1YJ9I

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1yj9I00
5JVGF 5DM6F 3G4SI 2ZJQF 3CMEI 3J7ZI 4UY8I 1YJWI 1VQNI 3CC4I 2E34A 1FOXA 1FOYA 3PIOF 1FOWA 1VQPI 1VQLI 3CCJI 2ZJPF 2OTJI 3CCSI 3CF5F 3I56I 1YI2I 3CCQI 3CC2I 3CCVI 3G6EI 2ZJRF 1VQ4I 2E35A 1YJNI 2K3FA 1S72I 1VQ6I 2QEXI 2FOWA 5GAHJ 3CJTB 1VQOI 1VQMI 1VQKI 1QA6A 4IOAF 5GADJ 3I55I 3G71I 2JQ7A 5DM7F 1MMSA 3CCUI 1YJ9I 1VQ7I 4IOCF 1VQ5I 1VQ8I 1YHQI 5GAEJ 3CMAI 2E36A 1YITI 3CCMI 3CCEI 3J7YJ 4V19K 1VQ9I 3DLLF 3CD6I 2OTLI 5GAGJ 1YIJI 2H8WA 3CCLI 1Y39A 3PIPF 3CC7I 1HC8A 4IO9F 1ACIA 3CCRI 2NXNB 2QA4I
chains in the Genus database with same CATH superfamily
4RGSA 3U1KA 2HDDA 3K0LA 5JLWA 2JA5J 2E2IJ 2LTPA 2HNHA 2RNJA 3FKJA 4LIUA 1K4TA 5DD8A 5D8KB 2GAUA 3ABLH 2NVXJ 2Y69H 1P2FA 3K9TA 2R93J 3VSLA 3ECOA 4OMYA 1WI9A 1CGPA 3EUKL 2XGEA 4AC0A 3SEQA 1U78A 3TKYA 4HPQA 2QM3A 1LDDA 3D5SC 4B3XA 3QU6A 1G8XA 3OS1A 1MH4A 2WBMA 3AG3H 2KRFA 2LKSA 3BTCA 2EB7A 1DDNA 1D0YA 4M9XA 4EM1A 3OYNA 3CC2I 1P92A 2JZYA 2HGCA 4EJWA 4UUSA 3IRRA 1LB2A 1GHCA 4PSXA 3S14J 4HF0A 1X58A 2LBFB 2EZIA 4E70A 3BG3A 3OSGA 4XKBA 3H35A 1ZRCA 3NEUA 3W2WA 4PK4A 4HF1A 1FEXA 2R7UA 1I27A 5D6FA 4EJOA 4F92B 2M1BA 3CJTB 4YFXF 2RNGA 1SVLA 4B4CA 3HSFA 1ON2A 4JX4A 1TBXA 1S8NA 4IPAA 2A5WA 1ETQA 1UELB 4ZYHA 1TQMA 4ENJA 4ZH4F 2HS5A 1MMSA 4LLLA 4ESBA 2LY1A 4M74A 3J81K 2X51A 2DDBA 1IUFA 4A3GJ 2Y2ZA 3B73A 1HKQA 2L9SA 2FF4A 2EFNA 1MMAA 2YPRA 5E3OA 2ISZA 5KNLA 2F6CA 4I98B 5BQTA 1FYMA 2K4JA 1U9NA 5D5VB 1RZ4A 3HUGA 2K85A 1UHWA 3QOEA 3FMSA 2JA8J 3GLXA 4PFPA 2YR2A 4F3QA 1Y1VJ 2AQEA 4ZDLA 3R4KA 4Q48A 3HM5A 3S2DJ 3UKGA 2P0WA 4M3GA 4OINF 2CQKA 4LG0B 3FMQA 4YFKF 3OYHA 1QVUA 2CFOA 1FOKA 2LR8A 3P5JA 5EGOA 3G1MA 3BR5A 2XF5A 1ZGWA 2PMUA 2V1UA 1RUNA 2DA3A 4DJAA 1R00A 2LNBA 1VTNC 2KQRA 1HC8A 4XN0A 2STTA 2BW3B 2E5NA 1MJBA 3WGGA 5E79C 5FFZA 3H9QA 4KISA 2HEOA 2HQ5A 3DP7A 3ZP5A 3EUAA 3DEWA 4CCOA 5JFRA 5DM6F 3W2AA 3WHCA 4Y17A 5K5OA 1FSHA 3SYTA 5FKLA 4G6QA 5D4RA 4HV5A 1MBHA 4Y7NJ 1YE9A 3LL7A 1RPWA 4A0YA 1VQPI 1SANA 2OUMA 1W7PD 1WH7A 1R22A 1IAWA 5LHIA 1OCCH 4GCVA 1F1ZA 3I53A 4PJLA 5ERIA 4IRGA 1CF7B 5HS8A 3AG4H 3N05A 1DGWY 2AO9A 4BAYA 1OYYA 3K2ZA 4KITB 2ZO4A 4HSTA 1JTYA 3VEPA 3PM1A 4E7HA 2LKXA 2V26A 3E0JB 4DW6A 3FF5A 5F0CA 2IVMA 2W84A 2OC6A 3QYEA 2QSGX 3FKIJ 4Y4RA 4MO7A 2GXAA 5CLSA 3LSJA 1MD0A 1U6GA 3HSEA 3F6VA 3R0JA 1S72I 1DUXC 5HDNA 2DFIA 2JUCA 3IRQA 2XASA 3DXJF 4E7LA 4ZZLA 1T95A 2DMNA 2KZGA 1SFUA 1TL8A 2DXIA 3GFJA 3SFIA 5LD2C 3FXRA 1AA7A 5KHDA 3I55I 3FX3A 2HQAA 5DYMA 2DPDA 1Z6TA 2F2EA 5FKNA 2JN6A 5EZGA 4BH9A 4BKXA 3Q3SA 4I0BA 1VFCA 4XRMA 1U5TA 1SAXA 1FT9A 4ZYDA 3E5XA 1JT0A 4B47A 4ZJZA 3M9AA 1WKMA 4X6AJ 3VYRB 2EPFA 2ZMEB 3VB2A 1WJDA 4ENNA 1QU3A 3I3LA 2X6OA 4A3EJ 2HQRA 2LY9A 1SC7A 4DZPA 2B63J 1ZGJA 3F8CA 2HOAA 5EEAA 2WV0A 2CO5A 4DQ2A 4QPQA 4HX8A 3NAUA 4HA8A 3I9V2 4X0GA 2VUMJ 1BR2A 1JJ6C 4BY7J 1HW1A 3OMYA 4XKCA 2V7FA 2O61A 1U0JA 2EILH 3EETA 1S7AA 3ASOH 3HUGB 1FYKA 5JLXA 1X1BA 2P4WA 1LNWA 4BGDA 3JW4A 3RQ4A 2X4HA 3QU3A 3L2UA 2QA4I 1O4XA 1MIJA 2IS6A 3RZDJ 1ETOA 2VL8A 3HPGA 3TMOA 3K70C 3AL0B 3CMYA 3S1NJ 5ICGA 4UY8I 3OSFA 2BY1A 2P5VA 1X3WB 2KP6A 2O0YA 3OOPA 2W25A 3EUHA 2LREA 1FOYA 2EZKA 3OYKA 3GLLA 1OCZH 4XM3A 5K5QA 4MIMA 4CZCA 2XROA 2DBBA 1X1DA 2VJ4A 1Y0UA 5M5WJ 3GTMJ 1KQ9A 5BOXA 5J47A 3FBIB 4XLCA 3RPUD 2EFPA 4XRSG 1FMWA 1LJ9A 1NG7A 1TWCJ 3LSGA 4YRVA 2LH9A 4I0AA 5EG0B 3V4GA 3VODA 1T33A 2RAEA 3KLOA 2DN0A 4ON0A 3MKWB 4G12A 1A5JA 2LRDA 4L0ZB 2E2JJ 1ZHFA 3LA2A 4DIQA 5C44J 1QGPA 3I54A 2VIXA 4IRHA 2FMYA 4C2MJ 3JSOA 1P7IA 1UJ8A 3RYRA 3ZQQA 1R6RA 3TGNA 5D5XB 1ZG3A 2DU9A 3KP6A 5FFXA 2R7VA 1KA8A 1P4WA 5J6XA 4XKWA 5J40A 1WJBA 3S2WA 3GTGJ 5FKMA 4BJ5C 2I8DA 2BVLA 5JHUA 5FLXK 2JA7J 1XSDA 5DUKA 2MG4A 2K4BA 3R61A 4WWCA 2DA1A 2DLLA 3FK6A 3ASNH 4EJTA 5H20A 2OZ6A 4IOCF 1FTZA 2WAFA 3F0CA 2V4JC 3GFLA 3GZ6A 2JMWA 3HOUJ 4N4NB 2JA2A 4A12A 2HYGD 3L09A 1Z21A 2IW5A 4OWRB 1MBJA 2VKEA 4JP0A 2E1OA 4R1HA 4AVPA 5FRNA 3I64A 4V2GA 3KYCB 3KLNA 3VYUB 2VB6A 2DO7A 3WTTC 2VE8A 3QYBA 4M72A 2OV7A 3JCUC 3QPLA 1LPQA 3A1YA 4IHWA 3RCOA 5LGTA 3MEXA 2UZKA 3RDIA 4HNVA 1PYVA 2HVSA 4C3HJ 4C3JJ 3HDDA 4A3IJ 3QPTA 1SFEA 1D0XA 1HSJA 2DMUA 3C1DA 4LJZF 1BJAA 2BZTA 1Z7LA 4C2UA 3GWZA 2Z16A 3H5NA 3AKZA 1OPCA 1N25A 1WJEA 1ACIA 1U2WA 4U0VA 5KK1A 5E20A 4HDUA 2W00A 3KIOA 1MZBA 1Z77A 2QQBA 2A6EF 3CLOA 4DBRA 4A2UA 1V54H 2VOOA 4BHPA 2RV8A 1K79A 4P9UA 1BOBA 2YS9A 1VQNI 3DKWA 2FD5A 3ZQFA 3L2CA 3E3VA 3V7RA 1B8IA 2ID3A 2MH2A 3BOQA 1XCBA 5HS7A 3HRTA 5LBQA 5BPIA 2HZTA 3AG1H 3QODA 4ESFA 4Q47A 2P8TA 4UNOA 4AIJA 5FB2A 3PFYA 3CCJI 3BCBA 5J3LA 3CZ6A 5E1ZB 4YIFA 3PFIA 3HRSA 2L9RA 4RAFA 5LRSA 1YI2I 3ZMDA 4CSWA 1RKTA 1V55H 2PMZN 3A02A 4UHTA 3GTLJ 4AYBN 2DTRA 2CRGA 2W24A 4HEA2 5FGMA 4G6TB 2E35A 3LAJA 3HTSB 1RNLA 2YUSA 2NNNA 1B4AA 2W1OA 1XDUA 1HSTA 4LD5A 4KN7X 1J2XA 1QHGA 1ONVA 3A01B 2QEXI 2XPVA 3DQVC 3WTVC 3OIQA 2GZWA 1PJRA 1D1AA 3E6MA 2LC2A 2ELKA 2BVMA 2VKVA 3HKZN 1YQAA 4A5MA 2H6CA 2VQCA 3HXLA 3K6GA 1V3FA 1OJLA 4I6ZA 3M8JA 4G6DA 2VT3A 1H89C 1LDKB 3QOPA 3OYCA 2JWTA 4OMZA 3ESWB 4M9SA 3TW7A 5K1YA 4PGHA 3U9GA 3OYFA 1SD4A 1T56A 5K7ZA 2ECCA 2XV4S 1G6NA 3OIPA 5HLHA 3WE3A 1LFPA 2J5PA 2FOKA 5TRDA 1RR7A 4NHJA 2KT0A 2XB5A 4JX6A 3BTJA 4LB6B 3JAMZ 1WH5A 4D5FA 3COAC 4A3BJ 1B9NA 4N0BA 2COMA 3DLAA 4M3DA 4E4HA 3OYAA 2EA4A 4KMUX 5HLIA 2MH9A 3BPVA 1XMKA 5EF6A 3CD6I 5A2QZ 1IN7A 4EMSA 5ICCA 3CUQC 1QPIA 4CYCA 3OOUA 3PO2J 1FJLA 3QQAA 1X19A 1YIJI 4CO8A 4EM0B 1IDZA 5ICEA 5K5RA 1ZLKA 3H36A 2G0EA 2XRLA 5ED4A 3F8FA 4IO9F 1IRZA 1ERDA 3CLQA 3NWSA 2KRHA 1S7EA 3LFKA 1JTXA 1KU2A 3L00A 1TT0A 5HLGA 4XLFA 2ZJQF 1TWAJ 2H1KA 3WTSC 3V8KA 1ETXA 3BG9A 2DFEA 1W5SA 4EVIA 2K3PA 3BZCA 2DW4A 5E3NA 2GWRA 4BU2A 4ANJA 1OCOH 2O6GE 1USTA 2L4MA 2K9LA 3Q0VA 1NTCA 4HX4A 2Z2SB 3BQZA 3O3KA 2R0QC 1F5TA 4KN4X 4HRIA 4F55A 5E3MA 2CQQA 2BXYA 2XUBA 1GXPA 4EGYA 1EJ9A 3ZOBA 4BE2A 1HXDA 1R5HA 1S3JA 1SMTA 1R5GA 1W36D 5AONA 1GVDA 3I4NJ 4FX0A 4OOIA 1UG2A 1YG2A 2Y0SN 2R7WA 4L18B 2K9QA 4A0ZA 2BE5F 1BI2A 1PVEA 4A3MJ 2ELHA 1USSA 3HGGA 1VQ4I 4N4OB 2UWMA 2HXOA 2EK5A 2ELJA 2LBFA 1PDNC 3ZXSA 5JI6A 2DODA 1XDSA 3C18A 5GPCA 4ASNA 4BACA 4UXNA 1VQMI 1VQKI 1XGSA 2RQPA 3LSIA 3P9CA 5L3GA 4Q4ZF 1W0TA 4L5IA 3T0YA 1Y6IA 1SAUA 1P7JA 1T39A 5E8GA 4OAZA 3WU2C 4BXFA 2OF7A 2UXXA 3S15J 1LQ1A 1HBXG 1S7OA 4EATA 2X1CA 4M71A 4BQOA 1AKHA 5LRRA 3GTQJ 4CCJA 3ZMTA 2FXAA 4D1QA 3KZYA 3ZRGA 3F21A 2H09A 2R5YB 4HF2A 1P6RA 1JUPA 3HSRA 2FSWA 4EJUA 1FMVA 4QIWN 5HOOA 2K40A 2EZHA 2JUGA 1EA3A 2KMUA 2NVTJ 5EEGA 3H1CA 1XSVA 4JK1X 2HI3A 1TQIA 3KEOA 4HLXA 3G73A 4XLNF 4LLGF 2HU9A 3CCMI 2WTEA 3BR6A 3W6JB 4IHYA 4HQMA 4RAYA 5TJJA 5F1JA 1TWFJ 3DU5A 3CTAA 2GXBA 3LSPA 1SVOA 1G3SA 5HS9A 2VE9A 1O7LA 3TP0A 2EINH 2LLKA 2VKHA 2V1XA 3ZPLA 4LG3A 2XF7A 1RI7A 2O8XA 1H8AC 4ESJA 4LG0A 1H9TA 1X1CA 2R3SA 4DYQA 3L2QA 1REPC 3I71A 3GTKJ 4YELA 5KCMA 2VPRA 3V7CA 4CH7A 3AFHA 1APLC 2MBFA 3B6CA 3HOWJ 1U3EM 4MTDA 2ACJA 2VJJA 1F9NA 2BW3A 3DTKA 3G3ZA 2ZB9A 3LQRA 4M6XA 1WGXA 3CQZJ 2X85A 4TV7A 4M6YA 5M3MJ 5IOZA 4CHUA 1JUMA 2E34A 1UAAA 2RGVA 1S9HA 3D5RC 3WTUC 3GO5A 3VFZA 4FISA 1UZCA 2QGUA 2WB1N 1BN5A 4JYKA 4BNCA 1Z3YA 1FZPB 2HDCA 2GIVA 3EQLF 1LDJA 3FBNB 1UMQA 4Z2YA 2E1NA 2MGQA 3PO3J 2ZJPF 1YTYA 4BL0B 1B1BA 3GF2A 3Q9SA 2A61A 1IRXA 3NRVA 1CF7A 4I02A 2Y48A 5CPRB 3CUOA 2DOAA 5F27A 2PFBA 3FK7A 1R5ID 4W1UA 2IS4A 5KVRA 3SXYA 1YW8A 3H3ZA 2I5UA 4HSRA 4EM2A 4I2OA 1I1SA 5C4XJ 1AOYA 4XORA 1PUFB 1VQ6I 4WX9A 5IYDJ 4RAGA 4L5EA 5FD5A 2HXIA 2QQ9A 3R60A 1ITYA 1WVRA 5GAHJ 3OIOA 3EPZA 4AIKA 4DYCA 4HDVA 2CW8A 1J9IA 3A0HC 1WRJA 4AUXA 2K9NA 4HNUA 1BI1A 2VOPA 3KFWX 5DS9A 2E1MC 3REOA 1ZK8A 2ZSIB 3CJQB 2DQRA 4XONA 3BDDA 1ZG1A 2V79A 1K4SA 5L3CA 2MC4A 4GYGA 3ERMA 2X6WA 2F48A 3PSIA 2VC1A 2QKLB 5DCMB 5BS6A 1Z91A 2ZMEA 1ZRFA 4GO1A 3F6OA 3JTGA 1AKHB 3OR2C 2ESHA 3F8BA 4L5JA 4LK0F 3UNGC 4E7KA 2WAEA 1TQPA 5J8CA 2GA1A 3FXQA 3TL4X 3JRDA 2LOOA 4ZYEA 1DP3A 3I5UA 1KU3A 1VF9A 1JE8A 2D1HA 2XAGA 2XAHA 4IVNA 2Y75A 2L3DA 4RBOA 3W3CA 3E97A 2DAOA 5CKTA 2BHZA 3QAHA 1P9QC 1ZH5A 3HOSA 5E1WA 5HNHA 1LFUP 2M2EA 1U8RA 4LIVA 1Y0NA 3T8RA 2V1DA 1YS6A 3J7ZI 5EJCA 2QQ8A 1KZHA 1LE8B 3C2HA 2R7SA 3M3YJ 2EV6A 1OCTC 3MMYB 3WG7H 1FOWA 2PMZA 3HOYJ 2FUG2 2MLKA 4AYBA 2EIJH 1FY7A 3IH2A 4HAMA 2BY2A 2IA2A 2HYFA 2XIGA 3BR3A 4XBFA 1K61A 4KIFA 2WWYA 4KDPA 4ZDOA 2MW8A 3PNTA 4L9JA 2W48A 2M7AA 2XGCA 3CCQI 2FRHA 4LGWA 2HWVA 1IJWC 2HPMA 4A0XA 3HKZA 2KHMA 3HBLA 1I50J 3FHZA 4XL9A 5EG0A 1W5CC 1WJFA 4UV9A 3WG9A 1AU7A 4A69C 3IWFA 5FD6A 3PNYA 4LB5A 3DEEA 1ODDA 2CQ7A 3BG5A 4O5VA 4KA4A 4N9IA 1EF4A 1WI3A 1ZG5A 4Z6YA 2CV1A 4RA2A 5JHFA 1BM9A 1SEUA 2QVOA 4B09A 5D5WB 2Z5UA 2G9WA 3ZMVA 4CGZA 2EFOA 1JT6A 2JQ7A 2Y0MA 3S16J 2JRMA 1L0OC 3EYIA 3BROA 4Y13A 4GFBA 2OZUA 4KIBA 1OKRA 1R1TA 1IXRC 4HG2A 2IJLA 4WXCA 2GOMA 1BA5A 1Q1VA 3GMEA 1VQ8I 4PDKA 4A3LJ 4ZDPA 2FJ1A 3FIWA 5IYBJ 2R7ZJ 2VC0A 2RC4A 1TP4A 4C30A 2XRNA 3S2HJ 3KPHA 1S6LA 5E17F 3BCAA 1NK3P 4S0HB 2VJIA 1T0FA 2R7RA 2YX4A 5GPAA 5JR3A 1IN6A 4RB1A 1Z3XA 3K1MA 2EBIA 3R6SA 3SQNA 2X1EA 4I01A 4R8HA 1O3SA 1MBKA 4OAYA 5B3SH 3BWGA 1R58A 2BBYA 3Q0UA 4L9NA 4XMYA 4P5OA 4RGRA 1G3TA 4XLHA 3RPQA 1IRFA 2AXLA 2H8WA 3ZN0A 5GTIC 4E7IA 1U9OA 2X1DA 4KYWA 3I59B 2LG4A 5D5UB 3DEUA 4BYYA 1UHSA 3HHHA 5J4VA 1IV8A 1FP1D 3OYMA 1SFKA 1K7AA 3K4MA 1FYLA 5FKKA 1S5LC 5GP9A 3KX2A 5FLMJ 3ZQ7A 2KJCA 2L7ZA 1P4XA 4HV6A 3W2VA 2HVRA 2YSRA 3K10A 2AHQA 2L7FP 2PI0A 2K27A 4ZYAA 4YEJA 2Y0SA 1UHMA 2LYCA 2M4GA 2M87A 2FA5A 2DOFA 5HDGA 2WADA 3QWLA 2L5QA 1XCVA 5EYRA 2DA7A 2DK8A 2F5VA 1QZZA 5LHGA 2I10A 3GX4X 3JRCA 4EEFG 1UFMA 2R7XA 2DK5A 1S29A 3H3UA 1Y56A 1BBYA 4GYIA 3G2BA 4KMFA 1IG7A 5HVQC 4GRIA 2X9DA 4G94A 3OS2A 4MLOA 6PAXA 2D2WA 2BYVE 1E3OC 1YJNI 3K1PA 2NVUB 3J80Z 4ENKA 3WTYC 2DA2A 2IS2A 3KE2A 1XN7A 2DA4A 3QP5A 3ZQHA 2ZXIA 3A01A 1VQOI 1OR7C 5J1UA 1BIAA 4CYDA 1O3TA 1JJ8C 4PCQA 2M30A 3LOCA 4E7SA 1IZ1A 1TW2A 4I09A 4A6EA 2BGCA 3J7AY 2E7WA 4KNYA 3PUBA 3U1DA 3DCFA 3KP7A 1I5ZA 3VSKA 2DA6A 3BZKA 4U88A 1MKMA 2W4SA 5LEKA 4DOZA 3TQNA 3SZPA 1HDPA 2CS3A 2QSHX 2GBYA 1HW2A 5DUIA 2HKOA 1SMYF 5M5YJ 1GT0C 2A68F 3ZMUA 1Y8QB 4M73A 1RIOH 1XTAA 2RKHA 4XRSA 4ZC3A 4RM2A 4NDLA 4YG2F 2Z9OA 1XPXA 2W7NA 3CCEI 4B43A 3L2WA 3IV5A 1A31A 4XSXF 2CGPA 3TW6A 4QLCU 3OL4A 3CDIA 4KUMA 3Q9VA 1KQ8A 3ZN1A 5F08A 4CXFA 2ETHA 1FWZA 1ULYA 1SFOJ 2BY3A 2AQFA 4JOMA 1YOVB 1JKPC 4L0YB 4L9VA 4UUTA 4BJTA 1IUYA 1Y39A 3ECHA 4HQEA 2PLYA 2PJRB 1R36A 1RUOA 5ILUA 2WB1A 3WTXC 1X1AA 4NQWB 2HYJA 1OLTA 5IYCJ 2E71A 1RR8C 4B48A 5CQGA 1FP2A 1T08B 3FM3A 4XIDA 2DFFA 2MYSA 3S17J 1JI8A 2MSYA 2R7OA 4WXDA 2OU2A 1HDDC 4CDGA 1QHHD 2E2HJ 2K86A 1JGGA 2ZXHA 1YRNB 4XKVA 3GYHX 1TTYA 4XN3A 1IN5A 4G7ZF 3X2QH 3FWEA 4RMNA 1EH8A 1H9GA 4DZJA 4S05A 3S1QJ 3O6BB 4HBLA 3QP6A 3L2RA 3JREA 3FXMA 3B6AA 2VQLA 1WCMJ 5EZHA 1PUEE 4PGGA 3CJRB 3ZQLA 2PJPA 2H6BA 4BY1J 2VONA 4E6KG 1FSEA 1ZARA 1V5GA 4BDYA 3GEZA 4MGRA 1BC7C 4F91B 4EGZA 5IT9K 4CICA 4UVBA 2PG4A 1LVKA 4NC6A 3ROUA 3O8HA 4W97A 1R1VA 2HOTA 1Z1DA 5L3BA 3HTUA 4FE4A 3P9IA 2KISA 1WWXA 1W1WE 1X2NA 3BG7A 3L7WA 1VZ0A 1WZ2A 3HHGA 1TC3C 2VT2A 3GFIA 3N97A 3AAFA 3K4LA 2ME0A 3BTIA 5FRMA 1IXCA 4UVCA 1BR4A 3KYLA 2JVGA 2R5YA 3Q5FA 3BPXA 3CDHA 1QVTA 5J1YA 4UVAA 9ANTA 2IPQX 4XLAA 2E36A 1JHFA 3MKYB 1X2MA 2JTVA 4PZJA 3FMRA 3RTRA 3FM5A 1D8KA 5M3FJ 1XMAA 3JTHA 5CQEA 2E1MB 1YIOA 4FCYA 2WY7Q 4PUSA 2O7OA 2V6CA 1EH7A 3JRFA 4IL6C 2VQGA 2DJIA 1ZRDA 2L7MP 5BPDA 1O57A 1MSEC 1HA8A 3E1SA 3HRMA 1Y1WJ 4OIRF 2MD0A 2O03A 1J75A 2JVHA 3VDXA 1R4NB 2L01A 3BT9A 5L3FA 3FDYA 4PJNA 5FO5A 2O3FA 5E3LA 1T98A 2NXNB 4IHVA 2DCEA 3OR1C 2PMHA 2ME6A 2EFQA 4R79A 4D0PA 2HR3A 1QZEA 4P9FA 4BBSJ 2EV5A 2IGKA 5D6EA 3OYDA 4I7HA 1H0MA 4G7OF 1I39A 4B44A 1J0RA 2Z3YA 3GCMA 4H0EA 3SEZA 1BJZA 4IF4A 1E3PA 3PSFA 2GM4A 4KJZA 4BEHB 2X0LA 1BW5A 4IRIA 3OYIA 2ZMEC 3OWTA 4OIOF 2NNYA 3TO9A 2Q2EB 1XS9A 3QPHA 1BC8C 3E5UA 1GVJA 1X3ZB 3C3WA 4B3AA 5J1RA 4MNUA 3MZ8A 4DBQA 5IPAA 1YW9A 1POGA 1G4DA 3BTLA 3CDLA 4PJMA 4NC7A 3WTZA 2MA3A 1XGNA 2AXTC 2KDOA 3GZ5A 1LEBA 2VI6A 4RB3C 3KYDB 3KP2A 1QQIA 2NS0A 3HPHA 1LFBA 2EH3A 1MBFA 4XOTA 2GA2A 4HX7A 3DTEA 1WHUA 2NRAC 1BI0A 2CG4A 4A3DJ 3EYYA 1ENHA 2Z1DA 2F5DA 1D5YA 5TISC 2ZNZA 4A3KJ 3S8PA 4Q5SF 1Z05A 4M3BA 4U87A 3A03A 1PUFA 1ZR4A 3R0AA 2TCTA 2V9KA 2IP2A 3ZR8X 4EQQA 1W36C 3LNQA 1T6SA 2H8RA 1T2KA 2ISYA 3F72A 3U2RA 2M8EA 3RPUA 2NOGA 2NVYJ 5ILVA 1W5TA 5BMZA 5DTDA 2L0KA 1FBUA 3IAM2 1TLHB 3FHNA 1Z7UA 2A5YB 2XVCA 3KCCA 4A5NA 3OYLA 1W4MA 4FTHA 3F23A 2H1LA 1OMIA 2F4IA 1Z0XA 1W7PB 4MEXF 3W6KB 4AU7A 2VXZA 3RKQA 3T1BA 4RM3A 1MSFC 5DCMA 2CV2A 1UB9A 3MFKA 1QNTA 3WHBA 2P7CB 1NK2P 2Q0OA 3KEQA 3HB9A 4DNCA 1D1CA 2HFHA 2RVCA 1R9TJ 3T5XA 5B5EC 1LEAA 3ML6A 1QO0D 3DU6A 3RIRA 5GAGJ 3I58A 4HYEA 1HKSA 4L9TA 2IAIA 1NG6A 1DQUA 4GDFA 3GTOJ 2XSDC 1XSXA 2E19A 3ABKH 3MAJA 2XHKA 3L9FA 2P7VB 5D8LB 3S1MJ 2HPIA 4CA0A 4MQ9F 1L3LA 5CVRA 2DT6A 2KIMA 2LMDA 4AVZA 1OFCX 1QRYA 3K69A 1YYVA 2KKOA 4G9YA 2V9VA 1ETKA 2F4OB 1BL0A 5A2QK 2BY0A 3IH4A 4CZZA 4XLEA 4MFEA 5K7HA 1PP8F 1CQTA 2RQQA 4Y33A 4BBRJ 2IA1A 1LE8A 2IEKA 1G59A 2MABA 3HOZJ 2Y30A 1VNDA 3MKZA 3CP8A 4XNFA 4BQNA 2VODA 4O3MA 1ETYA 2ID6A 2ZC2A 2P5KA 5LLQA 1U5TC 1D8JA 4MTEA 1V5EA 2GXGA 5IY5H 5TGTA 3DPTA 2XAFA 3LQQA 2LDUA 3SFZA 1QZYA 3J81Z 3TEDA 3LSHA 4QWQA 3I0TA 2KRCA 1I6HJ 2ZBKA 4FASD 2CUFA 1Z6RA 3V8JA 2ADUA 1XB4A 2NS7A 2FBHA 2HTSA 1ZLJA 3BQYA 3F8NA 2L9VA 4I99C 4RB2C 4IKFA 3SZTA 4IOAF 4BHCA 4U0YA 4UUVA 2IT0A 3LFUA 2LF7A 1N77A 3A2KA 3EDPA 1G3WA 3KP3A 4XR6A 3C7JA 3K1NA 2MD5A 3WU0A 3CCUI 4BJ6C 2JT1A 3HL2A 5M5XJ 2Z33A 3F9KA 1N78A 3IKTA 3DV8A 2F5FA 1SD5A 1XD7A 3TOBA 3D1NI 2F4MB 4XOPA 5CVVA 1JKOC 2OD5A 3DBHB 2L7KA 2WA0A 5EDNA 5GTHC 2R5ZB 1TT5B 2IGNA 3TDUC 1T8IA 3GXOA 2MFZA 4K2EA 3CO6C 1R49A 3EUHC 3CMMA 4ZZDA 3G1LA 4EJVA 2DJNA 5F04A 1JUSA 2IA0A 3KP4A 2CUEA 4DGWB 2KIUA 3H92A 1BOAA 1MNDA 1K78B 3JRBA 3BC8A 3WGIA 4J00A 5F64A 1BW6A 4G7HF 3BJ6A 3I59A 4KICA 2KJBA 4QSHA 1GLNA 2WAQN 2CSOA 3OL3A 4U7BA 2DYRH 4A3CJ 3PL8A 3IHUA 3G1OA 5B1BH 1HOMA 1A04A 4BQQA 1WFXA 1TNSA 2VLAA 4NBQA 3ZMSA 4CCMA 1R7JA 3OYEA 1I6XA 1LKXA 2K9SA 4RLFA 2O5RA 3MZYA 3H9GA 3CUQA 2LY2A 4RB0A 1GXQA 2EV0A 1MDMB 3ZQCA 3WU1B 3L2VA 4QTRA 3P7NA 3H0GJ 1BI3A 3GFMA 5BNGA 5IT3A 5K7FA 4F7ZA 4AIDA 1KQ0A 3H5AA 4CCNA 4M3FA 4AD9A 1YX5A 2FX0A 2ZJRF 3M1EA 4M6VA 4BDZA 3CF2A 4C2TA 5HODA 5IP6A 4XK4A 2QENA 3IC7A 5DD4A 2FQ4A 4C3IJ 1FLIA 1M1EB 2EZLA 3FXJA 5LFAA 4N9HA 3QPSA 3PUFA 3LSTA 2E7XA 2TDXA 3S3MA 5CVJA 2GOXB 2M0MA 2ZXWH 4UV8A 2HOSA 2QBYB 4KIGA 1IDYA 3FXKA 4XSZF 1T38A 2A6HF 1FBSA 2CJJA 2V9PA 3D5LA 2EWNA 2UUZA 1BIBA 1JHHA 3WGHA 3IKVA 5J4YA 3DPLC 3RJPA 5HDKA 1YJ9I 4RGXA 2K7LA 4MEYF 1FNNA 1FPQA 1HQCA 3ONQA 1B72B 2J5OA 2O8KA 3JRIA 2R7QA 3V42A 2QQAA 3S93A 3HG9A 1UCRA 5C4JJ 3FXLA 3IL2A 1TW3A 2COBA 2QWWA 1O3RA 2R92J 3LA3A 3OV8A 5DDGA 3ULQB 5JVTA 1KGSA 2XB0X 4WK8F 2ZCWA 3E6CC 1JKQC 1D3YA 3NQOA 2VBZA 1KYZA 1Q1HA 5D4SA 1FBQA 4D7MA 5IP9J 2Q8KA 4EV0A 2VBWA 3TO6A 1KU9A 4AM3A 2DMPA 5DCFA 3DKXA 4HW0A 2MC3A 2JSCA 2W82A 2VBXA 2K02A 1ETWA 1STZA 3S32A 4GGGA 2L4AA 2D1VA 2P6SA 3B02A 4QPOA 2DTZA 4LK1F 1WSUA 2PJRA 3H5RA 4AWXB 3OS0A 2CW7A 1Y8RB 1P4AA 3RKWA 4BS9A 1ZAOA 1KYWA 2CH0A 3MZHA 4KFCA 1YLFA 3GUDA 3K7AJ 4NQWA 2JRTA 3CCYA 1YJWI 1D5VA 1A36A 1JKRC 3VYSB 2NOJB 1RKWA 2ICWG 2X6XA 2LSOA 2KPMA 3RI4A 3V8LA 1D0ZA 4C9YA 1HCRA 1ZKGA 3GW2A 4E7JA 1X1PA 2QZ8A 1MMDA 5L3EA 4NB5A 2KLOA 2XAJA 1RETA 4WF2A 1E2XA 2LKPA 4LITA 2FE3A 3HRUA 2W57A 4OIPF 4UUSB 2FNPA 3Q0WA 3F22A 4B1RA 1I3QJ 2DI3A 2NYXA 3K4JA 1R23A 1IO2A 5LGUA 1YRNA 2XKOA 4XRFA 2E1CA 3K4CA 2XKPA 5LHHA 1ZTRA 2BHYA 1BR1A 1FX7A 3K4BA 3CCVI 5FLXZ 2PX9A 1HF0A 1C0WA 4IHXA 3H3VK 1DU6A 3G6EI 2UV1A 4BUPA 1LUJB 3E7LA 3CUQB 1ZYRF 2FU4A 3OY9A 4J19A 2CW0F 4IJAA 2PQ8A 2IRFG 2K3FA 1SD6A 2DYSH 4UB8C 2OCEA 1IC8A 2IBDA 2M34A 2ECBA 5FROA 3TBIA 3MD2A 3DWLE 4IHSA 2TRTA 1FIAA 2IXSA 3K2AA 2VPLA 2H27A 1MMGA 4XICA 1KONA 4BHBA 2LD5A 4ZTJA 2V6EA 2L9NA 3DTIA 3JRHA 2K5CA 4ABZA 5DM7F 3ZCOA 2GIZA 2CYYA 3BR2A 5C3EJ 1XX5A 4XLPF 2ZKZA 3HOXJ 2EIMH 2HQNA 1VQ7I 4BE0A 3LA7A 5FJ8J 4IZZA 2A69F 2CQNA 1SFXA 2FQ3A 3LSKA 5F0FA 3CO7C 2MLGA 1D1BA 3A0BC 2HTJA 2CFXA 1EKEA 3D0SA 5CVUA 3PNVA 5F1RA 2BV6A 1GDTA 2NVQJ 2LP0A 2L54A 1WJCA 2CQXA 2DPUA 2ZFWA 2Q1ZB 2M9HA 4Y15A 1B9MA 2STWA 2HKXA 4G8XA 3J7YJ 1SVMA 1F43A 2BOLA 4MFDA 2E5ZA 2CUZA 2RDPA 1W0UA 3O8GA 3K70D 1IXSB 5EGOB 2QCOA 4JX5A 3FISA 3MCZA 1FIPA 3WTWC 4RS8A 3L1PA 1MW7A 2RN7A 1KU7A 3V7SA 4JQFA 2N8GA 5CYVA 5AIQA 3KEYA 1G3YA 4YIRX 4YFNF 5B1AH 3OYJA 3CCLI 2DDAA 3F8MA 3SDBA 4BQAA 1IN8A 5ICFA 4CUGA 3LWFA 5IT9Z 1J5YA 2UXNA 4NNJA 3HZJA 1ON1A 4FETA 3WODF 2DT7B 4B8XA 4IHTA 2W85A 3ZMZA 2R7DA 3G4SI 4A93J 3HOTA 4II2A 4LFUA 3QRFF 3NARA 4BE1A 1AHDP 3M8FA 1Z9CA 1OYIA 1XG1A 1WQ2A 2X48A 4D7NA 3VYTB 4FE7A 4II3A 3LAPA 2XF6A 1YO5C 4KT6A 4HLYA 4BEHA 4OIQF 4LMYA 2QUFA 2XAQA 2ZNYA 5LEJA 3FZVA 3JRAA 2Q2EA 2JJ7A 2M4KA 1X4PA 5EEHA 4ETSA 4RLQA 1QPMA 3HIFA 5HNFA 2XSJC 4U0WA 2YU9J 4M3EA 2R7FA 4DYRA 1PP7U 1X3UA 2BXZA 1YW7A 1I3AA 2B7EA 3BJAA 4PFOA 1A35A 4RGUA 1MJ9A 2Y9ZA 1EH6A 2FOWA 1NH3A 2XPWA 2NS8A 2QSFX 4F93B 2A6TA 2L2OA 2DT5A 3BLYA 3DKYA 5KAFC 2X6YA 2FBKA 1QA6A 3WE2A 5GADJ 3IH3A 5E8IA 1J09A 1DGRM 2ZFUA 1NHAA 1U5TB 3O2PE 3U21A 3C2GA 1ZR2A 1GV5A 1HKTA 1JGSA 3JR9A 4E7ZA 2EJRA 1GUUA 1I1GA 1VQ5I 3DBRB 3GVAA 2EIKH 3HJEA 1QBJA 3J80K 2WY8Q 1V5FA 3KZZA 1YHQI 2O9LA 4FQGA 1WPKA 3DFGA 2QF7A 3CMAI 2JSPA 2JA6J 1IRGA 4V2FA 1YITI 1W7PA 1IW7F 3CP2A 3ELKA 1FC3A 2XPUA 4P55A 3SHFA 1IF1A 3RZOJ 1R1UA 3RKYA 4V19K 2IGMA 3BR0A 3DLLF 1ZREA 1J7KA 2A05A 3E5QA 3TP3A 5FLVA 1DPRA 1F36A 2IGOA 2CWEA 2WAQA 2C6YA 2KIQA 1E3HA 2XC7A 5KAIC 1MMNA 3CESA 2EFWA 3FXUA 3VOEA 3HYIA 3MVPA 3CCRI 3ZGKA 1ORKA 5F0HA 4H4KC 4YIIA 3SZGA 2R7TA 3ISPA 3IP4B 3KETA 4J01A 5JVGF 4Y3OA 2XGDA 2LFBA 5DEQA 4AIHA 3HOVJ 2OQRA 4IX7A 2DQLA 3TO7A 1XGOA 2XAUA 2HOEA 4NC8A 2VBYA 4FX4A 2L02A 2ZSHB 3E6DA 5J8FA 3S3OA 5DV5A 5AIPA 1ZQ3P 1XC5A 3N4MA 3ZQIA 3VWBA 3PJRA 1B59A 3BY6A 1SD7A 5CJ9A 1ETVA 2PBIA 2KIFA 2EA2A 3CCSI 2G7UA 3CF5F 4LLNA 2VJ5A 2DMTA 3QYFA 2CV0A 3RKXA 1HW5A 4IQJA 3LSRA 1OYWA 2FEZA 2XDVA 2B0LA 3DF8A 1IV6A 5H2FC 1R4MB 4X1EA 3JSPA 1MGTA 3M4OJ 1EV7A 1TNTA 1YS7A 4LOCA 4WCGA 4KT5C 2RREA 2DMQA 2VKDA 5E18F 1RRJA 2DOEA 3M7GA 2JK3A 2F5EA 5B66C 1O7FA 4D9JA 2P5LC 2ZXJA 5LGNA 2M8GX 3OYBA 1R71A 3BR1A 2P81A 1U8BA 3M8EA 3DBLB 2HZDA 3PQKA 4IQ4A 3S1RJ 1YX3A 2LK2A 2OCCH 3HEFA 3J7AO 2WV1A 1MH3A 2M45A 1DP7P 5ILSA 4HNTA 3SDGA 2VQHA 3RQIA 2D5VA 4ITVA 3TOAA 4F52A 1K6YA 2R4GA 3MWMA 4ZTFA 3C2BA 1OISA 2JPCA 5FKOA 3CJNA 2DA5A 3E6BA 4A6DA 3RSNA 3NWTA 5L3DA 1OR7A 2ZJ2A 1IGNA 4CCLA 3GTPJ 3AL0C 1H88C 2DFHA 1VQ9I 1G2HA 2R5ZA 2KL4A 4IEJA 4ENMA 3KZIC 2OQGA 4PJ0C 4MQVA 2OTLI 5H6QA 5F6FA 1N75A 1VI0A 2KZVA 2QLZA 1V4RA 1MNEA 3GBGA 3H9JA 2KDZA 1Z67A 2QKMB 2B9SA 1X4OA 3PIPF 3A4CA 1ZGAA 3CC7I 2M0CA 1RC9A 3MQ0A 3UR3C 1F4KA 2P6TA 1ZELA 2FBIA 2IS1A 2CMPA 3ABMH 4CCKA 3K4KA 3JRGA 1K78A 1A6IA 2VXDA 3LSMA 4U7DA 3SJMA 4RAZA 1OCRH 5HLTA 2BEOA 1MBEA 3HGYA 3BP8A 1B8IB 3CMEI 2A3SA 3ABUA 3S3NA 3CC4I 1IN4A 2OPTA 2FMLA 1FOXA 1MJAA 1WJAA 3PIOF 3PQJA 2M7BA 3I4MJ 4OU0A 1VQLI 2KFDA 3BZ6A 3OYGA 1ZN2A 3TDZC 2PEXA 4BXUA 4A3FJ 1YFHA 3P9KA 2CUJA 3JAMK 1MDMA 2OTJI 3VPRA 2ESNA 2F5CA 3I56I 1K6OA 3GTJJ 1UG0A 4JBAA 2AS5F 3W6VA 2OA4A 4S04A 1K83J 2FNAA 5E1XA 2OAZA 2VN2A 4PJJA 1JXSA 3BG6A 1TWGJ 3T8TA 2Z99A 3ERED 4P96A 4D5CA 4XQFA 1OCPA 2WC2A 2M5WA 2JPBA 3LMMA 4MHGA 1A6QA 3AG2H 2OJED 1DU0A 1T0FC 4PSWA 4IXAA 2A07F 3G71I 2V1NA 1E17A 3RYPA 1FTTA 4Y52J 4P1WA 3KP5A 4I76A 4M9ZA 5IP7J 2D45A 4ZYGA 2QBYA 3H0DA 1RESA 2YU3A 3BJOA 1XGMA 3K4NA 2PN6A 2Y31A 4NUBA 2EQRA 2LVSA 3FXOA 2HVQA 4FHTA 2GQQA 2Y9YA 4BXXJ 4HZFA 2K9MA 3MKLA 1B72A 1WJ5A 3DPUA 1LVAA 5GAEJ 4FT8A 2G7HA 3I4PA 5H6RA 1HLVA 4O6JA 2M3AA 4WXHA 2LF8A 1DPUA 4RDUA 1GV2A 1OQYA 1XMXA 1MBGA 2E60A 2VASA 1TZLA 2H94A 4CYCB 1B6AA 1J59A 1MNMC 3IUOA 2GLOA 2CU7A 2OBPA 3M07A 2YX7A 4UB6C 2NAZA 5CVIA 1O3QA 3F3XA 3ZQGA 3M1CA 2QYOA 4HOBA 1TWHJ 3ABTA 3IWZA 3HC7A 3IAS2 2HDWA 4GXOA 4A3JJ 1E0EA 1AWCA 3MN2A 2XGXA 5IOYA 3GZNB
chains in the Genus database with same CATH topology
5JVGF 5DM6F 3G4SI 2ZJQF 3CMEI 3J7ZI 4UY8I 1YJWI 1VQNI 3CC4I 2E34A 1FOXA 1FOYA 3PIOF 1FOWA 1VQPI 1VQLI 3CCJI 2ZJPF 2OTJI 3CCSI 3CF5F 3I56I 1YI2I 3CCQI 3CC2I 3CCVI 3G6EI 2ZJRF 1VQ4I 2E35A 1YJNI 2K3FA 1S72I 1VQ6I 2QEXI 2FOWA 5GAHJ 3CJTB 1VQOI 1VQMI 1VQKI 1QA6A 4IOAF 5GADJ 3I55I 3G71I 2JQ7A 5DM7F 1MMSA 3CCUI 1YJ9I 1VQ7I 4IOCF 1VQ5I 1VQ8I 1YHQI 5GAEJ 3CMAI 2E36A 1YITI 3CCMI 3CCEI 3J7YJ 4V19K 1VQ9I 3DLLF 3CD6I 2OTLI 5GAGJ 1YIJI 2H8WA 3CCLI 1Y39A 3PIPF 3CC7I 1HC8A 4IO9F 1ACIA 3CCRI 2NXNB 2QA4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JVG F;  5DM6 F;  3G4S I;  2ZJQ F;  3CME I;  3J7Z I;  4UY8 I;  1YJW I;  1VQN I;  3CC4 I;  2E34 A;  1FOX A;  1FOY A;  3PIO F;  1FOW A;  1VQP I;  1VQL I;  3CCJ I;  2ZJP F;  2OTJ I;  3CCS I;  3CF5 F;  3I56 I;  1YI2 I;  3CCQ I;  3CC2 I;  3CCV I;  3G6E I;  2ZJR F;  1VQ4 I;  2E35 A;  1YJN I;  2K3F A;  1S72 I;  1VQ6 I;  2QEX I;  2FOW A;  5GAH J;  3CJT B;  1VQO I;  1VQM I;  1VQK I;  1QA6 A;  4IOA F;  5GAD J;  3I55 I;  3G71 I;  2JQ7 A;  5DM7 F;  1MMS A;  3CCU I;  1YJ9 I;  1VQ7 I;  4IOC F;  1VQ5 I;  1VQ8 I;  1YHQ I;  5GAE J;  3CMA I;  2E36 A;  1YIT I;  3CCM I;  3CCE I;  3J7Y J;  4V19 K;  1VQ9 I;  3DLL F;  3CD6 I;  2OTL I;  5GAG J;  1YIJ I;  2H8W A;  3CCL I;  1Y39 A;  3PIP F;  3CC7 I;  1HC8 A;  4IO9 F;  1ACI A;  3CCR I;  2NXN B;  2QA4 I; 
#chains in the Genus database with same CATH topology
 4RGS A;  3U1K A;  2HDD A;  3K0L A;  5JLW A;  2JA5 J;  2E2I J;  2LTP A;  2HNH A;  2RNJ A;  3FKJ A;  4LIU A;  1K4T A;  5DD8 A;  5D8K B;  2GAU A;  3ABL H;  2NVX J;  2Y69 H;  1P2F A;  3K9T A;  2R93 J;  3VSL A;  3ECO A;  4OMY A;  1WI9 A;  1CGP A;  3EUK L;  2XGE A;  4AC0 A;  3SEQ A;  1U78 A;  3TKY A;  4HPQ A;  2QM3 A;  1LDD A;  3D5S C;  4B3X A;  3QU6 A;  1G8X A;  3OS1 A;  1MH4 A;  2WBM A;  3AG3 H;  2KRF A;  2LKS A;  3BTC A;  2EB7 A;  1DDN A;  1D0Y A;  4M9X A;  4EM1 A;  3OYN A;  3CC2 I;  1P92 A;  2JZY A;  2HGC A;  4EJW A;  4UUS A;  3IRR A;  1LB2 A;  1GHC A;  4PSX A;  3S14 J;  4HF0 A;  1X58 A;  2LBF B;  2EZI A;  4E70 A;  3BG3 A;  3OSG A;  4XKB A;  3H35 A;  1ZRC A;  3NEU A;  3W2W A;  4PK4 A;  4HF1 A;  1FEX A;  2R7U A;  1I27 A;  5D6F A;  4EJO A;  4F92 B;  2M1B A;  3CJT B;  4YFX F;  2RNG A;  1SVL A;  4B4C A;  3HSF A;  1ON2 A;  4JX4 A;  1TBX A;  1S8N A;  4IPA A;  2A5W A;  1ETQ A;  1UEL B;  4ZYH A;  1TQM A;  4ENJ A;  4ZH4 F;  2HS5 A;  1MMS A;  4LLL A;  4ESB A;  2LY1 A;  4M74 A;  3J81 K;  2X51 A;  2DDB A;  1IUF A;  4A3G J;  2Y2Z A;  3B73 A;  1HKQ A;  2L9S A;  2FF4 A;  2EFN A;  1MMA A;  2YPR A;  5E3O A;  2ISZ A;  5KNL A;  2F6C A;  4I98 B;  5BQT A;  1FYM A;  2K4J A;  1U9N A;  5D5V B;  1RZ4 A;  3HUG A;  2K85 A;  1UHW A;  3QOE A;  3FMS A;  2JA8 J;  3GLX A;  4PFP A;  2YR2 A;  4F3Q A;  1Y1V J;  2AQE A;  4ZDL A;  3R4K A;  4Q48 A;  3HM5 A;  3S2D J;  3UKG A;  2P0W A;  4M3G A;  4OIN F;  2CQK A;  4LG0 B;  3FMQ A;  4YFK F;  3OYH A;  1QVU A;  2CFO A;  1FOK A;  2LR8 A;  3P5J A;  5EGO A;  3G1M A;  3BR5 A;  2XF5 A;  1ZGW A;  2PMU A;  2V1U A;  1RUN A;  2DA3 A;  4DJA A;  1R00 A;  2LNB A;  1VTN C;  2KQR A;  1HC8 A;  4XN0 A;  2STT A;  2BW3 B;  2E5N A;  1MJB A;  3WGG A;  5E79 C;  5FFZ A;  3H9Q A;  4KIS A;  2HEO A;  2HQ5 A;  3DP7 A;  3ZP5 A;  3EUA A;  3DEW A;  4CCO A;  5JFR A;  5DM6 F;  3W2A A;  3WHC A;  4Y17 A;  5K5O A;  1FSH A;  3SYT A;  5FKL A;  4G6Q A;  5D4R A;  4HV5 A;  1MBH A;  4Y7N J;  1YE9 A;  3LL7 A;  1RPW A;  4A0Y A;  1VQP I;  1SAN A;  2OUM A;  1W7P D;  1WH7 A;  1R22 A;  1IAW A;  5LHI A;  1OCC H;  4GCV A;  1F1Z A;  3I53 A;  4PJL A;  5ERI A;  4IRG A;  1CF7 B;  5HS8 A;  3AG4 H;  3N05 A;  1DGW Y;  2AO9 A;  4BAY A;  1OYY A;  3K2Z A;  4KIT B;  2ZO4 A;  4HST A;  1JTY A;  3VEP A;  3PM1 A;  4E7H A;  2LKX A;  2V26 A;  3E0J B;  4DW6 A;  3FF5 A;  5F0C A;  2IVM A;  2W84 A;  2OC6 A;  3QYE A;  2QSG X;  3FKI J;  4Y4R A;  4MO7 A;  2GXA A;  5CLS A;  3LSJ A;  1MD0 A;  1U6G A;  3HSE A;  3F6V A;  3R0J A;  1S72 I;  1DUX C;  5HDN A;  2DFI A;  2JUC A;  3IRQ A;  2XAS A;  3DXJ F;  4E7L A;  4ZZL A;  1T95 A;  2DMN A;  2KZG A;  1SFU A;  1TL8 A;  2DXI A;  3GFJ A;  3SFI A;  5LD2 C;  3FXR A;  1AA7 A;  5KHD A;  3I55 I;  3FX3 A;  2HQA A;  5DYM A;  2DPD A;  1Z6T A;  2F2E A;  5FKN A;  2JN6 A;  5EZG A;  4BH9 A;  4BKX A;  3Q3S A;  4I0B A;  1VFC A;  4XRM A;  1U5T A;  1SAX A;  1FT9 A;  4ZYD A;  3E5X A;  1JT0 A;  4B47 A;  4ZJZ A;  3M9A A;  1WKM A;  4X6A J;  3VYR B;  2EPF A;  2ZME B;  3VB2 A;  1WJD A;  4ENN A;  1QU3 A;  3I3L A;  2X6O A;  4A3E J;  2HQR A;  2LY9 A;  1SC7 A;  4DZP A;  2B63 J;  1ZGJ A;  3F8C A;  2HOA A;  5EEA A;  2WV0 A;  2CO5 A;  4DQ2 A;  4QPQ A;  4HX8 A;  3NAU A;  4HA8 A;  3I9V 2;  4X0G A;  2VUM J;  1BR2 A;  1JJ6 C;  4BY7 J;  1HW1 A;  3OMY A;  4XKC A;  2V7F A;  2O61 A;  1U0J A;  2EIL H;  3EET A;  1S7A A;  3ASO H;  3HUG B;  1FYK A;  5JLX A;  1X1B A;  2P4W A;  1LNW A;  4BGD A;  3JW4 A;  3RQ4 A;  2X4H A;  3QU3 A;  3L2U A;  2QA4 I;  1O4X A;  1MIJ A;  2IS6 A;  3RZD J;  1ETO A;  2VL8 A;  3HPG A;  3TMO A;  3K70 C;  3AL0 B;  3CMY A;  3S1N J;  5ICG A;  4UY8 I;  3OSF A;  2BY1 A;  2P5V A;  1X3W B;  2KP6 A;  2O0Y A;  3OOP A;  2W25 A;  3EUH A;  2LRE A;  1FOY A;  2EZK A;  3OYK A;  3GLL A;  1OCZ H;  4XM3 A;  5K5Q A;  4MIM A;  4CZC A;  2XRO A;  2DBB A;  1X1D A;  2VJ4 A;  1Y0U A;  5M5W J;  3GTM J;  1KQ9 A;  5BOX A;  5J47 A;  3FBI B;  4XLC A;  3RPU D;  2EFP A;  4XRS G;  1FMW A;  1LJ9 A;  1NG7 A;  1TWC J;  3LSG A;  4YRV A;  2LH9 A;  4I0A A;  5EG0 B;  3V4G A;  3VOD A;  1T33 A;  2RAE A;  3KLO A;  2DN0 A;  4ON0 A;  3MKW B;  4G12 A;  1A5J A;  2LRD A;  4L0Z B;  2E2J J;  1ZHF A;  3LA2 A;  4DIQ A;  5C44 J;  1QGP A;  3I54 A;  2VIX A;  4IRH A;  2FMY A;  4C2M J;  3JSO A;  1P7I A;  1UJ8 A;  3RYR A;  3ZQQ A;  1R6R A;  3TGN A;  5D5X B;  1ZG3 A;  2DU9 A;  3KP6 A;  5FFX A;  2R7V A;  1KA8 A;  1P4W A;  5J6X A;  4XKW A;  5J40 A;  1WJB A;  3S2W A;  3GTG J;  5FKM A;  4BJ5 C;  2I8D A;  2BVL A;  5JHU A;  5FLX K;  2JA7 J;  1XSD A;  5DUK A;  2MG4 A;  2K4B A;  3R61 A;  4WWC A;  2DA1 A;  2DLL A;  3FK6 A;  3ASN H;  4EJT A;  5H20 A;  2OZ6 A;  4IOC F;  1FTZ A;  2WAF A;  3F0C A;  2V4J C;  3GFL A;  3GZ6 A;  2JMW A;  3HOU J;  4N4N B;  2JA2 A;  4A12 A;  2HYG D;  3L09 A;  1Z21 A;  2IW5 A;  4OWR B;  1MBJ A;  2VKE A;  4JP0 A;  2E1O A;  4R1H A;  4AVP A;  5FRN A;  3I64 A;  4V2G A;  3KYC B;  3KLN A;  3VYU B;  2VB6 A;  2DO7 A;  3WTT C;  2VE8 A;  3QYB A;  4M72 A;  2OV7 A;  3JCU C;  3QPL A;  1LPQ A;  3A1Y A;  4IHW A;  3RCO A;  5LGT A;  3MEX A;  2UZK A;  3RDI A;  4HNV A;  1PYV A;  2HVS A;  4C3H J;  4C3J J;  3HDD A;  4A3I J;  3QPT A;  1SFE A;  1D0X A;  1HSJ A;  2DMU A;  3C1D A;  4LJZ F;  1BJA A;  2BZT A;  1Z7L A;  4C2U A;  3GWZ A;  2Z16 A;  3H5N A;  3AKZ A;  1OPC A;  1N25 A;  1WJE A;  1ACI A;  1U2W A;  4U0V A;  5KK1 A;  5E20 A;  4HDU A;  2W00 A;  3KIO A;  1MZB A;  1Z77 A;  2QQB A;  2A6E F;  3CLO A;  4DBR A;  4A2U A;  1V54 H;  2VOO A;  4BHP A;  2RV8 A;  1K79 A;  4P9U A;  1BOB A;  2YS9 A;  1VQN I;  3DKW A;  2FD5 A;  3ZQF A;  3L2C A;  3E3V A;  3V7R A;  1B8I A;  2ID3 A;  2MH2 A;  3BOQ A;  1XCB A;  5HS7 A;  3HRT A;  5LBQ A;  5BPI A;  2HZT A;  3AG1 H;  3QOD A;  4ESF A;  4Q47 A;  2P8T A;  4UNO A;  4AIJ A;  5FB2 A;  3PFY A;  3CCJ I;  3BCB A;  5J3L A;  3CZ6 A;  5E1Z B;  4YIF A;  3PFI A;  3HRS A;  2L9R A;  4RAF A;  5LRS A;  1YI2 I;  3ZMD A;  4CSW A;  1RKT A;  1V55 H;  2PMZ N;  3A02 A;  4UHT A;  3GTL J;  4AYB N;  2DTR A;  2CRG A;  2W24 A;  4HEA 2;  5FGM A;  4G6T B;  2E35 A;  3LAJ A;  3HTS B;  1RNL A;  2YUS A;  2NNN A;  1B4A A;  2W1O A;  1XDU A;  1HST A;  4LD5 A;  4KN7 X;  1J2X A;  1QHG A;  1ONV A;  3A01 B;  2QEX I;  2XPV A;  3DQV C;  3WTV C;  3OIQ A;  2GZW A;  1PJR A;  1D1A A;  3E6M A;  2LC2 A;  2ELK A;  2BVM A;  2VKV A;  3HKZ N;  1YQA A;  4A5M A;  2H6C A;  2VQC A;  3HXL A;  3K6G A;  1V3F A;  1OJL A;  4I6Z A;  3M8J A;  4G6D A;  2VT3 A;  1H89 C;  1LDK B;  3QOP A;  3OYC A;  2JWT A;  4OMZ A;  3ESW B;  4M9S A;  3TW7 A;  5K1Y A;  4PGH A;  3U9G A;  3OYF A;  1SD4 A;  1T56 A;  5K7Z A;  2ECC A;  2XV4 S;  1G6N A;  3OIP A;  5HLH A;  3WE3 A;  1LFP A;  2J5P A;  2FOK A;  5TRD A;  1RR7 A;  4NHJ A;  2KT0 A;  2XB5 A;  4JX6 A;  3BTJ A;  4LB6 B;  3JAM Z;  1WH5 A;  4D5F A;  3COA C;  4A3B J;  1B9N A;  4N0B A;  2COM A;  3DLA A;  4M3D A;  4E4H A;  3OYA A;  2EA4 A;  4KMU X;  5HLI A;  2MH9 A;  3BPV A;  1XMK A;  5EF6 A;  3CD6 I;  5A2Q Z;  1IN7 A;  4EMS A;  5ICC A;  3CUQ C;  1QPI A;  4CYC A;  3OOU A;  3PO2 J;  1FJL A;  3QQA A;  1X19 A;  1YIJ I;  4CO8 A;  4EM0 B;  1IDZ A;  5ICE A;  5K5R A;  1ZLK A;  3H36 A;  2G0E A;  2XRL A;  5ED4 A;  3F8F A;  4IO9 F;  1IRZ A;  1ERD A;  3CLQ A;  3NWS A;  2KRH A;  1S7E A;  3LFK A;  1JTX A;  1KU2 A;  3L00 A;  1TT0 A;  5HLG A;  4XLF A;  2ZJQ F;  1TWA J;  2H1K A;  3WTS C;  3V8K A;  1ETX A;  3BG9 A;  2DFE A;  1W5S A;  4EVI A;  2K3P A;  3BZC A;  2DW4 A;  5E3N A;  2GWR A;  4BU2 A;  4ANJ A;  1OCO H;  2O6G E;  1UST A;  2L4M A;  2K9L A;  3Q0V A;  1NTC A;  4HX4 A;  2Z2S B;  3BQZ A;  3O3K A;  2R0Q C;  1F5T A;  4KN4 X;  4HRI A;  4F55 A;  5E3M A;  2CQQ A;  2BXY A;  2XUB A;  1GXP A;  4EGY A;  1EJ9 A;  3ZOB A;  4BE2 A;  1HXD A;  1R5H A;  1S3J A;  1SMT A;  1R5G A;  1W36 D;  5AON A;  1GVD A;  3I4N J;  4FX0 A;  4OOI A;  1UG2 A;  1YG2 A;  2Y0S N;  2R7W A;  4L18 B;  2K9Q A;  4A0Z A;  2BE5 F;  1BI2 A;  1PVE A;  4A3M J;  2ELH A;  1USS A;  3HGG A;  1VQ4 I;  4N4O B;  2UWM A;  2HXO A;  2EK5 A;  2ELJ A;  2LBF A;  1PDN C;  3ZXS A;  5JI6 A;  2DOD A;  1XDS A;  3C18 A;  5GPC A;  4ASN A;  4BAC A;  4UXN A;  1VQM I;  1VQK I;  1XGS A;  2RQP A;  3LSI A;  3P9C A;  5L3G A;  4Q4Z F;  1W0T A;  4L5I A;  3T0Y A;  1Y6I A;  1SAU A;  1P7J A;  1T39 A;  5E8G A;  4OAZ A;  3WU2 C;  4BXF A;  2OF7 A;  2UXX A;  3S15 J;  1LQ1 A;  1HBX G;  1S7O A;  4EAT A;  2X1C A;  4M71 A;  4BQO A;  1AKH A;  5LRR A;  3GTQ J;  4CCJ A;  3ZMT A;  2FXA A;  4D1Q A;  3KZY A;  3ZRG A;  3F21 A;  2H09 A;  2R5Y B;  4HF2 A;  1P6R A;  1JUP A;  3HSR A;  2FSW A;  4EJU A;  1FMV A;  4QIW N;  5HOO A;  2K40 A;  2EZH A;  2JUG A;  1EA3 A;  2KMU A;  2NVT J;  5EEG A;  3H1C A;  1XSV A;  4JK1 X;  2HI3 A;  1TQI A;  3KEO A;  4HLX A;  3G73 A;  4XLN F;  4LLG F;  2HU9 A;  3CCM I;  2WTE A;  3BR6 A;  3W6J B;  4IHY A;  4HQM A;  4RAY A;  5TJJ A;  5F1J A;  1TWF J;  3DU5 A;  3CTA A;  2GXB A;  3LSP A;  1SVO A;  1G3S A;  5HS9 A;  2VE9 A;  1O7L A;  3TP0 A;  2EIN H;  2LLK A;  2VKH A;  2V1X A;  3ZPL A;  4LG3 A;  2XF7 A;  1RI7 A;  2O8X A;  1H8A C;  4ESJ A;  4LG0 A;  1H9T A;  1X1C A;  2R3S A;  4DYQ A;  3L2Q A;  1REP C;  3I71 A;  3GTK J;  4YEL A;  5KCM A;  2VPR A;  3V7C A;  4CH7 A;  3AFH A;  1APL C;  2MBF A;  3B6C A;  3HOW J;  1U3E M;  4MTD A;  2ACJ A;  2VJJ A;  1F9N A;  2BW3 A;  3DTK A;  3G3Z A;  2ZB9 A;  3LQR A;  4M6X A;  1WGX A;  3CQZ J;  2X85 A;  4TV7 A;  4M6Y A;  5M3M J;  5IOZ A;  4CHU A;  1JUM A;  2E34 A;  1UAA A;  2RGV A;  1S9H A;  3D5R C;  3WTU C;  3GO5 A;  3VFZ A;  4FIS A;  1UZC A;  2QGU A;  2WB1 N;  1BN5 A;  4JYK A;  4BNC A;  1Z3Y A;  1FZP B;  2HDC A;  2GIV A;  3EQL F;  1LDJ A;  3FBN B;  1UMQ A;  4Z2Y A;  2E1N A;  2MGQ A;  3PO3 J;  2ZJP F;  1YTY A;  4BL0 B;  1B1B A;  3GF2 A;  3Q9S A;  2A61 A;  1IRX A;  3NRV A;  1CF7 A;  4I02 A;  2Y48 A;  5CPR B;  3CUO A;  2DOA A;  5F27 A;  2PFB A;  3FK7 A;  1R5I D;  4W1U A;  2IS4 A;  5KVR A;  3SXY A;  1YW8 A;  3H3Z A;  2I5U A;  4HSR A;  4EM2 A;  4I2O A;  1I1S A;  5C4X J;  1AOY A;  4XOR A;  1PUF B;  1VQ6 I;  4WX9 A;  5IYD J;  4RAG A;  4L5E A;  5FD5 A;  2HXI A;  2QQ9 A;  3R60 A;  1ITY A;  1WVR A;  5GAH J;  3OIO A;  3EPZ A;  4AIK A;  4DYC A;  4HDV A;  2CW8 A;  1J9I A;  3A0H C;  1WRJ A;  4AUX A;  2K9N A;  4HNU A;  1BI1 A;  2VOP A;  3KFW X;  5DS9 A;  2E1M C;  3REO A;  1ZK8 A;  2ZSI B;  3CJQ B;  2DQR A;  4XON A;  3BDD A;  1ZG1 A;  2V79 A;  1K4S A;  5L3C A;  2MC4 A;  4GYG A;  3ERM A;  2X6W A;  2F48 A;  3PSI A;  2VC1 A;  2QKL B;  5DCM B;  5BS6 A;  1Z91 A;  2ZME A;  1ZRF A;  4GO1 A;  3F6O A;  3JTG A;  1AKH B;  3OR2 C;  2ESH A;  3F8B A;  4L5J A;  4LK0 F;  3UNG C;  4E7K A;  2WAE A;  1TQP A;  5J8C A;  2GA1 A;  3FXQ A;  3TL4 X;  3JRD A;  2LOO A;  4ZYE A;  1DP3 A;  3I5U A;  1KU3 A;  1VF9 A;  1JE8 A;  2D1H A;  2XAG A;  2XAH A;  4IVN A;  2Y75 A;  2L3D A;  4RBO A;  3W3C A;  3E97 A;  2DAO A;  5CKT A;  2BHZ A;  3QAH A;  1P9Q C;  1ZH5 A;  3HOS A;  5E1W A;  5HNH A;  1LFU P;  2M2E A;  1U8R A;  4LIV A;  1Y0N A;  3T8R A;  2V1D A;  1YS6 A;  3J7Z I;  5EJC A;  2QQ8 A;  1KZH A;  1LE8 B;  3C2H A;  2R7S A;  3M3Y J;  2EV6 A;  1OCT C;  3MMY B;  3WG7 H;  1FOW A;  2PMZ A;  3HOY J;  2FUG 2;  2MLK A;  4AYB A;  2EIJ H;  1FY7 A;  3IH2 A;  4HAM A;  2BY2 A;  2IA2 A;  2HYF A;  2XIG A;  3BR3 A;  4XBF A;  1K61 A;  4KIF A;  2WWY A;  4KDP A;  4ZDO A;  2MW8 A;  3PNT A;  4L9J A;  2W48 A;  2M7A A;  2XGC A;  3CCQ I;  2FRH A;  4LGW A;  2HWV A;  1IJW C;  2HPM A;  4A0X A;  3HKZ A;  2KHM A;  3HBL A;  1I50 J;  3FHZ A;  4XL9 A;  5EG0 A;  1W5C C;  1WJF A;  4UV9 A;  3WG9 A;  1AU7 A;  4A69 C;  3IWF A;  5FD6 A;  3PNY A;  4LB5 A;  3DEE A;  1ODD A;  2CQ7 A;  3BG5 A;  4O5V A;  4KA4 A;  4N9I A;  1EF4 A;  1WI3 A;  1ZG5 A;  4Z6Y A;  2CV1 A;  4RA2 A;  5JHF A;  1BM9 A;  1SEU A;  2QVO A;  4B09 A;  5D5W B;  2Z5U A;  2G9W A;  3ZMV A;  4CGZ A;  2EFO A;  1JT6 A;  2JQ7 A;  2Y0M A;  3S16 J;  2JRM A;  1L0O C;  3EYI A;  3BRO A;  4Y13 A;  4GFB A;  2OZU A;  4KIB A;  1OKR A;  1R1T A;  1IXR C;  4HG2 A;  2IJL A;  4WXC A;  2GOM A;  1BA5 A;  1Q1V A;  3GME A;  1VQ8 I;  4PDK A;  4A3L J;  4ZDP A;  2FJ1 A;  3FIW A;  5IYB J;  2R7Z J;  2VC0 A;  2RC4 A;  1TP4 A;  4C30 A;  2XRN A;  3S2H J;  3KPH A;  1S6L A;  5E17 F;  3BCA A;  1NK3 P;  4S0H B;  2VJI A;  1T0F A;  2R7R A;  2YX4 A;  5GPA A;  5JR3 A;  1IN6 A;  4RB1 A;  1Z3X A;  3K1M A;  2EBI A;  3R6S A;  3SQN A;  2X1E A;  4I01 A;  4R8H A;  1O3S A;  1MBK A;  4OAY A;  5B3S H;  3BWG A;  1R58 A;  2BBY A;  3Q0U A;  4L9N A;  4XMY A;  4P5O A;  4RGR A;  1G3T A;  4XLH A;  3RPQ A;  1IRF A;  2AXL A;  2H8W A;  3ZN0 A;  5GTI C;  4E7I A;  1U9O A;  2X1D A;  4KYW A;  3I59 B;  2LG4 A;  5D5U B;  3DEU A;  4BYY A;  1UHS A;  3HHH A;  5J4V A;  1IV8 A;  1FP1 D;  3OYM A;  1SFK A;  1K7A A;  3K4M A;  1FYL A;  5FKK A;  1S5L C;  5GP9 A;  3KX2 A;  5FLM J;  3ZQ7 A;  2KJC A;  2L7Z A;  1P4X A;  4HV6 A;  3W2V A;  2HVR A;  2YSR A;  3K10 A;  2AHQ A;  2L7F P;  2PI0 A;  2K27 A;  4ZYA A;  4YEJ A;  2Y0S A;  1UHM A;  2LYC A;  2M4G A;  2M87 A;  2FA5 A;  2DOF A;  5HDG A;  2WAD A;  3QWL A;  2L5Q A;  1XCV A;  5EYR A;  2DA7 A;  2DK8 A;  2F5V A;  1QZZ A;  5LHG A;  2I10 A;  3GX4 X;  3JRC A;  4EEF G;  1UFM A;  2R7X A;  2DK5 A;  1S29 A;  3H3U A;  1Y56 A;  1BBY A;  4GYI A;  3G2B A;  4KMF A;  1IG7 A;  5HVQ C;  4GRI A;  2X9D A;  4G94 A;  3OS2 A;  4MLO A;  6PAX A;  2D2W A;  2BYV E;  1E3O C;  1YJN I;  3K1P A;  2NVU B;  3J80 Z;  4ENK A;  3WTY C;  2DA2 A;  2IS2 A;  3KE2 A;  1XN7 A;  2DA4 A;  3QP5 A;  3ZQH A;  2ZXI A;  3A01 A;  1VQO I;  1OR7 C;  5J1U A;  1BIA A;  4CYD A;  1O3T A;  1JJ8 C;  4PCQ A;  2M30 A;  3LOC A;  4E7S A;  1IZ1 A;  1TW2 A;  4I09 A;  4A6E A;  2BGC A;  3J7A Y;  2E7W A;  4KNY A;  3PUB A;  3U1D A;  3DCF A;  3KP7 A;  1I5Z A;  3VSK A;  2DA6 A;  3BZK A;  4U88 A;  1MKM A;  2W4S A;  5LEK A;  4DOZ A;  3TQN A;  3SZP A;  1HDP A;  2CS3 A;  2QSH X;  2GBY A;  1HW2 A;  5DUI A;  2HKO A;  1SMY F;  5M5Y J;  1GT0 C;  2A68 F;  3ZMU A;  1Y8Q B;  4M73 A;  1RIO H;  1XTA A;  2RKH A;  4XRS A;  4ZC3 A;  4RM2 A;  4NDL A;  4YG2 F;  2Z9O A;  1XPX A;  2W7N A;  3CCE I;  4B43 A;  3L2W A;  3IV5 A;  1A31 A;  4XSX F;  2CGP A;  3TW6 A;  4QLC U;  3OL4 A;  3CDI A;  4KUM A;  3Q9V A;  1KQ8 A;  3ZN1 A;  5F08 A;  4CXF A;  2ETH A;  1FWZ A;  1ULY A;  1SFO J;  2BY3 A;  2AQF A;  4JOM A;  1YOV B;  1JKP C;  4L0Y B;  4L9V A;  4UUT A;  4BJT A;  1IUY A;  1Y39 A;  3ECH A;  4HQE A;  2PLY A;  2PJR B;  1R36 A;  1RUO A;  5ILU A;  2WB1 A;  3WTX C;  1X1A A;  4NQW B;  2HYJ A;  1OLT A;  5IYC J;  2E71 A;  1RR8 C;  4B48 A;  5CQG A;  1FP2 A;  1T08 B;  3FM3 A;  4XID A;  2DFF A;  2MYS A;  3S17 J;  1JI8 A;  2MSY A;  2R7O A;  4WXD A;  2OU2 A;  1HDD C;  4CDG A;  1QHH D;  2E2H J;  2K86 A;  1JGG A;  2ZXH A;  1YRN B;  4XKV A;  3GYH X;  1TTY A;  4XN3 A;  1IN5 A;  4G7Z F;  3X2Q H;  3FWE A;  4RMN A;  1EH8 A;  1H9G A;  4DZJ A;  4S05 A;  3S1Q J;  3O6B B;  4HBL A;  3QP6 A;  3L2R A;  3JRE A;  3FXM A;  3B6A A;  2VQL A;  1WCM J;  5EZH A;  1PUE E;  4PGG A;  3CJR B;  3ZQL A;  2PJP A;  2H6B A;  4BY1 J;  2VON A;  4E6K G;  1FSE A;  1ZAR A;  1V5G A;  4BDY A;  3GEZ A;  4MGR A;  1BC7 C;  4F91 B;  4EGZ A;  5IT9 K;  4CIC A;  4UVB A;  2PG4 A;  1LVK A;  4NC6 A;  3ROU A;  3O8H A;  4W97 A;  1R1V A;  2HOT A;  1Z1D A;  5L3B A;  3HTU A;  4FE4 A;  3P9I A;  2KIS A;  1WWX A;  1W1W E;  1X2N A;  3BG7 A;  3L7W A;  1VZ0 A;  1WZ2 A;  3HHG A;  1TC3 C;  2VT2 A;  3GFI A;  3N97 A;  3AAF A;  3K4L A;  2ME0 A;  3BTI A;  5FRM A;  1IXC A;  4UVC A;  1BR4 A;  3KYL A;  2JVG A;  2R5Y A;  3Q5F A;  3BPX A;  3CDH A;  1QVT A;  5J1Y A;  4UVA A;  9ANT A;  2IPQ X;  4XLA A;  2E36 A;  1JHF A;  3MKY B;  1X2M A;  2JTV A;  4PZJ A;  3FMR A;  3RTR A;  3FM5 A;  1D8K A;  5M3F J;  1XMA A;  3JTH A;  5CQE A;  2E1M B;  1YIO A;  4FCY A;  2WY7 Q;  4PUS A;  2O7O A;  2V6C A;  1EH7 A;  3JRF A;  4IL6 C;  2VQG A;  2DJI A;  1ZRD A;  2L7M P;  5BPD A;  1O57 A;  1MSE C;  1HA8 A;  3E1S A;  3HRM A;  1Y1W J;  4OIR F;  2MD0 A;  2O03 A;  1J75 A;  2JVH A;  3VDX A;  1R4N B;  2L01 A;  3BT9 A;  5L3F A;  3FDY A;  4PJN A;  5FO5 A;  2O3F A;  5E3L A;  1T98 A;  2NXN B;  4IHV A;  2DCE A;  3OR1 C;  2PMH A;  2ME6 A;  2EFQ A;  4R79 A;  4D0P A;  2HR3 A;  1QZE A;  4P9F A;  4BBS J;  2EV5 A;  2IGK A;  5D6E A;  3OYD A;  4I7H A;  1H0M A;  4G7O F;  1I39 A;  4B44 A;  1J0R A;  2Z3Y A;  3GCM A;  4H0E A;  3SEZ A;  1BJZ A;  4IF4 A;  1E3P A;  3PSF A;  2GM4 A;  4KJZ A;  4BEH B;  2X0L A;  1BW5 A;  4IRI A;  3OYI A;  2ZME C;  3OWT A;  4OIO F;  2NNY A;  3TO9 A;  2Q2E B;  1XS9 A;  3QPH A;  1BC8 C;  3E5U A;  1GVJ A;  1X3Z B;  3C3W A;  4B3A A;  5J1R A;  4MNU A;  3MZ8 A;  4DBQ A;  5IPA A;  1YW9 A;  1POG A;  1G4D A;  3BTL A;  3CDL A;  4PJM A;  4NC7 A;  3WTZ A;  2MA3 A;  1XGN A;  2AXT C;  2KDO A;  3GZ5 A;  1LEB A;  2VI6 A;  4RB3 C;  3KYD B;  3KP2 A;  1QQI A;  2NS0 A;  3HPH A;  1LFB A;  2EH3 A;  1MBF A;  4XOT A;  2GA2 A;  4HX7 A;  3DTE A;  1WHU A;  2NRA C;  1BI0 A;  2CG4 A;  4A3D J;  3EYY A;  1ENH A;  2Z1D A;  2F5D A;  1D5Y A;  5TIS C;  2ZNZ A;  4A3K J;  3S8P A;  4Q5S F;  1Z05 A;  4M3B A;  4U87 A;  3A03 A;  1PUF A;  1ZR4 A;  3R0A A;  2TCT A;  2V9K A;  2IP2 A;  3ZR8 X;  4EQQ A;  1W36 C;  3LNQ A;  1T6S A;  2H8R A;  1T2K A;  2ISY A;  3F72 A;  3U2R A;  2M8E A;  3RPU A;  2NOG A;  2NVY J;  5ILV A;  1W5T A;  5BMZ A;  5DTD A;  2L0K A;  1FBU A;  3IAM 2;  1TLH B;  3FHN A;  1Z7U A;  2A5Y B;  2XVC A;  3KCC A;  4A5N A;  3OYL A;  1W4M A;  4FTH A;  3F23 A;  2H1L A;  1OMI A;  2F4I A;  1Z0X A;  1W7P B;  4MEX F;  3W6K B;  4AU7 A;  2VXZ A;  3RKQ A;  3T1B A;  4RM3 A;  1MSF C;  5DCM A;  2CV2 A;  1UB9 A;  3MFK A;  1QNT A;  3WHB A;  2P7C B;  1NK2 P;  2Q0O A;  3KEQ A;  3HB9 A;  4DNC A;  1D1C A;  2HFH A;  2RVC A;  1R9T J;  3T5X A;  5B5E C;  1LEA A;  3ML6 A;  1QO0 D;  3DU6 A;  3RIR A;  5GAG J;  3I58 A;  4HYE A;  1HKS A;  4L9T A;  2IAI A;  1NG6 A;  1DQU A;  4GDF A;  3GTO J;  2XSD C;  1XSX A;  2E19 A;  3ABK H;  3MAJ A;  2XHK A;  3L9F A;  2P7V B;  5D8L B;  3S1M J;  2HPI A;  4CA0 A;  4MQ9 F;  1L3L A;  5CVR A;  2DT6 A;  2KIM A;  2LMD A;  4AVZ A;  1OFC X;  1QRY A;  3K69 A;  1YYV A;  2KKO A;  4G9Y A;  2V9V A;  1ETK A;  2F4O B;  1BL0 A;  5A2Q K;  2BY0 A;  3IH4 A;  4CZZ A;  4XLE A;  4MFE A;  5K7H A;  1PP8 F;  1CQT A;  2RQQ A;  4Y33 A;  4BBR J;  2IA1 A;  1LE8 A;  2IEK A;  1G59 A;  2MAB A;  3HOZ J;  2Y30 A;  1VND A;  3MKZ A;  3CP8 A;  4XNF A;  4BQN A;  2VOD A;  4O3M A;  1ETY A;  2ID6 A;  2ZC2 A;  2P5K A;  5LLQ A;  1U5T C;  1D8J A;  4MTE A;  1V5E A;  2GXG A;  5IY5 H;  5TGT A;  3DPT A;  2XAF A;  3LQQ A;  2LDU A;  3SFZ A;  1QZY A;  3J81 Z;  3TED A;  3LSH A;  4QWQ A;  3I0T A;  2KRC A;  1I6H J;  2ZBK A;  4FAS D;  2CUF A;  1Z6R A;  3V8J A;  2ADU A;  1XB4 A;  2NS7 A;  2FBH A;  2HTS A;  1ZLJ A;  3BQY A;  3F8N A;  2L9V A;  4I99 C;  4RB2 C;  4IKF A;  3SZT A;  4IOA F;  4BHC A;  4U0Y A;  4UUV A;  2IT0 A;  3LFU A;  2LF7 A;  1N77 A;  3A2K A;  3EDP A;  1G3W A;  3KP3 A;  4XR6 A;  3C7J A;  3K1N A;  2MD5 A;  3WU0 A;  3CCU I;  4BJ6 C;  2JT1 A;  3HL2 A;  5M5X J;  2Z33 A;  3F9K A;  1N78 A;  3IKT A;  3DV8 A;  2F5F A;  1SD5 A;  1XD7 A;  3TOB A;  3D1N I;  2F4M B;  4XOP A;  5CVV A;  1JKO C;  2OD5 A;  3DBH B;  2L7K A;  2WA0 A;  5EDN A;  5GTH C;  2R5Z B;  1TT5 B;  2IGN A;  3TDU C;  1T8I A;  3GXO A;  2MFZ A;  4K2E A;  3CO6 C;  1R49 A;  3EUH C;  3CMM A;  4ZZD A;  3G1L A;  4EJV A;  2DJN A;  5F04 A;  1JUS A;  2IA0 A;  3KP4 A;  2CUE A;  4DGW B;  2KIU A;  3H92 A;  1BOA A;  1MND A;  1K78 B;  3JRB A;  3BC8 A;  3WGI A;  4J00 A;  5F64 A;  1BW6 A;  4G7H F;  3BJ6 A;  3I59 A;  4KIC A;  2KJB A;  4QSH A;  1GLN A;  2WAQ N;  2CSO A;  3OL3 A;  4U7B A;  2DYR H;  4A3C J;  3PL8 A;  3IHU A;  3G1O A;  5B1B H;  1HOM A;  1A04 A;  4BQQ A;  1WFX A;  1TNS A;  2VLA A;  4NBQ A;  3ZMS A;  4CCM A;  1R7J A;  3OYE A;  1I6X A;  1LKX A;  2K9S A;  4RLF A;  2O5R A;  3MZY A;  3H9G A;  3CUQ A;  2LY2 A;  4RB0 A;  1GXQ A;  2EV0 A;  1MDM B;  3ZQC A;  3WU1 B;  3L2V A;  4QTR A;  3P7N A;  3H0G J;  1BI3 A;  3GFM A;  5BNG A;  5IT3 A;  5K7F A;  4F7Z A;  4AID A;  1KQ0 A;  3H5A A;  4CCN A;  4M3F A;  4AD9 A;  1YX5 A;  2FX0 A;  2ZJR F;  3M1E A;  4M6V A;  4BDZ A;  3CF2 A;  4C2T A;  5HOD A;  5IP6 A;  4XK4 A;  2QEN A;  3IC7 A;  5DD4 A;  2FQ4 A;  4C3I J;  1FLI A;  1M1E B;  2EZL A;  3FXJ A;  5LFA A;  4N9H A;  3QPS A;  3PUF A;  3LST A;  2E7X A;  2TDX A;  3S3M A;  5CVJ A;  2GOX B;  2M0M A;  2ZXW H;  4UV8 A;  2HOS A;  2QBY B;  4KIG A;  1IDY A;  3FXK A;  4XSZ F;  1T38 A;  2A6H F;  1FBS A;  2CJJ A;  2V9P A;  3D5L A;  2EWN A;  2UUZ A;  1BIB A;  1JHH A;  3WGH A;  3IKV A;  5J4Y A;  3DPL C;  3RJP A;  5HDK A;  1YJ9 I;  4RGX A;  2K7L A;  4MEY F;  1FNN A;  1FPQ A;  1HQC A;  3ONQ A;  1B72 B;  2J5O A;  2O8K A;  3JRI A;  2R7Q A;  3V42 A;  2QQA A;  3S93 A;  3HG9 A;  1UCR A;  5C4J J;  3FXL A;  3IL2 A;  1TW3 A;  2COB A;  2QWW A;  1O3R A;  2R92 J;  3LA3 A;  3OV8 A;  5DDG A;  3ULQ B;  5JVT A;  1KGS A;  2XB0 X;  4WK8 F;  2ZCW A;  3E6C C;  1JKQ C;  1D3Y A;  3NQO A;  2VBZ A;  1KYZ A;  1Q1H A;  5D4S A;  1FBQ A;  4D7M A;  5IP9 J;  2Q8K A;  4EV0 A;  2VBW A;  3TO6 A;  1KU9 A;  4AM3 A;  2DMP A;  5DCF A;  3DKX A;  4HW0 A;  2MC3 A;  2JSC A;  2W82 A;  2VBX A;  2K02 A;  1ETW A;  1STZ A;  3S32 A;  4GGG A;  2L4A A;  2D1V A;  2P6S A;  3B02 A;  4QPO A;  2DTZ A;  4LK1 F;  1WSU A;  2PJR A;  3H5R A;  4AWX B;  3OS0 A;  2CW7 A;  1Y8R B;  1P4A A;  3RKW A;  4BS9 A;  1ZAO A;  1KYW A;  2CH0 A;  3MZH A;  4KFC A;  1YLF A;  3GUD A;  3K7A J;  4NQW A;  2JRT A;  3CCY A;  1YJW I;  1D5V A;  1A36 A;  1JKR C;  3VYS B;  2NOJ B;  1RKW A;  2ICW G;  2X6X A;  2LSO A;  2KPM A;  3RI4 A;  3V8L A;  1D0Z A;  4C9Y A;  1HCR A;  1ZKG A;  3GW2 A;  4E7J A;  1X1P A;  2QZ8 A;  1MMD A;  5L3E A;  4NB5 A;  2KLO A;  2XAJ A;  1RET A;  4WF2 A;  1E2X A;  2LKP A;  4LIT A;  2FE3 A;  3HRU A;  2W57 A;  4OIP F;  4UUS B;  2FNP A;  3Q0W A;  3F22 A;  4B1R A;  1I3Q J;  2DI3 A;  2NYX A;  3K4J A;  1R23 A;  1IO2 A;  5LGU A;  1YRN A;  2XKO A;  4XRF A;  2E1C A;  3K4C A;  2XKP A;  5LHH A;  1ZTR A;  2BHY A;  1BR1 A;  1FX7 A;  3K4B A;  3CCV I;  5FLX Z;  2PX9 A;  1HF0 A;  1C0W A;  4IHX A;  3H3V K;  1DU6 A;  3G6E I;  2UV1 A;  4BUP A;  1LUJ B;  3E7L A;  3CUQ B;  1ZYR F;  2FU4 A;  3OY9 A;  4J19 A;  2CW0 F;  4IJA A;  2PQ8 A;  2IRF G;  2K3F A;  1SD6 A;  2DYS H;  4UB8 C;  2OCE A;  1IC8 A;  2IBD A;  2M34 A;  2ECB A;  5FRO A;  3TBI A;  3MD2 A;  3DWL E;  4IHS A;  2TRT A;  1FIA A;  2IXS A;  3K2A A;  2VPL A;  2H27 A;  1MMG A;  4XIC A;  1KON A;  4BHB A;  2LD5 A;  4ZTJ A;  2V6E A;  2L9N A;  3DTI A;  3JRH A;  2K5C A;  4ABZ A;  5DM7 F;  3ZCO A;  2GIZ A;  2CYY A;  3BR2 A;  5C3E J;  1XX5 A;  4XLP F;  2ZKZ A;  3HOX J;  2EIM H;  2HQN A;  1VQ7 I;  4BE0 A;  3LA7 A;  5FJ8 J;  4IZZ A;  2A69 F;  2CQN A;  1SFX A;  2FQ3 A;  3LSK A;  5F0F A;  3CO7 C;  2MLG A;  1D1B A;  3A0B C;  2HTJ A;  2CFX A;  1EKE A;  3D0S A;  5CVU A;  3PNV A;  5F1R A;  2BV6 A;  1GDT A;  2NVQ J;  2LP0 A;  2L54 A;  1WJC A;  2CQX A;  2DPU A;  2ZFW A;  2Q1Z B;  2M9H A;  4Y15 A;  1B9M A;  2STW A;  2HKX A;  4G8X A;  3J7Y J;  1SVM A;  1F43 A;  2BOL A;  4MFD A;  2E5Z A;  2CUZ A;  2RDP A;  1W0U A;  3O8G A;  3K70 D;  1IXS B;  5EGO B;  2QCO A;  4JX5 A;  3FIS A;  3MCZ A;  1FIP A;  3WTW C;  4RS8 A;  3L1P A;  1MW7 A;  2RN7 A;  1KU7 A;  3V7S A;  4JQF A;  2N8G A;  5CYV A;  5AIQ A;  3KEY A;  1G3Y A;  4YIR X;  4YFN F;  5B1A H;  3OYJ A;  3CCL I;  2DDA A;  3F8M A;  3SDB A;  4BQA A;  1IN8 A;  5ICF A;  4CUG A;  3LWF A;  5IT9 Z;  1J5Y A;  2UXN A;  4NNJ A;  3HZJ A;  1ON1 A;  4FET A;  3WOD F;  2DT7 B;  4B8X A;  4IHT A;  2W85 A;  3ZMZ A;  2R7D A;  3G4S I;  4A93 J;  3HOT A;  4II2 A;  4LFU A;  3QRF F;  3NAR A;  4BE1 A;  1AHD P;  3M8F A;  1Z9C A;  1OYI A;  1XG1 A;  1WQ2 A;  2X48 A;  4D7N A;  3VYT B;  4FE7 A;  4II3 A;  3LAP A;  2XF6 A;  1YO5 C;  4KT6 A;  4HLY A;  4BEH A;  4OIQ F;  4LMY A;  2QUF A;  2XAQ A;  2ZNY A;  5LEJ A;  3FZV A;  3JRA A;  2Q2E A;  2JJ7 A;  2M4K A;  1X4P A;  5EEH A;  4ETS A;  4RLQ A;  1QPM A;  3HIF A;  5HNF A;  2XSJ C;  4U0W A;  2YU9 J;  4M3E A;  2R7F A;  4DYR A;  1PP7 U;  1X3U A;  2BXZ A;  1YW7 A;  1I3A A;  2B7E A;  3BJA A;  4PFO A;  1A35 A;  4RGU A;  1MJ9 A;  2Y9Z A;  1EH6 A;  2FOW A;  1NH3 A;  2XPW A;  2NS8 A;  2QSF X;  4F93 B;  2A6T A;  2L2O A;  2DT5 A;  3BLY A;  3DKY A;  5KAF C;  2X6Y A;  2FBK A;  1QA6 A;  3WE2 A;  5GAD J;  3IH3 A;  5E8I A;  1J09 A;  1DGR M;  2ZFU A;  1NHA A;  1U5T B;  3O2P E;  3U21 A;  3C2G A;  1ZR2 A;  1GV5 A;  1HKT A;  1JGS A;  3JR9 A;  4E7Z A;  2EJR A;  1GUU A;  1I1G A;  1VQ5 I;  3DBR B;  3GVA A;  2EIK H;  3HJE A;  1QBJ A;  3J80 K;  2WY8 Q;  1V5F A;  3KZZ A;  1YHQ I;  2O9L A;  4FQG A;  1WPK A;  3DFG A;  2QF7 A;  3CMA I;  2JSP A;  2JA6 J;  1IRG A;  4V2F A;  1YIT I;  1W7P A;  1IW7 F;  3CP2 A;  3ELK A;  1FC3 A;  2XPU A;  4P55 A;  3SHF A;  1IF1 A;  3RZO J;  1R1U A;  3RKY A;  4V19 K;  2IGM A;  3BR0 A;  3DLL F;  1ZRE A;  1J7K A;  2A05 A;  3E5Q A;  3TP3 A;  5FLV A;  1DPR A;  1F36 A;  2IGO A;  2CWE A;  2WAQ A;  2C6Y A;  2KIQ A;  1E3H A;  2XC7 A;  5KAI C;  1MMN A;  3CES A;  2EFW A;  3FXU A;  3VOE A;  3HYI A;  3MVP A;  3CCR I;  3ZGK A;  1ORK A;  5F0H A;  4H4K C;  4YII A;  3SZG A;  2R7T A;  3ISP A;  3IP4 B;  3KET A;  4J01 A;  5JVG F;  4Y3O A;  2XGD A;  2LFB A;  5DEQ A;  4AIH A;  3HOV J;  2OQR A;  4IX7 A;  2DQL A;  3TO7 A;  1XGO A;  2XAU A;  2HOE A;  4NC8 A;  2VBY A;  4FX4 A;  2L02 A;  2ZSH B;  3E6D A;  5J8F A;  3S3O A;  5DV5 A;  5AIP A;  1ZQ3 P;  1XC5 A;  3N4M A;  3ZQI A;  3VWB A;  3PJR A;  1B59 A;  3BY6 A;  1SD7 A;  5CJ9 A;  1ETV A;  2PBI A;  2KIF A;  2EA2 A;  3CCS I;  2G7U A;  3CF5 F;  4LLN A;  2VJ5 A;  2DMT A;  3QYF A;  2CV0 A;  3RKX A;  1HW5 A;  4IQJ A;  3LSR A;  1OYW A;  2FEZ A;  2XDV A;  2B0L A;  3DF8 A;  1IV6 A;  5H2F C;  1R4M B;  4X1E A;  3JSP A;  1MGT A;  3M4O J;  1EV7 A;  1TNT A;  1YS7 A;  4LOC A;  4WCG A;  4KT5 C;  2RRE A;  2DMQ A;  2VKD A;  5E18 F;  1RRJ A;  2DOE A;  3M7G A;  2JK3 A;  2F5E A;  5B66 C;  1O7F A;  4D9J A;  2P5L C;  2ZXJ A;  5LGN A;  2M8G X;  3OYB A;  1R71 A;  3BR1 A;  2P81 A;  1U8B A;  3M8E A;  3DBL B;  2HZD A;  3PQK A;  4IQ4 A;  3S1R J;  1YX3 A;  2LK2 A;  2OCC H;  3HEF A;  3J7A O;  2WV1 A;  1MH3 A;  2M45 A;  1DP7 P;  5ILS A;  4HNT A;  3SDG A;  2VQH A;  3RQI A;  2D5V A;  4ITV A;  3TOA A;  4F52 A;  1K6Y A;  2R4G A;  3MWM A;  4ZTF A;  3C2B A;  1OIS A;  2JPC A;  5FKO A;  3CJN A;  2DA5 A;  3E6B A;  4A6D A;  3RSN A;  3NWT A;  5L3D A;  1OR7 A;  2ZJ2 A;  1IGN A;  4CCL A;  3GTP J;  3AL0 C;  1H88 C;  2DFH A;  1VQ9 I;  1G2H A;  2R5Z A;  2KL4 A;  4IEJ A;  4ENM A;  3KZI C;  2OQG A;  4PJ0 C;  4MQV A;  2OTL I;  5H6Q A;  5F6F A;  1N75 A;  1VI0 A;  2KZV A;  2QLZ A;  1V4R A;  1MNE A;  3GBG A;  3H9J A;  2KDZ A;  1Z67 A;  2QKM B;  2B9S A;  1X4O A;  3PIP F;  3A4C A;  1ZGA A;  3CC7 I;  2M0C A;  1RC9 A;  3MQ0 A;  3UR3 C;  1F4K A;  2P6T A;  1ZEL A;  2FBI A;  2IS1 A;  2CMP A;  3ABM H;  4CCK A;  3K4K A;  3JRG A;  1K78 A;  1A6I A;  2VXD A;  3LSM A;  4U7D A;  3SJM A;  4RAZ A;  1OCR H;  5HLT A;  2BEO A;  1MBE A;  3HGY A;  3BP8 A;  1B8I B;  3CME I;  2A3S A;  3ABU A;  3S3N A;  3CC4 I;  1IN4 A;  2OPT A;  2FML A;  1FOX A;  1MJA A;  1WJA A;  3PIO F;  3PQJ A;  2M7B A;  3I4M J;  4OU0 A;  1VQL I;  2KFD A;  3BZ6 A;  3OYG A;  1ZN2 A;  3TDZ C;  2PEX A;  4BXU A;  4A3F J;  1YFH A;  3P9K A;  2CUJ A;  3JAM K;  1MDM A;  2OTJ I;  3VPR A;  2ESN A;  2F5C A;  3I56 I;  1K6O A;  3GTJ J;  1UG0 A;  4JBA A;  2AS5 F;  3W6V A;  2OA4 A;  4S04 A;  1K83 J;  2FNA A;  5E1X A;  2OAZ A;  2VN2 A;  4PJJ A;  1JXS A;  3BG6 A;  1TWG J;  3T8T A;  2Z99 A;  3ERE D;  4P96 A;  4D5C A;  4XQF A;  1OCP A;  2WC2 A;  2M5W A;  2JPB A;  3LMM A;  4MHG A;  1A6Q A;  3AG2 H;  2OJE D;  1DU0 A;  1T0F C;  4PSW A;  4IXA A;  2A07 F;  3G71 I;  2V1N A;  1E17 A;  3RYP A;  1FTT A;  4Y52 J;  4P1W A;  3KP5 A;  4I76 A;  4M9Z A;  5IP7 J;  2D45 A;  4ZYG A;  2QBY A;  3H0D A;  1RES A;  2YU3 A;  3BJO A;  1XGM A;  3K4N A;  2PN6 A;  2Y31 A;  4NUB A;  2EQR A;  2LVS A;  3FXO A;  2HVQ A;  4FHT A;  2GQQ A;  2Y9Y A;  4BXX J;  4HZF A;  2K9M A;  3MKL A;  1B72 A;  1WJ5 A;  3DPU A;  1LVA A;  5GAE J;  4FT8 A;  2G7H A;  3I4P A;  5H6R A;  1HLV A;  4O6J A;  2M3A A;  4WXH A;  2LF8 A;  1DPU A;  4RDU A;  1GV2 A;  1OQY A;  1XMX A;  1MBG A;  2E60 A;  2VAS A;  1TZL A;  2H94 A;  4CYC B;  1B6A A;  1J59 A;  1MNM C;  3IUO A;  2GLO A;  2CU7 A;  2OBP A;  3M07 A;  2YX7 A;  4UB6 C;  2NAZ A;  5CVI A;  1O3Q A;  3F3X A;  3ZQG A;  3M1C A;  2QYO A;  4HOB A;  1TWH J;  3ABT A;  3IWZ A;  3HC7 A;  3IAS 2;  2HDW A;  4GXO A;  4A3J J;  1E0E A;  1AWC A;  3MN2 A;  2XGX A;  5IOY A;  3GZN B; 
#chains in the Genus database with same CATH homology
 5JVG F;  5DM6 F;  3G4S I;  2ZJQ F;  3CME I;  3J7Z I;  4UY8 I;  1YJW I;  1VQN I;  3CC4 I;  2E34 A;  1FOX A;  1FOY A;  3PIO F;  1FOW A;  1VQP I;  1VQL I;  3CCJ I;  2ZJP F;  2OTJ I;  3CCS I;  3CF5 F;  3I56 I;  1YI2 I;  3CCQ I;  3CC2 I;  3CCV I;  3G6E I;  2ZJR F;  1VQ4 I;  2E35 A;  1YJN I;  2K3F A;  1S72 I;  1VQ6 I;  2QEX I;  2FOW A;  5GAH J;  3CJT B;  1VQO I;  1VQM I;  1VQK I;  1QA6 A;  4IOA F;  5GAD J;  3I55 I;  3G71 I;  2JQ7 A;  5DM7 F;  1MMS A;  3CCU I;  1YJ9 I;  1VQ7 I;  4IOC F;  1VQ5 I;  1VQ8 I;  1YHQ I;  5GAE J;  3CMA I;  2E36 A;  1YIT I;  3CCM I;  3CCE I;  3J7Y J;  4V19 K;  1VQ9 I;  3DLL F;  3CD6 I;  2OTL I;  5GAG J;  1YIJ I;  2H8W A;  3CCL I;  1Y39 A;  3PIP F;  3CC7 I;  1HC8 A;  4IO9 F;  1ACI A;  3CCR I;  2NXN B;  2QA4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...