;  2BZT A;  1MSE C;  1EH7 A;  1E2X A;  3VYU B;  2A3S A;  4XOT A;  2GOM A;  3RYP A;  1ACI A;  2FA5 A;  3OL3 A;  4B3A A;  2JMW A;  2KZG A;  3H9Q A;  1EKE A;  1FBS A;  4HW0 A;  2VT2 A;  4AVZ A;  2K86 A;  1DQU A;  1T08 B;  1RIO H;  4AD9 A;  2A6H F;  2OTJ I;  1KQ9 A;  5IOY A;  1HLV A;  1B1B A;  1TC3 C;  1JT6 A;  2P5V A;  3CZ6 A;  2QWW A;  1BN5 A;  3BTJ A;  4BHC A;  4PFP A;  3ZQG A;  1Q1V A;  2ID6 A;  4KJZ A;  2Y48 A;  1IXC A;  1LEA A;  2BEO A;  1W7P B;  2KIM A;  2VJ4 A;  1SFX A;  5F1J A;  3J81 Z;  1J75 A;  3SZG A;  4A0Z A;  5LFA A;  1J2X A;  1SD4 A;  4WCG A;  5M5Y J;  2R5Y A;  4CGZ A;  2H1L A;  3O2P E;  3J7A O;  2FMY A;  3I0T A;  2V1U A;  2IA0 A;  2HNH A;  4PSW A;  2WV0 A;  1FJL A;  1FMV A;  5A2Q Z;  5DM7 F;  2MGQ A;  1KQ0 A;  1ODD A;  4Q47 A;  3HGY A;  1XTA A;  4EJT A;  1GXP A;  2QBY B;  2P0W A;  3MZH A;  2Y75 A;  4A0Y A;  5ED4 A;  1Z3X A;  3CDL A;  2XHK A;  1OR7 A;  4BDY A;  3EUK L;  4A3F J;  2DO7 A;  3ERE D;  4HLY A;  4I09 A;  3L2U A;  2H1K A;  3OYG A;  2M8G X;  4MQ9 F;  2M34 A;  2Z9O A;  1B6A A;  5FKO A;  3PFY A;  5K1Y A;  2YX7 A;  4XOR A;  3F3X A;  3ZGK A;  3CO6 C;  4EAT A;  2R7V A;  5KHD A;  1UST A;  3BG9 A;  1HXD A;  2F4I A;  1TQI A;  3Q5F A;  4Y3O A;  3VFZ A;  1O7F A;  1ETX A;  1WH5 A;  1K6Y A;  4LLG F;  2OF7 A;  2V6E A;  1BOA A;  2OJE D;  3KYD B;  1DP7 P;  4HQE A;  3DPU A;  4DW6 A;  4P5O A;  2B7E A;  1KON A;  4DOZ A;  4BY7 J;  2DLL A;  3F6O A;  3QPL A;  2LY2 A;  1YG2 A;  2HZD A;  1DP3 A;  1FOX A;  1IN5 A;  4N9H A;  2F6C A;  2M2E A;  2YUS A;  3LSJ A;  2A61 A;  2FML A;  3L9F A;  5GTH C;  1S9H A;  2DJI A;  2HXO A;  1Y6I A;  5HDG A;  3ZMT A;  4H0E A;  1ZG5 A;  3OYL A;  2H09 A;  1MDM A;  3KFW X;  1YLF A;  3K4K A;  4AVP A;  4S05 A;  1MSF C;  4UVA A;  1IW7 F;  3ECO A;  5KNL A;  2CW8 A;  2P4W A;  1QZE A;  5LGU A;  2Y9Z A;  2X1E A;  3GFM A;  3MZY A;  1VF9 A;  4RLQ A;  3GFL A;  3QAH A;  2K9M A;  4IPA A;  2BW3 B;  5IYC J;  2OAZ A;  3H9J A;  1GDT A;  1LFP A;  5M5W J;  2W57 A;  1XD7 A;  1RET A;  2W1O A;  3TGN A;  5KAF C;  2D45 A;  3BQZ A;  5FB2 A;  4XL9 A;  2RNG A;  1LB2 A;  4DBQ A;  5D6E A;  1W36 D;  3HXL A;  2A6T A;  1R00 A;  1BW5 A;  3JRH A;  3WU0 A;  1OCO H;  3GLL A;  1Y0N A;  1BR1 A;  2W00 A;  1I27 A;  5J1R A;  1MMA A;  1W7P A;  4PJN A;  4RMN A;  4XOP A;  5F6F A;  3OYM A;  4Y52 J;  4DZP A;  2JA2 A;  3V7R A;  3BR6 A;  2OBP A;  2CG4 A;  3VSL A;  4UXN A;  3H0G J;  2VBX A;  3S8P A;  4EJV A;  4XLE A;  1DU0 A;  2XF7 A;  4IHX A;  2KIU A;  4BE2 A;  1P4X A;  2VKH A;  3T5X A;  1TNT A;  3A4C A;  2W25 A;  3OL4 A;  5F08 A;  5L3F A;  1ZRF A;  2CWE A;  1DU6 A;  4G6T B;  1RC9 A;  5EZH A;  1X1B A;  2BBY A;  3BG3 A;  4BQA A;  1W5C C;  5GAG J;  2LKS A;  4R1H A;  2QBY A;  3F72 A;  5D5X B;  3F22 A;  3ABT A;  4A69 C;  2FQ4 A;  1WJA A;  5J40 A;  1QVU A;  2RQQ A;  1SD5 A;  1CGP A;  3MCZ A;  3V4G A;  2FD5 A;  3EUA A;  1J59 A;  3W2V A;  1TWA J;  3K4C A;  4IJA A;  4C2M J;  2XAJ A;  4D1Q A;  1FC3 A;  2F4M B;  1KU3 A;  3CLO A;  3FIS A;  5HNH A;  5LHH A;  1W1W E;  1B4A A;  4KN4 X;  2ISZ A;  2L01 A;  3AG1 H;  3ZRG A;  3G6E I;  4BH9 A;  4NC6 A;  3E6M A;  3S1R J;  5LD2 C;  2ZC2 A;  3S2W A;  2NVT J;  1R71 A;  3BTI A;  2VC1 A;  3I54 A;  2DT5 A;  1ZHF A;  4PDK A;  3RYR A;  1IAW A;  4CHU A;  5LEJ A;  2BY2 A;  3CCE I;  1DPU A;  2VPR A;  2RDP A;  4FHT A;  1VQ5 I;  1QRY A;  4IRI A;  4BJT A;  4JQF A;  1FOW A;  2BYV E;  3ABL H;  2ZBK A;  4KIC A;  1VFC A;  1AWC A;  2IAI A;  4HG2 A;  3R4K A;  4IZZ A;  1G59 A;  1MBG A;  1WRJ A;  2JN6 A;  2DYR H;  2EIJ H;  3IKV A;  4ITV A;  4YEL A;  1YJW I;  3VWB A;  2QYO A;  3VB2 A;  4UNO A;  3PO3 J;  4I76 A;  3DLL F;  2VQH A;  3H3Z A;  5D4S A;  3ZQ7 A;  2BHY A;  1IO2 A;  1BOB A;  1ORK A;  2L4M A;  3ELK A;  2VE9 A;  3FWE A;  5CPR B;  5HNF A;  3CJR B;  3CCU I;  5E1Z B;  3HHH A;  2L7F P;  2PJR B;  1E0E A;  1UMQ A;  5ICF A;  3QPH A;  1B8I B;  2BW3 A;  1X1C A;  1V55 H;  2VKE A;  1FY7 A;  1O3T A;  5FKL A;  4ENM A;  1JE8 A;  2FSW A;  4WXH A;  2X4H A;  4E7L A;  2LR8 A;  4G12 A;  1I5Z A;  2BV6 A;  2IS1 A;  4RBO A;  5DTD A;  3HKZ N;  3PUF A;  2K3P A;  2IA2 A;  3TL4 X;  2IS2 A;  2R92 J;  4Q48 A;  2EFQ A;  5HDK A;  4BGD A;  3S1M J;  2COB A;  2HKO A;  4DGW B;  3FXO A;  4PGG A;  2XB0 X;  1WSU A;  3GTK J;  4L0Y B;  2CS3 A;  1U6G A;  2JA7 J;  2HDW A;  1X4P A;  1RES A;  2L9V A;  2WWY A;  5LGT A;  1OYW A;  3IL2 A;  4ZDP A;  1GHC A;  5H2F C;  4CCM A;  3QPT A;  1MBJ A;  3BJO A;  1VQO I;  1O4X A;  1O3R A;  5JR3 A;  1VQ8 I;  2L3D A;  3DXJ F;  3WOD F;  4HV6 A;  2DW4 A;  2XC7 A;  2ZJR F;  4JYK A;  4P9U A;  4FT8 A;  2Z1D A;  4XON A;  2QQ8 A;  1KQ8 A;  2O03 A;  2V1D A;  1G4D A;  2EV0 A;  2K4J A;  4ASN A;  1IRZ A;  5CYV A;  4IHW A;  4UHT A;  1G6N A;  2KL4 A;  5IP6 A;  3A03 A;  1BI3 A;  4XR6 A;  3HRS A;  2PMZ N;  5JVG F;  1Y39 A;  5FLV A;  1F1Z A;  3HPG A;  3NQO A;  2O8K A;  2F2E A;  3S16 J;  3TBI A;  5IP9 J;  4A3C J;  4GXO A;  5FRN A;  3TQN A;  4HX4 A;  3BCA A;  2V9K A;  1LFB A;  2FJ1 A;  4XRM A;  4P9F A;  3PO2 J;  1YO5 C;  4C2U A;  2DN0 A;  3CJT B;  4BHP A;  1DGR M;  3BP8 A;  2CO5 A;  3OYJ A;  2YPR A;  1J0R A;  3HKZ A;  2LH9 A;  3JRI A;  1N75 A;  1Y0U A;  4ENK A;  4AC0 A;  2IRF G;  4J00 A;  2JPB A;  2MH9 A;  1D0X A;  5GAH J;  4JP0 A;  3EYI A;  1NTC A;  1XX5 A;  2DQL A;  2R7W A;  3M3Y J;  4BJ6 C;  1E17 A;  4JOM A;  2QEN A;  1R49 A;  2LFB A;  4IRG A;  4M6Y A;  4B4C A;  5M3M J;  2R3S A;  1SAU A;  2Z99 A;  1HW2 A;  2AXL A;  2EZH A;  3DTE A;  4E7K A;  1VQ7 I;  2W85 A;  4RS8 A;  2L4A A;  2PJR A;  4N4N B;  4YIF A;  1IC8 A;  2F5C A;  3C18 A;  4OMY A;  3CC7 I;  5CKT A;  1SVO A;  4HDV A;  4LFU A;  1B8I A;  1IDZ A;  2JVG A;  3H3V K;  1F43 A;  3OR1 C;  1FSE A;  2QF7 A;  1UCR A;  3QYF A;  4L5I A;  3K0L A;  5D5V B;  3A01 B;  4L18 B;  3ERM A;  3FDY A;  2XRN A;  4LIU A;  1T0F A;  4C30 A;  2KDZ A;  5D5U B;  3K69 A;  1M1E B;  4Y17 A;  1BIB A;  3BCB A;  3RSN A;  2DBB A;  3AL0 B;  2R7F A;  3F8F A;  3CUQ B;  2VOO A;  2PMZ A;  1V3F A;  4HX7 A;  4OOI A;  3L00 A;  2VBZ A;  2MH2 A;  2ELK A;  5D8K B;  1T39 A;  3L1P A;  1WJ5 A;  4MTD A;  2MD5 A;  2XKP A;  5HDN A;  1RUN A;  1OQY A;  5GP9 A;  2GQQ A;  4UB6 C;  3BRO A;  2DMU A;  3ABM H;  3CCL I;  5IT3 A;  4M9Z A;  4ZYH A;  3G2B A;  3MKW B;  3NRV A;  3WTU C;  3BZ6 A;  5AIQ A;  3HG9 A;  2M45 A;  4O5V A;  2NVU B;  3LA2 A;  3RKX A;  1D1B A;  3SYT A;  4M9S A;  2F48 A;  2DQR A;  3Q0W A;  3OIQ A;  2F5V A;  2DK8 A;  1XSX A;  4BE1 A;  4UVC A;  4B1R A;  1BR2 A;  1LVA A;  2IEK A;  4BS9 A;  3HSE A;  3VEP A;  3FK7 A;  3RZD J;  3DKY A;  2O0Y A;  4KIB A;  4HST A;  4IO9 F;  3AG3 H;  3HPH A;  2HXI A;  3F6V A;  4ZYE A;  1H89 C;  2ZFW A;  1ZRE A;  1SMY F;  4QWQ A;  2DU9 A;  4A3E J;  4XKB A;  1BIA A;  2TDX A;  1XG1 A;  2WBM A;  1RI7 A;  2NOG A;  2Q1Z B;  4DJA A;  2LD5 A;  2V6C A;  3RKW A;  5ILS A;  2W7N A;  4I6Z A;  2VKD A;  3HOT A;  1QPI A;  3K1M A;  3D5S C;  3K4N A;  4RAG A;  1G3T A;  4B48 A;  1IXS B;  2KP6 A;  2IJL A;  5FJ8 J;  1ZK8 A;  3C2H A;  1XMX A;  4ZDL A;  1HST A;  2HTS A;  3TDU C;  3OYK A;  1LEB A;  3OIP A;  4S04 A;  5AON A;  1W5T A;  4X6A J;  4PK4 A;  4LB6 B;  4EJU A;  1ZAO A;  2PG4 A;  2HPM A;  4CZC A;  3IV5 A;  1YW8 A;  3TP0 A;  5F0C A;  2M87 A;  4Y15 A;  1W0T A;  1S5L C;  4XNF A;  2YU9 J;  4EMS A;  4G7O F;  4YFX F;  1X2N A;  4XLP F;  2V1N A;  2VBY A;  2XPV A;  3AFH A;  4Y13 A;  2JWT A;  1E3H A;  5FRO A;  1YQA A;  1YW7 A;  2Z2S B;  2ZXI A;  4EV0 A;  2JSC A;  3LQR A;  1LNW A;  3FK6 A;  3I4P A;  3A01 A;  2LNB A;  3BPX A;  4IOC F;  1ZGW A;  1VQ6 I;  3B73 A;  2EZI A;  5D6F A;  1XCB A;  2X6W A;  2W82 A;  1D3Y A;  1NK3 P;  2VJ5 A;  3K10 A;  4PJJ A;  3MMY B;  2HI3 A;  4HQM A;  4F93 B;  3CUQ A;  3MWM A;  2ZB9 A;  1SVL A;  3K6G A;  3GYH X;  2L0K A;  5DEQ A;  2HOE A;  2HU9 A;  3HSR A;  3M7G A;  4OWR B;  5E1W A;  1Z7U A;  3BOQ A;  4E4H A;  1EV7 A;  2EA4 A;  2RVC A;  4M9X A;  3P9K A;  3ABK H;  3WTV C;  1WJD A;  1Z7L A;  2DPU A;  1XGN A;  2EJR A;  3P5J A;  3AKZ A;  2DK5 A;  2MG4 A;  1CF7 B;  1PJR A;  2GM4 A;  3K4J A;  4L9T A;  2MC3 A;  1HQC A;  2UUZ A;  3U2R A;  1NK2 P;  4MHG A;  4Y4R A;  2ZME C;  1XS9 A;  3JSO A;  1T0F C;  4N0B A;  2UZK A;  1Y8R B;  2DXI A;  2K4B A;  2XAQ A;  3T1B A;  2KIF A;  2L9S A;  1Z1D A;  3IHU A;  3VSK A;  3KP3 A;  2I10 A;  3KP4 A;  2ZSH B;  2VI6 A;  1R5I D;  3IC7 A;  3WHC A;  3FBI B;  3W6J B;  3A2K A;  3GVA A;  2TCT A;  2VUM J;  3QWL A;  2R5Z B;  4I99 C;  4C2T A;  1A5J A;  5F64 A;  3W2A A;  3BLY A;  3BG5 A;  3LSK A;  5L3D A;  1IRX A;  5TJJ A;  2BY3 A;  3H5N A;  3FMR A;  2DT7 B;  2QQB A;  2QCO A;  1I6H J;  3J7Z I;  2J5P A;  2K40 A;  3TP3 A;  1N25 A;  4E7I A;  1X1A A;  2LYC A;  3CD6 I;  4YRV A;  3JRF A;  4CXF A;  2XAS A;  3EQL F;  5E79 C;  3MKL A;  3S1N J;  3IUO A;  1Y56 A;  1BBY A;  3RTR A;  3TO6 A;  3DBR B;  5CQE A;  1VND A;  2Y0M A;  2E5N A;  4XKW A;  2FE3 A;  3GWZ A;  2EV6 A;  3CMA I;  1ZGA A;  2ELJ A;  3ULQ B;  1LVK A;  3PL8 A;  3HOU J;  1XMK A;  2E34 A;  4ESF A;  2Z3Y A;  2RV8 A;  1AKH B;  1ETW A;  2K5C A;  3CQZ J;  3BZK A;  2V4J C;  4EEF G;  5LBQ A;  2EH3 A;  2OCC H;  5ILU A;  4AYB N;  4RB1 A;  1W36 C;  1D1A A;  5DUK A;  4XSZ F;  1JTX A;  4UV9 A;  2Q8K A;  5K5O A;  4QTR A;  2HVQ A;  2IT0 A;  1XSV A;  4GDF A;  4EM2 A;  2Y9Y A;  5DYM A;  3OYE A;  1P7I A;  3VYR B;  2WB1 N;  4UUV A; 
#chains in the Genus database with same CATH homology
 2NXN B;  4IOC F;  1VQ6 I;  5GAE J;  1ACI A;  2QA4 I;  4IOA F;  5DM6 F;  1VQN I;  2OTJ I;  1S72 I;  3CF5 F;  2JQ7 A;  1YJ9 I;  1FOY A;  1VQ4 I;  3PIO F;  3G4S I;  2E36 A;  3CCL I;  1VQO I;  1VQ8 I;  3PIP F;  1YHQ I;  5GAD J;  2ZJR F;  1QA6 A;  5DM7 F;  5GAG J;  3CCQ I;  1YJN I;  1YIJ I;  1VQM I;  3CME I;  3CCV I;  2ZJP F;  4IO9 F;  1VQL I;  3CCJ I;  2E35 A;  2OTL I;  5JVG F;  1Y39 A;  1HC8 A;  2K3F A;  3J7Z I;  3G6E I;  3G71 I;  3CD6 I;  1VQK I;  4UY8 I;  1VQ9 I;  3CJT B;  2ZJQ F;  3I56 I;  3CCE I;  2FOW A;  2QEX I;  1VQ5 I;  3CC2 I;  1MMS A;  3CCR I;  3J7Y J;  1FOW A;  3CCM I;  3CMA I;  4V19 K;  2H8W A;  5GAH J;  1YIT I;  2E34 A;  1YJW I;  1FOX A;  1VQP I;  3DLL F;  1YI2 I;  3CC4 I;  1VQ7 I;  3I55 I;  3CCU I;  3CC7 I;  3CCS I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...