1YJ9I

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1yj9I00
3CCUI 1FOXA 3G4SI 3J7YJ 2E36A 2FOWA 1VQPI 4UY8I 5DM7F 5JVGF 1VQ7I 2E35A 1FOYA 3CF5F 1VQ6I 1YJNI 2ZJPF 2OTLI 5GAHJ 1QA6A 5GAEJ 2H8WA 3G6EI 1VQ4I 1YITI 1YIJI 3DLLF 4IOAF 2ZJQF 5GADJ 3CC4I 3CCVI 1YHQI 1VQ9I 1VQNI 1VQ8I 3CJTB 1HC8A 1VQLI 4IO9F 1Y39A 3CC2I 2OTJI 3G71I 5GAGJ 3J7ZI 3PIPF 3PIOF 3I56I 3CCQI 1VQKI 1YI2I 3CD6I 3CCJI 5DM6F 3CCEI 3CCMI 1YJ9I 2E34A 2ZJRF 3CCSI 1VQ5I 2NXNB 2K3FA 1YJWI 1FOWA 1VQOI 3CCLI 2JQ7A 3CCRI 2QEXI 1ACIA 2QA4I 1VQMI 1S72I 3I55I 3CC7I 4IOCF 3CMEI 1MMSA 4V19K 3CMAI
chains in the Genus database with same CATH superfamily
2IA0A 1XC5A 1I1SA 1G8XA 3HIFA 3QOEA 1JTXA 2DDAA 1U2WA 3IHUA 1O3TA 2XSJC 3HGYA 1LEAA 2GIZA 1OMIA 2EFWA 1D5VA 3WHBA 3GEZA 2DLLA 1K4TA 3BG6A 5KAIC 1B8IA 2VUMJ 4BBSJ 4OIPF 5E3OA 5HNHA 5H20A 2FNPA 3OYCA 4AVZA 5IT9K 1FYKA 3F21A 4WXDA 2L7FP 4DBRA 4IL6C 2QF7A 4XN0A 2JVGA 2VB6A 2X6YA 4OIRF 2LBFB 3MN2A 5JHUA 2GQQA 2LFBA 4EM2A 1HKQA 1VQ4I 1E3PA 1XSDA 1H89C 1YITI 1YIJI 4EMSA 1GDTA 4HG2A 1SD4A 2LVSA 1USTA 2GXAA 1UMQA 3OSFA 2A61A 4XRFA 2NVXJ 2DJNA 1IW7F 3UKGA 1DPRA 1X1DA 1OYWA 5K7HA 4ZH4F 2RAEA 4L0ZB 3HL2A 3PL8A 3JRGA 4KA4A 1A5JA 1X2MA 2HQNA 2LOOA 4KN7X 2EA4A 4BBRJ 5LRSA 2EB7A 3GMEA 4KT6A 1QU3A 5FGMA 2JVHA 4M3GA 2MC3A 2FXAA 4DYQA 2Y48A 2M5WA 3GLXA 2IS1A 2CMPA 3HG9A 3TMOA 4HEA2 3ECOA 2M0CA 4XLHA 4A3MJ 3J81K 4D1QA 4HQEA 3B73A 1OR7A 3N05A 4WX9A 2VJ5A 2CQQA 3JRIA 3V8LA 3VFZA 4NUBA 1KQ9A 2OD5A 3I54A 4GFBA 2JA8J 2Y0SN 2EFPA 4BL0B 1HW2A 2CUEA 2E5NA 1ZRCA 2DA5A 3CQZJ 1YJ9I 2E34A 2LG4A 1SFOJ 4XKCA 3R4KA 2ZBKA 4NB5A 2F48A 2LR8A 1X1BA 1WHUA 4LLLA 5LHHA 4MTDA 2PJPA 4YG2F 1T33A 4I0AA 2BY3A 3V4GA 1YW7A 2LYCA 4Y7NJ 1ZLKA 3ABMH 4XL9A 4A0XA 5GTHC 3WE3A 3OYNA 3ABKH 4GXOA 2UV1A 1N78A 5CVVA 1ON1A 2IXSA 2R5YB 2COBA 3CC7I 1BI2A 2MYSA 3IC7A 2MD0A 3JAMZ 4HNVA 3CLOA 1B9MA 2BW3B 1OYYA 4HZFA 1TWHJ 2FMLA 5A2QZ 2FOWA 4I0BA 4UB8C 1X4OA 4MNUA 4U7DA 4H0EA 3AL0B 5TRDA 3I4MJ 1YQAA 1F4KA 5LEJA 3UNGC 2R7FA 4IHTA 2NOJB 4UV9A 4EJWA 2NVUB 2CQKA 3RZDJ 2IGMA 1FOYA 1MKMA 1OR7C 2VT2A 3DCFA 4ZDPA 4Q4ZF 2AXTC 2ZJPF 1GXQA 3EYYA 4XBFA 4IHSA 2EZHA 3T0YA 1WFXA 1BW6A 2A6EF 1FOKA 1ETQA 2W1OA 3FX3A 5ERIA 3U1KA 3LSKA 3KP5A 5ED4A 4ON0A 4FISA 3N4MA 4RB3C 2M7BA 1SD5A 3H35A 3WTTC 5B1AH 4LB5A 4BY1J 2UXNA 1TNTA 3CC4I 2W57A 1R00A 2M45A 4M73A 4G94A 3W6JB 4I6ZA 3BWGA 2O8XA 2R7ZJ 1D1BA 4DZPA 2WADA 3BCBA 2V79A 2BY0A 1H0MA 3H9QA 2VODA 1XX5A 5J3LA 4JP0A 1IG7A 1ZRDA 4LJZF 2HNHA 1HLVA 4BQAA 3FM3A 3EUHA 2QSFX 3L2CA 3U21A 1C0WA 1UG0A 3G2BA 3BY6A 2VBWA 2KZGA 3BTJA 5ILVA 4GGGA 1TBXA 1SFXA 3I56I 2L9SA 4HBLA 2XPWA 1KQ0A 4G6DA 4E7HA 2IBDA 1T2KA 3PSFA 3CD6I 1RI7A 3DU5A 3CCMI 3OR2C 2XAJA 1RUOA 2LDUA 1OJLA 3ZQ7A 2QENA 4Y15A 3F3XA 1YLFA 3KYDB 1BL0A 1FOWA 3BZ6A 2DBBA 2K3PA 2DW4A 4WXHA 1TQPA 3FXQA 3V7SA 2KJCA 4BE2A 1E3OC 2R7UA 3OYEA 2K02A 2VKVA 4UV8A 2CV0A 2O03A 5FJ8J 1QBJA 1E0EA 1FT9A 1IGNA 2YPRA 2GLOA 2X6WA 4OOIA 1Z6TA 1R23A 1W4MA 3F6OA 4ZJZA 1IRGA 1IV6A 1HSTA 2F5FA 2H6CA 3VODA 2PI0A 2F6CA 1RR7A 4UB6C 1QVUA 1FMWA 4A2UA 2GZWA 4EGYA 2DOAA 2FBKA 3HJEA 1SMYF 3MD2A 1J5YA 1WPKA 1Y1VJ 5BNGA 5KHDA 2I8DA 1OCRH 4AWXB 3I4PA 3VEPA 1JI8A 2VASA 2VL8A 4KYWA 3CDLA 4FT8A 1ETKA 4CYCB 3SZTA 1VQ6I 4A6DA 2CS3A 2XDVA 2NOGA 5LEKA 3WGIA 4XLPF 1OCZH 3EETA 3C7JA 5GAEJ 5C44J 1R4NB 2EH3A 2OZUA 1BC8C 2OJED 4A0ZA 4NDLA 1FPQA 1YRNB 2QQBA 3FHNA 4BACA 5D4RA 3D5SC 4ZYEA 2VIXA 3TL4X 3QPTA 1FTTA 4XM3A 1NK3P 3KP7A 3Q5FA 2CSOA 2E1MB 3BROA 1WCMJ 4OMYA 3LOCA 3FZVA 2CV1A 2X1DA 1LVKA 2L5QA 3CJQB 4IJAA 3QU6A 5BPDA 1D0YA 2Y75A 3C3WA 1DGWY 5H6QA 4A6EA 2EV5A 1BIAA 3KZZA 3GTQJ 4JK1X 1V5FA 4L9TA 3K10A 5TISC 3GCMA 5IPAA 4AD9A 4LB6B 3JRBA 1SFEA 2VJJA 2KZVA 2OTJI 4RLQA 2JRTA 4II3A 2ZFUA 3GBGA 3KCCA 3TOBA 1RKTA 1MNEA 2IVMA 2WWYA 1UHWA 2F5EA 3CCQI 1ZKGA 2R7DA 1K79A 4XRMA 1PP7U 1YI2I 4LMYA 1IF1A 2BY1A 1X19A 5GPCA 3K0LA 2NS7A 1AKHA 2CW7A 2Z3YA 4S05A 4YEJA 1HW5A 3BR6A 1K83J 3GWZA 1T39A 1W7PB 1DUXC 2GIVA 4HDVA 3RZOJ 1ZG1A 1P6RA 3KP6A 3FXOA 1P2FA 3DPUA 1IC8A 5KCMA 3GO5A 2JZYA 5EZHA 3F8FA 1JKQC 3CCRI 3M1CA 1FYLA 3K4KA 4XOPA 2K9QA 3DLAA 3ZMUA 1BR2A 3S1MJ 4IHXA 1YS6A 3OIQA 3BC8A 1B72B 4AVPA 3QOPA 2ADUA 1ZRFA 1LFBA 3I58A 1WSUA 2XF5A 3E5QA 2HDWA 3CUOA 2LKSA 1GUUA 2R7RA 1LQ1A 3K4BA 5FROA 1QRYA 1QZZA 4YIFA 4ZDLA 3KEQA 3NARA 3CO6C 5E8IA 1KU3A 1OKRA 1OLTA 2HYGD 3FMSA 3LA7A 4G7HF 3GZNB 4CCKA 1J75A 1WH5A 1WH7A 3ZPLA 1W7PD 5J8FA 4LD5A 5D5XB 5K5QA 1GV2A 3W6VA 3CF5F 2L0KA 5ICEA 5HDNA 3AG3H 3LWFA 1WJ5A 4A3JJ 1ETYA 5CQEA 2UUZA 4OWRB 2HOSA 3TP0A 2G9WA 4HF0A 2L02A 2ZMEA 3IUOA 1AU7A 1G6NA 2KFDA 3BPXA 4PGGA 5E79C 4Y13A 2DQLA 1W5SA 2H94A 3ZP5A 1JGSA 2F5CA 2K9MA 3KEYA 2HR3A 3H3UA 3DLLF 2CV2A 4GDFA 1FC3A 3L2VA 1IN5A 1MSFC 2E2JJ 2K40A 2IGOA 3GUDA 1S29A 5GADJ 3E6BA 5IY5H 2V6EA 1XMXA 3RPUD 2Z9OA 4ZYGA 4QLCU 3O3KA 3AL0C 3T5XA 4PFOA 3TDUC 1VQ8I 4QPQA 2CFXA 3MFKA 2TRTA 4Y33A 1Y56A 1DU0A 1PUEE 1KONA 4B1RA 1PUFB 2EV6A 3BPVA 1Y39A 3ECHA 2RGVA 1N75A 1K6YA 1D5YA 1VFCA 2P5KA 1RESA 1LPQA 2M0MA 1V4RA 5M3FJ 4UNOA 1G4DA 1EH6A 3FBIB 4UUSA 4M72A 4C3IJ 1J0RA 2DMPA 1ENHA 3RQIA 2Z33A 4A3GJ 4CICA 3SDBA 3M8EA 5DM6F 4D9JA 3MQ0A 4DZJA 1DU6A 1ZTRA 2BXYA 1A6QA 2RVCA 4F3QA 3LMMA 2M1BA 4M6YA 3V7RA 3JW4A 4XLCA 1Z7LA 1L3LA 1VZ0A 2XGXA 4D5FA 5E18F 3JAMK 4PDKA 2X1EA 3W2AA 2ZCWA 2V7FA 4EJOA 2AQFA 1FEXA 4CUGA 2DQRA 4PGHA 2DFFA 5A2QK 3H1CA 1TL8A 4BEHB 3IH4A 3QODA 3OOUA 1WZ2A 2VBYA 2EZIA 4PK4A 2KL4A 3VPRA 4XKBA 3B6CA 3IAM2 5KAFC 2K7LA 3KYLA 1IUYA 3OYDA 3Q9SA 1ITYA 1D8JA 1MBKA 2UZKA 4AUXA 2EZKA 2RN7A 4U87A 3TBIA 5E3MA 2VXZA 1VI0A 2DCEA 3PUBA 4XKVA 1YOVB 3K70D 3K7AJ 3MKLA 4B8XA 1R6RA 3VB2A 3I9V2 2F4MB 1BJAA 4PSWA 2L4AA 2MABA 2BHYA 1LUJB 1TQMA 4G9YA 4HRIA 4P9UA 5D5VB 2R5ZA 3LAPA 1U3EM 1R5GA 2W48A 3L7WA 5DUIA 5J4YA 4A5MA 1XGNA 4ITVA 5AONA 1X1CA 1MJ9A 1IN7A 1WI3A 2LY9A 1BIBA 3A03A 3E3VA 4LG3A 2XROA 4G7ZF 2H27A 1JUMA 3AKZA 3LFUA 5FD5A 3S15J 3NRVA 3F8CA 5FB2A 1TW2A 1W5CC 5CYVA 4WF2A 1G3YA 2RNGA 5JHFA 4A3DJ 1GHCA 1EKEA 1ZN2A 3CJTB 4EEFG 3BOQA 5D5WB 2G0EA 3TQNA 4JOMA 3CJRB 2XC7A 3HOXJ 2E2HJ 4KISA 5LGNA 1P4AA 2E60A 2A3SA 1P4XA 2EFQA 1U5TA 4I99C 2MA3A 5FFZA 3G71I 5BPIA 1Z9CA 4K2EA 3HSRA 1A35A 1FBUA 3VWBA 2HKXA 2HOAA 3DV8A 1LE8A 1R7JA 5D8KB 1FJLA 2TDXA 3S1RJ 4M3DA 5LLQA 1BW5A 3OY9A 1QVTA 2BOLA 2EQRA 2ZXIA 4KIGA 3MZHA 4ZTFA 1XGOA 3CCJI 1L0OC 3ROUA 1KQ8A 2Z2SB 4BE0A 2IP2A 5EZGA 3LA2A 3WTSC 2E1MC 1FBSA 1IRFA 1J7KA 1VQOI 2DA6A 1IJWC 1QNTA 3C18A 4FTHA 2O3FA 3OL4A 5HS9A 3I71A 2HEOA 2JN6A 2JPCA 3ZN1A 1XSXA 2K85A 2MG4A 2OU2A 1I27A 5HLGA 1UHMA 2EFOA 3BZCA 3D5RC 2FX0A 2QA4I 3RYRA 3VOEA 1WJAA 4CH7A 4O3MA 5IYDJ 3HRUA 2AXLA 1CQTA 3FXKA 2JA2A 4RLFA 2M7AA 5DYMA 1HF0A 4Y4RA 5E3LA 2HQRA 1SVMA 3BR2A 1UAAA 3CMAI 2M4GA 4L18B 1FIPA 3GTKJ 1FIAA 4G12A 3ZQHA 1ORKA 1VQPI 2QBYA 4UY8I 1RIOH 3L9FA 4A93J 3K4MA 2W85A 5E1XA 4PSXA 1T8IA 4Q48A 1X3ZB 3KPHA 3M8FA 3OSGA 2HYJA 4U88A 3HKZA 2E2IJ 5K7ZA 1Z1DA 1MGTA 4MQ9F 1J2XA 3LSHA 2QLZA 1O7LA 5C4JJ 1BI1A 1HBXG 2ZXJA 2K5CA 4L9VA 2YX7A 2JA6J 1AHDP 1SAUA 3S2DJ 1HQCA 2A69F 4BHPA 3K1PA 3WU1B 3LAJA 1QHHD 1QA6A 2L4MA 3TW7A 1T08B 2CH0A 1BR1A 4P55A 2HU9A 1LJ9A 2Z16A 3G6EI 4CA0A 4IXAA 2XAFA 1B59A 5CVRA 4E6KG 1Z0XA 2PMHA 2EA2A 4EATA 1MMAA 2P81A 2ZJQF 4D7MA 4HV6A 1APLC 2JRMA 1YHQI 3KLNA 3TGNA 5FRNA 2M30A 3LFKA 3OIOA 2B9SA 4GRIA 1MDMA 4L5EA 4X6AJ 2ELHA 3U2RA 1QZYA 1G2HA 3I5UA 2H1LA 1G59A 2FEZA 2K9LA 3EYIA 2HFHA 4DIQA 2CJJA 4ZDOA 4KJZA 2ZSHB 4JQFA 5CVUA 2HZTA 3AG4H 3PJRA 1AA7A 1DDNA 3PSIA 2FE3A 1SANA 5EG0A 3QYEA 4DYCA 4KMUX 3ZMDA 5IOZA 4HLYA 2LREA 4CHUA 1VNDA 4KIFA 4RAFA 3KP2A 5DCMB 1KA8A 3FK6A 5FKLA 3F72A 1S7AA 2X48A 3CUQB 2V26A 4FQGA 3REOA 4ENJA 2Q2EA 3L2QA 2ISYA 4AM3A 5BMZA 3OWTA 1TNSA 2IJLA 3FXLA 1JHHA 2LY1A 3TP3A 4C3JJ 2FA5A 2GM4A 2FD5A 1IXRC 5J1YA 2M4KA 2ZXHA 2MD5A 2WV1A 3R60A 3HUGA 2XHKA 3I64A 4OU0A 1STZA 2VKHA 3LQQA 3VYTB 2ID3A 2X4HA 5EJCA 5ILUA 1MNMC 3G1MA 2DA1A 4RA2A 4LGWA 4ZTJA 4XRSG 5KK1A 1YG2A 2HQ5A 3WG9A 1V55H 4W97A 4F92B 2QQAA 1D8KA 2HVQA 3WGHA 2G7HA 5EDNA 1XTAA 2W24A 3QP6A 3OV8A 2KIUA 4KUMA 2XAUA 1I3AA 3CESA 1U8BA 4EGZA 1HDPA 3QP5A 3QRFF 4L5IA 3KP3A 5JVGF 2YX4A 2LH9A 5F64A 1DGRM 4Q47A 1R49A 3KIOA 4BYYA 2PJRA 1MBEA 4CDGA 3BJAA 4ABZA 2EIKH 4Q5SF 4MGRA 3PO2J 3SEQA 3IWFA 3OYLA 2ZC2A 4A5NA 3GZ5A 3OMYA 3WGGA 2BEOA 1S6LA 2R7XA 3S93A 1QPIA 3VDXA 3G3ZA 2WAEA 4A12A 3KX2A 3L1PA 1I39A 2CFOA 2VI6A 3IV5A 2VPLA 2LP0A 3U9GA 2E5ZA 4D0PA 5CQGA 4EM1A 4FX4A 3HTSB 3CTAA 4QSHA 2K27A 3CMYA 3GFMA 5FO5A 2L2OA 4N9IA 5ICGA 1EF4A 3R6SA 2BV6A 1W0TA 1VQNI 2WA0A 1J59A 5KNLA 5BOXA 3E6DA 1WJEA 5B1BH 4A3IJ 2NVYJ 4GYIA 3RKXA 1IRXA 3RKYA 2QWWA 3ONQA 4HAMA 2VOOA 1OISA 1RR8C 4IO9F 2YUSA 3J7AO 4BJ5C 2QKLB 3K6GA 2HQAA 4DW6A 2D1HA 3V7CA 4NQWA 3ABUA 4EM0B 5L3FA 2P5VA 3OYBA 1IRZA 3H0DA 1RRJA 2CG4A 3IWZA 3ML6A 5FKKA 1P7IA 4DJAA 4I02A 2WV0A 2ZXWH 4IHWA 1PDNC 2KHMA 2BXZA 3PIOF 1TC3C 2L9VA 2PFBA 1JKRC 5LGUA 1JGGA 4A3BJ 3RTRA 2XVCA 2OV7A 4LIVA 1KU7A 1MNDA 3WG7H 4I09A 5IYCJ 3MMYB 4HV5A 1D3YA 5F6FA 4XLNF 1QGPA 2R3SA 1OCCH 2O0YA 2RC4A 3OYMA 4Y17A 2JUCA 1IN4A 1IDYA 3E0JB 3I59B 2W4SA 1DPUA 4DOZA 3PQKA 1ZLJA 3DKXA 1U9NA 4ETSA 1WRJA 1H9TA 3TO7A 3I55I 1BA5A 2Y9YA 5J1RA 2OF7A 4ZZLA 4IOCF 1ON2A 4A3KJ 4BJ6C 2GWRA 2IA2A 3O8HA 3K1NA 2B7EA 1UZCA 2DFEA 2QSHX 3CCUI 3BG3A 2CQ7A 3FMQA 3J7YJ 2E36A 1UJ8A 2FU4A 3HKZN 1XPXA 1YE9A 2JMWA 2QZ8A 1FTZA 3T8RA 1QQIA 1VQ7I 4A3LJ 2EV0A 2F5VA 2LK2A 3CO7C 3C2GA 1H8AC 2E35A 3P9KA 3DEEA 4ENKA 1RUNA 1WJFA 1ZK8A 2VJ4A 3DBHB 3RYPA 3FMRA 4II2A 2LNBA 2EBIA 1UHSA 3HRMA 2HYFA 3BR1A 1ZREA 4AIKA 3W2WA 4RAZA 3WU2C 4Z6YA 1BC7C 4AU7A 2M3AA 2BY2A 1HOMA 4UUSB 3S14J 3DTEA 3H5RA 1WI9A 3QU3A 1JT6A 1ERDA 4E7SA 4I7HA 2RV8A 2HVSA 2DMUA 4XQFA 4PCQA 3LA3A 2DA7A 4NC8A 4KT5C 1IN8A 3QPHA 3WODF 1G3WA 2RNJA 2Y0MA 4WXCA 3W6KB 2V6CA 3FIWA 2XF6A 2X51A 1XDSA 3DF8A 2BHZA 3BQZA 2J5OA 2R7SA 4U0VA 1IUFA 1CGPA 3OYFA 1I6XA 4BGDA 2BGCA 4HNTA 1XSVA 1SFKA 5L3DA 4DNCA 4LG0A 1R22A 2X6XA 2KIMA 2XUBA 3H5AA 4XN3A 1XN7A 1FSHA 2JTVA 3S2HJ 3FXRA 2LTPA 5J6XA 1J09A 2OBPA 4XSZF 1FBQA 2DOEA 3KE2A 2FBIA 1R9TJ 2JSCA 1PJRA 1LDJA 4RBOA 3RCOA 1FNNA 5E1WA 5JLXA 4YIRX 4QTRA 3BCAA 4A69C 5HNFA 2ZFWA 5JI6A 4J00A 4A0YA 3HEFA 3S17J 4DQ2A 1P7JA 3NAUA 5AIQA 2ZO4A 3IRRA 2MLKA 3E7LA 2R5ZB 4OIQF 3LSRA 3WU0A 2VPRA 5HLHA 1NG6A 2NNNA 1NG7A 3K1MA 3ERED 4CZZA 1O57A 1FOXA 2VC0A 2EFNA 5IT3A 3A01A 1JJ6C 2JWTA 3DXJF 3FISA 4RAYA 2RREA 1X4PA 1I6HJ 5DM7F 1RZ4A 2W25A 3ABTA 4BS9A 1LNWA 4ZYAA 1B1BA 1F36A 1XGSA 1NH3A 2A6HF 3ZMSA 3KEOA 3K4LA 3HOUJ 3M8JA 2VOPA 2OTLI 2X6OA 1J9IA 5FFXA 1YX3A 3HDDA 1U5TB 3KP4A 2JSPA 2M2EA 1MBFA 1S7EA 2XRNA 4JX5A 4BKXA 1S3JA 5DUKA 4F55A 5L3EA 2HZDA 4IHVA 5FLXZ 3NWTA 4CSWA 3BG5A 5TGTA 4E4HA 2RDPA 5M5XJ 3RSNA 3ERMA 5FKNA 3SFZA 2CWEA 2HI3A 1X3WB 3K4JA 1Z6RA 1Q1VA 4BDYA 4E7LA 3I3LA 5E8GA 3N97A 1GVDA 3JSPA 5FRMA 2HGCA 1ZGAA 3HHGA 3GTLJ 3A1YA 5E17F 4DYRA 4E7JA 1R1UA 2JJ7A 4RAGA 3MZYA 5DDGA 2BVMA 2V9PA 2EIJH 5LGTA 3I0TA 5D6FA 4V2FA 3HB9A 2NRAC 3ZCOA 1Z3YA 5EEHA 1RC9A 1W36D 4HF2A 3CDHA 2GBYA 2HTSA 4C9YA 1B6AA 1T38A 4XLAA 3J7ZI 2DOFA 4JX4A 5J4VA 1RKWA 1ODDA 3PUFA 3F22A 5DD8A 2DT5A 2VLAA 2VC1A 1XS9A 1AOYA 1TTYA 5F08A 4LLNA 3F6VA 3O8GA 3LSMA 2FQ3A 5HDGA 4MFEA 3ISPA 4AIHA 3BR0A 2QBYB 2VQHA 2WB1A 3WTWC 2P7VB 2R0QC 3MAJA 3ASNH 4C3HJ 2W84A 1YJWI 4P96A 2AQEA 5DEQA 3CCLI 4UHTA 1BI3A 1XCVA 3LSTA 1EH8A 1OFCX 4IRHA 1SC7A 1R36A 3IH2A 3GF2A 4F7ZA 1CF7B 2LLKA 4HNUA 3FDYA 3EQLF 2Z5UA 2DU9A 4P5OA 5IP7J 2R7WA 2MGQA 2MC4A 1USSA 2ZSIB 2V1NA 2CGPA 4FETA 1QO0D 2CUZA 5GPAA 4RB2C 1GT0C 1T6SA 1V5GA 1TT5B 3CMEI 1SD7A 4RM3A 5F27A 1T0FA 2CUFA 5IOYA 3TDZC 4PJLA 4L5JA 1P4WA 4F93B 3L2RA 3DFGA 4J01A 2NNYA 3DP7A 3P9CA 1P9QC 1B8IB 4JX6A 1N77A 2E19A 1GV5A 5M3MJ 2DMQA 1ZR4A 4HF1A 5IP9J 2Q1ZB 4RB0A 1R5ID 1JE8A 2P5LC 1T98A 1RNLA 3JCUC 3Q9VA 2FNAA 2VJIA 1Z67A 2VKEA 1YJNI 2OC6A 2MSYA 4FASD 3OS0A 4CCLA 5HOOA 4XMYA 3HC7A 4CXFA 3GW2A 1XCBA 3ZMZA 3FHZA 1LFUP 2HWVA 4C2UA 3K9TA 3F8NA 5F04A 1TZLA 5FLVA 5EG0B 4LK0F 1ZG5A 2E1OA 2H6BA 1PP8F 1YRNA 2ESHA 1D1CA 2R7QA 3K69A 2VBXA 1I1GA 4RS8A 5DCFA 1A31A 5HODA 2HOEA 3ZGKA 2DN0A 1K7AA 3F8MA 5BQTA 2L7KA 4E7KA 4H4KC 1JT0A 2Y9ZA 1ETOA 3H5NA 3HOYJ 1BM9A 5H2FC 4BUPA 1VQLI 5D6EA 1JKPC 3K2AA 3JRCA 1BJZA 4C30A 3AFHA 1YIOA 1DQUA 3VYSB 3PNVA 1WKMA 2XKOA 3HUGB 3ZN0A 3KZIC 1ZGWA 1T0FC 2Y31A 2VBZA 3A02A 4N0BA 4ZC3A 3PNYA 1FP1D 1Y8RB 4MHGA 4YFNF 5D4SA 2I10A 1REPC 5J40A 2X9DA 2IT0A 4IQJA 4MEXF 1X1AA 5DTDA 1XD7A 4ESFA 3GTJJ 2DO7A 3M9AA 3HOTA 3SYTA 4C2TA 4I2OA 2R93J 1VQ5I 2AS5F 5CVIA 1T56A 1TW3A 3JRAA 3M4OJ 3CCYA 3AG1H 1W7PA 2OCCH 5GTIC 1KYZA 2HXOA 3QYBA 1TQIA 2CUJA 3J80Z 1IAWA 3OYJA 3OIPA 1UELB 3P9IA 2XKPA 3KETA 3C2BA 1S72I 3ZXSA 2H1KA 2K9NA 1YW9A 2R4GA 1FYMA 5HDKA 4M9SA 3EPZA 3QPSA 4JBAA 4NC6A 1ZH5A 3DWLE 5JR3A 1K4SA 3JRFA 1Z7UA 3V8JA 3IRQA 3ESWB 3GYHX 3ZQLA 3HGGA 4L0YB 3HOVJ 2XAQA 3RPUA 2CRGA 2IGKA 1XB4A 1U8RA 1NHAA 1MH3A 5LFAA 2QYOA 2RQPA 1RETA 3JTGA 1IXCA 1BN5A 5HLIA 2L54A 3OYGA 4AC0A 1BBYA 3HPGA 4EJVA 1ZHFA 3ELKA 3LNQA 3GTMJ 2B63J 2F2EA 2KLOA 2WY8Q 4HX4A 3GTGJ 4BAYA 1XG1A 1FWZA 1MJAA 5B5EC 1O4XA 4NBQA 1W0UA 1UCRA 5HLTA 2A07F 2XB5A 1BOAA 4MLOA 4KIBA 4Z2YA 4PFPA 2KISA 1Q1HA 5F0FA 4HDUA 3MCZA 2YU3A 2HVRA 3WTYC 2PQ8A 4ANJA 2WAQA 4HOBA 2LMDA 3BTCA 1BI0A 2CO5A 2IW5A 2V9KA 2Z1DA 1SVOA 1W5TA 3O6BB 4HPQA 4ASNA 4AIDA 4BXXJ 1O7FA 1ULYA 1GLNA 1YO5C 3G73A 4CGZA 4N9HA 3E1SA 5F0HA 1FX7A 5B3SH 3BLYA 3ZR8X 5GAGJ 4M3BA 2MH9A 2D2WA 3PIPF 4A3CJ 3BTLA 2XGEA 4B3XA 3WTXC 2ELJA 3DEUA 2ME6A 1PVEA 3BG9A 2E71A 2VKDA 2ESNA 2EINH 5E3NA 3GZ6A 3L09A 1MBGA 5CLSA 2WB1N 1HA8A 3PQJA 4P1WA 2ECCA 1S8NA 2FSWA 3CCEI 3D1NI 4IF4A 3F0CA 3LSGA 3DTKA 1A6IA 1M1EB 4XLEA 1V5EA 2K3FA 4XOTA 4KNYA 2GXBA 4OINF 2KP6A 1LFPA 2CQNA 2P7CB 2IS6A 4LITA 2JQ7A 3HYIA 3TOAA 4FCYA 4BHCA 2L7MP 3I53A 4AYBA 4D7NA 3KYCB 2W00A 4Y3OA 3ZRGA 5LHGA 1ZGJA 2OZ6A 2QEXI 1MMDA 2L9NA 3FM5A 1K6OA 1OPCA 3BJ6A 3IKVA 3QWLA 4S04A 1VQMI 1NK2P 4PJMA 2F5DA 2WAFA 3E5XA 3CF2A 3Q0UA 4EQQA 2BVLA 1MJBA 5CKTA 3ZMVA 4BEHA 1VF9A 4N4OB 1O3QA 1LDDA 4XRSA 3G4SI 1LVAA 2M8EA 2E7XA 1JXSA 1DP3A 2Y2ZA 2FUG2 4ESJA 2IEKA 1FZPB 2K4JA 4UUVA 1R1TA 2CYYA 1IXSB 2QUFA 2KRCA 1N25A 2XV4S 3BTIA 4NC7A 4B43A 4AIJA 4M3FA 5FLXK 5K5OA 1F9NA 4M9XA 3A0HC 1R1VA 1S5LC 3K4CA 1KU9A 2DMNA 4CO8A 3HSFA 4FE7A 4PJNA 5KVRA 4EJTA 5FKOA 2GA2A 2XPUA 1U78A 3R0AA 5TJJA 1KGSA 2OAZA 4R79A 4KN4X 3L2UA 4QIWN 2JA5J 2RKHA 2LKXA 3MEXA 2PEXA 3WTZA 3FF5A 4LG0B 1Y0NA 4ZYDA 4XONA 2MFZA 2YU9J 3K70C 3DBRB 3HPHA 3AG2H 1VQ9I 5JLWA 5E1ZB 2DPUA 3DEWA 2KT0A 1ETXA 4G8XA 4RGUA 1ETVA 4CCMA 2M9HA 3WTUC 2IS4A 3PFIA 3HRSA 4LIUA 2L3DA 5JVTA 2ZB9A 1HC8A 1EV7A 5IP6A 3GFIA 3B6AA 5J47A 3PFYA 3MWMA 4MQVA 4W1UA 1R58A 3OYKA 3CC2I 1I3QJ 5C4XJ 2HPIA 5M5YJ 1R71A 2DODA 5CPRB 1Z3XA 3BZKA 1JJ8C 2RQQA 2A5WA 2BYVE 3BG7A 4RB1A 3F23A 2VE9A 4XORA 4MEYF 3TW6A 2O6GE 1AKHB 3J7AY 1Z77A 1Y8QB 1F1ZA 4BXUA 1GXPA 2DDBA 3LSPA 3A01B 2JPBA 4U0YA 3E6MA 2UWMA 4EJUA 3CP2A 3DKYA 3LL7A 3E97A 3VYRB 5FD6A 4KMFA 4IKFA 2Y69H 2Q8KA 4FX0A 1EJ9A 2QGUA 1E2XA 2VN2A 2DTZA 1U0JA 4BQOA 2I5UA 5JFRA 2R92J 3SHFA 4B44A 2V1DA 4DBQA 3BQYA 3S3MA 5L3CA 2VQCA 1ZARA 5LD2C 4B4CA 1QHGA 1QZEA 2LKPA 2OCEA 3M07A 5CJ9A 4Y52J 3ZQIA 3MKZA 3C1DA 1WJBA 2DT7B 3CLQA 3OS1A 1YS7A 2KJBA 4N4NB 3HRTA 4L9JA 3OL3A 3H36A 3T1BA 1ETWA 1JKOC 4M6XA 2PLYA 3S32A 4QWQA 2F4OB 2DA4A 1IN6A 5EGOA 3R0JA 4E7ZA 1RPWA 4S0HB 2ZNZA 3SQNA 1MIJA 3NEUA 9ANTA 2ME0A 2DA3A 2QCOA 1V54H 2ISZA 4BE1A 4CZCA 3FXUA 3FKJA 3K2ZA 3JRDA 3HOSA 4NHJA 3HXLA 5LHIA 2DK5A 3GX4X 3S3NA 3FWEA 2ZMEB 5H6RA 3SZGA 3ZQFA 2J5PA 4HYEA 5HS7A 2R7TA 1Y0UA 1A04A 2PX9A 3HTUA 3FXJA 2QKMB 4ESBA 1LDKB 4OMZA 2WAQN 2HKOA 2L7ZA 1K78A 1X1PA 2QM3A 4MIMA 4PJ0C 4IOAF 3HBLA 3EDPA 3DU6A 1P92A 3EUKL 3RKQA 3NQOA 2JT1A 2BBYA 5EEGA 4I98B 3BT9A 1AWCA 1FP2A 3M1EA 2EK5A 2XB0X 1IV8A 1POGA 2JK3A 4HQMA 5E20A 2KIFA 4MTEA 4F91B 2A6TA 2JUGA 2E1CA 1R4MB 2AO9A 2IAIA 1HKSA 2UXXA 2FMYA 3BR5A 4RGSA 3Q0WA 1XGMA 3JSOA 2DI3A 2KPMA 2N8GA 3BR3A 2LBFA 1MD0A 1SVLA 1OCTC 1BR4A 4J19A 3CJNA 2K9SA 3H3ZA 2XPVA 3PM1A 4A3EJ 2DMTA 1JHFA 2P8TA 4YELA 2NVQJ 1PYVA 2X85A 1VQKI 3FK7A 4BXFA 1U9OA 5EYRA 3J80K 3CCSI 2QQ8A 4PJJA 4M74A 5DCMA 2L01A 1JTYA 2NXNB 2XAHA 2ACJA 3CUQA 4AYBN 2HTJA 4I01A 3DPTA 4HSRA 4XKWA 4NNJA 2HDDA 4YFKF 2MH2A 5ICCA 2JA7J 3H9GA 1U6GA 1WWXA 3SFIA 2WBMA 3GXOA 3EUHC 4UVCA 4FHTA 1X58A 5HS8A 1Z21A 3OOPA 4XR6A 2WTEA 3A4CA 3HZJA 5FLMJ 3X2QH 2R7VA 1ZG3A 5EF6A 1ZQ3P 2C6YA 2CW8A 2L9RA 1TLHB 5ILSA 5C3EJ 4X0GA 3U1DA 4GO1A 2O61A 3S8PA 1HKTA 4GCVA 5M5WJ 3ABLH 3ULQB 2CQXA 4G7OF 3DKWA 3VSLA 3M7GA 2A5YB 3SEZA 1UG2A 4IZZA 5K1YA 3RPQA 2HOTA 1E17A 2VONA 3HSEA 1WQ2A 2XASA 2ICWG 3TO6A 2STTA 4BY7J 2XRLA 1B4AA 2D45A 3ZQQA 4M9ZA 1TWFJ 1Y6IA 4IQ4A 3IP4B 5GAHJ 1O3RA 2R5YA 1Z91A 2KRFA 2BW3A 5D8LB 4KICA 1NTCA 4ZYHA 5IT9Z 4ENMA 2NAZA 2OQRA 1WJDA 2PMZA 3UR3C 3K4NA 4BJTA 1HXDA 2ETHA 2MW8A 3I4NJ 3CUQC 4ZZDA 2O8KA 4HA8A 4OAYA 2NS0A 5EEAA 2DJIA 3E5UA 1XMAA 4V2GA 2STWA 3KLOA 3ZMTA 3L00A 4BQNA 3ASOH 3SJMA 2BE5F 2XGCA 1SMTA 4WCGA 1IDZA 2HS5A 1F43A 4I76A 4MFDA 2V4JC 4PZJA 3TEDA 2MLGA 2E7WA 2PBIA 5K7FA 5GP9A 3AAFA 1LE8B 1ZELA 1D0XA 2K4BA 4C2MJ 1LEBA 4IRGA 4P9FA 4RM2A 2LSOA 2M87A 3A2KA 1IO2A 3H0GJ 4BNCA 2DFHA 4HLXA 4YRVA 1YYVA 2VT3A 3NWSA 4QPOA 3VYUB 2LF7A 5DD4A 4YFXF 2XGDA 4XSXF 4RGRA 2FJ1A 4UUTA 3S1QJ 3OYHA 1MW7A 5B66C 3J81Z 3A0BC 2QVOA 3ZOBA 3MKYB 1F5TA 1X2NA 1FSEA 1G3SA 3JTHA 2ZJRF 2HDCA 4IVNA 2EWNA 3EUAA 2O9LA 4UXNA 2OA4A 3LSIA 1E3HA 2G7UA 1D1AA 2ECBA 2Z99A 1YW8A 1X3UA 1WJCA 4UVAA 3IH3A 3F8BA 1ACIA 3I59A 4IPAA 1HCRA 3PO3J 6PAXA 1SD6A 3C2HA 2FBHA 2ZNYA 2V1UA 3DQVC 5CVJA 2GXGA 1FLIA 2GA1A 1KZHA 2CW0F 2V1XA 3CZ6A 4U7BA 1UB9A 3CP8A 2DYRH 2A05A 3FXMA 3QPLA 5F1JA 4XIDA 2KQRA 2F4IA 5HVQC 3VSKA 2D1VA 2GAUA 4X1EA 1MBJA 1TWCJ 2M34A 3KZYA 4BDZA 1G3TA 3QAHA 3T8TA 1QPMA 3OR1C 4M71A 4MO7A 1OCOH 2GOXB 2IS2A 2FOKA 4HX8A 3MVPA 4GYGA 4WWCA 3ZQCA 2DA2A 2OUMA 3L2WA 4E7IA 4IEJA 2KIQA 2PN6A 2ZJ2A 3FKIJ 3TKYA 2XIGA 2ID6A 4M3EA 4O6JA 4KITB 1EH7A 4XLFA 3M3YJ 2K86A 3H3VK 4A3FJ 3S16J 2COMA 2VQLA 3CMMA 2PG4A 3IL2A 3QQAA 1I5ZA 1MMNA 2VQGA 2ZKZA 4LOCA 4HW0A 2VE8A 1OQYA 1TWAJ 1MMGA 2O7OA 4FE4A 4F52A 1MDMB 2W82A 2FRHA 3HOZJ 1T95A 1LB2A 1FY7A 4IRIA 3D5LA 2FF4A 1HSJA 2PMUA 5J1UA 1YX5A 4BH9A 5DS9A 2FQ4A 1TT0A 1W1WE 4CYCA 5ICFA 1H9GA 2P6SA 2D5VA 1K61A 5K5RA 1Z05A 4G6TB 1SFUA 1BOBA 3GTPJ 5IYBJ 3DTIA 4U0WA 4BHBA 1ZYRF 1B9NA 2ZMEC 3S3OA 4OIOF 1MH4A 5L3BA 1XMKA 2LC2A 2EZLA 3QYFA 3GVAA 1KYWA 1D0ZA 1KU2A 1TWGJ 4B47A 1LKXA 1OYIA 2Q2EB 4G6QA 2X1CA 4LK1F 2MBFA 3B02A 2DT6A 2ELKA 2NS8A 2Y30A 2OQGA 2Y0SA 1WGXA 3IAS2 2B0LA 3GTOJ 1ONVA 2YR2A 4IX7A 1XDUA 4YIIA 3SZPA 2P4WA 4JYKA 3JRHA 3BJOA 4XNFA 3MKWB 2KKOA 2DK8A 4CCNA 3JREA 5J8CA 3RI4A 2IGNA 2YSRA 1Y1WJ 5DV5A 2DXIA 2LY2A 4RMNA 3WHCA 3W3CA 3HOWJ 2HXIA 4BQQA 1MMSA 3O2PE 4V19K 3RQ4A 3S2WA 3HHHA 2GOMA 4IHYA 3DPLC 1ZAOA 3S1NJ 1V3FA 2LD5A 2IRFG 4CCJA 3BP8A 3KFWX 3P7NA 2Q0OA 1JUSA 4ENNA 3V8KA 3LSJA 3R61A 2KMUA 4B09A 2PJRB 2EPFA 3LQRA 4TV7A 4EVIA 1H88C 3TO9A 1WVRA 2WY7Q 3DBLB 3SDGA 3D0SA 2CU7A 4DGWB 2OPTA 2IPQX 2O5RA 3W2VA 4LFUA 3Q3SA 2EIMH 4KFCA 1B72A 2BZTA 3RJPA 3GLLA 2H8WA 4BU2A 1ZR2A 2PMZN 1VTNC 2E1NA 1JUPA 2DFIA 4LLGF 4KDPA 2H09A 3H92A 2R7OA 1A36A 2QQ9A 2V9VA 2H8RA 4CYDA 1O3SA 3CCVI 1UFMA 4E70A 5FKMA 5F1RA 1FMVA 3SXYA 5L3GA 4R8HA 2W7NA 3OS2A 2XSDC 3CDIA 5F0CA 4O5VA 3WTVC 2DAOA 1OCPA 1YTYA 4B3AA 1S7OA 4NQWB 2TCTA 5AIPA 4RDUA 2DTRA 4HX7A 4UVBA 5D5UB 5LBQA 4WK8F 3PNTA 1MZBA 4PUSA 1EA3A 2XF7A 4EV0A 3GFLA 3HM5A 1HW1A 3BDDA 2IA1A 3JR9A 2DYSH 1MBHA 1DP7P 2EILH 3MZ8A 5LRRA 2A68F 2P0WA 4M6VA 2DPDA 4B48A 3ZQGA 2XAGA 5EGOB 1IZ1A 3Q0VA 3COAC 3WE2A 2VXDA 2NVTJ 2LRDA 3P5JA 4L9NA 3G1OA 1SEUA 5BS6A 2M8GX 2WC2A 1W36C 1S9HA 3FBNB 4RGXA 2NYXA 3RIRA 1PUFA 1GVJA 1TP4A 2EJRA 3RDIA 2KDZA 3RKWA 1YFHA 3OYAA 1R5HA 3H9JA 3G1LA 1U5TC 2LF8A 1HDDC 3IKTA 4CCOA 2KDOA 1CF7A 1I50J 2HPMA 2X0LA 4HSTA 4OAZA 2KRHA 2AHQA 3V42A 3OYIA 1SAXA 2P6TA 2YS9A 4D5CA 1MSEC 4R1HA 2QSGX 3GFJA 4XICA 4XK4A 3E6CC 3F9KA 1K78B
chains in the Genus database with same CATH topology
3CCUI 1FOXA 3G4SI 3J7YJ 2E36A 2FOWA 1VQPI 4UY8I 5DM7F 5JVGF 1VQ7I 2E35A 1FOYA 3CF5F 1VQ6I 1YJNI 2ZJPF 2OTLI 5GAHJ 1QA6A 5GAEJ 2H8WA 3G6EI 1VQ4I 1YITI 1YIJI 3DLLF 4IOAF 2ZJQF 5GADJ 3CC4I 3CCVI 1YHQI 1VQ9I 1VQNI 1VQ8I 3CJTB 1HC8A 1VQLI 4IO9F 1Y39A 3CC2I 2OTJI 3G71I 5GAGJ 3J7ZI 3PIPF 3PIOF 3I56I 3CCQI 1VQKI 1YI2I 3CD6I 3CCJI 5DM6F 3CCEI 3CCMI 1YJ9I 2E34A 2ZJRF 3CCSI 1VQ5I 2NXNB 2K3FA 1YJWI 1FOWA 1VQOI 3CCLI 2JQ7A 3CCRI 2QEXI 1ACIA 2QA4I 1VQMI 1S72I 3I55I 3CC7I 4IOCF 3CMEI 1MMSA 4V19K 3CMAI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU I;  1FOX A;  3G4S I;  3J7Y J;  2E36 A;  2FOW A;  1VQP I;  4UY8 I;  5DM7 F;  5JVG F;  1VQ7 I;  2E35 A;  1FOY A;  3CF5 F;  1VQ6 I;  1YJN I;  2ZJP F;  2OTL I;  5GAH J;  1QA6 A;  5GAE J;  2H8W A;  3G6E I;  1VQ4 I;  1YIT I;  1YIJ I;  3DLL F;  4IOA F;  2ZJQ F;  5GAD J;  3CC4 I;  3CCV I;  1YHQ I;  1VQ9 I;  1VQN I;  1VQ8 I;  3CJT B;  1HC8 A;  1VQL I;  4IO9 F;  1Y39 A;  3CC2 I;  2OTJ I;  3G71 I;  5GAG J;  3J7Z I;  3PIP F;  3PIO F;  3I56 I;  3CCQ I;  1VQK I;  1YI2 I;  3CD6 I;  3CCJ I;  5DM6 F;  3CCE I;  3CCM I;  1YJ9 I;  2E34 A;  2ZJR F;  3CCS I;  1VQ5 I;  2NXN B;  2K3F A;  1YJW I;  1FOW A;  1VQO I;  3CCL I;  2JQ7 A;  3CCR I;  2QEX I;  1ACI A;  2QA4 I;  1VQM I;  1S72 I;  3I55 I;  3CC7 I;  4IOC F;  3CME I;  1MMS A;  4V19 K;  3CMA I; 
#chains in the Genus database with same CATH topology
 2IA0 A;  1XC5 A;  1I1S A;  1G8X A;  3HIF A;  3QOE A;  1JTX A;  2DDA A;  1U2W A;  3IHU A;  1O3T A;  2XSJ C;  3HGY A;  1LEA A;  2GIZ A;  1OMI A;  2EFW A;  1D5V A;  3WHB A;  3GEZ A;  2DLL A;  1K4T A;  3BG6 A;  5KAI C;  1B8I A;  2VUM J;  4BBS J;  4OIP F;  5E3O A;  5HNH A;  5H20 A;  2FNP A;  3OYC A;  4AVZ A;  5IT9 K;  1FYK A;  3F21 A;  4WXD A;  2L7F P;  4DBR A;  4IL6 C;  2QF7 A;  4XN0 A;  2JVG A;  2VB6 A;  2X6Y A;  4OIR F;  2LBF B;  3MN2 A;  5JHU A;  2GQQ A;  2LFB A;  4EM2 A;  1HKQ A;  1VQ4 I;  1E3P A;  1XSD A;  1H89 C;  1YIT I;  1YIJ I;  4EMS A;  1GDT A;  4HG2 A;  1SD4 A;  2LVS A;  1UST A;  2GXA A;  1UMQ A;  3OSF A;  2A61 A;  4XRF A;  2NVX J;  2DJN A;  1IW7 F;  3UKG A;  1DPR A;  1X1D A;  1OYW A;  5K7H A;  4ZH4 F;  2RAE A;  4L0Z B;  3HL2 A;  3PL8 A;  3JRG A;  4KA4 A;  1A5J A;  1X2M A;  2HQN A;  2LOO A;  4KN7 X;  2EA4 A;  4BBR J;  5LRS A;  2EB7 A;  3GME A;  4KT6 A;  1QU3 A;  5FGM A;  2JVH A;  4M3G A;  2MC3 A;  2FXA A;  4DYQ A;  2Y48 A;  2M5W A;  3GLX A;  2IS1 A;  2CMP A;  3HG9 A;  3TMO A;  4HEA 2;  3ECO A;  2M0C A;  4XLH A;  4A3M J;  3J81 K;  4D1Q A;  4HQE A;  3B73 A;  1OR7 A;  3N05 A;  4WX9 A;  2VJ5 A;  2CQQ A;  3JRI A;  3V8L A;  3VFZ A;  4NUB A;  1KQ9 A;  2OD5 A;  3I54 A;  4GFB A;  2JA8 J;  2Y0S N;  2EFP A;  4BL0 B;  1HW2 A;  2CUE A;  2E5N A;  1ZRC A;  2DA5 A;  3CQZ J;  1YJ9 I;  2E34 A;  2LG4 A;  1SFO J;  4XKC A;  3R4K A;  2ZBK A;  4NB5 A;  2F48 A;  2LR8 A;  1X1B A;  1WHU A;  4LLL A;  5LHH A;  4MTD A;  2PJP A;  4YG2 F;  1T33 A;  4I0A A;  2BY3 A;  3V4G A;  1YW7 A;  2LYC A;  4Y7N J;  1ZLK A;  3ABM H;  4XL9 A;  4A0X A;  5GTH C;  3WE3 A;  3OYN A;  3ABK H;  4GXO A;  2UV1 A;  1N78 A;  5CVV A;  1ON1 A;  2IXS A;  2R5Y B;  2COB A;  3CC7 I;  1BI2 A;  2MYS A;  3IC7 A;  2MD0 A;  3JAM Z;  4HNV A;  3CLO A;  1B9M A;  2BW3 B;  1OYY A;  4HZF A;  1TWH J;  2FML A;  5A2Q Z;  2FOW A;  4I0B A;  4UB8 C;  1X4O A;  4MNU A;  4U7D A;  4H0E A;  3AL0 B;  5TRD A;  3I4M J;  1YQA A;  1F4K A;  5LEJ A;  3UNG C;  2R7F A;  4IHT A;  2NOJ B;  4UV9 A;  4EJW A;  2NVU B;  2CQK A;  3RZD J;  2IGM A;  1FOY A;  1MKM A;  1OR7 C;  2VT2 A;  3DCF A;  4ZDP A;  4Q4Z F;  2AXT C;  2ZJP F;  1GXQ A;  3EYY A;  4XBF A;  4IHS A;  2EZH A;  3T0Y A;  1WFX A;  1BW6 A;  2A6E F;  1FOK A;  1ETQ A;  2W1O A;  3FX3 A;  5ERI A;  3U1K A;  3LSK A;  3KP5 A;  5ED4 A;  4ON0 A;  4FIS A;  3N4M A;  4RB3 C;  2M7B A;  1SD5 A;  3H35 A;  3WTT C;  5B1A H;  4LB5 A;  4BY1 J;  2UXN A;  1TNT A;  3CC4 I;  2W57 A;  1R00 A;  2M45 A;  4M73 A;  4G94 A;  3W6J B;  4I6Z A;  3BWG A;  2O8X A;  2R7Z J;  1D1B A;  4DZP A;  2WAD A;  3BCB A;  2V79 A;  2BY0 A;  1H0M A;  3H9Q A;  2VOD A;  1XX5 A;  5J3L A;  4JP0 A;  1IG7 A;  1ZRD A;  4LJZ F;  2HNH A;  1HLV A;  4BQA A;  3FM3 A;  3EUH A;  2QSF X;  3L2C A;  3U21 A;  1C0W A;  1UG0 A;  3G2B A;  3BY6 A;  2VBW A;  2KZG A;  3BTJ A;  5ILV A;  4GGG A;  1TBX A;  1SFX A;  3I56 I;  2L9S A;  4HBL A;  2XPW A;  1KQ0 A;  4G6D A;  4E7H A;  2IBD A;  1T2K A;  3PSF A;  3CD6 I;  1RI7 A;  3DU5 A;  3CCM I;  3OR2 C;  2XAJ A;  1RUO A;  2LDU A;  1OJL A;  3ZQ7 A;  2QEN A;  4Y15 A;  3F3X A;  1YLF A;  3KYD B;  1BL0 A;  1FOW A;  3BZ6 A;  2DBB A;  2K3P A;  2DW4 A;  4WXH A;  1TQP A;  3FXQ A;  3V7S A;  2KJC A;  4BE2 A;  1E3O C;  2R7U A;  3OYE A;  2K02 A;  2VKV A;  4UV8 A;  2CV0 A;  2O03 A;  5FJ8 J;  1QBJ A;  1E0E A;  1FT9 A;  1IGN A;  2YPR A;  2GLO A;  2X6W A;  4OOI A;  1Z6T A;  1R23 A;  1W4M A;  3F6O A;  4ZJZ A;  1IRG A;  1IV6 A;  1HST A;  2F5F A;  2H6C A;  3VOD A;  2PI0 A;  2F6C A;  1RR7 A;  4UB6 C;  1QVU A;  1FMW A;  4A2U A;  2GZW A;  4EGY A;  2DOA A;  2FBK A;  3HJE A;  1SMY F;  3MD2 A;  1J5Y A;  1WPK A;  1Y1V J;  5BNG A;  5KHD A;  2I8D A;  1OCR H;  4AWX B;  3I4P A;  3VEP A;  1JI8 A;  2VAS A;  2VL8 A;  4KYW A;  3CDL A;  4FT8 A;  1ETK A;  4CYC B;  3SZT A;  1VQ6 I;  4A6D A;  2CS3 A;  2XDV A;  2NOG A;  5LEK A;  3WGI A;  4XLP F;  1OCZ H;  3EET A;  3C7J A;  5GAE J;  5C44 J;  1R4N B;  2EH3 A;  2OZU A;  1BC8 C;  2OJE D;  4A0Z A;  4NDL A;  1FPQ A;  1YRN B;  2QQB A;  3FHN A;  4BAC A;  5D4R A;  3D5S C;  4ZYE A;  2VIX A;  3TL4 X;  3QPT A;  1FTT A;  4XM3 A;  1NK3 P;  3KP7 A;  3Q5F A;  2CSO A;  2E1M B;  3BRO A;  1WCM J;  4OMY A;  3LOC A;  3FZV A;  2CV1 A;  2X1D A;  1LVK A;  2L5Q A;  3CJQ B;  4IJA A;  3QU6 A;  5BPD A;  1D0Y A;  2Y75 A;  3C3W A;  1DGW Y;  5H6Q A;  4A6E A;  2EV5 A;  1BIA A;  3KZZ A;  3GTQ J;  4JK1 X;  1V5F A;  4L9T A;  3K10 A;  5TIS C;  3GCM A;  5IPA A;  4AD9 A;  4LB6 B;  3JRB A;  1SFE A;  2VJJ A;  2KZV A;  2OTJ I;  4RLQ A;  2JRT A;  4II3 A;  2ZFU A;  3GBG A;  3KCC A;  3TOB A;  1RKT A;  1MNE A;  2IVM A;  2WWY A;  1UHW A;  2F5E A;  3CCQ I;  1ZKG A;  2R7D A;  1K79 A;  4XRM A;  1PP7 U;  1YI2 I;  4LMY A;  1IF1 A;  2BY1 A;  1X19 A;  5GPC A;  3K0L A;  2NS7 A;  1AKH A;  2CW7 A;  2Z3Y A;  4S05 A;  4YEJ A;  1HW5 A;  3BR6 A;  1K83 J;  3GWZ A;  1T39 A;  1W7P B;  1DUX C;  2GIV A;  4HDV A;  3RZO J;  1ZG1 A;  1P6R A;  3KP6 A;  3FXO A;  1P2F A;  3DPU A;  1IC8 A;  5KCM A;  3GO5 A;  2JZY A;  5EZH A;  3F8F A;  1JKQ C;  3CCR I;  3M1C A;  1FYL A;  3K4K A;  4XOP A;  2K9Q A;  3DLA A;  3ZMU A;  1BR2 A;  3S1M J;  4IHX A;  1YS6 A;  3OIQ A;  3BC8 A;  1B72 B;  4AVP A;  3QOP A;  2ADU A;  1ZRF A;  1LFB A;  3I58 A;  1WSU A;  2XF5 A;  3E5Q A;  2HDW A;  3CUO A;  2LKS A;  1GUU A;  2R7R A;  1LQ1 A;  3K4B A;  5FRO A;  1QRY A;  1QZZ A;  4YIF A;  4ZDL A;  3KEQ A;  3NAR A;  3CO6 C;  5E8I A;  1KU3 A;  1OKR A;  1OLT A;  2HYG D;  3FMS A;  3LA7 A;  4G7H F;  3GZN B;  4CCK A;  1J75 A;  1WH5 A;  1WH7 A;  3ZPL A;  1W7P D;  5J8F A;  4LD5 A;  5D5X B;  5K5Q A;  1GV2 A;  3W6V A;  3CF5 F;  2L0K A;  5ICE A;  5HDN A;  3AG3 H;  3LWF A;  1WJ5 A;  4A3J J;  1ETY A;  5CQE A;  2UUZ A;  4OWR B;  2HOS A;  3TP0 A;  2G9W A;  4HF0 A;  2L02 A;  2ZME A;  3IUO A;  1AU7 A;  1G6N A;  2KFD A;  3BPX A;  4PGG A;  5E79 C;  4Y13 A;  2DQL A;  1W5S A;  2H94 A;  3ZP5 A;  1JGS A;  2F5C A;  2K9M A;  3KEY A;  2HR3 A;  3H3U A;  3DLL F;  2CV2 A;  4GDF A;  1FC3 A;  3L2V A;  1IN5 A;  1MSF C;  2E2J J;  2K40 A;  2IGO A;  3GUD A;  1S29 A;  5GAD J;  3E6B A;  5IY5 H;  2V6E A;  1XMX A;  3RPU D;  2Z9O A;  4ZYG A;  4QLC U;  3O3K A;  3AL0 C;  3T5X A;  4PFO A;  3TDU C;  1VQ8 I;  4QPQ A;  2CFX A;  3MFK A;  2TRT A;  4Y33 A;  1Y56 A;  1DU0 A;  1PUE E;  1KON A;  4B1R A;  1PUF B;  2EV6 A;  3BPV A;  1Y39 A;  3ECH A;  2RGV A;  1N75 A;  1K6Y A;  1D5Y A;  1VFC A;  2P5K A;  1RES A;  1LPQ A;  2M0M A;  1V4R A;  5M3F J;  4UNO A;  1G4D A;  1EH6 A;  3FBI B;  4UUS A;  4M72 A;  4C3I J;  1J0R A;  2DMP A;  1ENH A;  3RQI A;  2Z33 A;  4A3G J;  4CIC A;  3SDB A;  3M8E A;  5DM6 F;  4D9J A;  3MQ0 A;  4DZJ A;  1DU6 A;  1ZTR A;  2BXY A;  1A6Q A;  2RVC A;  4F3Q A;  3LMM A;  2M1B A;  4M6Y A;  3V7R A;  3JW4 A;  4XLC A;  1Z7L A;  1L3L A;  1VZ0 A;  2XGX A;  4D5F A;  5E18 F;  3JAM K;  4PDK A;  2X1E A;  3W2A A;  2ZCW A;  2V7F A;  4EJO A;  2AQF A;  1FEX A;  4CUG A;  2DQR A;  4PGH A;  2DFF A;  5A2Q K;  3H1C A;  1TL8 A;  4BEH B;  3IH4 A;  3QOD A;  3OOU A;  1WZ2 A;  2VBY A;  2EZI A;  4PK4 A;  2KL4 A;  3VPR A;  4XKB A;  3B6C A;  3IAM 2;  5KAF C;  2K7L A;  3KYL A;  1IUY A;  3OYD A;  3Q9S A;  1ITY A;  1D8J A;  1MBK A;  2UZK A;  4AUX A;  2EZK A;  2RN7 A;  4U87 A;  3TBI A;  5E3M A;  2VXZ A;  1VI0 A;  2DCE A;  3PUB A;  4XKV A;  1YOV B;  3K70 D;  3K7A J;  3MKL A;  4B8X A;  1R6R A;  3VB2 A;  3I9V 2;  2F4M B;  1BJA A;  4PSW A;  2L4A A;  2MAB A;  2BHY A;  1LUJ B;  1TQM A;  4G9Y A;  4HRI A;  4P9U A;  5D5V B;  2R5Z A;  3LAP A;  1U3E M;  1R5G A;  2W48 A;  3L7W A;  5DUI A;  5J4Y A;  4A5M A;  1XGN A;  4ITV A;  5AON A;  1X1C A;  1MJ9 A;  1IN7 A;  1WI3 A;  2LY9 A;  1BIB A;  3A03 A;  3E3V A;  4LG3 A;  2XRO A;  4G7Z F;  2H27 A;  1JUM A;  3AKZ A;  3LFU A;  5FD5 A;  3S15 J;  3NRV A;  3F8C A;  5FB2 A;  1TW2 A;  1W5C C;  5CYV A;  4WF2 A;  1G3Y A;  2RNG A;  5JHF A;  4A3D J;  1GHC A;  1EKE A;  1ZN2 A;  3CJT B;  4EEF G;  3BOQ A;  5D5W B;  2G0E A;  3TQN A;  4JOM A;  3CJR B;  2XC7 A;  3HOX J;  2E2H J;  4KIS A;  5LGN A;  1P4A A;  2E60 A;  2A3S A;  1P4X A;  2EFQ A;  1U5T A;  4I99 C;  2MA3 A;  5FFZ A;  3G71 I;  5BPI A;  1Z9C A;  4K2E A;  3HSR A;  1A35 A;  1FBU A;  3VWB A;  2HKX A;  2HOA A;  3DV8 A;  1LE8 A;  1R7J A;  5D8K B;  1FJL A;  2TDX A;  3S1R J;  4M3D A;  5LLQ A;  1BW5 A;  3OY9 A;  1QVT A;  2BOL A;  2EQR A;  2ZXI A;  4KIG A;  3MZH A;  4ZTF A;  1XGO A;  3CCJ I;  1L0O C;  3ROU A;  1KQ8 A;  2Z2S B;  4BE0 A;  2IP2 A;  5EZG A;  3LA2 A;  3WTS C;  2E1M C;  1FBS A;  1IRF A;  1J7K A;  1VQO I;  2DA6 A;  1IJW C;  1QNT A;  3C18 A;  4FTH A;  2O3F A;  3OL4 A;  5HS9 A;  3I71 A;  2HEO A;  2JN6 A;  2JPC A;  3ZN1 A;  1XSX A;  2K85 A;  2MG4 A;  2OU2 A;  1I27 A;  5HLG A;  1UHM A;  2EFO A;  3BZC A;  3D5R C;  2FX0 A;  2QA4 I;  3RYR A;  3VOE A;  1WJA A;  4CH7 A;  4O3M A;  5IYD J;  3HRU A;  2AXL A;  1CQT A;  3FXK A;  2JA2 A;  4RLF A;  2M7A A;  5DYM A;  1HF0 A;  4Y4R A;  5E3L A;  2HQR A;  1SVM A;  3BR2 A;  1UAA A;  3CMA I;  2M4G A;  4L18 B;  1FIP A;  3GTK J;  1FIA A;  4G12 A;  3ZQH A;  1ORK A;  1VQP I;  2QBY A;  4UY8 I;  1RIO H;  3L9F A;  4A93 J;  3K4M A;  2W85 A;  5E1X A;  4PSX A;  1T8I A;  4Q48 A;  1X3Z B;  3KPH A;  3M8F A;  3OSG A;  2HYJ A;  4U88 A;  3HKZ A;  2E2I J;  5K7Z A;  1Z1D A;  1MGT A;  4MQ9 F;  1J2X A;  3LSH A;  2QLZ A;  1O7L A;  5C4J J;  1BI1 A;  1HBX G;  2ZXJ A;  2K5C A;  4L9V A;  2YX7 A;  2JA6 J;  1AHD P;  1SAU A;  3S2D J;  1HQC A;  2A69 F;  4BHP A;  3K1P A;  3WU1 B;  3LAJ A;  1QHH D;  1QA6 A;  2L4M A;  3TW7 A;  1T08 B;  2CH0 A;  1BR1 A;  4P55 A;  2HU9 A;  1LJ9 A;  2Z16 A;  3G6E I;  4CA0 A;  4IXA A;  2XAF A;  1B59 A;  5CVR A;  4E6K G;  1Z0X A;  2PMH A;  2EA2 A;  4EAT A;  1MMA A;  2P81 A;  2ZJQ F;  4D7M A;  4HV6 A;  1APL C;  2JRM A;  1YHQ I;  3KLN A;  3TGN A;  5FRN A;  2M30 A;  3LFK A;  3OIO A;  2B9S A;  4GRI A;  1MDM A;  4L5E A;  4X6A J;  2ELH A;  3U2R A;  1QZY A;  1G2H A;  3I5U A;  2H1L A;  1G59 A;  2FEZ A;  2K9L A;  3EYI A;  2HFH A;  4DIQ A;  2CJJ A;  4ZDO A;  4KJZ A;  2ZSH B;  4JQF A;  5CVU A;  2HZT A;  3AG4 H;  3PJR A;  1AA7 A;  1DDN A;  3PSI A;  2FE3 A;  1SAN A;  5EG0 A;  3QYE A;  4DYC A;  4KMU X;  3ZMD A;  5IOZ A;  4HLY A;  2LRE A;  4CHU A;  1VND A;  4KIF A;  4RAF A;  3KP2 A;  5DCM B;  1KA8 A;  3FK6 A;  5FKL A;  3F72 A;  1S7A A;  2X48 A;  3CUQ B;  2V26 A;  4FQG A;  3REO A;  4ENJ A;  2Q2E A;  3L2Q A;  2ISY A;  4AM3 A;  5BMZ A;  3OWT A;  1TNS A;  2IJL A;  3FXL A;  1JHH A;  2LY1 A;  3TP3 A;  4C3J J;  2FA5 A;  2GM4 A;  2FD5 A;  1IXR C;  5J1Y A;  2M4K A;  2ZXH A;  2MD5 A;  2WV1 A;  3R60 A;  3HUG A;  2XHK A;  3I64 A;  4OU0 A;  1STZ A;  2VKH A;  3LQQ A;  3VYT B;  2ID3 A;  2X4H A;  5EJC A;  5ILU A;  1MNM C;  3G1M A;  2DA1 A;  4RA2 A;  4LGW A;  4ZTJ A;  4XRS G;  5KK1 A;  1YG2 A;  2HQ5 A;  3WG9 A;  1V55 H;  4W97 A;  4F92 B;  2QQA A;  1D8K A;  2HVQ A;  3WGH A;  2G7H A;  5EDN A;  1XTA A;  2W24 A;  3QP6 A;  3OV8 A;  2KIU A;  4KUM A;  2XAU A;  1I3A A;  3CES A;  1U8B A;  4EGZ A;  1HDP A;  3QP5 A;  3QRF F;  4L5I A;  3KP3 A;  5JVG F;  2YX4 A;  2LH9 A;  5F64 A;  1DGR M;  4Q47 A;  1R49 A;  3KIO A;  4BYY A;  2PJR A;  1MBE A;  4CDG A;  3BJA A;  4ABZ A;  2EIK H;  4Q5S F;  4MGR A;  3PO2 J;  3SEQ A;  3IWF A;  3OYL A;  2ZC2 A;  4A5N A;  3GZ5 A;  3OMY A;  3WGG A;  2BEO A;  1S6L A;  2R7X A;  3S93 A;  1QPI A;  3VDX A;  3G3Z A;  2WAE A;  4A12 A;  3KX2 A;  3L1P A;  1I39 A;  2CFO A;  2VI6 A;  3IV5 A;  2VPL A;  2LP0 A;  3U9G A;  2E5Z A;  4D0P A;  5CQG A;  4EM1 A;  4FX4 A;  3HTS B;  3CTA A;  4QSH A;  2K27 A;  3CMY A;  3GFM A;  5FO5 A;  2L2O A;  4N9I A;  5ICG A;  1EF4 A;  3R6S A;  2BV6 A;  1W0T A;  1VQN I;  2WA0 A;  1J59 A;  5KNL A;  5BOX A;  3E6D A;  1WJE A;  5B1B H;  4A3I J;  2NVY J;  4GYI A;  3RKX A;  1IRX A;  3RKY A;  2QWW A;  3ONQ A;  4HAM A;  2VOO A;  1OIS A;  1RR8 C;  4IO9 F;  2YUS A;  3J7A O;  4BJ5 C;  2QKL B;  3K6G A;  2HQA A;  4DW6 A;  2D1H A;  3V7C A;  4NQW A;  3ABU A;  4EM0 B;  5L3F A;  2P5V A;  3OYB A;  1IRZ A;  3H0D A;  1RRJ A;  2CG4 A;  3IWZ A;  3ML6 A;  5FKK A;  1P7I A;  4DJA A;  4I02 A;  2WV0 A;  2ZXW H;  4IHW A;  1PDN C;  2KHM A;  2BXZ A;  3PIO F;  1TC3 C;  2L9V A;  2PFB A;  1JKR C;  5LGU A;  1JGG A;  4A3B J;  3RTR A;  2XVC A;  2OV7 A;  4LIV A;  1KU7 A;  1MND A;  3WG7 H;  4I09 A;  5IYC J;  3MMY B;  4HV5 A;  1D3Y A;  5F6F A;  4XLN F;  1QGP A;  2R3S A;  1OCC H;  2O0Y A;  2RC4 A;  3OYM A;  4Y17 A;  2JUC A;  1IN4 A;  1IDY A;  3E0J B;  3I59 B;  2W4S A;  1DPU A;  4DOZ A;  3PQK A;  1ZLJ A;  3DKX A;  1U9N A;  4ETS A;  1WRJ A;  1H9T A;  3TO7 A;  3I55 I;  1BA5 A;  2Y9Y A;  5J1R A;  2OF7 A;  4ZZL A;  4IOC F;  1ON2 A;  4A3K J;  4BJ6 C;  2GWR A;  2IA2 A;  3O8H A;  3K1N A;  2B7E A;  1UZC A;  2DFE A;  2QSH X;  3CCU I;  3BG3 A;  2CQ7 A;  3FMQ A;  3J7Y J;  2E36 A;  1UJ8 A;  2FU4 A;  3HKZ N;  1XPX A;  1YE9 A;  2JMW A;  2QZ8 A;  1FTZ A;  3T8R A;  1QQI A;  1VQ7 I;  4A3L J;  2EV0 A;  2F5V A;  2LK2 A;  3CO7 C;  3C2G A;  1H8A C;  2E35 A;  3P9K A;  3DEE A;  4ENK A;  1RUN A;  1WJF A;  1ZK8 A;  2VJ4 A;  3DBH B;  3RYP A;  3FMR A;  4II2 A;  2LNB A;  2EBI A;  1UHS A;  3HRM A;  2HYF A;  3BR1 A;  1ZRE A;  4AIK A;  3W2W A;  4RAZ A;  3WU2 C;  4Z6Y A;  1BC7 C;  4AU7 A;  2M3A A;  2BY2 A;  1HOM A;  4UUS B;  3S14 J;  3DTE A;  3H5R A;  1WI9 A;  3QU3 A;  1JT6 A;  1ERD A;  4E7S A;  4I7H A;  2RV8 A;  2HVS A;  2DMU A;  4XQF A;  4PCQ A;  3LA3 A;  2DA7 A;  4NC8 A;  4KT5 C;  1IN8 A;  3QPH A;  3WOD F;  1G3W A;  2RNJ A;  2Y0M A;  4WXC A;  3W6K B;  2V6C A;  3FIW A;  2XF6 A;  2X51 A;  1XDS A;  3DF8 A;  2BHZ A;  3BQZ A;  2J5O A;  2R7S A;  4U0V A;  1IUF A;  1CGP A;  3OYF A;  1I6X A;  4BGD A;  2BGC A;  4HNT A;  1XSV A;  1SFK A;  5L3D A;  4DNC A;  4LG0 A;  1R22 A;  2X6X A;  2KIM A;  2XUB A;  3H5A A;  4XN3 A;  1XN7 A;  1FSH A;  2JTV A;  3S2H J;  3FXR A;  2LTP A;  5J6X A;  1J09 A;  2OBP A;  4XSZ F;  1FBQ A;  2DOE A;  3KE2 A;  2FBI A;  1R9T J;  2JSC A;  1PJR A;  1LDJ A;  4RBO A;  3RCO A;  1FNN A;  5E1W A;  5JLX A;  4YIR X;  4QTR A;  3BCA A;  4A69 C;  5HNF A;  2ZFW A;  5JI6 A;  4J00 A;  4A0Y A;  3HEF A;  3S17 J;  4DQ2 A;  1P7J A;  3NAU A;  5AIQ A;  2ZO4 A;  3IRR A;  2MLK A;  3E7L A;  2R5Z B;  4OIQ F;  3LSR A;  3WU0 A;  2VPR A;  5HLH A;  1NG6 A;  2NNN A;  1NG7 A;  3K1M A;  3ERE D;  4CZZ A;  1O57 A;  1FOX A;  2VC0 A;  2EFN A;  5IT3 A;  3A01 A;  1JJ6 C;  2JWT A;  3DXJ F;  3FIS A;  4RAY A;  2RRE A;  1X4P A;  1I6H J;  5DM7 F;  1RZ4 A;  2W25 A;  3ABT A;  4BS9 A;  1LNW A;  4ZYA A;  1B1B A;  1F36 A;  1XGS A;  1NH3 A;  2A6H F;  3ZMS A;  3KEO A;  3K4L A;  3HOU J;  3M8J A;  2VOP A;  2OTL I;  2X6O A;  1J9I A;  5FFX A;  1YX3 A;  3HDD A;  1U5T B;  3KP4 A;  2JSP A;  2M2E A;  1MBF A;  1S7E A;  2XRN A;  4JX5 A;  4BKX A;  1S3J A;  5DUK A;  4F55 A;  5L3E A;  2HZD A;  4IHV A;  5FLX Z;  3NWT A;  4CSW A;  3BG5 A;  5TGT A;  4E4H A;  2RDP A;  5M5X J;  3RSN A;  3ERM A;  5FKN A;  3SFZ A;  2CWE A;  2HI3 A;  1X3W B;  3K4J A;  1Z6R A;  1Q1V A;  4BDY A;  4E7L A;  3I3L A;  5E8G A;  3N97 A;  1GVD A;  3JSP A;  5FRM A;  2HGC A;  1ZGA A;  3HHG A;  3GTL J;  3A1Y A;  5E17 F;  4DYR A;  4E7J A;  1R1U A;  2JJ7 A;  4RAG A;  3MZY A;  5DDG A;  2BVM A;  2V9P A;  2EIJ H;  5LGT A;  3I0T A;  5D6F A;  4V2F A;  3HB9 A;  2NRA C;  3ZCO A;  1Z3Y A;  5EEH A;  1RC9 A;  1W36 D;  4HF2 A;  3CDH A;  2GBY A;  2HTS A;  4C9Y A;  1B6A A;  1T38 A;  4XLA A;  3J7Z I;  2DOF A;  4JX4 A;  5J4V A;  1RKW A;  1ODD A;  3PUF A;  3F22 A;  5DD8 A;  2DT5 A;  2VLA A;  2VC1 A;  1XS9 A;  1AOY A;  1TTY A;  5F08 A;  4LLN A;  3F6V A;  3O8G A;  3LSM A;  2FQ3 A;  5HDG A;  4MFE A;  3ISP A;  4AIH A;  3BR0 A;  2QBY B;  2VQH A;  2WB1 A;  3WTW C;  2P7V B;  2R0Q C;  3MAJ A;  3ASN H;  4C3H J;  2W84 A;  1YJW I;  4P96 A;  2AQE A;  5DEQ A;  3CCL I;  4UHT A;  1BI3 A;  1XCV A;  3LST A;  1EH8 A;  1OFC X;  4IRH A;  1SC7 A;  1R36 A;  3IH2 A;  3GF2 A;  4F7Z A;  1CF7 B;  2LLK A;  4HNU A;  3FDY A;  3EQL F;  2Z5U A;  2DU9 A;  4P5O A;  5IP7 J;  2R7W A;  2MGQ A;  2MC4 A;  1USS A;  2ZSI B;  2V1N A;  2CGP A;  4FET A;  1QO0 D;  2CUZ A;  5GPA A;  4RB2 C;  1GT0 C;  1T6S A;  1V5G A;  1TT5 B;  3CME I;  1SD7 A;  4RM3 A;  5F27 A;  1T0F A;  2CUF A;  5IOY A;  3TDZ C;  4PJL A;  4L5J A;  1P4W A;  4F93 B;  3L2R A;  3DFG A;  4J01 A;  2NNY A;  3DP7 A;  3P9C A;  1P9Q C;  1B8I B;  4JX6 A;  1N77 A;  2E19 A;  1GV5 A;  5M3M J;  2DMQ A;  1ZR4 A;  4HF1 A;  5IP9 J;  2Q1Z B;  4RB0 A;  1R5I D;  1JE8 A;  2P5L C;  1T98 A;  1RNL A;  3JCU C;  3Q9V A;  2FNA A;  2VJI A;  1Z67 A;  2VKE A;  1YJN I;  2OC6 A;  2MSY A;  4FAS D;  3OS0 A;  4CCL A;  5HOO A;  4XMY A;  3HC7 A;  4CXF A;  3GW2 A;  1XCB A;  3ZMZ A;  3FHZ A;  1LFU P;  2HWV A;  4C2U A;  3K9T A;  3F8N A;  5F04 A;  1TZL A;  5FLV A;  5EG0 B;  4LK0 F;  1ZG5 A;  2E1O A;  2H6B A;  1PP8 F;  1YRN A;  2ESH A;  1D1C A;  2R7Q A;  3K69 A;  2VBX A;  1I1G A;  4RS8 A;  5DCF A;  1A31 A;  5HOD A;  2HOE A;  3ZGK A;  2DN0 A;  1K7A A;  3F8M A;  5BQT A;  2L7K A;  4E7K A;  4H4K C;  1JT0 A;  2Y9Z A;  1ETO A;  3H5N A;  3HOY J;  1BM9 A;  5H2F C;  4BUP A;  1VQL I;  5D6E A;  1JKP C;  3K2A A;  3JRC A;  1BJZ A;  4C30 A;  3AFH A;  1YIO A;  1DQU A;  3VYS B;  3PNV A;  1WKM A;  2XKO A;  3HUG B;  3ZN0 A;  3KZI C;  1ZGW A;  1T0F C;  2Y31 A;  2VBZ A;  3A02 A;  4N0B A;  4ZC3 A;  3PNY A;  1FP1 D;  1Y8R B;  4MHG A;  4YFN F;  5D4S A;  2I10 A;  1REP C;  5J40 A;  2X9D A;  2IT0 A;  4IQJ A;  4MEX F;  1X1A A;  5DTD A;  1XD7 A;  4ESF A;  3GTJ J;  2DO7 A;  3M9A A;  3HOT A;  3SYT A;  4C2T A;  4I2O A;  2R93 J;  1VQ5 I;  2AS5 F;  5CVI A;  1T56 A;  1TW3 A;  3JRA A;  3M4O J;  3CCY A;  3AG1 H;  1W7P A;  2OCC H;  5GTI C;  1KYZ A;  2HXO A;  3QYB A;  1TQI A;  2CUJ A;  3J80 Z;  1IAW A;  3OYJ A;  3OIP A;  1UEL B;  3P9I A;  2XKP A;  3KET A;  3C2B A;  1S72 I;  3ZXS A;  2H1K A;  2K9N A;  1YW9 A;  2R4G A;  1FYM A;  5HDK A;  4M9S A;  3EPZ A;  3QPS A;  4JBA A;  4NC6 A;  1ZH5 A;  3DWL E;  5JR3 A;  1K4S A;  3JRF A;  1Z7U A;  3V8J A;  3IRQ A;  3ESW B;  3GYH X;  3ZQL A;  3HGG A;  4L0Y B;  3HOV J;  2XAQ A;  3RPU A;  2CRG A;  2IGK A;  1XB4 A;  1U8R A;  1NHA A;  1MH3 A;  5LFA A;  2QYO A;  2RQP A;  1RET A;  3JTG A;  1IXC A;  1BN5 A;  5HLI A;  2L54 A;  3OYG A;  4AC0 A;  1BBY A;  3HPG A;  4EJV A;  1ZHF A;  3ELK A;  3LNQ A;  3GTM J;  2B63 J;  2F2E A;  2KLO A;  2WY8 Q;  4HX4 A;  3GTG J;  4BAY A;  1XG1 A;  1FWZ A;  1MJA A;  5B5E C;  1O4X A;  4NBQ A;  1W0U A;  1UCR A;  5HLT A;  2A07 F;  2XB5 A;  1BOA A;  4MLO A;  4KIB A;  4Z2Y A;  4PFP A;  2KIS A;  1Q1H A;  5F0F A;  4HDU A;  3MCZ A;  2YU3 A;  2HVR A;  3WTY C;  2PQ8 A;  4ANJ A;  2WAQ A;  4HOB A;  2LMD A;  3BTC A;  1BI0 A;  2CO5 A;  2IW5 A;  2V9K A;  2Z1D A;  1SVO A;  1W5T A;  3O6B B;  4HPQ A;  4ASN A;  4AID A;  4BXX J;  1O7F A;  1ULY A;  1GLN A;  1YO5 C;  3G73 A;  4CGZ A;  4N9H A;  3E1S A;  5F0H A;  1FX7 A;  5B3S H;  3BLY A;  3ZR8 X;  5GAG J;  4M3B A;  2MH9 A;  2D2W A;  3PIP F;  4A3C J;  3BTL A;  2XGE A;  4B3X A;  3WTX C;  2ELJ A;  3DEU A;  2ME6 A;  1PVE A;  3BG9 A;  2E71 A;  2VKD A;  2ESN A;  2EIN H;  5E3N A;  3GZ6 A;  3L09 A;  1MBG A;  5CLS A;  2WB1 N;  1HA8 A;  3PQJ A;  4P1W A;  2ECC A;  1S8N A;  2FSW A;  3CCE I;  3D1N I;  4IF4 A;  3F0C A;  3LSG A;  3DTK A;  1A6I A;  1M1E B;  4XLE A;  1V5E A;  2K3F A;  4XOT A;  4KNY A;  2GXB A;  4OIN F;  2KP6 A;  1LFP A;  2CQN A;  2P7C B;  2IS6 A;  4LIT A;  2JQ7 A;  3HYI A;  3TOA A;  4FCY A;  4BHC A;  2L7M P;  3I53 A;  4AYB A;  4D7N A;  3KYC B;  2W00 A;  4Y3O A;  3ZRG A;  5LHG A;  1ZGJ A;  2OZ6 A;  2QEX I;  1MMD A;  2L9N A;  3FM5 A;  1K6O A;  1OPC A;  3BJ6 A;  3IKV A;  3QWL A;  4S04 A;  1VQM I;  1NK2 P;  4PJM A;  2F5D A;  2WAF A;  3E5X A;  3CF2 A;  3Q0U A;  4EQQ A;  2BVL A;  1MJB A;  5CKT A;  3ZMV A;  4BEH A;  1VF9 A;  4N4O B;  1O3Q A;  1LDD A;  4XRS A;  3G4S I;  1LVA A;  2M8E A;  2E7X A;  1JXS A;  1DP3 A;  2Y2Z A;  2FUG 2;  4ESJ A;  2IEK A;  1FZP B;  2K4J A;  4UUV A;  1R1T A;  2CYY A;  1IXS B;  2QUF A;  2KRC A;  1N25 A;  2XV4 S;  3BTI A;  4NC7 A;  4B43 A;  4AIJ A;  4M3F A;  5FLX K;  5K5O A;  1F9N A;  4M9X A;  3A0H C;  1R1V A;  1S5L C;  3K4C A;  1KU9 A;  2DMN A;  4CO8 A;  3HSF A;  4FE7 A;  4PJN A;  5KVR A;  4EJT A;  5FKO A;  2GA2 A;  2XPU A;  1U78 A;  3R0A A;  5TJJ A;  1KGS A;  2OAZ A;  4R79 A;  4KN4 X;  3L2U A;  4QIW N;  2JA5 J;  2RKH A;  2LKX A;  3MEX A;  2PEX A;  3WTZ A;  3FF5 A;  4LG0 B;  1Y0N A;  4ZYD A;  4XON A;  2MFZ A;  2YU9 J;  3K70 C;  3DBR B;  3HPH A;  3AG2 H;  1VQ9 I;  5JLW A;  5E1Z B;  2DPU A;  3DEW A;  2KT0 A;  1ETX A;  4G8X A;  4RGU A;  1ETV A;  4CCM A;  2M9H A;  3WTU C;  2IS4 A;  3PFI A;  3HRS A;  4LIU A;  2L3D A;  5JVT A;  2ZB9 A;  1HC8 A;  1EV7 A;  5IP6 A;  3GFI A;  3B6A A;  5J47 A;  3PFY A;  3MWM A;  4MQV A;  4W1U A;  1R58 A;  3OYK A;  3CC2 I;  1I3Q J;  5C4X J;  2HPI A;  5M5Y J;  1R71 A;  2DOD A;  5CPR B;  1Z3X A;  3BZK A;  1JJ8 C;  2RQQ A;  2A5W A;  2BYV E;  3BG7 A;  4RB1 A;  3F23 A;  2VE9 A;  4XOR A;  4MEY F;  3TW6 A;  2O6G E;  1AKH B;  3J7A Y;  1Z77 A;  1Y8Q B;  1F1Z A;  4BXU A;  1GXP A;  2DDB A;  3LSP A;  3A01 B;  2JPB A;  4U0Y A;  3E6M A;  2UWM A;  4EJU A;  3CP2 A;  3DKY A;  3LL7 A;  3E97 A;  3VYR B;  5FD6 A;  4KMF A;  4IKF A;  2Y69 H;  2Q8K A;  4FX0 A;  1EJ9 A;  2QGU A;  1E2X A;  2VN2 A;  2DTZ A;  1U0J A;  4BQO A;  2I5U A;  5JFR A;  2R92 J;  3SHF A;  4B44 A;  2V1D A;  4DBQ A;  3BQY A;  3S3M A;  5L3C A;  2VQC A;  1ZAR A;  5LD2 C;  4B4C A;  1QHG A;  1QZE A;  2LKP A;  2OCE A;  3M07 A;  5CJ9 A;  4Y52 J;  3ZQI A;  3MKZ A;  3C1D A;  1WJB A;  2DT7 B;  3CLQ A;  3OS1 A;  1YS7 A;  2KJB A;  4N4N B;  3HRT A;  4L9J A;  3OL3 A;  3H36 A;  3T1B A;  1ETW A;  1JKO C;  4M6X A;  2PLY A;  3S32 A;  4QWQ A;  2F4O B;  2DA4 A;  1IN6 A;  5EGO A;  3R0J A;  4E7Z A;  1RPW A;  4S0H B;  2ZNZ A;  3SQN A;  1MIJ A;  3NEU A;  9ANT A;  2ME0 A;  2DA3 A;  2QCO A;  1V54 H;  2ISZ A;  4BE1 A;  4CZC A;  3FXU A;  3FKJ A;  3K2Z A;  3JRD A;  3HOS A;  4NHJ A;  3HXL A;  5LHI A;  2DK5 A;  3GX4 X;  3S3N A;  3FWE A;  2ZME B;  5H6R A;  3SZG A;  3ZQF A;  2J5P A;  4HYE A;  5HS7 A;  2R7T A;  1Y0U A;  1A04 A;  2PX9 A;  3HTU A;  3FXJ A;  2QKM B;  4ESB A;  1LDK B;  4OMZ A;  2WAQ N;  2HKO A;  2L7Z A;  1K78 A;  1X1P A;  2QM3 A;  4MIM A;  4PJ0 C;  4IOA F;  3HBL A;  3EDP A;  3DU6 A;  1P92 A;  3EUK L;  3RKQ A;  3NQO A;  2JT1 A;  2BBY A;  5EEG A;  4I98 B;  3BT9 A;  1AWC A;  1FP2 A;  3M1E A;  2EK5 A;  2XB0 X;  1IV8 A;  1POG A;  2JK3 A;  4HQM A;  5E20 A;  2KIF A;  4MTE A;  4F91 B;  2A6T A;  2JUG A;  2E1C A;  1R4M B;  2AO9 A;  2IAI A;  1HKS A;  2UXX A;  2FMY A;  3BR5 A;  4RGS A;  3Q0W A;  1XGM A;  3JSO A;  2DI3 A;  2KPM A;  2N8G A;  3BR3 A;  2LBF A;  1MD0 A;  1SVL A;  1OCT C;  1BR4 A;  4J19 A;  3CJN A;  2K9S A;  3H3Z A;  2XPV A;  3PM1 A;  4A3E J;  2DMT A;  1JHF A;  2P8T A;  4YEL A;  2NVQ J;  1PYV A;  2X85 A;  1VQK I;  3FK7 A;  4BXF A;  1U9O A;  5EYR A;  3J80 K;  3CCS I;  2QQ8 A;  4PJJ A;  4M74 A;  5DCM A;  2L01 A;  1JTY A;  2NXN B;  2XAH A;  2ACJ A;  3CUQ A;  4AYB N;  2HTJ A;  4I01 A;  3DPT A;  4HSR A;  4XKW A;  4NNJ A;  2HDD A;  4YFK F;  2MH2 A;  5ICC A;  2JA7 J;  3H9G A;  1U6G A;  1WWX A;  3SFI A;  2WBM A;  3GXO A;  3EUH C;  4UVC A;  4FHT A;  1X58 A;  5HS8 A;  1Z21 A;  3OOP A;  4XR6 A;  2WTE A;  3A4C A;  3HZJ A;  5FLM J;  3X2Q H;  2R7V A;  1ZG3 A;  5EF6 A;  1ZQ3 P;  2C6Y A;  2CW8 A;  2L9R A;  1TLH B;  5ILS A;  5C3E J;  4X0G A;  3U1D A;  4GO1 A;  2O61 A;  3S8P A;  1HKT A;  4GCV A;  5M5W J;  3ABL H;  3ULQ B;  2CQX A;  4G7O F;  3DKW A;  3VSL A;  3M7G A;  2A5Y B;  3SEZ A;  1UG2 A;  4IZZ A;  5K1Y A;  3RPQ A;  2HOT A;  1E17 A;  2VON A;  3HSE A;  1WQ2 A;  2XAS A;  2ICW G;  3TO6 A;  2STT A;  4BY7 J;  2XRL A;  1B4A A;  2D45 A;  3ZQQ A;  4M9Z A;  1TWF J;  1Y6I A;  4IQ4 A;  3IP4 B;  5GAH J;  1O3R A;  2R5Y A;  1Z91 A;  2KRF A;  2BW3 A;  5D8L B;  4KIC A;  1NTC A;  4ZYH A;  5IT9 Z;  4ENM A;  2NAZ A;  2OQR A;  1WJD A;  2PMZ A;  3UR3 C;  3K4N A;  4BJT A;  1HXD A;  2ETH A;  2MW8 A;  3I4N J;  3CUQ C;  4ZZD A;  2O8K A;  4HA8 A;  4OAY A;  2NS0 A;  5EEA A;  2DJI A;  3E5U A;  1XMA A;  4V2G A;  2STW A;  3KLO A;  3ZMT A;  3L00 A;  4BQN A;  3ASO H;  3SJM A;  2BE5 F;  2XGC A;  1SMT A;  4WCG A;  1IDZ A;  2HS5 A;  1F43 A;  4I76 A;  4MFD A;  2V4J C;  4PZJ A;  3TED A;  2MLG A;  2E7W A;  2PBI A;  5K7F A;  5GP9 A;  3AAF A;  1LE8 B;  1ZEL A;  1D0X A;  2K4B A;  4C2M J;  1LEB A;  4IRG A;  4P9F A;  4RM2 A;  2LSO A;  2M87 A;  3A2K A;  1IO2 A;  3H0G J;  4BNC A;  2DFH A;  4HLX A;  4YRV A;  1YYV A;  2VT3 A;  3NWS A;  4QPO A;  3VYU B;  2LF7 A;  5DD4 A;  4YFX F;  2XGD A;  4XSX F;  4RGR A;  2FJ1 A;  4UUT A;  3S1Q J;  3OYH A;  1MW7 A;  5B66 C;  3J81 Z;  3A0B C;  2QVO A;  3ZOB A;  3MKY B;  1F5T A;  1X2N A;  1FSE A;  1G3S A;  3JTH A;  2ZJR F;  2HDC A;  4IVN A;  2EWN A;  3EUA A;  2O9L A;  4UXN A;  2OA4 A;  3LSI A;  1E3H A;  2G7U A;  1D1A A;  2ECB A;  2Z99 A;  1YW8 A;  1X3U A;  1WJC A;  4UVA A;  3IH3 A;  3F8B A;  1ACI A;  3I59 A;  4IPA A;  1HCR A;  3PO3 J;  6PAX A;  1SD6 A;  3C2H A;  2FBH A;  2ZNY A;  2V1U A;  3DQV C;  5CVJ A;  2GXG A;  1FLI A;  2GA1 A;  1KZH A;  2CW0 F;  2V1X A;  3CZ6 A;  4U7B A;  1UB9 A;  3CP8 A;  2DYR H;  2A05 A;  3FXM A;  3QPL A;  5F1J A;  4XID A;  2KQR A;  2F4I A;  5HVQ C;  3VSK A;  2D1V A;  2GAU A;  4X1E A;  1MBJ A;  1TWC J;  2M34 A;  3KZY A;  4BDZ A;  1G3T A;  3QAH A;  3T8T A;  1QPM A;  3OR1 C;  4M71 A;  4MO7 A;  1OCO H;  2GOX B;  2IS2 A;  2FOK A;  4HX8 A;  3MVP A;  4GYG A;  4WWC A;  3ZQC A;  2DA2 A;  2OUM A;  3L2W A;  4E7I A;  4IEJ A;  2KIQ A;  2PN6 A;  2ZJ2 A;  3FKI J;  3TKY A;  2XIG A;  2ID6 A;  4M3E A;  4O6J A;  4KIT B;  1EH7 A;  4XLF A;  3M3Y J;  2K86 A;  3H3V K;  4A3F J;  3S16 J;  2COM A;  2VQL A;  3CMM A;  2PG4 A;  3IL2 A;  3QQA A;  1I5Z A;  1MMN A;  2VQG A;  2ZKZ A;  4LOC A;  4HW0 A;  2VE8 A;  1OQY A;  1TWA J;  1MMG A;  2O7O A;  4FE4 A;  4F52 A;  1MDM B;  2W82 A;  2FRH A;  3HOZ J;  1T95 A;  1LB2 A;  1FY7 A;  4IRI A;  3D5L A;  2FF4 A;  1HSJ A;  2PMU A;  5J1U A;  1YX5 A;  4BH9 A;  5DS9 A;  2FQ4 A;  1TT0 A;  1W1W E;  4CYC A;  5ICF A;  1H9G A;  2P6S A;  2D5V A;  1K61 A;  5K5R A;  1Z05 A;  4G6T B;  1SFU A;  1BOB A;  3GTP J;  5IYB J;  3DTI A;  4U0W A;  4BHB A;  1ZYR F;  1B9N A;  2ZME C;  3S3O A;  4OIO F;  1MH4 A;  5L3B A;  1XMK A;  2LC2 A;  2EZL A;  3QYF A;  3GVA A;  1KYW A;  1D0Z A;  1KU2 A;  1TWG J;  4B47 A;  1LKX A;  1OYI A;  2Q2E B;  4G6Q A;  2X1C A;  4LK1 F;  2MBF A;  3B02 A;  2DT6 A;  2ELK A;  2NS8 A;  2Y30 A;  2OQG A;  2Y0S A;  1WGX A;  3IAS 2;  2B0L A;  3GTO J;  1ONV A;  2YR2 A;  4IX7 A;  1XDU A;  4YII A;  3SZP A;  2P4W A;  4JYK A;  3JRH A;  3BJO A;  4XNF A;  3MKW B;  2KKO A;  2DK8 A;  4CCN A;  3JRE A;  5J8C A;  3RI4 A;  2IGN A;  2YSR A;  1Y1W J;  5DV5 A;  2DXI A;  2LY2 A;  4RMN A;  3WHC A;  3W3C A;  3HOW J;  2HXI A;  4BQQ A;  1MMS A;  3O2P E;  4V19 K;  3RQ4 A;  3S2W A;  3HHH A;  2GOM A;  4IHY A;  3DPL C;  1ZAO A;  3S1N J;  1V3F A;  2LD5 A;  2IRF G;  4CCJ A;  3BP8 A;  3KFW X;  3P7N A;  2Q0O A;  1JUS A;  4ENN A;  3V8K A;  3LSJ A;  3R61 A;  2KMU A;  4B09 A;  2PJR B;  2EPF A;  3LQR A;  4TV7 A;  4EVI A;  1H88 C;  3TO9 A;  1WVR A;  2WY7 Q;  3DBL B;  3SDG A;  3D0S A;  2CU7 A;  4DGW B;  2OPT A;  2IPQ X;  2O5R A;  3W2V A;  4LFU A;  3Q3S A;  2EIM H;  4KFC A;  1B72 A;  2BZT A;  3RJP A;  3GLL A;  2H8W A;  4BU2 A;  1ZR2 A;  2PMZ N;  1VTN C;  2E1N A;  1JUP A;  2DFI A;  4LLG F;  4KDP A;  2H09 A;  3H92 A;  2R7O A;  1A36 A;  2QQ9 A;  2V9V A;  2H8R A;  4CYD A;  1O3S A;  3CCV I;  1UFM A;  4E70 A;  5FKM A;  5F1R A;  1FMV A;  3SXY A;  5L3G A;  4R8H A;  2W7N A;  3OS2 A;  2XSD C;  3CDI A;  5F0C A;  4O5V A;  3WTV C;  2DAO A;  1OCP A;  1YTY A;  4B3A A;  1S7O A;  4NQW B;  2TCT A;  5AIP A;  4RDU A;  2DTR A;  4HX7 A;  4UVB A;  5D5U B;  5LBQ A;  4WK8 F;  3PNT A;  1MZB A;  4PUS A;  1EA3 A;  2XF7 A;  4EV0 A;  3GFL A;  3HM5 A;  1HW1 A;  3BDD A;  2IA1 A;  3JR9 A;  2DYS H;  1MBH A;  1DP7 P;  2EIL H;  3MZ8 A;  5LRR A;  2A68 F;  2P0W A;  4M6V A;  2DPD A;  4B48 A;  3ZQG A;  2XAG A;  5EGO B;  1IZ1 A;  3Q0V A;  3COA C;  3WE2 A;  2VXD A;  2NVT J;  2LRD A;  3P5J A;  4L9N A;  3G1O A;  1SEU A;  5BS6 A;  2M8G X;  2WC2 A;  1W36 C;  1S9H A;  3FBN B;  4RGX A;  2NYX A;  3RIR A;  1PUF A;  1GVJ A;  1TP4 A;  2EJR A;  3RDI A;  2KDZ A;  3RKW A;  1YFH A;  3OYA A;  1R5H A;  3H9J A;  3G1L A;  1U5T C;  2LF8 A;  1HDD C;  3IKT A;  4CCO A;  2KDO A;  1CF7 A;  1I50 J;  2HPM A;  2X0L A;  4HST A;  4OAZ A;  2KRH A;  2AHQ A;  3V42 A;  3OYI A;  1SAX A;  2P6T A;  2YS9 A;  4D5C A;  1MSE C;  4R1H A;  2QSG X;  3GFJ A;  4XIC A;  4XK4 A;  3E6C C;  3F9K A;  1K78 B; 
#chains in the Genus database with same CATH homology
 3CCU I;  1FOX A;  3G4S I;  3J7Y J;  2E36 A;  2FOW A;  1VQP I;  4UY8 I;  5DM7 F;  5JVG F;  1VQ7 I;  2E35 A;  1FOY A;  3CF5 F;  1VQ6 I;  1YJN I;  2ZJP F;  2OTL I;  5GAH J;  1QA6 A;  5GAE J;  2H8W A;  3G6E I;  1VQ4 I;  1YIT I;  1YIJ I;  3DLL F;  4IOA F;  2ZJQ F;  5GAD J;  3CC4 I;  3CCV I;  1YHQ I;  1VQ9 I;  1VQN I;  1VQ8 I;  3CJT B;  1HC8 A;  1VQL I;  4IO9 F;  1Y39 A;  3CC2 I;  2OTJ I;  3G71 I;  5GAG J;  3J7Z I;  3PIP F;  3PIO F;  3I56 I;  3CCQ I;  1VQK I;  1YI2 I;  3CD6 I;  3CCJ I;  5DM6 F;  3CCE I;  3CCM I;  1YJ9 I;  2E34 A;  2ZJR F;  3CCS I;  1VQ5 I;  2NXN B;  2K3F A;  1YJW I;  1FOW A;  1VQO I;  3CCL I;  2JQ7 A;  3CCR I;  2QEX I;  1ACI A;  2QA4 I;  1VQM I;  1S72 I;  3I55 I;  3CC7 I;  4IOC F;  3CME I;  1MMS A;  4V19 K;  3CMA I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...