1YJ9O

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1yj9O00
3CCEL 3CXCK 3CCUL 3CCML 1YHQL 1VQLO 2OTLO 1VQ6L 1QVFK 1VQ9L 1VQOL 1W2BK 1YJWO 1Q82P 3G6EO 1JJ2K 1N8RP 3G4SO 3CPWN 1YJ9O 1Q82M 1QVGN 3CCLL 3CD6L 1VQ5O 1KC8P 3CC7O 1VQLL 1VQ7O 3G71O 1YI2L 1VQ4L 1VQKO 3CCVO 1KC8M 1NJIP 3OW2K 3I56O 3CC2O 3CMEO 1YITO 1KQSK 3I55O 3G4SL 1NJIM 1K73P 1YJNL 1YJ9L 1VQ8O 3CCQO 1VQMO 1K73M 3CCJO 3CCEO 3CXCN 1VQ8L 1VQ5L 3CC7L 3CCMO 1YHQO 1VQNO 3CCRO 3CMAO 2QEXO 2OTJO 1QVFN 1K9MP 2OTLL 1VQKL 1VQ9O 3CCVL 1VQOO 1M90P 1S72O 3CCSO 1YJWL 1K9MM 1JJ2N 1YITL 2QA4O 3G6EL 1M90M 1Q86P 3CPWK 1KD1P 3CC4O 1Q81P 1YIJO 1VQPO 3CCQL 3CCLO 1QVGK 3CCJL 1Q86M 1KD1M 1K8AP 1VQNL 3CCRL 3CCUO 1Q81M 1Q7YP 3CMAL 1YI2O 1VQ4O 2QEXL 1VQ7L 2OTJL 3G71L 1VQ6O 1K8AM 3OW2N 1W2BN 1Q7YM 1M1KP 1S72L 3CCSL 1KQSN 3I56L 3CC2L 2QA4L 3CMEL 1YJNO 3I55L 1M1KM 3CC4L 1YIJL 1VQPL 1N8RM 1VQML 3CD6O
chains in the Genus database with same CATH superfamily
3CCEL 3CXCK 3CCUL 3CCML 1YHQL 1VQLO 2OTLO 1VQ6L 1QVFK 1VQ9L 1VQOL 1W2BK 2YZSA 1YJWO 1Q82P 3G6EO 1JJ2K 1N8RP 3G4SO 3CPWN 1YJ9O 1Q82M 1QVGN 3CCLL 3CD6L 1VQ5O 4W8KA 3CC7O 1KC8P 1VQLL 1VQ7O 3G71O 1YI2L 1VQ4L 1VQKO 3CCVO 1KC8M 1NJIP 3OW2K 5DS4A 3I56O 3CC2O 3CMEO 1YITO 1KQSK 3I55O 3G4SL 1NJIM 1K73P 1YJNL 4N06A 1YJ9L 1VQ8O 3CCQO 1VQMO 3CCJO 4QDLA 1K73M 3CCEO 3CXCN 1VQ8L 1VQ5L 3CC7L 3CCMO 1YHQO 1VQNO 3CCRO 3CMAO 2QEXO 2OTJO 1QVFN 1K9MP 2OTLL 1VQKL 1VQ9O 3CCVL 1VQOO 1M90P 5DS6A 1S72O 3CCSO 5DQZA 1YJWL 5DQTA 1K9MM 1JJ2N 1YITL 2QA4O 4XTKA 3G6EL 1M90M 1Q86P 3GODA 3CPWK 1KD1P 4WJ0A 3CC4O 1Q81P 1YIJO 1VQPO 3CCQL 3CCLO 1QVGK 3CCJL 1Q86M 3NKDA 1KD1M 1K8AP 5DLJA 3CCRL 3CCUO 1Q81M 1VQNL 1Q7YP 3CMAL 1YI2O 1VQ4O 2QEXL 1VQ7L 2OTJL 3G71L 1VQ6O 5DS5A 1K8AM 3OW2N 1W2BN 1Q7YM 5FCLA 1S72L 1M1KP 4P6IC 3CCSL 1KQSN 3I56L 3CC2L 2QA4L 3CMEL 1YJNO 3I55L 1M1KM 3CC4L 1YIJL 1VQPL 1N8RM 1VQML 3CD6O
chains in the Genus database with same CATH topology
3CCEL 3CXCK 3CCUL 3CCML 1YHQL 1VQLO 2OTLO 1VQ6L 1QVFK 1VQ9L 1VQOL 1W2BK 2YZSA 1YJWO 1Q82P 3G6EO 1JJ2K 1N8RP 3G4SO 3CPWN 1YJ9O 1Q82M 1QVGN 3CCLL 3CD6L 1VQ5O 4W8KA 3CC7O 1KC8P 1VQLL 1VQ7O 3G71O 1YI2L 1VQ4L 1VQKO 3CCVO 1KC8M 1NJIP 3OW2K 5DS4A 3I56O 3CC2O 3CMEO 1YITO 1KQSK 3I55O 3G4SL 1NJIM 1K73P 1YJNL 4N06A 1YJ9L 1VQ8O 3CCQO 1VQMO 3CCJO 4QDLA 1K73M 3CCEO 3CXCN 1VQ8L 1VQ5L 3CC7L 3CCMO 1YHQO 1VQNO 3CCRO 3CMAO 2QEXO 2OTJO 1QVFN 1K9MP 2OTLL 1VQKL 1VQ9O 3CCVL 1VQOO 1M90P 5DS6A 1S72O 3CCSO 5DQZA 1YJWL 5DQTA 1K9MM 1JJ2N 1YITL 2QA4O 4XTKA 3G6EL 1M90M 1Q86P 3GODA 3CPWK 1KD1P 4WJ0A 3CC4O 1Q81P 1YIJO 1VQPO 3CCQL 3CCLO 1QVGK 3CCJL 1Q86M 3NKDA 1KD1M 1K8AP 5DLJA 3CCRL 3CCUO 1Q81M 1VQNL 1Q7YP 3CMAL 1YI2O 1VQ4O 2QEXL 1VQ7L 2OTJL 3G71L 1VQ6O 5DS5A 1K8AM 3OW2N 1W2BN 1Q7YM 5FCLA 1S72L 1M1KP 4P6IC 3CCSL 1KQSN 3I56L 3CC2L 2QA4L 3CMEL 1YJNO 3I55L 1M1KM 3CC4L 1YIJL 1VQPL 1N8RM 1VQML 3CD6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE L;  3CXC K;  3CCU L;  3CCM L;  1YHQ L;  1VQL O;  2OTL O;  1VQ6 L;  1QVF K;  1VQ9 L;  1VQO L;  1W2B K;  1YJW O;  1Q82 P;  3G6E O;  1JJ2 K;  1N8R P;  3G4S O;  3CPW N;  1YJ9 O;  1Q82 M;  1QVG N;  3CCL L;  3CD6 L;  1VQ5 O;  1KC8 P;  3CC7 O;  1VQL L;  1VQ7 O;  3G71 O;  1YI2 L;  1VQ4 L;  1VQK O;  3CCV O;  1KC8 M;  1NJI P;  3OW2 K;  3I56 O;  3CC2 O;  3CME O;  1YIT O;  1KQS K;  3I55 O;  3G4S L;  1NJI M;  1K73 P;  1YJN L;  1YJ9 L;  1VQ8 O;  3CCQ O;  1VQM O;  1K73 M;  3CCJ O;  3CCE O;  3CXC N;  1VQ8 L;  1VQ5 L;  3CC7 L;  3CCM O;  1YHQ O;  1VQN O;  3CCR O;  3CMA O;  2QEX O;  2OTJ O;  1QVF N;  1K9M P;  2OTL L;  1VQK L;  1VQ9 O;  3CCV L;  1VQO O;  1M90 P;  1S72 O;  3CCS O;  1YJW L;  1K9M M;  1JJ2 N;  1YIT L;  2QA4 O;  3G6E L;  1M90 M;  1Q86 P;  3CPW K;  1KD1 P;  3CC4 O;  1Q81 P;  1YIJ O;  1VQP O;  3CCQ L;  3CCL O;  1QVG K;  3CCJ L;  1Q86 M;  1KD1 M;  1K8A P;  1VQN L;  3CCR L;  3CCU O;  1Q81 M;  1Q7Y P;  3CMA L;  1YI2 O;  1VQ4 O;  2QEX L;  1VQ7 L;  2OTJ L;  3G71 L;  1VQ6 O;  1K8A M;  3OW2 N;  1W2B N;  1Q7Y M;  1M1K P;  1S72 L;  3CCS L;  1KQS N;  3I56 L;  3CC2 L;  2QA4 L;  3CME L;  1YJN O;  3I55 L;  1M1K M;  3CC4 L;  1YIJ L;  1VQP L;  1N8R M;  1VQM L;  3CD6 O; 
#chains in the Genus database with same CATH topology
 3CCE L;  3CXC K;  3CCU L;  3CCM L;  1YHQ L;  1VQL O;  2OTL O;  1VQ6 L;  1QVF K;  1VQ9 L;  1VQO L;  1W2B K;  2YZS A;  1YJW O;  1Q82 P;  3G6E O;  1JJ2 K;  1N8R P;  3G4S O;  3CPW N;  1YJ9 O;  1Q82 M;  1QVG N;  3CCL L;  3CD6 L;  1VQ5 O;  4W8K A;  3CC7 O;  1KC8 P;  1VQL L;  1VQ7 O;  3G71 O;  1YI2 L;  1VQ4 L;  1VQK O;  3CCV O;  1KC8 M;  1NJI P;  3OW2 K;  5DS4 A;  3I56 O;  3CC2 O;  3CME O;  1YIT O;  1KQS K;  3I55 O;  3G4S L;  1NJI M;  1K73 P;  1YJN L;  4N06 A;  1YJ9 L;  1VQ8 O;  3CCQ O;  1VQM O;  3CCJ O;  4QDL A;  1K73 M;  3CCE O;  3CXC N;  1VQ8 L;  1VQ5 L;  3CC7 L;  3CCM O;  1YHQ O;  1VQN O;  3CCR O;  3CMA O;  2QEX O;  2OTJ O;  1QVF N;  1K9M P;  2OTL L;  1VQK L;  1VQ9 O;  3CCV L;  1VQO O;  1M90 P;  5DS6 A;  1S72 O;  3CCS O;  5DQZ A;  1YJW L;  5DQT A;  1K9M M;  1JJ2 N;  1YIT L;  2QA4 O;  4XTK A;  3G6E L;  1M90 M;  1Q86 P;  3GOD A;  3CPW K;  1KD1 P;  4WJ0 A;  3CC4 O;  1Q81 P;  1YIJ O;  1VQP O;  3CCQ L;  3CCL O;  1QVG K;  3CCJ L;  1Q86 M;  3NKD A;  1KD1 M;  1K8A P;  5DLJ A;  3CCR L;  3CCU O;  1Q81 M;  1VQN L;  1Q7Y P;  3CMA L;  1YI2 O;  1VQ4 O;  2QEX L;  1VQ7 L;  2OTJ L;  3G71 L;  1VQ6 O;  5DS5 A;  1K8A M;  3OW2 N;  1W2B N;  1Q7Y M;  5FCL A;  1S72 L;  1M1K P;  4P6I C;  3CCS L;  1KQS N;  3I56 L;  3CC2 L;  2QA4 L;  3CME L;  1YJN O;  3I55 L;  1M1K M;  3CC4 L;  1YIJ L;  1VQP L;  1N8R M;  1VQM L;  3CD6 O; 
#chains in the Genus database with same CATH homology
 3CCE L;  3CXC K;  3CCU L;  3CCM L;  1YHQ L;  1VQL O;  2OTL O;  1VQ6 L;  1QVF K;  1VQ9 L;  1VQO L;  1W2B K;  2YZS A;  1YJW O;  1Q82 P;  3G6E O;  1JJ2 K;  1N8R P;  3G4S O;  3CPW N;  1YJ9 O;  1Q82 M;  1QVG N;  3CCL L;  3CD6 L;  1VQ5 O;  4W8K A;  3CC7 O;  1KC8 P;  1VQL L;  1VQ7 O;  3G71 O;  1YI2 L;  1VQ4 L;  1VQK O;  3CCV O;  1KC8 M;  1NJI P;  3OW2 K;  5DS4 A;  3I56 O;  3CC2 O;  3CME O;  1YIT O;  1KQS K;  3I55 O;  3G4S L;  1NJI M;  1K73 P;  1YJN L;  4N06 A;  1YJ9 L;  1VQ8 O;  3CCQ O;  1VQM O;  3CCJ O;  4QDL A;  1K73 M;  3CCE O;  3CXC N;  1VQ8 L;  1VQ5 L;  3CC7 L;  3CCM O;  1YHQ O;  1VQN O;  3CCR O;  3CMA O;  2QEX O;  2OTJ O;  1QVF N;  1K9M P;  2OTL L;  1VQK L;  1VQ9 O;  3CCV L;  1VQO O;  1M90 P;  5DS6 A;  1S72 O;  3CCS O;  5DQZ A;  1YJW L;  5DQT A;  1K9M M;  1JJ2 N;  1YIT L;  2QA4 O;  4XTK A;  3G6E L;  1M90 M;  1Q86 P;  3GOD A;  3CPW K;  1KD1 P;  4WJ0 A;  3CC4 O;  1Q81 P;  1YIJ O;  1VQP O;  3CCQ L;  3CCL O;  1QVG K;  3CCJ L;  1Q86 M;  3NKD A;  1KD1 M;  1K8A P;  5DLJ A;  3CCR L;  3CCU O;  1Q81 M;  1VQN L;  1Q7Y P;  3CMA L;  1YI2 O;  1VQ4 O;  2QEX L;  1VQ7 L;  2OTJ L;  3G71 L;  1VQ6 O;  5DS5 A;  1K8A M;  3OW2 N;  1W2B N;  1Q7Y M;  5FCL A;  1S72 L;  1M1K P;  4P6I C;  3CCS L;  1KQS N;  3I56 L;  3CC2 L;  2QA4 L;  3CME L;  1YJN O;  3I55 L;  1M1K M;  3CC4 L;  1YIJ L;  1VQP L;  1N8R M;  1VQM L;  3CD6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...