1YJDC

Crystal structure of human cd28 in complex with the fab fragment of a mitogenic antibody (5.11a1)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment of 5.11A1 antibody light chain
publication title Crystal structure of a soluble CD28-Fab complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/signaling protein
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15910 V-set_2 ICOS V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yjdC00
3HRZA 3MJ7B 4NOBA 1J18A 4MXQC 2H2PD 2FHCA 4P4KB 2DI7A 5SX5K 2A2QT 3B6SB 3FN9A 4DZ8A 4PY8I 5I8CA 3W5MA 2H32B 1MHPH 3S9DB 1QP1A 3QPXH 3OKEA 3KJ4B 3VH8G 2FSEA 4UU9B 2Z8WC 4GMTH 2A74A 5EOCJ 4F7TA 5K93A 3MRGB 4O2EB 5ESAB 4QT5B 3PWUA 1WWBX 4XP1L 4XNYH 4Y7MA 4J3OC 3I75A 5CHNA 5J9PB 3GIVB 1C5BL 2G5RA 5DVNA 2D4DA 4PJGE 2K9UA 2BMKA 5F88B 2AVGA 1JMZA 4WY7L 1F4XH 2BRRH 1HXYB 4P23D 3RL2A 4GBXB 4G43A 1P4IH 4XBEH 4F8TA 3V0AC 1ZT7B 4F15B 4LQFL 3IXAB 4ONOA 5DUBA 2R9HC 1HH9A 1KLFA 1UT9A 1A22B 2HJLA 1WTLA 1RIUH 3DVIA 1F3DJ 5E5UB 1JPGB 4XVSH 4G7VL 4N1EA 3AFLA 3UTQB 3BISA 4RA0C 5DQDL 1RUKH 2ED7A 1ZLVK 3C6LC 5DYOB 5C9KA 4JGUA 5B8CA 5DR5L 2AJ3A 4UIMB 3U4AA 5KAQF 4E5XB 5BQ7B 2VLJA 5IB2B 4NWUL 2QV2A 1CTOA 1FNSH 1I3VA 4XI5C 1BBDL 5E2UL 3HI6H 5T1LB 3U82B 4YIQB 5F6HJ 1BIIA 1RUQH 1U95A 4Q6IA 1NUGA 4OD1L 1MRDL 1SEBB 3KAAA 1UM6H 5J0BA 4JFOA 4R7DB 4DKDC 3Q1SL 1I8KB 4LLDA 4BZ2L 2P8MA 2EEBA 3QIUD 1CGWA 3IFPB 4DGYL 1A1MA 2EDOA 4NO2A 2NY4D 3BEVB 6FABL 3FB6B 3EYUL 4JO2H 1CIUA 4G9FB 5CZVL 5EUOA 4A6YL 4Y16D 2XA8L 4XCEA 4RQQB 3O2DL 3H7BB 1IL1A 4XP4H 4JY5L 4EJ1C 4MNHB 1JGUH 3GMMA 1GGIH 1MWAH 3VWKD 5C2BH 3LMJL 3U46A 4OM0H 1RZJH 3R06B 1D5IL 5C0BA 2I07A 3RZCB 3KYOA 1QSFD 1DQTA 3CK0H 4TULH 3SDCD 4IJ3C 1KB9K 2UY6A 1P4LB 4GRWF 5ILTH 3H7LA 1Q9OA 1NEZA 1Q9KB 4N0CD 1NGZA 1R3LA 2VLRD 3VXSA 2ITCB 2FGZA 1V3KA 1LGVA 1QA9A 1FLRL 3NFNB 4NQCE 4W4OC 1P5VA 1XGTA 5FM4A 5J3HC 3FFCB 4U3HA 3RDTC 3UO1L 1AD0B 4NQDE 1CLZL 4J3WA 3EJYC 3MV7D 2ZP0T 3KWWB 4JRYE 1F3JB 1HI6A 1JE6A 4ZYKB 3HUJA 4R90H 1HIMH 1OP9A 3HZYA 3MRDB 4YNYA 3BFOA 5D1XA 2MPAH 1PW3A 4Z78B 3LEVH 3T0DA 2CKBH 3MA9L 1CR9L 3L5IA 2Q86B 4HZLB 2HH0H 4KPHL 1IM3A 32C2A 3C8DA 4DAGL 1UEMA 3C60D 1HWGB 1YEEL 4FG6C 4QXGL 4LSVL 2B4CL 5EO0B 1U91B 3V4PH 4AEIL 2YEZB 4JFEB 5CJOH 2BHZA 4FMFA 3QUZD 3O3AA 2ESVE 4U49A 3MLYL 4E41D 4KKBD 4H25B 2P8LA 3D69A 4NGHH 1RFDL 4M4PA 3LEXB 1KJ2L 4M6NL 1NEZG 3DV4A 1A7QH 1KB5L 3WUWB 3CFEB 1S9VA 1YYLL 4C54A 5FK9A 4Q9BA 1NFIB 4GJTB 2FBJH 4XXCC 1KNOB 2V2XB 3C8KA 5D72L 2ZCLL 4CJ1A 4P2RD 5DD6A 4JM2B 5EU4B 1G6RH 3TN0B 5CILL 3U7WL 1QBBA 4NKIL 2EIEA 4QHUB 5E6IB 3QQ4A 4YC2C 3RKDD 1B0GB 4YHIB 1DQLH 1RVFH 1EFQA 3GM8A 2V9RA 4U7MA 3RA7H 2QSCH 1F58L 1JUFB 1P7HL 2XKUA 4Z7WE 5CWSA 1KG0B 3E6FA 2V17H 1SYVA 4JFFD 2BNRD 4YHMH 4LHUD 3GHEH 5TF1L 2DN7A 3ULVL 3KLAB 4K8RH 2FX8H 2DQJL 2VQ1B 1MELA 3MFFA 3MV01 4XZUB 1C8PA 4YHNB 4KK9C 3CNKA 4LLYA 1TJHL 3THMH 2CLRA 4W81A 4MNGE 4P5TA 4KK8D 5FIEA 3D0LA 1MCHA 1YMHB 4IRSC 2OTWB 2IAMC 3JVGC 2BOCB 4L29A 4NZTH 3WUZA 3UC0H 3L9RA 4HWBH 4AM0B 1F6LL 4I0PD 3KPRE 3CU1A 4Y2DD 2QQKH 3BKJH 5AYUH 3ZE1E 4MXWH 3SGKA 3BYYA 4Y2OA 1SMAA 4KVNH 3ROOA 4PJ5E 2AJZA 5F72S 4NFCA 4NRZA 4MXVE 4PP2A 3NA4A 3OR7B 5IBTL 2E7LC 4ONFL 4DW2L 2C3GA 2HG5A 1DCLA 3MLZH 4YO0A 1IM9B 2D4FA 4OLYH 5BS0D 4ODVH 5KBNC 4LEOB 2QEJA 1A3RL 3IJSA 4KTYA 5FYJL 2CIKB 3ARDC 4CBPA 3SDDD 3VFVA 1QFWH 2E7CA 3G9VA 1KBGL 2FBOJ 4ZSOA 1LDSA 4HMCA 2OJZL 1V05A 2ZSWB 4QRPA 1IGFH 4G5ZH 2X6MA 1BZ9A 2W92A 3BDYL 4XNUH 1CD9B 3GSUA 1QVOA 5LCVH 4NKMB 1WEJH 4BSVB 4P2YA 4KROD 1FYTA 1J5OL 2JIXD 2OR8A 3FO0H 3UYOD 3EIFA 3FT3B 1VFOA 4RGNE 1SEQH 4Z7QE 3D0VB 3D9AL 4RX4A 4FTVA 2H3NB 1NMBL 2YPLE 4WFFD 4XVJH 4KDTA 5KSUB 4UOW1 2E9JA 4KH2A 2NXYC 4N0FB 1AD9B 1MHPL 2UZIL 4NUJB 3QPXL 3ARVA 3LHPH 1U8IA 5LVEA 4NDMB 1SJVA 3QRGL 4M1GH 2RR3A 5K9OB 1P53A 5EUOE 3X3GL 4L8BA 2J6EA 2QHRL 5IJVA 1TITA 2IMMA 2J5LB 4UNVA 4IDJH 4UTBH 3VFNB 4JZJA 1TCMA 3EZJB 4JFPA 4APQA 5C0BE 5C0AA 3V4VL 5FCUH 5FYKH 1KPUB 5EBLB 1PBYA 3BWAA 2AK4D 2V2TA 5E00A 3ARGA 2YN3A 1FAKT 2BNQD 3PWVB 1UJTA 3VXSE 3LEYH 1JBJA 3VW3H 2WZPD 2NW2B 4EZMA 5I0DA 1A7BA 5L0QC 5E8DH 2VR4A 2XN9B 2VQTA 2XG5A 2EDTA 3EYFA 4XVSL 2YD8A 3VRJA 1T21B 3OWEA 5DDHA 1FNGA 4R8WL 5HHXH 3AB0B 4R4NC 5E24E 4YPGA 1OT2A 3DRTA 2W38A 1OTUD 4XCCL 5JDSA 5IB4B 5F7YC 4PJ9D 3QIUB 1IC7H 2IF7A 5IHUH 2NY4B 3VWJC 3HZKB 1FFPB 1ZA3B 1AGBB 3HI6L 2D3VA 5FUZH 3FOMB 1Q94A 5IQ9B 1NUFA 3GBMH 2JCCA 4G8EB 5J13B 3WS3B 4HS3B 4OCSH 3GSNA 3KGRA 4Y16B 2FECI 5EG6C 2IALA 1S9YA 1JFQL 1NANH 1MH5A 2CRZA 4PJGF 2Z35B 2QL1A 3W82A 3VWKB 1QG3A 5DI8B 1MJJB 2R69H 3VXUB 1QSFB 1NDGA 1V8HA 3G6JB 3SDCB 5JW4N 1NBVH 3PL6C 1I4FB 1UKTA 1QR1B 5HGDB 2VLRB 3BKYH 4U6YA 4UQ3A 5HHOA 1K4DA 3U7AA 1OAXL 4FQJL 5EZIL 4JO2L 2P45B 4R7NB 1HXMA 3EO1B 4TVSa 5JO5B 3MV7B 2ZPKH 1NLDL 5F7DB 5HVWA 4HK3N 4KGLA 3WJLA 3F7YB 4H5SA 1CDYA 5J7CC 4HS6A 3P77B 1T0NB 1R24A 4CADB 3O9WC 2EDWA 1FVDA 4OFYD 4XP6H 1EAJA 3L95B 2C4XA 1OAZL 3C60B 4J3VA 3RTQC 3O6FA 1A3LH 3GJFB 4LHQB 3NGBB 3BW9A 3HG1D 1X5HA 4B0MM 4LCWA 3DYMA 3QUZB 1O7SA 1ORQB 1LO4L 3ULSA 2UVEA 1CGSH 4E41B 1M71A 4ZFOB 4BH7A 5JPMB 4L9DA 1DL7L 5ANMA 3QO1B 5GS0D 1GYAA 3TO4A 1ED3A 1FL3B 2DBLH 2H9GA 5DQ9B 1UJ3A 1SQ2N 4KY1H 1IGJA 1GOHA 5HDQH 4UAOC 4DZBB 4PUBL 4OGXL 3T8XA 3TIDB 3TFKC 4JN1L 1KCUH 2JB6B 3S36L 2E7MA 3F6IA 1OF2B 2O5XH 4P2RB 3D18B 4OGAC 1V3JA 4H1LB 5BRZA 5K9JH 3WIIL 3IDMA 4P5KB 4D9QE 4P5MB 4NGHL 1HCVA 3GRWA 5BO1L 3FHQA 4XX1G 1QSEA 5BXFA 1SJHA 1EVUA 2BXYA 5C09A 3MX0A 1MJ8H 5E2TL 1L7TL 5BV7H 2J8UB 4JFFB 5TE7H 4YHLH 5DJYB 1KV3A 2BNRB 4LHUB 1CXLA 1F4YL 4JR9H 4X6BA 1INEL 1P7KB 1ZHBB 1I1AC 5LBSH 1OARL 3W2DL 4AENB 2F58H 4CUCA 4ZSOE 1N3NA 1UVQB 2B7DT 3LD8C 4QRPE 4F9PC 1IE5A 1BD2A 2QSCL 2VL5A 5ADPL 5EU5B 4MB3A 3EYOA 3BSZL 4QXUH 4I0PB 5K9QG 2AKRA 2DLFL 1FYTE 3DBXB 1L9NA 1JPSL 3ARZA 1FVCA 4HX1B 3MRLB 5I8EA 4WDIB 4FQQA 5I1GH 3GMOB 4K8RL 4WUUA 5FOBA 2YD1A 1DBJH 4XPAL 4TSAH 5CJ8A 2ENSA 3J7HA 5D2NB 5HGHB 4Y5VA 4OM1H 1HQ4A 5CEXB 2GEEA 3QEUB 4MD0B 3S3JA 1TZGH 4FTVE 1T7YA 1DLFH 2JJWA 3MREA 5JQ6H 4P46A 3DXAB 2OZ4A 2HLFC 4LLWB 2B1AL 1TCRB 3MBEA 1UACH 3BH9A 2QQKL 3SDDB 4MXWL 4UT9H 4PJIA 1F4WH 3DMMC 4MNQD 1Z9LA 1IGCH 2R9HD 2R2HA 2VXQH 2WWKO 3O4LD 4Z7WF 2OL3H 2XY1A 4PG2A 3OGCB 2JELH 3SDAD 1INDL 4YX2L 3C6LD 4I48A 4LKXA 1NCBH 5C0AE 4TVPE 5C70A 4MCZA 1QRNA 4WFHD 1PKQA 4KROB 2EDLA 4FQXC 2VLKA 5CD3A 2JIXB 4AT6B 5HHPA 1GH7A 5EBMA 5JW4M 5IB3B 3ZSTA 4PRID 1E4XI 1P1ZA 1QFWL 5E08H 2ADJB 3DETC 1S9KC 3CCHA 5B3JE 2NY1B 1RK0B 1ZE3C 4HWZB 3QJFA 4L4VB 1KPRA 2FATL 4JY6B 3ZDZE 8CGTA 3LQAL 1A3QA 4RZCA 3GKWL 4AIOA 1DQJA 3ZE1F 5HPOA 4HPOL 4MAUL 4FZEL 1JWUB 3D2UD 3GSXB 3RIFK 5E0QA 5IMMA 1T7ZA 1G9NC 4MXVF 3WEXA 5CUSL 3GK8L 4KHTH 2JCCE 3FO0L 5I1CH 4JREC 4GO6B 4JHAL 1MFDH 1PDKA 1AFVH 1E6JL 3QUMB 1KIRB 2YUXA 3X11A 5GISL 1GHFH 3TPUA 3C9NA 4J3UA 2A9NH 3T0AA 4KRMB 3Q6FA 3RVXD 5I15H 5MEPA 1D9KD 4MSWA 4HUUB 3TA3A 4QY8B 2AK4B 1I3RB 4XVJL 3VXMD 1DEDA 5D9SA 2BNQB 4HF5H 1RJLA 2F54D 4RBPH 1J11A 1YEGH 5HHOE 3LHPL 5JW5B 1MNUL 1I9IL 1OLZA 2VQUA 4IMLB 1NEUA 3BE1H 4YAQB 1T5XA 5IHZA 2JE8A 3CSGA 1I1FB 5I66A 3O3BA 3NCCB 1BLNA 3GMPA 2ZSVA 4QRQA 3WFBL 3VD4A 3ARFD 3CSYB 3EO9H 3L5HA 3G5VA 2ADGA 3A0OA 2O5YL 2DWEA 4QTHB 4HS8H 2VAAA 2ADFH 2X1WL 2G75B 1B4JL 1FZOB 4PJ9B 3WBDA 2X89A 5GGRY 2ATPA 4XX1E 3UJJL 3BP4A 1JZ3A 1T4KA 3SE3A 2YBRB 3LEYL 4TYUA 3WL9B 4Y5XA 2VDLH 3T4AB 2A77H 3AMLA 1UH3A 5GGVH 1A9EA 5CJQL 1GZPB 1ZSDA 1QQDB 4FG6D 3FOLB 1GC1H 3HC0A 4Q6IC 5GIRA 4RGNC 1R3IH 5HHXL 4PJXB 1YY8B 4LCWE 2EKSA 2R2EA 4U1NA 5J6HB 1M7DB 2VZUA 4ODBD 1IEAB 2W9EL 2X4PB 2HKHH 4BM7A 4HDIA 4XB8A 3UTOA 3BZFB 5ANME 5GJTL 5EUOF 3U4BL 2FYYB 3MUGB 3QIWC 5DF0A 1H5BA 3NFSH 1J0IA 4O5LL 1N5AB 2CGRH 3NPZB 4LRNH 4GW1A 5INDA 5F3HA 5IQ7H 2DMBA 5DRXA 3D85A 2IAND 4Y1AA 2IH1B 3QDGA 3GIZH 1WZ1L 2YMXH 1A4JA 3MRIA 5GZND 5BRZE 2DQFB 3MV9A 4UBDC 5FXCH 4HJGA 3NPSB 1ZEAH 1OM3L 3CPLA 4KJYA 4DQOH 4N5UA 1QZ1A 1NCAH 1OGTA 1QSEE 2C3HA 1RD6A 4PD4J 5C09E 4WU7B 5HD8C 4EUPB 2YD7A 3FN0H 1ZGLM 1FSKB 3HG1B 3NCJH 4HH9A 4Y4KD 4ZDHA 3IFNH 1ZA6B 4PRPA 4FFYH 4X0KA 1ZLWK 4AEFA 5HI3C 2IFFH 4D0CB 1PYWB 4DGIH 3CDGA 2LV4A 4PS4L 2YZ1A 1A2YA 4GMSH 5J1TC 1UWGH 1MHEB 1K4CA 1RMFL 2QSVA 3E8UL 4X5XB 3WYRA 4KK9D 4PBVC 1IGIH 1X5LA 3H9YA 4ZO8A 1BD2E 5E9DD 1T3FB 3IAGC 4ZTOL 1A1OA 4OD2A 4KMQA 1B3JA 1HYSC 1BQHA 3CMOH 1JF1A 1KACB 4B7LA 3V52L 1U0QA 4FFZH 2NNAB 3SOBH 1CGSL 1JZ5A 4WUUE 4ZFOL 3SJVA 4A2LA 3O41A 3QCUL 2I9LA 4KI1A 2DQDL 5JDJA 1T7XA 4BH8A 3H9SD 4E9LA 3OAUH 3OXSA 4MQTB 5HDQL 1TJIH 3D39A 4EBQH 3NFPB 2GJ6A 2ZCKL 4WW2A 3TLRA 2Y6SC 1J05B 4B53A 3VFSA 1MFBH 4PJIE 3KPQA 2YD4A 3GSQA 3HLAA 4GW4A 5EOQL 1F4HA 1CS6A 1FVEB 4UOJA 1H9VA 3VD3A 1TVHB 4LLVA 2ZG1A 1PLGL 4XC3H 3UTZB 4QNPE 5ISZA 1I8IA 2ZUWA 4QXTB 4IOFC 2AEPH 2Z92A 1F11A 3VCLB 4G3YH 1PKQE 3BXNA 4FQHA 5KW9L 2VLKE 2HRPL 4K71B 4LAQH 3VE0B 3OHXB 1UXSB 1IT9H 3BZEA 1RZIA 2VITA 1BQHG 1Q0YH 3VFWA 4BYHA 3AU1B 4FFWC 3GJFK 1HHGA 3ZT5A 1EXUA 3B9KA 5E8NB 1BQUA 4I2XE 5E1AB 4ELKA 3BN3B 3K46A 4PJ7B 2P5ED 3MOAH 3X14A 5HYSB 1ERNA 3AS1A 1TZIA 1IGTB 2FL5B 3QFDB 5BW7A 1S7RB 1MI5D 3NH7L 1NGPH 1T7VA 5HHNB 2CJUL 2R0WL 4MNQB 2APWA 2V5SA 3KPOA 1MUJA 1NMAH 5MERA 3SY0B 4LSQH 3G6AA 5GRJL 3SGKC 5D1QA 4H8WC 1JK8B 2H1PL 4NN5C 3LN4B 3NIGE 1G7IB 4RMQA 3C6LB 4JZOA 2HYMA 2XA3A 3HNVL 2ED9A 3L3OB 2C1PA 3HNSH 5GHWH 3E2HC 4HPYH 4YHPA 1NGYA 1F90H 1X5AA 3RIAF 4HKJB 5HY9A 4G8IA 2Z4QA 1UB5A 4PRIB 4JPWH 4UT9L 3IFLL 5KS9A 3DRQA 5TE4L 3BRGC 5TQ0L 4OCYH 4Y4HA 2CO7B 2VXQL 4C56D 3U0TB 2P42B 3W11D 2DDQH 4Z0XB 2ITDA 1EEUA 5IB5B 4R4ND 5C0IA 2UZYB 4L4TD 4OFDA 1V7NH 3D2UB 1G0DA 1DUZA 1S78C 1DSFL 4MQ7A 2EH8H 4HJJH 1BQLH 4LSPL 1KFAH 1HHHA 4L8CA 3G04B 2L7UA 5JUEL 4ONGL 1LO5A 5IMOB 1OP5K 4LSTL 2WK2A 4I18C 2VABA 2AV7A 1QHPA 4CN1A 5DTFB 1EO5A 3VXMB 1OW0A 3QXDA 3PWJA 4IJ3B 4NSKB 2F54B 4M02A 5IW1A 3PL6D 2FIKA 4A6YA 1UXWA 3QUKA 3O2DA 1NCWH 1QKZH 3IVKB 1VA9A 2YC1B 4KHTL 5C6TL 4LFHD 5E2WH 5I1CL 1AI1L 1KJMB 3RNKA 1KOAA 4UMGA 3QUML 43CAB 4PJBA 2DMCA 2R1XB 3MYJA 1GHFL 3ARFB 2HVKA 4BSWA 2X4NB 4HAFA 1GOGA 3BPCA 4OLZL 5A16A 1VGEL 4PRAA 2H2SD 4Z77A 1CGUA 5JOFB 1ZLSH 4PFEA 1EHLH 4FHBD 5DMGD 1LNUB 4WCYH 5GRUH 3TBSB 2OR7A 4APQC 3MV9E 5I74C 1RULH 2AXGA 2P47B 5T1DH 4X4XA 4LOUD 4AK1A 1IKFH 5GS1A 4YXKH 5B3JF 4TNVK 5MEND 4DK3A 3ARGC 4OCXL 1JYNA 5I16A 2X1XR 5J89A 3LDBC 3OJDA 5H94A 2F74B 5D71L 3ZDZF 5CS7A 3VGAC 5DJ0B 5J6GA 3SE4A 4P57B 3RNQB 1VKXB 1RZGB 2D7QA 3EO9L 3RY6C 4PRPE 4QRRA 3IAPA 2X5PA 1FGVH 1A6VL 2PKDA 1LE9B 4N5EC 2R0ZH 3RUGA 5ICXA 1G7QB 3WSQL 4G7YH 3I85A 4NRYB 3MRBA 4LLQA 4TSCH 3RBSA 2APFA 2JCCF 4AMKH 4JJ5B 1VFAA 3VXQB 3FQTA 4LDLB 4MS8C 3M1BA 5FKPB 3OX8B 3V0WH 4FN0A 3BH8A 3OKMA 1YUHB 3LRGA 2PXYD 1GC1L 5ID0A 3MR9B 1J0YA 3FO1B 4L3EA 4U1GC 2A1WL 1IAII 1MAML 1NJ9B 1KLUA 2IANB 4B7IA 5TGBA 3U36A 1KJ2A 4OGAD 3TCXA 3EUUA 5DMIH 4NIKB 4ZQKA 1KB5A 4TUOA 4YC2B 2P8PB 3KPMB 2AABL 1EVTC 3F5WA 4HJ0C 1SY6H 4NO3B 3NFSL 1K6QH 1J0KA 1JTTA 2LU4A 3QHFH 1F2QA 4R4FH 5DD5L 3D39E 2BVOA 4JO3H 3VXRE 1MCDA 4Q9RH 4JFHE 3H3PL 2Y06L 4F7CB 2F53D 5IBUG 3GIZL 1YEFL 3LKQB 2YMXL 3HE7C 1I1AD 4LLMA 1S5HA 4L3CB 3DTXB 4WNQB 5CIPB 4HFUL 5HSFA 3UXFA 1P84J 1Z9MA 4OZIA 3OGOE 1RY7B 1CTNA 1FZKB 3ULUE 4RSVA 4D9LH 1K2DA 2GK2A 5E9DB 5ISZE 5D7SL 4X99A 1JPFB 1ETZB 3FN0L 1FN4B 1HHIB 1HKLL 5HVFB 4IRSB 2IAMB 4P4RB 2ORBH 4YDJA 3QJHB 1GSMA 4F33A 2DI8A 3QBTB 1RUML 2GI7A 4DGIL 3GMLB 1T5WB 4PJDB 4M5ZL 1YQVL 4ELMB 5GS0L 2MQ3A 2H8PA 5MHSE 1QLFA 2EH7L 1A9BB 1IGIL 2BVEA 4M43H 3UZEA 3ZTNH 2FB4L 4LGRB 3QR2A 3SGDH 3EYSH 4OF5A 1NUDA 1T1WB 1DP0A 1G7PB 3RWHB 4EVNA 5DRZB 1IKNA 2HLFD 2VC2H 2FIRT 1KCSL 3DLQR 2PTTA 5JW3H 1C12B 2PR4H 3VG0L 1JRHI 3ARDB 4QHKJ 3IFOB 4HFWA 2UWEA 2A73B 3DMMD 1TNMA 3GUTB 1I1YA 1ZS8B 3HR5B 3P11H 4Q2ZA 4YFDB 4PRNB 3CH1B 2KPNA 4MX7B 3VGFA 3QAZB 3AY4A 3ZYOA 1NBYB 1JGDA 2YD9A 4PGBA 3SDYH 4GKZA 3CUPA 4CVZA 2Z93B 4WEUD 5JMRA 5E2VL 3DX8A 1NCNA 1ITCA 3MNZA 4M7ZC 1I1CA 4KTEH 1FFOB 4XCFH 5IM7B 3C5JA 2P5EB 1U42A 1HCFX 1EMTL 2HT3D 5C7XL 3QIBA 1HHJB 1T0MB 1D3CA 5CP3A 5D7IB 3WFDH 3TNNA 3DX6B 3QPQD 5I1AB 1IQDB 4G3YL 3WJJA 1VERA 1DN0B 2FWOA 1AKJD 2NY7H 1G7LA 4F2MB 1MI5B 4D8PA 3FFDB 3UAJD 1Q9WB 1IT9L 2D0FA 2V2WA 1C16B 5ICZB 3MJ7A 3LKPB 4JANB 2R15A 1UYWH 4P4KA 3B6SA 1KEGL 2HJKB 3LS4L 1BVLB 2GJJA 4M7LH 2H32A 2VN4A 4O58H 1WUNT 3CLFL 4UU9A 4AIXA 1JYWA 2C7UB 4PJIF 3MRGA 4U3XA 4O2EA 5ESAA 4QT5A 5A2IH 4P46C 3FRUB 3GJEB 3CZFB 5J9PA 2HT4D 3GIVA 4QNPF 4C56B 4PJBE 5F88A 4XVTL 5C0RL 3QO0B 1Z5LB 2NZ9C 1HXYA 4ENED 1BJMA 4GBXA 4HAGA 1ZT7A 4L4TB 3HNSL 4UINL 3IXAA 3NABH 4FQIH 1DQMH 3UMTA 3KLHD 4M6OL 5CLWA 3VWJB 3MYZA 2BNUB 3UJTH 5FV2A 1JPGA 3BHBB 4HUXB 3UTQA 3P0GB 4MJ5B 5DYOA 3HRPA 4TUJB 4UIMA 4E5XA 4WTZA 5BQ7A 2QADC 5IB2A 2EDQA 1KJ3L 2HJFB 4QRRE 3NCFB 4QF1B 5T1LA 4IBLT 4YDKH 4M1CC 1KGCE 3RVTC 2G9HB 4RNRB 3PL6B 5DHVB 1V7NL 2AEIT 5IP4A 3TBTB 2A9MH 4YBLB 3UDWA 4U6XB 5BOPA 4XPTL 5E95B 1SEBA 5T3XH 1DDHB 1AY1H 3NIGF 3QIWD 1KFAL 1I9RH 2EDEA 2MOVA 4R7DA 1A6ZB 3NCYS 4Z7VB 3C08L 5JXEC 1I8KA 1YN6B 3TYGL 1IEHA 5AZ2L 4L3EE 4RCAA 3IFPA 4LSRH 3BEVA 4NC1C 4K23H 4RMUA 3FB6A 3WXWL 5ACMA 1ORSB 4LCCC 1GIGH 4JFDD 4G9FA 1JVKA 1L6XA 2MMXA 5BZDB 4RQQA 5MENB 3MRMB 3O9WB 3H7BA 3S35L 5L8KB 2F5BL 4MNHA 4OI8A 2EDDA 3R06A 3WLBB 3CSBA 3RZCA 3RTQB 4OCLC 1LVEA 1P4LA 1YEDB 2QQQA 2QTEA 3SO3C 5E1HB 2WQ8A 4NO0D 1Q9KA 1CFQB 3GBNL 2A6JB 4QWWC 1U8LB 2DTMH 5HI3D 1A6AB 2ITCA 4WTZG 1EHLL 3O0RH 5GRUL 5GXBB 4WEMB 5DRWB 3NFNA 4HSQA 2YSSB 2NTSP 4FXGB 3FCTB 2Q6WB 2VOTA 4OZIE 3BPNC 1L0YA 3FFCA 4FP8H 1E4KA 5HHVL 1AD0A 1YEJL 3MLRL 3SE3C 4LGPB 3KWWA 4I3SH 1F3JA 4Z0BH 4IRJC 4X6CB 4ZYKA 4POYA 4Y5XC 2W65B 4UAOB 2PTUA 4H88H 3MRDA 5DMKB 4POUB 1FGVL 4Z78A 4ESKA 1HYSD 4DVRH 2YPVL 4BZ1L 3KJ6H 3R4DA 2Q86A 3E3QE 4HZLA 5EORH 1WFTA 2GYSA 3PWLB 3GO1H 2VXVH 5HYJD 1L4IA 1M7IB 1JZ8A 5EO0A 1U91A 2PO6C 1F2XK 3WFZA 4XTRD 3V0WL 4N68A 4PYGA 2YEZA 4JFEA 4PJHB 4JKPH 1ADQH 2Y5EA 2YRLA 5F3BB 3QYCA 5GGTH 4H25A 4ALAL 2F53B 3B2UC 4L3AA 4LVOC 3LEXA 3HNTH 1I1AB 4QOKD 35C8H 4ZPVB 2UWEE 3VFGH 3WUWA 1CN4A 3CFEA 2GFBB 1Z0MA 3GMQB 2E27L 1NFIA 5BCAA 1MAKA 3OJ2C 4JHWH 3ZKXB 4YHKL 1KNOA 4HWEL 2V2XA 3IKCB 2HA1A 3BJLA 4GXVH 1OPGH 3HC4L 2A6KB 1N6QH 4JO3L 3MGTB 4JM2A 5EU4A 2CRYA 3TN0A 2V5YA 4QHUA 2PW2B 1MVFA 5E6IA 5AD0B 1B0GA 4YHIA 4TSBL 1JUFA 2VXTH 4YFLF 3UJIH 3P0VH 3WDHA 3IDXL 2JB5L 2VDPL 1KG0A 1MIEL 2AEWA 4RGOL 3WIFB 1BEYL 4WU5B 1J1XH 1SHMA 3A6BL 1CDBA 1N7ML 2GHWB 1RI8A 5GGQL 3DROB 3KLAA 2VQ1A 3NCMA 5INCB 3WS6C 3QCVH 4XZUA 4YHNA 1JIBA 3U1SH 4NHCL 4WW1B 4BK4A 3DMMB 2Y1VA 3OQ3B 4Q58C 2GW5A 3D1MC 1YMHA 2OTWA 2BOCA 2NW3B 4AM0A 1EZVX 1BGXL 4OIIL 4WW2F 2NLJB 1TVBB 2XWTB 4MHHG 4Z18A 3U4EB 3R1GH 4KHXL 4MA7H 1EHNA 1JWSB 1N0LA 2Q8AH 3O81A 1I7UB 3HE6D 3OR7A 2PR4L 4RAVB 2X10A 3ULUF 5EZLB 3WHXB 3RP1A 4MJ4A 2BFVH 1IM9A 3I2CH 4Z7UE 3ALXA 3GNML 3GSVB 4LEOA 1EEQA 2LTQC 2CIKA 1MCWM 1AKJB 2ZOKB 3RWCB 4J23A 4I0CC 4ZFFB 3MLUH 3H42H 1G9NH 2NXZD 2ZSWA 2ZUQC 5J12B 2DD8H 1VHPA 2Z31D 2VUYA 3K8LA 1BVZA 1PY9A 1JGVL 4GG8B 4NKMA 3CFKB 2CH8A 4TRPH 1DBAL 2XFXB 4BSVA 2EC8A 3ARQA 4GAYB 1FH5L 3M07A 4OI9A 3S97C 4XVUD 4V1DD 2NY7L 2PCPB 1FNFA 3FT3A 3RVVC 1C08B 3SBWA 5BW7C 4O4YL 4KV5E 4RWYH 2EYSB 2V9TA 3D0VA 1I85A 2H3NA 1UH2A 3EW3B 2DJUA 5B22A 1W0VB 1UGNA 4DKFH 2O5ZH 5KSUA 3L3IB 1CDIA 4M7LL 1AD9A 1J8HD 2BOBB 3OJMB 4N0FA 4NUJA 4PGEB 3C87A 4O58L 2AJVH 3N1PC 4HIIB 2NR6C 4NDMA 2YN5A 3MCKB 3O6MH 5A40E 1A7OL 1PGRB 5K9QI 4G9FE 5K9OA 1G84A 1MLCB 1MCIA 3S4SB 3O6LH 1A1NB 1U8NB 1UWEH 1FNHA 4J1UB 3RAJH 4GSDH 3GFUA 3VFNA 4S10A 4PLNC 1CQKA 2GITB 2XRAH 1FORH 4ODHH 3IU4H 1KPUA 5EBLA 4U7SA 3MTRA 1EH9A 5ETUB 3GI9H 2CPCA 1MEXL 2A38A 2ERJC 3PWVA 1EGJH 2OMNA 2W0LA 1DQML 3BPOC 4JDTH 2NW2A 5I8KH 2XN9A 4WVRA 4NO5B 3PXJA 3QEGH 4QGYA 4YH6A 4HG4K 3UJTL 1DN2A 1R5VB 3LS5L 2P5WD 1T21A 4XPBH 1B0RB 3QIWB 3LY6A 3HPLB 5LJYH 4K3DL 3BZDA 5IB4A 3QIUA 2YK1L 2AJUH 3IDJB 3HZKA 1FFPA 1ZA3A 1AGBA 3CH8A 5D5MB 2W91A 3FOMA 2ICWI 3C09B 1FO0L 5IQ9A 4G8EA 3WS3A 4HS3A 4JFDB 2ZOLB 4Y16A 1CLYH 3P2TA 1X5IA 4P2QE 2WINB 2Z35A 4PJBF 3VWKA 5DI8A 3LIZL 1MJJA 1I9RL 1QSFA 3G6JA 3VXUA 3SDCA 4JFEE 1NFDB 5I17B 2AEQH 4NO0B 4UT7H 3V7MA 1I4FA 1QR1A 5F7KC 5EU7E 5F9OH 3AREC 5HGDA 2VLRA 3NCYP 4AEEA 3BKMH 1TJGH 3V9FA 2CD0A 4IMKC 5EZJB 4WI4A 3I02B 4R7NA 1QPXA 3HE7D 1IQWL 1S9XB 4JM4L 2IBGA 2DICA 3EO1A 5JO5A 3MV7A 1I1RA 5F7DA 3KYNB 3RWDB 5HYFA 4J6RL 4X7TB 1CL7I 5FA4B 1FZJB 5JNYB 2P49B 3F7YA 3IDYC 4F58H 4QGTA 4GRMB 1U2HA 3P77A 4MDJB 2J4WH 1T0NA 3SE4C 2DTML 4CADA 3O0RL 4MA1C 5HYEA 1N2RB 3L95A 1DBKL 3C60A 5HYJB 3BKCL 2X4UB 1ZTXL 3GJFA 3KPNB 5GRXG 2IBZX 5D8JL 5IUSA 4ORZC 3PJSB 2R0KL 3CFCL 4Z0BL 3OB0K 4QCIB 1YEKH 3QUZA 5DXWA 1ORQA 2B4CC 1U3ZA 1T7WA 1MCPH 1MJ7H 2N56A 4E41A 1Q9LB 3BUYB 4ZFOA 5JPMA 1RZ7H 2VWEE 4I8DA 3QO1A 4ZFGL 4QOKB 1MCRA 1FL3A 2C9AA 4OAWB 5DQ9A 3AM8C 3AVEA 1OAKH 2GKIA 3WFEH 1D5BB 5EPMB 4DZBA 3AUVA 1XCTB 3TIDA 2IWGA 5L7XH 1YMMD 4XWGH 1N5YH 1ITBB 2JB6A 2R8SH 1OF2A 1NAKL 1LDPL 4P2RA 3D18A 1IZKA 4JKPL 3MZTA 4H1LA 4LARH 2D0GA 4ODXB 5GGTL 1AJ7H 1WQVT 4P5KA 1XZ0B 3M8OL 1EAPB 4P5MA 5FFLA 2W9LA 4XNMB 1SVCP 1B88A 4OZIF 2G5BB 35C8L 4K55A 2C4FU 2VH5H 3O6KL 3T08A 2IMNA 1FDLH 3EOTL 5JTWA 2J8UA 4M7LT 4JFFA 1QNZH 1VB9A 5IFAH 2LAAA 4HEPG 5DJYA 2BNRA 3V95A 4LHUA 4GXVL 1L7IH 5T5NG 1P7KA 3Q2CA 1ZHBA 1LK3H 1DJSA 4AENA 1ODAA 2VXSH 1A7NL 1BJ1J 1TQCC 3ULVC 1Z6JT 5C0FB 1UVQA 4XC1L 5C07E 5LQBH 2J8HA 5F1IB 3E3QC 5LKNA 4H8WH 5EU5A 3VRIB 4I0PA 1SJEB 3C2SA 1J1XL 4JB9H 1XF4B 3DBXA 1U6AH 1X5ZA 4HX1A 3MRLA 5LXGL 4WDIA 4XCNB 3GMOA 3E2HB 4HUWB 5DJ2B 4JFYB 1Z3GL 5FV1L 2UWEF 4XMPH 5EWIH 2QKIB 5GGVY 3QCVL 2XNAB 4H1LG 4CAGA 5D2NA 5HGHA 2NY6C 3N1MC 1EEZB 3TVMC 1PZUB 5CEXA 3QEUA 4MD0A 5I30H 1PSKL 1CFNB 4JO4L 4R2GC 4HT1L 3DXAA 4X8JB 4HIEB 4LLWA 5D1ZC 2YA1A 1TENA 1TCRA 3RBGA 4OB5H 4K3JL 4MZ2A 3SDDA 1EV2E 1L9MA 5AG8A 2DQEH 2R1WB 1OT1A 4LHUG 1CDJA 3AY4C 5FHBL 2Q8AL 2NXZB 3GMNB 3A67L 2MFNA 1ONQB 4F7PB 3TNMB 2DIAA 1BJ8A 4XBPB 2Z31B 3OGCA 2WBWB 2Y7QB 1BZ7B 2CDGB 3MJ8B 3T2NH 1G9MH 4YXHH 5GSVB 2OLDA 3B9DA 3LQZB 1K3ZA 4I18B 2QADD 2GK0B 2JIXA 5F6HI 4AT6A 3PWPD 2OJEB 4OUOA 5IB3A 3BP7B 4M1CD 3HAEH 1KUMA 3HAEB 4PBXA 3QIBC 3RVTD 3ES6B 2ADJA 1OOAA 2XN9E 3QULB 3L6FB 3TV3L 4LP4A 1J88A 1RK0A 4WHTB 3WJJC 4A2MA 1W8OA 4HWZA 4L4VA 2DD8L 1IMHC 4JY6A 4XMLL 5MP6H 1UM5L 1M1SA 1JPTH 1J8HB 5JXED 3N85L 1JWUA 3HI5H 3GSXA 1N6UA 2J6EH 5F1NB 2RAMA 25C8H 1A7RH 2AGJL 4YFLI 5I74B 3P9WB 5L2JB 4GXUM 2R0LL 3QUMA 1KIRA 3GI8L 1QSVA 2FZ3B 4JG1L 4Z7UF 3MLXH 1JF6A 4GG6B 3WXVH 4H20H 4HUUA 3QDAA 3VXUE 1QSFE 3G6JE 4QY8A 2AK4A 1I3RA 5B3NA 1A64A 1KIQB 5IT2H 1CXHA 2BNQA 5IKCB 1AC6A 4TOYL 5JW5A 1CXEA 2WP3O 1ZWIB 2D03H 4GBXC 4IMLA 4YAQA 4RFOH 4DKEL 1I1FA 2P5WB 2GQHA 5T3ZD 3MV7E 4M6AA 1EJ6A 3CSYA 5IBLD 4GSDL 1JTOA 4QTHA 5DWUH 1FL5B 3ZYJA 4IRJD 2G75A 1FZOA 4PJ9A 3GSNH 3P73B 3GI9L 4DN3L 4M62H 1TTUA 3BIAX 1EGJL 2YBRA 4PJFB 5HGAB 4BA8A 4EI5C 1NGWB 4JDTL 3WL9A 4K7PX 4ODUB 3T4AA 4KV5F 4CRPA 2ZG2A 5JLZB 3QEGL 2Z0BA 1AQKL 1GZPA 3DVNB 3P40A 3QWQB 1QQDA 3FOLA 4YGVB 1U9KA 1JZ6A 2PO6D 4PJXA 1YY8A 3MLSL 5J6HA 4M3KB 1M7DA 3FRPA 1IEAA 1NGQH 2X4PA 4E41E 4ZUWB 4YDIL 1XIWD 3BZFA 2VAJA 3PGCB 4KK5D 2FYYA 3B2UD 3MUGA 5KVGH 3ECBB 3HE7B 4DEPB 1QBML 1ZGLB 2VN7A 1CLYL 4D3CH 4ZD3H 2FO4B 3QRFM 1N5AA 3LCYA 4S0SD 3MRPB 1WWCA 1I3GL 3MROB 1SBBA 2J8OA 3N9GL 4OCRL 4MJID 1ACYL 3T2QA 2IH1A 4YXLL 4NNXB 4Y0GA 4UT7L 3TT1H 2DQFA 5CGYD 1TFHA 1TJGL 4W6YB 3FMGL 1M6OB 2X42A 1B90A 5C3TA 3LB6D 1T1XB 2HWZH 4Q9CA 4LNRB 5J57B 1W0YT 1IC4L 4QRSB 4DVBB 4KZDL 4WU7A 1BFTA 1Q8MA 4EUPA 3LN9A 3HG1A 5HHQB 3QG7H 2UUDK 3PGFH 1ZA6A 2J8UE 4JFFE 4Q0XH 4ZODA 1FPTL 2VR9A 2BNRE 4D0CA 1IC5H 1PYWA 5L6YH 2R1YB 5ALCL 3Q48A 1FFNB 3DWTA 1MHEA 2D7NA 4X5XA 1I8LA 3FRPG 1WJ3A 4I77H 2WUBH 2ZCHH 2D31B 5IF0B 1OY3B 4E42B 5DEFB 1A4KB 5JIKA 1T3FA 2OP4L 3ZHKA 2F19L 5IFJB 5KANG 2FD6L 5DA0B 4U05A 2EE9A 3GSRB 2FDBP 3GRWH 3N1GC 3ZT7A 5HYQB 2NNAA 4OZGE 4LVNC 12E8H 4HKXB 3CLEH 5D2NE 2D0HA 2BSTB 3S3SA 1HILB 5J06A 4F37K 2ICES 3OAZH 1E4WL 4HCRH 3VFOB 3NFPA 4D9RD 3DXAE 4JM2F 4MDIB 1N5YL 3WFCH 1EK3A 1J05A 4O2CB 3O2WL 4M03A 5DK3A 1ZANL 1Y0LB 2VDKH 1B6DA 4JM2C 1O0VA 1FVEA 1Q1JH 3SE9H 5LGHH 2EXWC 4AIZB 1TVHA 3HI1B 2XWJB 4ODTH 5AZEH 5I6XC 3UTZA 4JVPA 5E6IC 4YE4H 4PGJA 3KLSA 4QXTA 4ZO6A 3VCLA 1QNZL 5DJXB 3SKJL 4GUPB 3L1OH 3V6OA 3VE0A 3OHXA 2EE3A 3ISWA 2FCBA 1UXSA 3RIFF 4PRHD 1CFBA 1NCDL 3RWGB 1WBZB 3AU1A 3OKLB 2OZ4H 5E8NA 2HTKC 5E1AA 4L4VE 1KT2B 4YBQD 4P9MH 4PJ7A 1WWWX 2AXJA 3WNLA 1BIHA 3H3KA 5HYSA 3BRFA 4WFFE 3EGSB 1CDCA 3SN6N 1IGTA 2FX7L 2FL5A 3QFDA 3CVHH 3CVHB 1S7RA 1U6AL 5HHNA 1U8MB 4MNQA 2NR6D 3MXWL 1H3VA 4U33A 3SY0A 5FYLD 2BSSB 5EA0L 3QHZH 5EWIL 5TPWL 4HUNB 3IDUA 4KI5E 4N8CH 4HK0B 1JK8A 3LN4A 3QNXB 4XNXH 1G7IA 5FECB 1JZ7A 1NBZB 1QLEL 3QUXD 3C6LA 1NC2D 3UBXI 3L3OA 4RGMB 3WIHL 1E4XH 4X5WB 4XPGH 2QADB 2FJHB 4FXKB 2BNQE 3PWPB 3G5YB 4HKJA 4ODSL 4JDVB 1KXVC 4PRIA 2BHYA 5MI0C 1CF8H 3FB5B 4PJEB 5GGSY 1NCCL 1BWMA 3I9GH 2ICCA 4I5BB 3FQNB 1CK0L 4KKAC 2C1OB 3U0TA 2H45A 1FFRA 4HW6A 4NM8H 3CX5K 1QFOA 1S7UB 4Z0XA 4KAQL 3T2NL 1CDUA 4EXPX 5IB5A 3EYVB 4RISH 3BT2L 1G1CA 5T33H 4K7PL 4OLWH 1S7QB 1MPAL 3LQAC 2QQNH 3D2UA 2H2PC 5HYSG 3EJZD 4JFZH 1HEZB 3LH2H 4YZFE 4BJLA 2C3WA 1X5JA 2J1KA 3UPCA 4LCCB 1ZOXA 1T22B 3OF6D 3JWOC 4NBXB 3G04A 4L5FH 3WDJA 4XCYB 5IMOA 4FQCH 4MMZC 5KTEH 5DTFA 3WNOA 3VXMA 3WFHB 4NSKA 3BOVA 2F54A 3WKMH 4PY7B 3HI5L 3ARED 2AI0H 3BGFB 2VZVA 2VLLB 4P23C 3IVKA 2YC1A 2W9DL 2NPLX 3BIBX 1KJMA 4EQ3A 4OZHB 1YZZA 5B4MC 3WD5H 3RU8H 43CAA 2R23B 5IEKB 2R1XA 4P3DB 4ZUTB 3BPNB 3ARFA 5CEYB 1CDGA 3V6BR 2X4NA 3MLXL 5JOFA 2XZZA 4IRJB 3HFMH 5E5MB 1LNUA 3TBSA 4FABH 4IEFB 3LN5B 3PNWB 2VZOA 5LG1A 1Q72L 4HULB 2DM7A 4BUGA 2D03L 2IG2L 3PXHA 2F74A 4YPJA 1A14H 3VFUB 5DJ0A 1MHHB 4P57A 3HG1E 3RNQA 1VKXA 1S5IH 4JFQB 2PO6B 1EDQA 1RZGA 4PJ8D 2VDML 5K9KB 3RX5A 4NM4H 1LE9A 3MMEB 4IS6B 4ZOEA 1G7QA 2QQLL 1RUPH 4NRYA 3NAAL 1BFSA 1FIEA 1QBLH 3AB0C 2AJYH 2FECL 4M62L 4JJ5A 4WUKH 1XIWB 3VXQA 4DOHB 4LVOB 3QIUC 3RGVD 1V5JA 5FKPA 2NY4C 3OX8A 4OLUH 1CWVA 4AQOA 1YUHA 3G6JF 2R4RL 4G8GE 4Y16C 1WLHA 2GSGB 3KPTA 3MR9A 3FO1A 3RWEB 1NJ9A 4KDVA 5TFSH 2IANA 2OR9H 3VWKC 2I60L 5GS2D 4EOWL 5DEGB 1NGQL 4NRXB 1F13A 3SDCC 5CSZB 1DBML 1RU9H 3KPRD 4JKWA 3NACH 2P8PA 3KPMA 3EFFB 1TQBC 4NO3A 2ED8A 4ODWB 4PJ5D 2Y72A 5CINL 5CZKA 5I1LB 4W6XB 1YPZB 4Q97A 4F7CA 1T89C 1KCRH 1HN1A 3LKQA 1LEGB 1YNLL 4L3CA 3DTXA 4WNQA 1KPVB 2CR6A 4HV8B 3INUL 5CIPA 3K3QA 2EEAA 2B1HH 3KPPB 4XPHH 5DJZB 2YR3A 1FZKA 5SX5H 5T5NF 4HIHB 5E9DA 3BP6B 4WIQA 3B9EA 2WWKT 1JPFA 4MB5A 2CIIB 2OK0L 1ETZA 1FN4A 1HHIA 3IU3B 4IRSA 4N9OB 2IAMA 1S7WB 4P4RA 3QJHA 3C60C 4JVWA 1X4YA 4Q0XL 1CBVH 3NGBC 3GMLA 4YHOL 1T5WA 4PJDA 1D6VH 5F9WB 3V7AG 2DQTL 4ELMA 3QUYC 3QUZC 4ETQB 4WI7A 4KDWA 4I77L 4KKBC 1A9BA 1NKOA 4HZAA 4HK3J 1JHKH 3TVMD 4PJ7E 1DFBL 4K3GA 1T1WA 1G7PA 3RWHA 1S7TB 2WNGA 5DRZA 4AH2B 4LF3B 4PJGB 5D1ZD 5I1HH 1PFCA 2YPLD 3O3UN 3ULUH 1EA9C 4KUZL 2C3XA 1C12A 1X5YA 3DUHA 3ARDA 3IFOA 4MNQE 1ZLVH 2A73A 1YEHH 1I9JL 3GUTA 4OLXH 1ZS8A 3HR5A 3KXFD 2ZUQB 3I3BA 1DQDL 2J8UF 4PRNA 3CH1A 4MYWB 4MX7A 4R9HA 3DI2B 4EDWH 1NBYA 2AQ2A 1JJUA 2EXYC 4YDVB 1N59B 2HRLA 4LAJH 1H8SA 2Z93A 4PRIE 4PRHB 4KTDL 4Q9QH 4L9LB 1OSPL 1K8DB 2VDKL 5ACZB 3VFPB 3QEQE 2Y5TB 5DZLA 4O51B 2A0LD 1FFOA 3MRFB 5AZEL 5IM7A 4LPYA 2P5EA 2D2OA 3Q6GL 4P59H 5I1IL 1HHJA 1T0MA 4OCNC 4XP1H 5D7IA 1N64L 3DX6A 5I1AA 1IQDA 4U1SB 5F1KC 1C5BH 1DN0A 1UENA 3LKSB 4KK8C 4F2MA 1MI5A 2VDRL 4OZGF 4PGDB 4WY7H 2ZUTA 3SDXE 1BF8A 1EHXA 4I0PC 3FFDA 1Q9WA 5I0ZA 4JQIL 2YWZA 4Y2DC 5D1XD 3CIQA 1C16A 1OL0A 5ICZA 3U2SB 5EBWB 1A47A 3LKPA 4JANA 2BHUA 3QUXB 5F6IC 1NC2B 2HJKA 1BVLA 1U3JA 1CI5A 5D2NC 1JNLL 1AC0A 3VXME 4QEGA 1EZVY 3B5GA 1AE6L 3TJHD 2C7UA 3MGOB 2F54E 1ZLUK 1P2CB 3MRCB 2HMIC 5DR5H 3CVHL 4I3RL 3R8BB 2ERJB 4L8SB 5I9QB 2RGSA 1GGCL 2Y4SA 5E4EC 3BPOB 3FRUA 3GJEA 3CZFA 1BBDH 2HFGL 4LCIL 3QHZL 2DKSA 3SDDC 4C56A 4GT7A 4KMTL 1JI2A 3QO0A 4JPVL 1Z5LA 3VDAA 1N4XL 3W9EB 1MRDH 5ALBL 1JL8A 4L4TA 4U6HB 4KJWD 5C8JB 4XPGL 4LSSL 3K1DA 3VWJA 2BNUA 4X7FC 3Q1SH 4MHHI 3BHBA 4KROC 4HUXA 4BZ2H 4OCWL 4MJ5A 4EI5D 4M61B 4DGYH 1UA6L 1BFVL 3RX8A 4TUJA 5TH2B 4H26B 5ESQB 5ADOH 3MODL 5CZVH 2HJFA 4A6YH 2XA8H 4KRPC 2SEBB 3O2DH 4QF1A 1AXTL 5FKAB 1CLOL 1T03L 5T33L 2DAVA 2DM3A 3VA6A 3VMOA 4OI7A 3LMJH 2G9HA 4RNRA 3PL6A 5D93B 5DHVA 1D5IH 3TBTA 4KK6C 4U6XA 3AREB 1U41A 3W0WD 3VRLE 1R5WB 4KI5F 1CLCA 1DDHA 5A2KH 1FBIL 1DZBA 4UV7L 4U6VL 3RRQA 1A6ZA 1FLRH 4Z7VA 1MY7A 1YN6A 3FJTA 4X8XA 2ARWA 1GOFA 1YNKL 4HXAL 3V7AE 2V5RA 4AY0A 5JR1L 3UO1H 2IANE 1CLZH 1ORSA 3WKML 2COQA 4OD3L 2E8YA 3ESUF 3DNKA 3QB7C 4L1HA 4LVHC 4HHAB 4RFEB 5BZDA 3MLTB 5I8OH 3ZE0E 5MENA 3MRMA 3O9WA 3VXNB 1NPUA 1FC2D 5HHME 4MQXD 4M7JL 3WLBA 4QLRA 4D9QD 3MA9H 1CR9H 1R6VA 1AIFB 1RPQA 3RTQA 1E4JA 5T3ZL 3IDIB 4KPHH 1YEDA 4DAGH 3BN9D 3ESVF 4R0LB 4PJ8B 3QQ9D 3G5ZB 1E0OB 1CFQA 3ZL4L 2A6JA 5JIPA 1YEEH 2KZ1B 3CFBB 1U8LA 4QXGH 4LSVH 1A6AA 4YZFF 2B4CH 5DK2B 1TETL 5DRWA 5E03A 4AEIH 2YSSA 1T20B 4FXGA 4FABL 3FCTA 5IB1B 2Q6WA 4PJ9C 1GGTA 1PX4A 3RGVB 3MLYH 3E0GA 5J11B 3MLPA 4KJQD 5E9DE 4LFHG 2JJVA 4X6CA 2VNCA 1KJ2H 4M6NH 2GT9B 2W65A 1XF3B 4LCUB 3HZMB 4B41A 1S5IL 2C26A 5DMKA 1KB5H 1QD0A 1YYLH 4MNGB 1MQ8A 4C4KT 5JA8B 1R3HB 4PJDE 3KPRB 4NN7C 3DUUB 5D72H 2ZCLH 3PWLA 2F8VA 3N1QC 3LKRB 3SQOL 1M7IA 4N9GB 3VGDA 4KGJA 3GB7B 1MSPA 1WC7B 4NKIH 4PJ5B 3U7WH 4LLAA 4OLUL 4PJHA 1I7ZB 1J1PL 3OKNB 5F3BA 1P69B 1F58H 2XXCB 3EHBD 5FM5O 5GGTA 1QBAA 2F53A 1A6WH 1UB6B 1I1AA 1PAMA 3K80A 4ZPVA 1AR1C 2W59A 5TF1H 5TDPB 3QFJD 2GFBA 3ULVH 1MIML 1TQCB 4ZUSB 3GMQA 5FM5M 2DQJH 5ABDE 2NY5L 3NPSC 5SWZE 4RMSA 3MJ6A 2IH3B 5LWYL 2KBGA 3IKCA 2ZUXA 4MA8H 2JJSA 1ZHLB 2A6KA 2ID5A 3MGTA 1TJHH 5F8RC 4S1QL 3I84A 5E56A 1FSKC 1MFAL 2PW2A 4GFTB 4TVPD 5AD0A 1LEKB 1V3LA 1ULVA 2FH6A 2YRPA 4XPHL 3K4AA 1H3XA 1WITA 3TVMB 2HTKD 3WIFA 4WU5A 2P5EE 5GS0C 1I8LC 5KSAC 5IBTH 5FAAA 4ONFH 4DW2H 1IEBB 3QI9D 4XHQA 3B5HA 4JFXB 5D7IE 2BCKB 3DROA 1HNFA 1J0ZA 3G6DL 1EJOL 5D1ZB 4DK6A 2YPLB 1MI5E 2AK1H 4HQQH 5INCA 3EAKA 4OQ1A 4TTGA 1VSCA 4WW1A 4S1SH 3DMMA 1A3RH 3KPSD 3CFDB 3KXFB 5FYJH 1QLRB 2MTPA 4NQED 4Y19E 2NW3A 2NCMA 1LQSR 1KBGH 4DKAA 1JHKL 3CXHK 2NLJA 1TVBA 2XWTA 1PQZB 3LRSB 2VZSA 1A02N 3U4EA 2H26B 4RMTA 2EDJA 4UT6L 4P99A 3X3FH 3BDYH 4QHMB 4EEEA 3QXUA 5AUMB 1JWSA 2AXFB 2YKLH 1NANI 2BVPB 1I7UA 4JPKL 2NY3C 5CMAB 4RAVA 3Q5YA 4PGZA 1YEHL 5EZLA 3WHXA 3VXTB 5IVOA 1J5OH 5CP3H 4C56E 1I7RB 2DLTA 4TPRL 3M17B 4KKAD 4NKDB 1RZ8B 3GSVA 3AS3A 4X9IA 3RHWK 4L4TE 4JAMB 3D9AH 3DV6B 1AKJA 2ZOKA 3RWCA 4ZO7A 1NMBH 6CGTA 4LMQE 4ZFFA 4Q9QL 4LP5A 4K71C 2H32H 3V6OC 2UZIH 3DX7B 1T04B 4HLJA 4PJ7F 5DC9B 1ZHNB 4GG8A 3CFKA 5F96H 2J88L 3QRGH 4Z7OE 2XFXA 2A6DB 4AL8L 4GAYA 4P59L 5SWSD 2Q1EA 3X3GH 1BAFH 2N4IA 3O6FD 3ZHLA 2QHRH 43C9B 3JV4B 1N8ZB 2P1YA 3FQWB 5JOPD 2PCPA 5L2KB 3V4VH 3MUY1 5JA9A 2EC9U 4LRIA 2I26N 1C08A 4JEGB 2ADIB 4KUCF 2EYSA 5FYLL 5T3XE 3U48A 5B4MD 3TC9A 4Z7VE 3CJJA 1W0VA 3NOIA 4JGJA 3L3IA 2BOBA 5EFIB 4YK4C 4PGEA 3VGBA 3ZKND 1FE8L 1XR8B 4HIIA 3BMVA 3SDAC 4R8WH 4CVXB 3ROLB 3MCKA 2HT2C 2E9WA 2VKXA 3NZHH 1X9QA 4RAUB 5F9JB 1MLCA 3MACL 2FRGP 3S4SA 1A1NA 4HBQA 4XCCH 5MENE 1U8NA 4EI5B 1LO3L 4J1UA 1G0YR 2GITA 3HMWL 4M7KL 2VRAA 1OQXA 1JGLH 5ETUA 1F42A 2BY3A 4FOMA 1OAQL 1JFQH 5FA3B 4OLEA 4CN6A 5DD0H 1EGJA 4HXBL 3SDXF 3HC3L 4W70A 4NO5A 3W0WB 1A6TB 1R5VA 4HWUA 2HFFB 1R5IB 5JMOC 5DT1L 1B0RA 3QIWA 1H0DB 2YUVA 3NIFE 4X6CE 3HPLA 1OAXH 4FQJH 5EZIH 4OLVL 5ADOL 3IDJA 1PZ5B 5D5MA 2AJSL 3RVXC 1D9KC 1NLDH 1KC5L 4JFDA 2ZOLA 2YD2A 3P0YL 3PHOB 4LEXH 3UTSE 2WINA 4RDQG 1UCBH 4WUUD 3S4SG 4PJHE 1NFDA 4U1HB 5I17A 2Q76B 4NO0A 1OAZH 4UILL 2CRIA 3QDJD 1J8KA 2F53E 4F8QA 3ARFC 5EZJA 2MCG1 1U8PB 2N7AA 3I02A 5CBAB 3PIQB 1S9XA 1LO4H 5I8OL 4PP1D 2Y07L 1NGXB 2NX5E 1I9EA 4LU5L 3V2AR 3KYNA 3RWDA 1DL7H 4EQ2A 5FA4A 1AR2A 2Y23A 1FZJA 5JNYA 3G5XB 3QNZB 1WTGT 4GRMA 4MDJA 5JHLH 4CDHA 4K9EC 4TUKL 1KN2L 5DEZA 1YEIL 4PUBH 3SKOB 2HLAB 4F7EB 4OGXH 3WMSA 4JN1H 3JWDL 3VGGA 3S36H 1N2RA 1J1OH 4PLKD 5HYJA 3SCMC 1KCVL 2X4UA 3QUYD 4LVNB 3ZLQC 5FM8A 3KPNA 2F5AL 1OVZA 3WIIH 3HTLX 5KG9B 2EDYA 2HVJB 1IAIL 3PJSA 1H3GA 2X9YA 4QCIA 5BO1H 4Z8FL 1A6PA 5C0EB 2Q8BL 1Q9LA 3BUYA 1YDPB 4PTTB 4QHKI 5E2TH 1L7TH 4Z5RB 4QOKA 3ZE0F 4ONHB 5IR1B 1UWXK 4OAWA 1F4YH 3QFJB 1D5BA 1INEH 3S8WA 5GZNC 1EEYB 2A6IB 2B0SH 5EPMA 2B2XL 1OARH 2DQGL 3W2DH 5I6XB 1CE1L 1IGYB 1MFEL 1MCOL 4UNTA 4ORGB 2DLIA 4NPYB 3ZKSD 3CVIL 1A7PL 1J7VR 3FHAA 1PY4A 4W68A 2QSQA 4ODXA 1N0XL 5DJAB 5C08D 4KRLB 1F6AB 4JO1L 4Y4KC 2EXYD 4XP9L 1XZ0A 1G7HB 1EAPA 1A6WL 1FFQA 4WEBH 5ADPH 3BSZH 4XNMA 5IHBA 2DLFH 2G5BA 1KB9J 3TBVB 1JPSH 3REWB 3ZKMD 1ZT1B 2Z8RA 1NKRA 4ERSL 5A1AA 2EECA 4PBWD 4XPAH 4MA8L 3QI9B 4LK4A 1KJVB 1JHLL 4PJDF 4UIKL 2VO5A 2EO9A 2CK0L 4UDUB 4YEEA 5C0FA 1IILE 5HGGS 2B1AH 4Z95L 3KPSB 2VYRE 1VESA 5F1IA 1QEWB 3I50L 3X12B 3S88L 4NQEB 1OTTD 3EDJA 3VRIA 3L5JA 3JTTB 1SJEA 3S36X 1XF4A 1P6FA 1JHTB 3WCYA 3FZUD 2E3VA 4HKBB 4HLZH 4XCNA 1JRHL 4M48L 3F7VB 4HUWA 5DJ2A 3BIKB 3ZZ1A 1INDH 4JFYA 4YX2H 3P4OB 4HQQL 2AK1L 2HMID 2QKIA 2XNAA 3C5ZC 3T0WA 1EEZA 5MI0B 4S1SL 1A0QL 2B5IC 3LVEA 1CFNA 5F21B 2Y9RT 2CUIA 4FQPA 1NLBL 1DVFD 4X8JA 4HIEA 4P3WA 1AXIB 1ZVHA 2C4FT 1ND0B 1XAUA 1RQ5A 1ES0B 3ILQC 2HAZA 2FATH 3QNYB 2R1WA 5KANI 3X3FL 3LQAH 3ZDXE 3QAZC 3GKWH 2YKLL 3GMNA 4G6KL 2XV6B 2VLJE 3D85D 1ONQA 4GS7B 3TNMA 4F7PA 4HPOH 4XBPA 2DRUA 2Z31A 4C57C 2WW8A 2Y7QA 4MAUH 4FZEH 1BZ7A 3S5LB 2CDGA 3HPJB 3MJ8A 2PW1B 3JWOH 1T2XA 5CUSH 2Y36H 3GK8H 5D70H 4IDLA 1O7VA 5GSVA 3LQZA 5D7IF 4JHAH 1HDMB 1EFXD 4I18A 5SWSB 2GK0A 1E6JH 2GAZB 4L8DB 2OJEA 4KRPD 5GISH 4WRLA 1U8OB 3BP7A 3HAEA 1JZ4A 3ES6A 4I9WD 3QULA 5GGUB 5ACLA 4KK6D 3L6FA 5I2IB 4TNWF 1FRGL 4WHTA 3I6GB 4P23B 2D7TH 5ERWB 1PJ9A 1VFBB 1MNUH 1KN4H 1I9IH 2CO6B 3F65A 5GRWA 5F96L 5AWNL 3TIEB 2D7PA 1J8HA 2VR5A 3DGGB 1BAFL 5D5ME 4WFED 5F1NA 2IEPA 3WO3B 3WFBH 4NT6B 3WN5C 4JFDE 2O5YH 5TQ2L 3B3IB 3B4NA 3ARWA 5L2JA 2R56H 5ESVB 5I18L 1X6LA 4MD5B 1B4JH 5HI5C 3QQ3B 3KPLB 4QHNB 4AJ0A 3UJJH 5BVJB 4O02L 2FZ3A 2MCPH 1FGNL 1ZLWH 4OV5B 4ZOBA 4GG6A 1J86A 1W8NA 1NFDE 1TXKA 4HWNA 2XTJC 1KIQA 3OSKA 3RY6A 1KENL 5IKCA 5IW6B 1R3KB 5CJQH 1FC1A 2IC2A 3W11C 4G6JL 1EUUA 1ZWIA 3MLVH 3VXRD 3TZVC 3NTCH 4JFHD 1VPOL 1A6UL 2VLMD 2W0PA 3NZHL 1I8MB 3HUJE 1R0AL 2APXA 4YHZL 2P5WA 3T77B 3NVQA 2MQ0A 3HAEG 2APTA 2W9EH 2CDEB 5A2JH 4NJAL 4Z7OF 5GJTH 2Q7YB 4NYLB 1SM3L 1OP3K 2ICWB 3U4BH 1FL5A 1HK6A 2Q87A 3P73A 2GUOB 1JGLL 1JN6B 1Q38A 4X80L 1TMCB 2XICA 5HGBB 4ZS7H 4O5LH 5DD0L 3D48R 4PJFA 5HGAA 2V5MA 1NGWA 1ZK9A 1LILA 4ODUA 2MQCA 2CLZB 2X9WA 4WGWB 5JLZA 5KJRH 2XQYK 5A2FA 5FGCE 3NBNA 4DFIA 3DVNA 1WZ1H 1TQBB 8FABB 4YBLC 4YGVA 4Z7VF 2DL2A 1OM3H 4CL7A 4LASH 3VD9A 5MHSD 3QP3A 1UADC 2OBGA 1C5DB 4OT1L 3QDJB 4ZUWA 3L7EB 3RI5F 3PGCA 2H2SC 3ECBA 1OB1B 3HE7A 1ZGLA 5DMGC 1AR1D 3QXAB 2FO4A 4PS4H 4LEXL 1UCBL 1H8NA 3HCVB 3MRPA 4LOUC 2D7MA 4MB4A 2X7LB 5BZWA 3MROA 1RMFH 3E8UH 3FQRB 4X4ZA 1SJXA 2FO1A 2FGWL 2ZJSH 3C2AL 4NNXA 5DFTA 3GJFH 4ZTOH 1M6OA 4J3SA 1T1XA 1INQB 2EE6A 4LNRA 3PGDB 3QUYB 4QRSA 4DVBA 3V52H 4UI2A 3QXVA 1BF2A 3NIFF 4X6CF 5HHQA 2DQIL 3QCUH 1WCQA 1OGAD 2DQDH 3ARRA 4PLJD 2R1YA 2BY0A 4I2XB 4Y4HD 5KSAD 5DD1L 2OSLB 3EDDA 1FFNA 5JHLL 3CFIC 1MCLA 2PXYC 3RVWC 3B5TA 2ZCKH 3MBXL 4ACPA 4YFEA 1J1OL 2D31A 5IF0A 1XGPB 1T66C 4E42A 5DEFA 1A4KA 1KYOK 2P7TB 4EIGB 4H1LH 3IJYB 4PJHF 2XWBB 5IFJA 1F4AA 3GSRA 3UTPE 5EOQH 4P2OC 4QHLB 4R96B 1RK1B 3P4NB 5C08B 1PLGH 5HDLA 4ETYA 5HYQA 3FB7B 4G6AC 3QHTC 5C0ND 3E1F1 1UQSB 2VXUL 4PB9H 4HKXA 1BWWA 3ET9F 4NFDA 4XGZB 1OAUL 3MOBL 1HHKB 1OD7A 2BSTA 2NY3D 4BK5A 3SE8L 5KW9H 2HRPH 1MF2H 4WI2A 1HOCB 1HILA 4HCRA 3VFOA 2B0SL 4UTAL 4S1RL 2E5EA 4MDIA 1LEIB 1LE5B 5CBEB 4O2CA 15C8L 3ZKXC 2EYRB 4NUGL 3CGTA 2K7QA 2JJSC 5IWLA 1QFUL 2W07A 3CX2A 5IVXB 4TVPL 1Y0LA 4WEBL 4QRTB 4AIZA 1YECH 1OP5H 3HI1A 2XWJA 5FUCC 4RRPA 3NH7H 4Y2DB 4LIQH 2CJUH 3ZYZA 2R0WH 5IHLB 1V7ML 4JQVA 2NYYD 3MZGB 5DJXA 5F6IB 1S8DA 4GUPA 5GRJH 2Z91B 4M4RA 4KMLB 3DURB 4HBCL 2NQCA 2H1PH 5GS3A 1I75A 2FNBA 4YEFA 3EDEA 3HNVH 3RWGA 2R2EB 1WBZA 4AZ8A 1R3JB 1FZMB 3OKLA 1KGCD 5BS0B 2WWMC 1BFOB 5E4EB 1KT2A 3LZFH 3ALWA 1RIHL 3WNMA 5DJ8B 2DQHL 1WZLA 3EGSA 4NP4L 3T4YB 3IFLH 4JZNB 1DVFB 5I1JH 5TE4H 5IESL 5TQ0H 4R3SB 1J8HE 2GTWB 3CXDL 3CVHA 4LCYB 1U8MA 1CXIA 4R26L 2V7HB 3BEWB 4L3ED 2YPKB 2BSSA 2HT2D 4HK0A 2Z9TA 1IARB 3QNXA 4M8VA 5FECA 1KIPB 5DVLA 2ZKHL 1NBZA 4GG6E 1WIUA 4XWOD 1H15B 1XF1A 4U0QB 4OV6F 1DSFH 1KCKA 1EFXB 4X5WA 1JWMB 2FJHA 4RRPG 4LSPH 3T1FB 4FXKA 3PWPA 4GQPH 4KRPB 4PLOB 3G5YA 4MCYB 1BOGB 4GLRI 3IDNB 4JDVA 4ONGH 5JUEH 2HT3C 3MCLH 4LSTH 3FB5A 3MO1B 4PJEA 3QPQC 4I5BA 5ECJE 2IQ9L 2P5WE 3FQNA 3J8F7 1KULA 2C1OA 2EDBA 2KQNA 1MRCH 1C1EH 1S7UA 4H0GA 3JWOL 3UAJC 3EYVA 3QWOB 2Y36L 5J12C 5D70L 5C6TH 3KYMB 1AI1H 5JXEA 2BRQA 1YJDL 1S7QA 3QUMH 1HEZA 2JJTC 2VDQL 4PJFE 4LCCA 2PYED 4OLZH 1T22A 1VGEH 2DL9A 4FZ8H 4NZRL 4LVHB 4ZS6C 1G9EA 3FT4B 4XCYA 4UQ2B 2D7TL 5T1MB 5HJ3B 1MCEA 5D7JD 4LRIC 3O4OB 1KN4L 4LVEA 3WFHA 2HT4C 3L5WB 4OCXH 3H2WA 5DD3H 4PY7A 5D71H 4X7SL 4RDQF 3ZDXF 4ENEC 2VLLA 5EC1B 3S34L 3VXRB 3AC0A 4OQTL 3PHQB 1A6VH 1UKSA 3MLWL 4OZHA 1MCFA 3LKNB 3SGDI 1CD0A 2R56L 3OZ9L 2R23A 3WSQH 3KLHC 5IEKA 4P3DA 4ZUTA 5JIHA 5D7LD 5CEYA 2BK8A 5GGRB 2MCPL 4S1DD 3VDBA 1H3WM 2PN5A 4ZOAA 3L3JB 4IRJA 2WBKA 5E5MA 4Z7QF 2BDNL 5J56B 2FLRT 4DN4L 3LN5A 3PNWA 1JV5B 3MLVL 1A21A 2A1WH 3NTCL 4M5YH 3S96B 1MAMH 3PUCA 4NKOB 4NN7B 3O8XC 2BVQB 3SCMD 4LKCB 3VFUA 3U6RB 1MHHA 3PE9A 4JFQA 2PO6A 3DHJA 4OGYL 1SBSH 5K9KA 3IF1B 1EPFA 2AABH 3MMEA 4IS6A 1T6VN 4UZGA 1VENA 5FHAL 5T5FL 3R8QA 3U9PL 5D5MF 1II4E 1MHCB 3BQUD 4Y5YC 5F7FA 4LDEB 4NZDA 4ZS7L 1XIWA 5DD5H 3VG9C 4XMKL 1HINL 5CKGA 1JPST 2ARJQ 4KQ3L 5ITBH 3H3PH 3C09C 2Y06H 2VZ1A 5KJRL 2WUCH 1CFTB 2D9QB 1YEFH 4ZNEA 2WBJC 4WO4C 1NFDF 2GSGA 1K8IB 4HFUH 4LASL 3RWEA 1AGCB 4JPIB 1NQBA 3CMGA 3UYRL 4X9BA 5TF0A 5DEGA 4NRXA 1D6EB 5CSZA 3O2VL 5D7SH 1X4ZA 4EUPH 5TJWK 1HKLH 3HUJF 3EFFA 4WV1C 3EO0B 1WWAX 5B38B 5E5RB 4LPXA 1RUMH 4ODWA 5C6PB 1CL7L 3KDMB 2X4SB 1AGEB 4YWGL 3MNVB 4M5ZH 1YQVH 4JN2B 4GKSB 5I1LA 1YPZA 3HB3D 1OGAB 5GS0H 5KSAB 2XT1B 2EH7H 1VCAA 2DLGA 2ZJSL 2FB4H 1LEGA 2EZ0D 4X4YB 1KPVA 4HV8A 4M8QB 2XQBL 4DUWA 4M1DL 3KPPA 5DJZA 3WS6A 4U1KB 1AQDB 3BD4A 5DLML 4AEHH 3HZVB 4QTIL 4LL9A 1KCSH 4HIHA 3BP6A 3VG0H 2CIIA 3IU3A 2R39A 2CMRL 1S7WA 2CR3A 2VTFA 3DOSA 1XGRB 1ZGLP 5IOPB 4N8PA 4XTRC 5C9JB 4ZNCD 3IXTB 5C0DB 4ETQA 4F3FB 1L0QA 5EUKB 4XNQB 2NY3B 3C5ZD 2EIBA 3GSWB 4X6FB 1CICC 4U1IB 3SQBA 1AO7D 5E2VH 1S7TA 5GRYA 4H0IA 7FABL 4QKXB 3RVUD 4LF3A 4AH2A 2X9XA 3RWJB 4PJGA 1UZ8B 4FNLL 4W6WB 4YDLC 1VGKB 2XTLA 1HQRB 1EMTH 3ILQD 5C7XH 3DVGB 2FEDC 2VDNH 3MXVL 4PB9L 4C4KO 1OSZB 1L6ZA 1QRNE 4ZO9A 1IGML 3SGEI 1S7VB 1MF2L 1FV1B 3PP4L 3WE6B 1F6FB 4PB0L 3Q0HA 5FO8B 4ZFZB 4YDVA 3PWPE 1N59A 2AQ3A 2DM4A 1FNLA 4PRHA 1KEGH 3D6GA 3LS4H 5EC2B 4L9LA 4PJEE 1S7SB 1WT5C 5CJ5A 1BM3L 1K8DA 3CLFH 2WP3T 5ACZA 3VFPA 2Y5TA 4O51A 1YECL 3MRFA 3B9AA 4LIQL 5EOCL 1BBJB 2JTDA 5FGBA 3OKDB 4U1SA 1GGYA 3TJEL 3LKSA 3O4LB 4K94L 4YK4B 3JTSB 4XVTH 4PGDA 4NC1E 5C0RH 1FJ1B 3SDAB 4NZJA 2CUMA 3UBXB 4UINH 5DA4A 3U2SA 4IIQC 5EBWA 4X7EC 4XAWH 1B4RA 4NC0B 5HI5D 5DJDB 5IW3A 4M6OH 3QUXA 2XZAL 1NC2A 3HE6C 4LPVA 3LZFL 4RIRB 1XR9B 3B43A 4P2QD 3SKUD 3F6LA 5I1JL 3U30B 1OAYL 2EICA 3MGOA 2XTJD 2XZCL 1P2CA 3MRCA 1IAMA 1QRKA 1NSNL 4L8SA 2QR0B 4JFED 3BD3A 4WJ5B 3K1KC 5GRZA 4CNIB 1E27B 1KJ3H 4XBGB 3TZVD 4OZHE 5JORB 3TF7C 2J2ZA 2LAGB 4U1JB 5F93C 5C2UB 2YZ8A 4KU1A 2NXZC 4XPTH 3U83A 3W9EA 5E99L 1MAJA 2AV1B 4U6HA 5C8JA 2Z31C 2E6QA 1PG7X 2PF6A 2N7BA 4J8RB 3BGMB 5KVEL 1T1YB 4DGVL 3C08H 4JHBA 1D9KB 3TYGH 3MCLL 5AZ2H 3AAZB 2PYEB 4NQTA 5F1SA 4JRWA 3PV6B 5EDXA 3ZO0A 4M61A 4G8FB 4XVUC 3MNWB 5TH2A 3WXWH 4H26A 3X13B 5ESQA 1YY9D 1HWHB 5D7JB 1NAMB 1MRCL 1C1EL 2BJMH 2SEBA 3S6CA 3DECA 4GAGL 3S35H 1JP5A 5FKAA 5AAWA 2F5BH 3HS0B 4HGKC 2IBBA 1FIGL 3AREA 4R6UA 3O3EB 2E8ZA 4PJCB 3EFDL 1PX3A 3NMEA 4DOHE 1R5WA 1ZHKB 4IMKA 2B20A 3GBNH 4MQSB 3V6FB 5IGXL 1NL0L 4FZ8L 4EI6B 5GQBA 4HC1H 4GG6F 4Y1AE 1G7MB 3QDGE 5D7LB 2EDFA 5CAYB 4BUHA 1GGBL 4JRXD 4ZNEE 5JZ7C 1RAMA 4NZUH 2EDRA 3LRHA 4ZAKC 1WIOA 5DJ6B 5HHVH 3IDGB 1YEJH 3MLRH 5JXAL 5DD3L 3DIFB 3S7GA 3DGCR 1E28B 4HHAA 4RFEA 3MLTA 1U2CA 2EDHA 1CVSC 3VXNA 4EN3D 3UPAA 1I7TB 4TN9A 2YPVH 3SCMB 1AIFA 4BZ1H 3E6HB 4X5LA 3ZDYE 2PYFB 3IDIA 5CD5D 1CU4H 4G6ML 1YPZE 4PJ8A 4R0LA 5C71A 3G5ZA 2EO1A 3ARPA 3CFBA 3BQUB 5DK2A 5DUML 1G0XA 4PJFF 2HN7B 4X9GA 3TM6A 1T20A 2ZUUA 5IB1A 3RVWD 3RGVA 4BFBD 1RZKL 4NCC2 1BREA 1NUNB 3TWCL 1M05B 4M5YL 3AM8A 4N1HB 4ALAH 4JY4B 1CYGA 1T66D 2GT9A 2W0FB 3PQYD 1XF3A 4G80B 4LCUA 4HUMB 3HZMA 3PP3H 3SJVE 5C07D 4S0TD 5CJXA 1SBSL 2V2WB 4MNGA 2IFGA 5I1DB 2E27H 2IPKB 3TYFB 1R3HA 4P2OD 3H9ZA 2C5DC 4YHKH 4HWEH 3KPRA 4NKQB 2YA0A 3DUUA 1QHOA 4G6AD 1K5NB 3HC4H 4Y4KB 3S3PA 3KYKL 2DKUA 3LKRA 4WHYG 3S35X 2GJ6E 4N9GA 3DO3A 3GB7A 1WC7A 2HKFH 4PJ5A 4X6DB 5ITBL 3LQMA 2AJXL 1FCGA 3AS2A 4NBZB 1I7ZA 2WUCL 1XCQB 3TT3H 1QSZA 3OKNA 1HSAB 4D9RE 4DEPC 5CIPH 1HKFA 1F5WA 2RQ8A 4TSBH 4LHJB 3P30H 3IDXH 2JB5H 5C0JB 1UB6A 2VDPH 2DYPD 4Z7UB 1MIEH 4RGOH 1BEYH 3A6BH 5TDPA 1N7MH 3M45A 5GGQH 4DFHA 4ZUSA 2XY2A 1BOYA 4OZ4B 3WNKA 3V4UL 2IH3A 5FDYA 4NHCH 1ZHLA 5JIIA 4KXZH 3RKPA 5KVMC 4M6ML 1AXSB 3H9SB 1U3HC 3QG6B 4UUJB 4WENB 4JE4B 5FYKD 3SPVB 4PRHE 1BGXH 4OIIH 1LEKA 2B39A 1F45A 2IGFL 3OPZL 3C5ZB 4KHXH 4AEHL 4U31A 4P3CL 3TVMA 2WWMD 5CEZD 1AO7B 2XN9D 2CUHA 2B5IB 1Y6MR 5FF6B 2E7HA 5F97E 3PF2A 1IEBA 4JFXA 1MCCA 2BCKA 5F9AC 4GQ9L 4NCDA 5D1ZA 2YPLA 2JK5B 3ARYA 4WWKC 2CXGA 4R97B 5EU3B 5B39B 2YD5A 3ZT6A 1RURL 4OCMC 3GNMH 5TE6L 5FYLE 2XKSA 1JYVA 3CFDA 3KXFA 4UB0L 1QLRA 4ZOCA 2X4QB 1NMCB 5HDOA 1UEYA 3VXOB 3MUJA 3UTTD 3F62A 1PQZA 5GPRA 3LRSA 2H26A 5KS9E 1MWAB 4MAYD 4QHMA 5AUMA 2AXFA 1JGVH 3VXUD 5HPMB 4N1CA 2BVPA 3KHQA 3JV6B 3L5XL 4FQ2L 1DBAH 5CMAA 4MJ6B 3VXTA 1FH5H 2VDNL 3RL1B 4CKVX 1BHGA 3BI9X 3MRHB 1I7RA 1PG7L 5IWLC 1DE4B 3M17A 3SKNB 4NKDA 1RZ8A 3JXAA 1QTYT 1IBGL 2VISB 1PVHA 4O4YH 4JAMA 3MRJB 3DV6A 2O61B 1RJYB 2P46B 4JQVC 4N90D 1FAIL 1D5XB 4F7MB 2W60B 2VIRB 3UP1A 3DO7B 3STZB 3WN5B 2X44D 4U0RC 4LLUB 3DX7A 4RA3A 1T04A 2CKBB 1T83A 1YYML 1ZHNA 4OFVA 4ISVB 4YQXL 4ZS6D 2XXMB 1VFMA 1A7OH 2DIJA 2A6DA 3TBWB 4P2QB 3EOBB 3B2VL 43C9A 3JV4A 3BPLB 4J4PC 4IOIB 2XTJB 1N8ZA 2MSPA 4HIJB 1EUTA 2WANA 3FQWA 5L2KA 4U1LB 4JCLA 2FHBA 2ADIA 5L88L 3TZVB 1MEXH 1F8TL 4OBRA 2GTZB 3V5KB 4NQVB 4WGVB 4XAWL 2F8OA 1V3MA 3DARA 4P49A 5T1KD 9CGTA 5EFIA 1MREH 2X4OB 1FG2B 3LS5H 3QXTA 1XR8A 4XPFL 5CZXC 4CVXA 3ROLA 4JG0L 1WSST 1LO2L 3UYPA 3FAWA 3U7YL 4PJEF 4RAUA 4RGMC 5EZOL 5F9JA 4K3DH 3ARBD 1S3KL 4EI5A 1VADB 2YK1H 2WQRA 1G6RB 3OAYH 1JTPA 1MJUH 4NN6C 3OB0H 4YIQA 1FO0H 1RZFH 1FO0B 3RUGE 5C3LD 5DSCB 2BVTA 3VU2A 5DHVH 3O8XD 2IADB 2XACC 3EDFA 2XQYG 5FA3A 3BAEL 5FO9B 1YN7B 5IIEB 3LIZH 5K59E 1CFVL 3DHMA 3O45B 4LBEB 4B50A 3W0WA 1A6TA 4I4WB 3VFMB 5E8EB 4JKLA 3OR6B 1IAOB 3FB8B 2HFFA 1R5IA 4J7RA 3VXPB 5EOTB 1H0DA 2EC9T 3V6ZB 4GAJL 5EULV 4JRXB 3OKKB 4PRBB 1NAML 1IQWH 2WBJD 2BJML 4WO4D 2R4SL 4JM4H 1LK2B 1PZ5A 4Q7DA 3H8NA 4IHOB 1T2QH 1LWRA 2L7JA 2NZIA 4J6RH 4O9HL 4OZHF 3PHOA 1IFHL 5HYIA 4EN3B 1XGYL 5E70A 3O11B 4C83B 3BGFC 5I71B 4HC1L 3T0EC 4U1HA 2Q76A 1MCSA 1DBKH 1CQYA 1DBBL 3BKCH 4KKNA 4NZUL 1ZTXH 3VFRB 5IBLC 1F3RB 3LKOB 2ZNWA 5D8JH 3I6KB 1U8PA 3DXAD 4NHUB 4FQ1L 1U8KB 5CBAA 2R0KH 3CFCH 4K9EL 3PIQA 2PXYB 1MCJA 1NGXA 3ULVE 4WFGD 2DM2A 2ILLA 3FQXB 3PV7A 5F70A 3F7QA 4ZFGH 3PQYB 3KS0H 3CDYA 3OBAA 1CFSB 5C07B 1CU4L 3G5XA 3QNZA 4NJ9L 3WLWD 1YNTB 1FCCA 3SKOA 2HLAA 4P2OB 4F7EA 2FLBT 3EOYG 5E4IA 4PG9B 3IAQA 1NAKH 1LDPH 3ARTA 4M00A 4XP5L 1Z9OA 1IAIM 4PREB 1SYSB 3ZTJH 4FMKA 2CLVB 5KG9A 2HVJA 1XIWC 2OYPA 3BP5B 5I1KL 3M8OH 4KK5C 1CICD 1HZHH 2NY1D 3K2UH 1TZHB 5C0EA 2Q20A 3LV3B 4L4VD 2FEEI 3O6KH 4K7FB 1MQKH 1LHZA 1YDPA 2M1KA 4PTTA 1Z0NA 2DYPB 3EOTH 4Z5RA 3L7FB 3D87B 3GSOB 5IR1A 4ONHA 3PABB 1XFPA 2WIIB 3QFJA 2FEDD 1EEYA 3KXFE 5FYJE 1FQ9C 2A6IA 4GMTL 5JHDD 3FO2B 1OHQA 3Q5TA 5CGYC 3ZDYF 2HKFL 1IGYA 1YPZF 4ORGA 1A7NH 5FO7B 4NPYA 4BFGA 1J10A 3LB6C 1FL6B 4KI5D 3TT3L 3TBYB 4XC1H 3KNBB 4H0HB 4XNYL 2NY5C 3TH4T 5EB9A 5DJAA 3RHWF 1F6AA 1RUAH 1MY5A 3IB4A 1MOEA 3P30L 1G7HA 4OUUB 1KTLB 1F4XL 2BRRL 1W72H 3WO4C 1CD1B 1W72B 5DGRA 5HVHB 3TBVA 1P4IL 4XBEL 5LXGH 4M3JA 3REWA 1UCTA 2FX9H 5DO2C 3HMXH 5CEZH 1ZT1A 1VEMA 5AYQA 1Z3GH 5HDBE 5AEAA 1RIUL 3P4MB 3QI9A 4JLRB 1KJVA 3MV8D 3O3DB 4P9HC 2UZXB 1RUKL 1PSKH 4P2CG 4JO4H 4UDUA 4HT1H 5H37H 3T2OA 4DUVA 2RB8A 3WUWG 1FNSL 3KPSA 2EYTB 3GBLA 1QEWA 4K3JH 3X12A 4XXDB 4NQEA 5F9WC 1RUQL 1P7QD 3PP3K 4Y4FD 4UNUA 3JTTA 3UTTB 5FHBH 3OB8A 4PRDB 2I5YH 3A67H 1JHTA 4HKBA 5CP7B 1UM6L 4FS0A 4MAYB 3F7VA 3BIKA 2FR4B 4BQBA 3P4OA 5L2KE 3ILPB 5JW4R 5FDWB 3C5SB 3TP4A 3I6LE 3BX7C 4I0KA 5DVMA 1IVLA 3AXLB 1ND0A 3FO9B 3TV3H 4XP4L 1ES0A 1JGUL 3DX9B 1GGIL 1MWAL 3QNYA 4XMLH 5C2BL 2AXHA 4OM0L 1RZJL 2YXFA 4TULL 3CK0L 1UM5H 5EO9B 2KL6A 5ILTL 1U58B 3OL2A 3N85H 3S5LA 3HPJA 4OJFH 2PW1A 1X5KA 5HI4C 2AW2A 2AGJH 4G6FD 4L9LC 1HDMA 5SWSA 2R0LH 5E8OB 2GAZA 4L8DA 3GI8H 1OTSC 3H9HB 4YBQC 3K7UA 2ZNXA 1U8OA 2H6PB 3JV5A 4JG1H 5H2BB 4BSJA 5FGBC 5GGUA 3W0WE 5I2IA 4HLZG 4R90L 4ZXBC