1YJDC

Crystal structure of human cd28 in complex with the fab fragment of a mitogenic antibody (5.11a1)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
b'NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment of 5.11A1 antibody light chain
molecule tags Immune system/signaling protein
source organism Homo sapiens
publication title Crystal structure of a soluble CD28-Fab complex
pubmed doi rcsb
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15910 V-set_2 ICOS V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yjdC00
2AK4B 4I77L 4ZO8A 4F33A 2AK4A 2CDEB 1M71A 2C26A 4Z7VB 3QNZA 4ZPTA 4GRLA 2C1OA 5D1ZD 3QR2A 3WDHA 4XMKL 5FYKE 5AUMB 4FOMA 3S36L 4QRPD 2R39A 2R0WH 1VCAA 5DK0B 2Z91A 3VGFA 4TQEH 4L3EA 5C0DA 2GTZA 3CFDA 3VXOB 1NGPH 3L95A 2JELH 1FVEB 3UTSD 1U8HA 3FT4B 3WMSA 32C2A 1QG3A 4KQ4H 1JPGB 3D39A 1U8PB 5FK9B 5FYJE 4U6VH 4LSVH 5D7LB 4FZ8H 3MXVH 5FO8B 2OTUA 4XGZB 5DK2B 4N9GA 1A6UL 5C08A 2NY6D 3O3EA 3KPSA 1EXUB 2AJXL 4JM2F 3H9HA 4RISH 3DBXB 2GK0A 5GRZA 1XGUB 1NL0H 5F3HA 3LKQB 4PJHA 2VQ1B 1YECH 5I18L 2AGJH 1PLGH 1A47A 4P5MB 1Q0YH 4UDTB 4Z18A 1AGCB 1NSNL 2VB5A 4BJLA 4NQEA 3U0WL 4WV1C 3IAGC 3FOLB 2F53B 1ED3A 5JHDE 4OCSH 4WHTA 2DTSA 3SKNA 4DVRH 3VFNA 4U33A 15C8L 4AM0A 4OV5A 5KVEH 5E2TH 4JFDE 1T89A 2GKIA 2GTWA 2XA3A 1U91A 3JXAA 4QRRB 4UDUB 3VFVB 4PUBH 2GSGA 3WKML 4GW5A 3ISWA 4PJCE 3PWNB 4QTHA 5F6HI 1HDMA 4R4NC 4D3CL 4IIQC 1T5XA 3QIUD 5D72L 4UMGA 3CX5J 3ZTNH 5F9OL 3DVNB 4IRJB 1OAQL 1MI5A 3ME0A 2VDMH 3Q6GH 3D9AH 1G9ML 1XFPA 4M1DH 3CDYA 1T7ZA 3HNVH 3MTRA 1VFBA 4ODSL 5TGBA 3RAJH 1XZ0A 2WINB 3EYQD 1OGTA 4FZ8L 4XPGH 2A6IA 5CCKH 5BV7H 2NY5L 1D6VH 4MJ5B 4N1HB 2F5BL 5IK3B 2KZ1B 3UYPA 1UACH 2UZIL 3FZUD 4R26L 4KKLD 4ORGA 4KDWA 2AJXH 1T0MA 3ESVF 3O3DB 2LU4A 5DMGD 1OSPL 5BO1H 5CLTA 2JCCA 1MCFA 2CSPA 1LDPL 1MREL 5LG1A 3WFHB 4J3WA 3MRIB 5I75C 1D9KD 1HE7A 4G8EA 3CSPA 1R0AH 4PBXA 1MCIA 3MROB 4YPGB 1I7UB 1P69B 3MACH 3U0WH 1F4HA 2Y5EA 1WC7A 2VDKL 4XT1C 3NIGE 2R23B 1RV6X 5GIRB 1XEDA 2DB8A 1G7LA 3V0WH 1MVUA 3QHTC 3HAEA 2CJUL 1LE9A 4PG2A 1MJUH 1UM5L 5E6IC 1S5HB 4NHUA 4ZO9A 3AM8A 2EDBA 3O4LE 1OGAD 3ROLA 4NQXB 5HGAA 1C1EL 2AEPL 3DIFA 4TPRL 1KB9K 3ARBA 5ALBL 3MRHB 3FQRB 5JA9A 1AC6A 1CGSH 3L6FA 2F54B 2IPUG 1DR9A 5FKPB 4PJXB 4LSRL 3IDUA 1A6WH 1X5YA 2YPLE 4G42B 1JWSB 5C0CE 4LEOB 5DK3A 1DANT 1ZLWH 4ELMA 4NN6C 3C9NB 4HT1H 2X10A 3OKOB 3HUJE 2VSDA 1FNEB 3OJVC 5H37G 3MRJA 4M00A 4F9PA 3U0TB 1PG7X 3FQNB 3RWCA 5BCAA 4ORZC 3MRCA 1CYGA 3QUMA 1P53A 3VRIA 1MAML 4L5FH 5IQ7L 4HCRL 5DSCB 1C16B 3EOBA 4JFOA 4G7YH 3U36B 2Z93A 4JEGB 3T04D 1A4JA 1UWEL 2PYEB 4EI5A 5EOQH 3ZHLA 2VR4A 4P3CH 4M93B 1A7QH 2EC9U 2HKFL 2O61A 5HI4C 3MV8A 2DQCH 4MA7H 1N59A 12E8H 1AGFB 3ARWA 2X40A 4KY1H 4N0UA 2AK4D 1WBZB 2YD4A 4WNQB 3QQ4B 4BZYA 5BQ7B 2AQ3A 4ODUA 1MCOH 4XAKD 4LLYB 2UYLB 3D2UB 3TA3C 2EDYA 3DWTA 5H94B 3RP1A 5L2KA 2ENYA 4I48B 3CFBB 1C1EH 3C5ZA 4RIRA 1KEGH 3UTPE 2D3VA 5CHNB 2F54E 5C0AB 3A6BL 4L8SA 5F6IC 5FA4B 3SDAD 1TLKA 1JPSL 2A9NH 4U1JA 4QO1A 3MFFA 3N06B 4PLKD 1MCNA 1ODAA 1IAIM 1NCCL 1C12B 2X1OA 5IW1A 1VA9A 4HFWA 3EAKA 4MJ4A 3SPVB 4Y4HC 1M1SA 1G9NH 2H45A 2BDNH 1WBYB 4HWZB 4GLRI 5KS9B 4YXHH 4YXLH 2E6PA 1AJ7L 1QFUH 3CXHJ 2OZ4A 5KZCB 1K2DB 5IQ7H 2NY6B 4DGIH 1CL7I 5BVPH 1CZ8L 5SWZE 4XCNA 4J1UB 4PRPA 5H35B 5EB9A 3UYOD 3T08A 1QSFE 5HI3D 1CFTB 2A9MH 2R1XB 2CGRH 4M61B 3S4SA 4EVNA 4G8IB 2YD1A 4UB0H 1Q9LA 3VFUB 1B6UA 1Q9WB 3ILQC 3F5WB 1E4KA 3TT3H 1BOGB 2XA8L 5LCVH 4RGOL 1W72H 3GI9L 3NAAL 1NMAL 5GS0C 3HZYA 2G5BA 3EYOB 5DJZB 4HFUL 4P3DB 1V5JA 1HN1A 3GSOA 1JNJA 1U3YA 3EGSA 3GJFB 2A6DA 4N68A 1JRHH 2H2SD 4KZEH 3QIUA 1P1ZA 4K7PX 4PGZA 2JJSA 3WYRA 2NX5B 1J88A 4NRYA 5MENA 1L0QA 3UEZA 2BSRB 5IWLA 1HQRA 2Q8AL 2J8HA 5EBLB 3IDXL 3FQUB 3KPOA 3L1OL 2FIRT 2JJUA 4NC1C 2CKBH 4ZFOL 5I75B 3BH9B 3HE6A 5H2BB 4PRHD 5FAAA 1WCQA 2VLJD 1QSFA 5JW4R 1AE6H 2LABA 5D2NE 4YDKH 3VFPB 1S7RA 4AIOA 3QIWB 5BRZE 3B9AA 1FRGH 1FC1A 1CXEA 4JO1H 4GBXD 3FO9B 3RZWA 1S5IL 1ES0A 4IDJH 3HPLA 3RTQA 3PABA 3INUH 3MNWA 4X6BB 5ISZD 5E8PB 3S98A 4OCWL 4NUJB 5C08D 2XXCB 3WJLA 1KG0B 1SEBB 1NAKL 4Y2DB 3MLZH 4MDIA 3PWUA 5GZOD 1XIWA 4A6YA 4F7MA 1VPOH 4YK4B 4OGAC 2YSSA 1ZGLM 1YEIH 3SGDI 3LN9A 2DQDH 3FB7A 1F6LL 2X70B 4F7EA 4F37F 4EXKA 3QUZA 4FMKA 2CPCA 5E94B 5CSGA 3SDAC 4K7PH 2OQJB 4ZAKB 5F21B 1ETZB 5C09D 1Z0MA 3MO1B 4QHNA 4E41E 3WD5L 5HPMB 5ISZA 4LGSB 1V8HA 4UT7L 5GZND 3HA0A 3IETB 5ITBL 4RMUA 4PLKC 3MRJB 3GDBA 4WEBL 5BS0B 1ZA3B 1DLHA 4XNYH 5DVKA 3MV8E 3MZGB 4XBGB 5DHYA 3C5SB 1ZA3A 4DGVL 2EDFA 2IAND 4FFZH 5FF6B 3X11B 3QO0B 1CFSB 4PY7B 3L7EB 3IU4H 3MBXL 1F13A 1CR9L 4NQSA 2MSPA 5F97E 4LPXA 1NANI 2CDFA 1GSMA 5F88B 1TJGH 3IJHA 2LAGB 5IGXL 3PF2A 4NWUL 4PREB 4XX1G 4C56B 3SCMD 3ORJA 4GG6F 3JV4B 3RZCA 1BQHG 5D7IE 5JO5B 1A7OH 5GIRA 3F62A 4GLRH 4A6YB 1XIWB 1NGQH 4AYFA 4JZNA 1S9KC 2GUOA 4NN7B 4G8GA 1L6ZA 2I26N 5TE7H 5ILTL 1IKFH 4WI2A 2JB6A 1JWUA 1MCEA 4D0DA 1ES0B 1V7NH 3GSNB 5D1XB 4CMMA 4JFYB 5DJDA 3G6JE 2DQGH 3NN8B 2J6EA 4QHMB 1BVKB 2VLJA 3X3GH 4KJQD 5HVFB 1U95B 3ULSB 4OV6F 5ID0A 2VISA 1TZGH 5JOPD 3NZHH 1SYSB 4X7TA 4APQB 2MHAA 3QDJD 1U8OA 4JANB 3U6RB 3T3MF 1RZFH 2J12B 1BZ9B 4S0SD 5MERB 3VRLE 2CR6A 2P24B 5C0EA 5ALCH 3WIHA 3JZ7A 1ACYH 2WAHA 4LLWB 1FL6B 4JGMA 1WFNA 3WO4B 3MSPA 3MV9A 2D31A 3NFSL 1P4IL 3CFCH 3WXWL 5MENB 1Q94B 3PHQB 3WNNA 3N9GH 4I9WE 1CFVL 2XTJD 5BZWB 3VFVA 4UDUA 4N0YL 4QRRA 4M43L 5GGUB 2X5PA 4Y4FA 3PWPA 5JW5B 4HS3A 4P2QD 4XNQB 4OCXL 3CZFA 2PO6C 2VLRB 2XTJC 1UACL 2MJWA 4OM1H 4RWHA 4F7CB 4P5TC 5AZEL 1AH1A 2N7BA 2OTWB 3T3ME 4FQLH 4LIQL 4F7PA 2QSVA 2P43B 3LS4L 4LKCA 4O5LH 3KYAA 5CSZA 4J3SA 3TT1H 2GK0B 4Y5XC 2A2QT 1JRHI 3MNWB 1I3UA 5F6HJ 4V1DD 2NXZD 5HTSA 5ESQA 1NFDB 3NA9L 1GH7A 4LF3A 2ICWJ 4BFIB 2R56H 5I1EH 4OQ1A 1BJMA 1Z3GH 1RMFL 1SYVA 3QIWA 3STZA 3HE7B 3U7WL 5CZVL 2B1AL 1BVLB 5JOFA 2AJVH 5FYLE 1I3RB 3MOAL 3LKRB 4BFEA 5ADPH 4K94C 1A6VL 3QDMA 1S7UA 3WV0A 3QFJB 4WI6A 4JKPH 1U0QA 4DZBA 4PG9B 5D6DC 4X6EA 4X4ZA 4YBQC 1OARH 3DXAE 2Z91B 4HZAA 2AJ3B 2MKLC 2P8PB 1RU9L 4S1RL 2BERA 3MR9A 4WFEE 3S9DB 4M6NH 4H88H 1JN6B 5E8NA 4Z5RA 4N1EA 5DZOA 5F3BA 3OGCA 5E95B 3CLFH 2FATL 4YDIL 3UZVB 4DGYH 3DLQR 1RJYA 3GSWB 3ZE2E 1GIGH 1GOHA 2OXGA 4CKVX 1A4KA 4KJWC 4ZXBC 2C3XA 5KSAD 2V9RA 2ZOLB 3PP4H 5ERWB 1X9QA 1T1YB 3L5JA 4Y2DD 2R8SH 1Z2KA 2BSTB 5B8CA 2FGZA 3HC3L 4L1DA 4NM4L 5FHBH 3QDJA 4XMLL 1CIDA 5IEHB 1P5VA 1K6QL 4YDJA 3BEWB 2DI9A 5T1KB 5HVGB 5J6HB 1A7QL 5TQ0L 3KAAA 1I8LA 2X4SB 3PWVB 4TNWF 4YHNB 2AS5M 1JNHB 3V6OC 4DN4H 1D7FA 4CRPA 2B4CC 2FIKA 1JI2A 3IDJA 5JDSB 1NDGB 1MQKH 1ZS8B 3QXAB 3H3KA 4PB9H 2R4SL 1MCOL 3QHZH 5DSCA 1YEGL 5EOCJ 4X80H 1Z6JT 4WY7L 3PP3K 1JTTA 2B1AH 4XXDB 3V7MA 4IBLT 2EYSB 4JDVB 1J5OL 3BPLC 1Z9LA 3GMQB 1T6WA 4Q58C 5L88H 2ZSWB 4LPTA 4D9QE 5DD6B 3EO0B 5GSVA 1OARL 1HH9A 4MNQA 1BEYL 4QXUL 3IFOA 4MZ2A 4HV8B 5IBTH 3TO4B 3IDYC 4CJ0A 5ACZA 4G6MH 4ALAH 4YNYB 1UJ3C 1U8JA 1YEJH 1B4JL 5FIEA 1A6TA 2VDLH 5EU3A 3SY0B 2ZKHL 4M6MH 3TWCH 2ZPKH 3MRPB 3V4VL 4OZIE 2ED8A 3QSKB 2A74B 1V05A 5FA4A 1HIML 1AJ7H 2V2TB 4S1SL 4GAYA 1T6VN 4Z78B 4K94L 1I7RA 3ULUH 2ZOKA 4YHIA 3TBTB 4HKJB 4GRWH 4P2OC 1KEMH 3KYMA 1M7DB 5C9JB 5I8CB 2UYLA 3LOWA 2W0FB 2VZOA 2AERT 3LN4B 3QEQD 3F7VB 4UQ2B 1NCWL 1OF2B 1ACZA 1J0YA 4RRPG 4U6HA 3WFZA 1NBYB 2Z31A 4MAYD 3TEUA 4UNTA 4EDXA 3QUXB 5B3JF 4UILH 1IAOB 5IP4A 5IW6B 5FO9B 1LP9A 3V0AC 3B43A 4ONGL 4X7SL 3ULUC 3MLVL 3OB0H 3VXNB 4EI5B 1W2KT 4LAJH 4D9LH 5HBBA 3RUGA 4TTGA 4OZFB 4TNVK 1C7SA 4JB9H 4JRXB 3SO3B 3KDMB 2ZUVA 4HPOH 3P11H 1DDHA 1DQQA 4NC1E 3WJJC 3ULVD 1FBIL 3X13B 4UIKL 1EEZA 4BUGA 4JFHE 3KPSD 5EUOE 4MNGE 3QIWC 1WZMA 3MV7B 1MWAL 5IB3B 5KBNC 5F1NA 1KJ3H 5KVDH 2EICA 5D4QA 4X98A 1WFUA 2C7UB 3NCYS 1FN4B 1XH3B 4G42A 4WFED 1KV3A 5ESAA 2YEZA 5DJYB 5IKCB 4NKIH 1X4YA 4LPCA 4ZPVB 4LEXH 1E4XL 1RAMA 2ICWI 4NQCB 1MJJB 4MJIA 1MJJA 3FMGL 3GK8L 2AXJA 3BJLA 2QR0A 1YMMA 2ZG2A 3PIQB 3IF1A 5E8OA 1C5CL 2AQ1A 3D1MC 1YNLL 1OLLA 4HWBL 4XVUC 1XGPB 3VGBA 2HT2D 1WC7B 1EJOL 3L3DA 4KKBD 1EHLL 2MPAL 1F5WA 4OLZL 5DJ8B 4HG4J 1NUNB 2APXA 4UBDC 4LVHB 3ZDYE 5A43C 4KTYA 4OFDA 3D69A 1OAKL 2BCKB 5IHLB 4IIQA 2XKNA 4P3WA 4OAWB 3BIKB 3F7VA 1PG7L 4UQ2A 4P49A 2DQDL 3NPSB 5FO8A 4PJBA 3VFTA 1BAFH 3O3DA 5T3ZL 3IU3A 5C2BH 3MRMB 3PIQA 2P5EA 4MYWB 4MXWH 4PJBB 2F74B 3TA3D 1M6OA 3VGEA 1UM4L 1MWAH 1ZT7A 3SBWA 1KJ3L 2XXMB 3W0WA 1OGTB 3WD5H 4YHLH 2UZYB 1I85A 2MWCA 5HYJD 3QUYD 4QXTA 3QUKB 1KIRB 1QLFA 5SWSD 3GB7B 2A1WH 4Q0XH 5LAXA 4K2UL 5F9OH 2DQEL 3TFKC 5FB8B 3TNMB 1HDMB 4WI3A 3IAPA 4ODSH 4DEPC 2GSGB 1PDKA 2NTFB 1CGTA 3MCG1 4D0CA 3O6KL 2XKUA 4F33B 3BRDA 1UENA 3K7UA 4YBHA 1I3VA 1ZWIA 4GBXA 1RULH 4FQPA 1P4LA 2AV1A 4P2OA 3SKNB 1F2QA 1CICB 2ESVE 5EN2A 3MLWL 2X4UA 1IBGL 4U6TA 4OB5H 3MGAA 4XP1L 5IVOA 2Z31C 3LMJH 4K3DH 3RKDC 3L3IB 3DUUB 3UBXB 1SJHB 5ACZB 1A7BA 4OZIA 4JY6A 3DPBA 2NY7L 1BJ1J 2HTKD 3F58L 2OR9L 3PWVA 5CILL 1NCAH 3OWEA 5D93B 5GZOC 5DRNB 2DKUA 5DDHA 4PJBE 3U30C 1YEEL 5ANME 1KELL 1NCDL 1X3DA 1Q9KA 3TYGH 1FVCA 1CTOA 2AXFA 3MYJB 4HKJA 4BZ1H 5DD5L 2P8LA 3BDYL 4PJ5E 1NFKA 1FCGA 1TZGL 3B2VH 3QXAA 2EKJA 1NC4D 1AR1D 3H9SB 1ITCA 4Z7NF 1KNOB 2X4SA 5GZNC 3FAWA 4OIIH 5K9KB 1T2QH 4R4BA 1G7PA 1G9EA 1NFIB 4XVJH 4WUUB 5HYIA 3VFSB 4R4FL 3TIDB 2Z8SA 4KROC 4Y16C 3WLBA 1S7UB 4CN6A 1M05A 3RIFF 3UJIH 5E9DA 4Z7VA 2HLAA 4X0KA 2FZ3B 3HLAA 5E1HB 3QEQA 3I6KA 1RJYB 3GSWA 4X4XB 5K9QI 3OZ9L 3MRQA 1CQKA 4MAYB 2V2XB 3MRFA 3U7AA 2AAVA 4V1DA 1U58A 2JK5B 3QEGH 3WFEH 4BKLB 2FBJH 5E8NB 1YYMH 3VD7A 4XXDA 3ZDXE 1RZJH 4XPBL 4QOKE 1UYWH 1NMBL 1CQYA 3AMLA 2ZWLT 4XTRC 3LHPH 5FM8A 4DZBB 3CDFA 1JTPA 5E2UL 5CSZB 1NKOA 1RUQH 1IARB 4POYA 4YHNA 3VFWB 1W0WB 3UTTB 2XQYG 5J1SC 3MLRL 4DVRL 4NIKB 2K7QA 4PS4H 4PRDA 4Y1AD 3EIFA 5DLML 4NC0B 3MA7B 3A6BH 1VFAA 2OK0H 3IKCB 3AY4C 3TH4T 1MWAB 5DJCA 3BWAB 4PV9B 2NY2B 4XP9H 4YPJA 1S7XA 4JFFD 3OKNB 4PJFB 2HFFA 4H1LB 4IOIA 2E7LA 1LGVA 4ZO6A 4OFVA 4MQSB 1F4YH 2XPGA 4V2CB 4Q9BA 5SWQA 4PD4K 1MHPH 3HC4H 3EYQC 3MZTA 4GAJL 1SJVA 4LASH 5I8EB 3P9MA 1GAFL 4G6FD 5DD3H 4ODXB 2J8UE 5F1IA 4QRPA 1IAII 3K1DA 1B0WA 2NY3C 1NGXB 2R1WB 3HS0A 1RZJL 2DQTL 5AWNH 4Z8FH 4PV8A 3OAZK 3WUWB 1LO0H 5EUKA 2XZAH 5TFSH 4UV7H 3SDCA 5IFJA 2RIKA 2VH5L 1U95A 5F1SA 3ULVF 1C5BL 3WNMA 3WE6A 4BELD 5C0GA 4IMKC 3RKDD 2PW1B 1LD9B 1K6QH 2MQCA 2YA0A 3KNBA 4CDHA 3UO1L 3GIZH 4KTDH 2GUOB 1T66D 5IVXE 1FO0A 2QADD 1I3RA 4PJIB 3VXRD 2OTWA 3K4ZA 3T1FA 4I0PC 4XC3L 1FFPA 4P5KB 4Y16A 1UM5H 4XXCC 3VXTA 3RWGA 2ESVD 5AZ2L 5IESH 2H32A 4R8WH 3T77B 2GITA 2GW5A 3KS0J 2RBLA 3AS1A 3ULSA 2VDOL 2XY1A 3IJHB 3UAJD 3PL6C 4PJAB 3MLYH 2M1KA 2VLME 1H8OA 1RZGB 3BHBB 1CBVH 3D0LB 4Y4FB 5FYKL 1I1FB 5KSVB 3LRSA 5J4MA 4QEGA 2VABB 1YEKL 1MH5B 5L2JA 5EPMA 1PZUB 4GJTB 2R0KL 5CGTA 2YUZA 1CDCA 5DT1L 4DFIA 5ITFA 4HW6A 3RVXC 2DWEA 1X5ZA 3S35H 5F7HA 5M95B 1B4JH 4ERSL 2L7JA 1A1OB 5I1HH 2P1YA 4FFYH 3QDGB 4TQEL 4WJ5B 4CN4A 3P4OB 3LIZH 2HFTA 3ALWA 5DDHB 5F7DA 1ADQA 3LEYH 1MHCA 2NY1D 3PWPB 5JW5A 2ZUSA 3KLDA 4KQ4L 1AP2B 4M7LL 1SBBA 1RJLA 1MFEL 2HFGL 2APFA 4Z0XB 5HI4D 3OXRB 1YN7B 5FYJU 4XTRD 4HAGA 4Y2DC 2IEPA 4OCWH 3V4UL 3SDDB 1ZVYA 1AKJD 4D0DB 4ONFH 4LCIL 2M2DA 4OZGF 3O2WL 3TCLA 2Q20A 3F6IA 4UILL 2H26B 5I1KL 1HYSC 2X6MA 4JO4H 4M7KH 4Y88A 4P59H 2XG5A 4HUXB 4X6CF 4PLJD 3BHBA 4HJ0C 1UG9A 3MFGB 4LHUB 2NW2B 5C0ND 3W5MA 4O2EB 5JOEA 3V95A 5HGDB 2GHWB 1U8LA 4WEBH 5GRUL 3H7LA 2RHEA 4J4PD 3RJQB 4I2XA 1IZJA 4RMRA 3Q1SL 1XF2B 1CGYA 1QRND 4NUGL 1MCQA 5E8PA 2E7MA 4R90L 5GGVL 3V7AE 3B9KC 4OCYH 2GT9B 2ICWB 5IV2A 1INEH 3RI5F 4PREA 4AEHH 1YEHH 4NGHL 1CZ8H 4CMHC 2YWZA 1MCPL 4JPKL 1OTSD 2YD5A 4Y19A 1RJLB 3Q6GL 2MMXA 3LS5L 4E0RB 4N0FA 4D3CH 3U46B 4MMZC 2NPLX 3BN3B 1FGNH 2XWBB 3VMPA 5BV7L 2MTPA 4W6XB 1FYHB 5IHBA 1XGPA 2BY3A 3D9AL 1PKOA 3P4OA 4XAWH 4BA8A 5HHQB 4KK5D 5JUEH 3BQUB 3QNXA 5I8EA 2BNQE 1JGEA 4Y1AB 4CJ1A 4EEEA 4HIIB 1IGYA 4FQXB 4QHKJ 4G8GD 5KVGL 3GI8L 4I0PB 5DI8B 3E8UH 3UZQA 5KTEH 5EPMB 2NY2D 2VABA 3PUCA 4OGXH 4LSUL 1A0QH 2BOBB 1MRCL 3RWIA 2IALA 2MKWA 5IFAH 4Y4KA 3VD3A 2FJGA 1NBZA 5KANI 4PRPB 5H35A 5D5MA 1X7QA 4OD2B 1NGZA 3DJ9A 3QULA 4U1SB 1DJSA 3STLA 4LLMB 3L9RA 3D3VB 5C0BA 4OLUH 5DD0H 4DOHB 4NWTL 5DA0B 3BSZH 4KFZC 5KVMC 4JJ5A 3VWKC 3QIWD 3HPLB 2DWDB 3FT3B 1S7SB 1TNMA 5IHZA 3QIBC 2NY1C 4TVPE 3HE6C 3VFOB 1YPZF 2QQNL 1CFQA 3WUZA 1PSKL 2YPLA 3J8F7 5F7EL 4OZGA 4ZTOL 1WWBX 4WWID 4IDJL 2IBBA 4KDTC 1LEKB 2CIIA 2NY4C 3OX8B 3UDWC 4X0KB 1BREA 1ZAGA 4LFHD 5IB2A 2PNDA 2O5XL 3CXHK 5I1LB 3TJEH 2WSKA 1H9VA 5C9JA 4HUNB 4MA8H 4Z0BL 5J11C 2EDLA 4XBEL 1X44A 4L3CB 1F02I 4FG6C 5EOTA 4WUUA 5K9JL 4ZNEA 1S7WA 1QPXA 4OLXH 2X2YA 3C6LA 2XOTA 2YMXL 3ZSSA 3MFFB 3BP5B 5K9OA 1B0RB 4HJ0D 1T04A 3KXFA 1K85A 5BV7C 3UJTH 3DNKA 4DK6A 2OX5A 2DQJH 3VXMA 2WIMA 3BKJL 1NCDH 5CIPH 3U4EA 1CD1A 3PNWA 4BZ1L 5TPWL 4J1UA 3SE4A 1DVFD 4HV8A 4X5XA 3PV6B 2V6HA 3TJHC 3TNNB 1BFOA 1A02N 4LBEB 2B8OT 4YGVB 2EIZB 1WK0A 5C0AE 4RGND 1MAJA 1T2QL 1XR8B 3RBSA 5DRZA 4LEOA 1A4JB 2PYEA 3BPNC 1J1XL 3F7QA 4HFWB 4Q9CA 3BPCA 2ZSVA 1D9KA 3PV7A 2N1KA 2VLKA 5EBMA 3VXMB 5HHNA 4WO4D 3N0PB 4FQJH 4HQQH 1FGVL 2JK5A 3LKPB 3ZDZF 1G7HB 1N0XL 1MJ8L 3Q5OA 3KWWB 1J10A 1WAAA 3B2UC 3S5LG 4LRNH 2PYFA 5E8EA 3JWDL 2MNUA 4P2QE 3V79C 4ONHB 3FHQA 3C5ZB 4RIRB 4RDQG 3MGOA 4HF5H 5B8CB 1HQ4B 1A3QA 3AXLA 4JFFA 1AQKH 4Y5YC 3WFDH 1KPRB 4EXPX 3SOBH 3IVKB 2H3NA 3MNVB 1MQKL 1NAML 3IDNB 2Y4SA 3E6FB 3FO0H 3CVHA 5MEPA 3L5WB 3WFHA 1IGIL 2F53D 3U4BH 2JCCB 2Q87A 2OR8A 5E2JA 4XRCA 3EYUL 3CMGA 1PEZA 5FOJA 1AI1L 1QRNB 4CU8A 2DQFA 5GHWL 1KIUA 1AGBB 2J6EL 4PR5B 2XZZA 5DR5H 3CCHA 4NZUL 2AJYL 2XN9D 4ZTPL 4ELKA 5TGBB 4FA8A 2VKWA 1JK8A 5IT2L 4GS7B 2NXYB 1DEEA 2O26U 4KQ3H 1R6VA 7FABL 1EPFA 2VZTA 1MHPL 3W9DB 3WN5C 1RZKL 4X4YB 3FN9A 3DUUA 3UBXA 1DBJH 2NX5E 3PWNA 4TOYL 4EBQH 4PRIE 3IYLW 3MRHA 4Y7MA 4TNVF 5E8OB 3ARDD 3DIFB 3HTLX 2GFBA 5HGAB 3I50L 3PXJA 1C08A 4F15C 5C7XL 5LVEA 4LMQI 1XZ0B 4NBYB 3VA2C 2YPKA 3F7PC 4PGBA 4XMKH 2MQ0A 4CL7A 5D2NB 3BQUA 2DKSA 2E9IA 1KB5H 3LEVL 1KJ2A 3T8XB 3Q6FA 3JWOH 1ZHNA 3TNMA 2BJMH 5I76A 1VB9A 4HS3B 5DUML 2EIEA 3W5NA 2Y5TB 1PG7W 3H6JA 4LSDA 4YZFF 3MLZL 4E0RA 2ZUUA 3RY5A 4QXWA 1CK0L 4JDZB 3G6AB 4ZTPH 2HLFD 4OGZA 5D8JL 4M3KB 4HS6B 1G7LB 4OLVH 4NO2B 1T0PB 1ZKAA 5DZLA 4YHYC 4PLOB 1NMCC 1CBVL 2VLRE 1V3MA 2DI8A 7FABH 3BIKA 3GGWB 2VITB 3SE4C 4XBPA 2ED9A 5E8DL 2MHAB 3MNZB 3MA9L 4RRPA 1TENA 1Q38A 1JMXA 2IPTH 3LQMA 5FUZH 1IKNA 4OBRA 4YAQB 1NBYA 3HMXL 1MFCH 3O3EB 1T3FB 1UB6B 2E8YA 3GJEB 3EYVA 3V4PH 3WNPA 1IE5A 1BVKA 2C3GA 9CGTA 5KSAA 2RCSL 1G0YR 4H8WC 5J9PA 1ZHBA 3GSNA 1MJ7L 3WFBL 4DGVH 3G9VA 4HX1A 4L3AA 5F7NC 1CXLA 5C08E 4WCYH 1M7XA 4YBQD 3L7FA 3LEXB 3HUJF 2EYRA 1OM3H 4NO0B 2HG5B 4ZPVA 1EZVX 1I8MA 5F72S 4FABL 3LKOA 5LGHH 1A6TB 1BD2D 3SY0A 5E1AA 5IBUB 3IFNH 3TZVD 3QRFM 1FE8L 3WN5B 4KJWD 6FABH 1AFVH 2HFEB 3HNVL 3QA3A 1QUNA 5FCUL 2AK1H 4ZPTB 3TN0D 5TE7L 1RIHL 4HLJA 3VWKA 1BAFL 4JQVC 1YN6A 4PGCB 5DD6A 4JGUA 5EO0B 3MLPA 3OJDA 5MHSD 3VI3E 3VXUB 4D9QD 4G5ZH 4MXWL 5FA3A 1NGYB 2ARJB 2P7TB 1A22B 5C0AD 3C2AL 2DLFL 1FO0H 1P7QB 1U92A 2PCPA 5J89A 1KTDA 1X6NA 3MCKB 1V7ML 1NFDF 3R0MA 1JNLH 3UX9B 3LKSB 4PRNB 3ZE2F 5CAYB 3TWCL 3VGAC 4NP4L 4X9FA 3KYNB 3QDHA 4XCFL 4L3EB 1IGCL 4AY0A 1KTLA 2I9LB 2AKRB 2W92A 4X6CE 3MLSL 3FB7B 3RDTC 2AEQL 5DMJB 4Y16B 4WWKB 3VXTB 1T1YA 1D6EB 5IIEA 5ERWA 2YUVA 1U8PA 1CGVA 2V5MA 3U7YH 4UUJA 4ODVH 4PJGA 2EEDA 5L8KB 3TV3H 3DX7A 3OF6D 1K8IB 4JGJA 1VFUA 3ARFB 4TVSa 1QACA 3BD5A 5C0GB 1CFVH 3GHBH 1F3JA 4HXAH 3WE6B 4GT7A 4EI5D 1IGTA 1CGXA 3CFKA 1YECL 3OKEB 3ARYA 2H6PA 4YDVB 3ULUE 4WO4A 1CDIA 1YYLH 3KPMB 1Q0YL 1S9YA 2AXGB 3JSSA 2J88H 1WJ3A 4Z7UF 1RUPH 4FP8L 4OZHA 3BO8A 5JOFB 2D4DA 4FNLH 4XPFL 4L5FL 3SDYL 3N85H 1TZHA 3LCYA 1LO4H 3KPOB 1BX2B 2EECA 3DMMD 3FFCE 4G7YL 5FECA 3MV7D 4HDIA 1D5MB 3WHXA 1EAPB 5EOQL 5JMOC 4X7EC 3QIBA 1JGDB 1QFWH 3RNQA 3UCRA 1DVFA 2W0LA 4X6CB 1K4DA 1FZJA 3VI4F 5C09E 3QIUB 5IEKA 1JNHA 2OM5A 4HZLB 2EH8H 5SWSE 3C6SB 3ARDB 4QTIL 1YNTB 4XC1H 2FSEB 2OZ4H 2CKBA 2QL1A 1N64L 4F7PB 2PW2B 5JXED 4X6DE 3D39E 3TBWB 4U1LB 1KTDB 1U92B 1YEDB 2PCPB 3B9KD 2AJVL 3RVUD 4JKMA 1RU9H 1G6RB 3LD8B 4U1GC 1P7HL 3OZ9H 1MEXH 5F89A 1MOEA 3IDGB 5EU6D 5AG9A 3P0VL 4MMXC 2PETA 4ZO7A 2GIYA 1WV7T 3BX7C 4LLVA 3VFGL 4WW2F 1ZLUH 5IR1B 5DEFB 5BV7B 1QBMH 4JO3H 2NY3D 4J3VA 4XCYA 2O5XH 5IHUH 1KLGA 4WENB 4ZUUA 2GJ6B 4N8VB 3CNKA 1J1PL 3O8XC 1I7TA 4PP2B 4BKLA 3BKYH 1BBDH 4HWNA 3UTQA 4XVTH 2VDKH 4YXHL 1P5UA 5FV2A 3QFJA 4Z95L 4BQCA 1MFDH 3VMNA 1NUFA 3QG7L 1U8OB 4JANA 1G7JB 4GMSH 4APQA 1QNZL 4JFZH 5EU4A 1OGAB 2YD7A 1UH2A 3VWJA 4I3GA 5CJQL 5SWSA 1TVHA 3FONB 3AMKA 1UC6A 1HXYB 5JQ6L 1MCHA 4HHAA 4NJ9H 4TVPD 3MRRA 5D1XA 3IGAB 5BJTA 3KPLB 2DTMH 1JWUB 2QSCH 2UUDH 3ILQD 2GSIA 1I9RL 4LVHC 3PL6D 2R69L 5E2WL 1AGDA 1UZ6F 1GRWA 4NKDA 4OZFH 4M7ZB 4HAFA 2MOVA 1LO5A 3GGWA 1T4KB 1U2CA 4OJFL 1MHHB 1FVCB 2AXFB 3D2UA 3ARGA 1UCBH 3O4LA 5HHMD 1BEYH 4HXBL 3WNKA 1DFBH 4WDIA 2P47B 5EZOL 4FTVD 4G6ML 2W0PA 1NBQA 1RJZB 5EU5B 3CMOL 5CMAA 4G9DA 2ADGA 3L7EA 4C56D 3X11A 2Y5TA 4X5LA 4Q7DA 3CXDL 2BVQB 1Q94A 3PHQA 3EOBB 1N4XH 2NY4D 3ZKXC 4FQIH 4J6RL 4PTUA 1CDJA 3FRPG 2ICEA 3NZ8B 5T1MA 1YNKL 2QJDA 1YMME 4MJ6B 1G7QA 5DJ0A 3RZCC 3H9SD 2GFBB 3BAEH 4X7DC 4FQQA 3QUYA 3DHMA 5DQ9A 5FYKD 1HCVA 1IM9D 2BXYA 1FAIL 2HT2C 3L5HA 1NL0L 2FH8A 3NN8A 3RPKA 1E4XI 4D9LL 4PB0L 3QRGL 1JHLH 4GO6B 3G9AB 1MI5D 3REVA 1ZA6B 1C7TA 3IJSA 4Y16D 4P2RE 4KI5C 4Y2DA 1S5HA 5SX5K 5CSBA 1EBPA 3EW3B 3MJ7A 5T3XL 15C8H 1R3KB 2WUCL 3I6GB 3AB0C 2WUBL 4HEPG 4NNPH 5GGQL 2CD0A 4EI6B 4XB7A 1OP5K 4ISVA 4UTAH 3B83A 2D03H 5E4IA 1D3CA 2YBRB 5ANMB 1S3KH 3FO9A 4KGJA 4KV5F 2HMID 1QSFD 5I0ZA 5I8KH 5I17B 2CDFB 1KCVH 4U1HB 3TYFA 4N1CA 3BDXA 1F8TL 1EDQA 4G80B 1FNSH 3GMNA 2DLIA 1U41A 5DVNA 1JVKA 3NCYP 4NKMB 3AFLA 5DVMA 3MYZA 5DO2C 4HWBH 4U7SA 1YMMB 1MCDA 3SGKA 3WS6A 1BJ1H 3WO3B 1MHEB 1JGVL 2NZ9D 3CSGA 5L2KD 2IQ9H 4U1MA 1JE6A 4TNWK 1CD8A 4MQTB 3KLSA 4WU5B 2FYYB 4KWUA 3TPUA 5EC1A 1J1OH 1AO7D 1QOKA 4PB0H 3EGSB 2VIRA 1KLGB 3VCLB 4QRTA 5C71A 3QISA 3TN0C 4P3DA 3MUHL 4NFBA 1N0LA 3B9KB 4MLSA 1S7QA 5F7MC 3VXSA 4FXKB 4MDIB 4LL9A 5EWIL 1N8ZB 4JREB 3VFNB 4W6YB 5E4EB 5IM7A 1YQVH 1AHWC 1S7VB 4I77H 3HMXH 4CNIB 4UAOC 5IVNA 3MCLL 4MNQE 2NTSP 1EHXA 4X6BA 2IFFH 3O8XB 5DHVA 2E3VA 1YNTA 2EC9T 3ARGD 2VQ1A 1HSAB 4AEIH 1LO3H 1FFOA 4M93C 2HJKB 4AIXA 3QI9B 3RA7L 3UTSE 1MFBH 4J3OC 5F9WB 1VADA 3QUXA 4D2NA 4LVEA 3C6LB 5F8RC 1S7WB 1KTRL 4LKXB 2CIKA 4BQ6A 5J11B 1IQWH 5INCB 1PVHA 3MLTA 3GMRA 1FNHA 5INCA 1OGAA 2DIJA 3VWJB 4R3SA 4DKEH 5A16B 1AFVL 1YEIL 4LSUH 4BUHA 5GRJH 2Q8BH 3BGMA 3I75B 2XKSA 2VLKE 3DO3A 4OZGB 4TSAL 4X4MA 4MDJB 1V3LA 3MRDA 3EJYD 4JLRA 4CVXB 3FHAA 5A2KH 3OHXB 1OD7A 3CFBA 2YXMA 4BK5A 4XMPH 5GRVL 3TBYA 3BDYH 5KSUB 4XHJC 4IS6A 4KY1L 5IM7B 5HDQL 1CDHA 4U1NB 3C5JB 5D1ZB 3M1BA 2DOCA 4FN0A 5D7JA 2IANE 3MV8B 4ENED 4U1SA 3F12A 1GHFL 4JM4H 3VFUA 1Q9LB 1RHHB 2X9XA 3LEYL 5FUOL 1LP9E 3UTSB 2MCPH 1RUAH 1RURH 3MX0A 1FYTA 1IEAA 4XCCH 1YMHA 3BUYA 5D7LE 1R5IA 3HG1B 3TA3A 4XCNB 5F93C 5FV1L 2CDGA 1WCBB 4D8PB 1PW3A 3RVWD 4PJAE 4PP1D 1IM3B 4DK3A 5JW4M 3QIBB 3HAEG 3TVMB 5L9DH 4LLUB 4Y1AA 4M7KL 4OZGE 4LCWE 1I7ZA 2NY5H 5DMKB 2D7OA 3IFLH 1LEGA 4P57B 1XAUA 4QOKB 4P4KB 1HHJB 4R7DB 4LHUD 5L7XH 4NQDE 5EO1A 4APQC 1I3GL 3ARBB 5HHPA 2DQJL 5JHDB 4UIMB 5GS1C 3Q3GA 3G6JB 3HZMA 5I6XB 5CJBA 4XPFH 5C0AA 2P8PA 1R3JA 1NC2B 1L6XA 1CE1H 2NMSA 3NZHL 3JVGC 1ORQB 4WFGD 5I74C 1NCTA 4JN2B 3P0GB 3F7RA 1R3HA 2ITDB 4N0UB 2I60L 4WNQA 5KN5A 3L7FB 3LEXA 2E27L 3V0WL 4DN4L 4HG4K 1RI8A 3JTSB 2IAMD 3QXTA 3RKPA 3LSOB 3W39A 5E08H 2VXQH 3MOQA 5HGDA 3G08B 4CBPA 3NPSC 5J8OA 3REWB 4F9PC 4U4BA 3BXNA 1DN0B 2HT4C 5E56A 5E5MA 1CVRA 1ZSDB 2VR9A 3AAZB 5I1DA 5IMMB 1J12A 4JHWL 4LCWB 3S37X 4C58B 4S2SA 2ICES 3PWJA 4HF5L 4IOFC 3TO2B 4TN9A 4KZDL 4OTXH 5EA0L 1G7IB 3VXRA 1JGUH 2F19H 4FQLL 4HIHA 4LIQH 3KPPA 4O4YL 5E00A 2BC4A 2RAMA 1A3RH 4OZ4A 4NOBA 3CVIH 4PIRF 3SDDA 3O3BB 5FYJL 4OGXL 5IB1B 4O58L 4JDZA 5E6IA 3UO1H 1H5BB 5I1JH 3NH7H 4L8CB 3U4BL 4YEFA 2Z8VC 3IB4A 1JHTB 4C83B 4Z7VF 4BFBD 1P84J 5I2IB 4NHUB 4JFZL 4NQVA 4M48L 3C8KB 1BZ7B 1DEDA 5ENWA 4P2OD 1A6UH 4WJ5A 5DA4A 1I8MB 4Z7WA 2VDPL 1BZ7A 5ENWB 1VPOL 1QEWB 1RY7B 2P5WA 5CD3A 3O6LL 1F90L 5C0CB 3T0DA 5E08L 2KQMA 1SYSA 4X7TB 5C70A 3AUVA 3ECBB 1T1ZA 4QNPF 4S11A 4JZJA 1ULVA 3BXNB 3RPIA 4PBWD 5F1KC 1CLZH 3O9WC 2JIXB 2UWEE 1PSKH 1MLCB 1JPSH 3QZWA 3FT2B 1MLCA 4HHAB 5J6GB 3ESUF 4H5SA 3DV4A 3DTXA 1RZIA 2WNGA 5DEGA 1JCKA 1KLFA 5D7LA 3JTSA 5EOCL 1JK8B 3Q5YA 3IDMB 1J8HE 2ICCA 2P5WD 5FXCH 1DBKL 1JUFA 1R5WB 4ZS7L 2PYEE 2D7PA 4M7LH 5KSBE 1AGBA 3UYRL 4NPYB 1GYAA 3S96A 3O6FB 4R7NA 1WF5A 2OL3H 2IGFL 4MJID 5C0DB 1DN0A 3NH7L 1BHGA 4L4VD 5M7QA 1U2HA 3ZTNL 4N8VA 3BPLB 3O2WH 4L8DA 2CRZA 4NQSB 3V6ZB 1NAMB 1FZMB 1WUNT 2XIDA 2BZDA 4WY7H 3WUWA 1MVFA 2DD8L 3TZVC 4GQPH 5IFHL 4P9HH 3SDXB 4LCIH 3I02A 3O3BA 4P2YA 3K8LA 1ZLSL 4RGOH 4QXUH 2E7BA 5DQDL 5HHME 1EHLH 5IG7B 2YPKB 4PGBB 3BIAX 4LU5L 1IM3A 1D9KC 4ALAL 6CGTA 3RRQA 3PG2A 1GL4B 3QBTB 1J0KA 4GH7B 2RCSH 3T1WA 5KS9E 3RL2B 3OG6B 4KJQC 5EO1B 4ZUWB 3JVGA 3V5HA 2CLVA 3OKNA 3UTSA 3KHOA 4HS8L 1T80A 4HIEB 4GUPA 4OSUH 3RVTD 3W39B 5D6CA 3Q1SH 4D9RD 1YEHL 3RQ3A 3VDAA 2NQCA 1ZHLA 4X9HA 4RMWA 5IJVB 4LVOC 5KOVC 3ARBC 1PEWA 3IAQA 4PJBF 2B7DT 1HH6B 2YD9A 1S9XA 3BPOC 2ZUYA 5JW4Q 3CFDB 3VXOA 1E4WL 4MD5B 1NPUA 1ZT4A 1PYWB 5GGRB 5CJOL 1JNNL 3NACH 2BY2A 5FKAA 5KVGH 2XWTA 2R0ZH 3QPXH 3BJ91 1S5IH 3Q3GB 3SDDC 5KTEL 2AEWA 1I4FB 4OM1L 5CZKA 4XB8A 3NPZB 3W9EA 4MJ2A 2DLFH 3KYOA 3LY6A 2DN7A 2FZ3A 1KPRA 4XPTH 4WVRA 3LH2L 2VXUH 1JMZA 4JRXE 2HWZL 2K7PA 4MQ7B 3TBYB 5EBLA 2DBJA 4ODHL 3P30L 3R8QA 2BSRA 5EH1A 2CO6B 5DUBB 4GOSA 2X4QB 1NC2A 4GW1A 4JO2H 5HDOA 1MNUH 5HGBA 1HHIA 5D6DA 1GC1H 2ZUXA 2FX8H 3BKCH 4UIMA 4KUCF 2AEQH 3WIHL 4W81A 2GJJA 4NKOA 4G6JH 4WHYG 4NQCD 3D3VE 1XR9A 4NBZB 5HJ3A 4IRSB 3MYJA 3CH1B 3S3PA 3O2DA 3EFDL 1QSEE 1IAIL 2EDNA 5FA3B 1PY9A 1N8ZA 3ZHDA 4FXKA 3VXSB 5HYSG 1BFOB 1DLFL 3N1QC 4KRPC 3ZKSD 4OIIL 4PJEF 2VL5B 1NGZB 4UBDD 3G5YA 1X7QB 4YZFE 4KPHH 5EIIB 2CO7B 4QT5B 4MA3A 4WFFE 4X6FA 1FL5A 1KN4H 4MDJA 3I9GH 4NWUH 1ROWA 2GAZA 3LH2H 3EO1B 5E03A 2NZ9C 3K74B 3HC3H 1YA5A 3O11A 4QLRA 2J1KA 4Z0BH 1ZGLA 4OLVL 4QRSA 1YYML 4NJAH 1S8DB 5HYJB 2VXTH 4XAKE 3IS0X 5T3ZE 2LVCA 3MLTB 5ILTH 3PE9A 3NGBC 3EJZC 3QXDA 5E2UH 4UB0L 4PJ9D 1CG9B 1HILB 1EGJL 3GMNB 2FYYA 5BS0D 2X09A 3BKJH 4G80A 4JE4B 3TP4A 3X3GL 4I5BA 5ADOL 1OQOA 2VXVL 5LCVL 3WFBH 5EORL 1XGQB 3AVEA 1KUMA 1UZ8A 3T4AA 3J7HA 1S7SA 5FUOH 3KR3L 4LARL 5LKNA 1MUJA 5ESVA 1OM3L 5D71L 1EERB 3FTGA 4BZ2L 1OCWH 3AU1A 1UXSB 4GRWE 4Z7OE 2I24N 2OL3B 3BPOB 4NDMA 1TQBB 1J0HA 5IWLC 1KN2L 3MOBH 3JWDH 3TZVB 2HJKA 4BYHA 2HT3D 3GSUA 1FFOB 1FGVH 2IH3A 4MQXC 1J9CT 3MXWL 4OI9A 4URTB 3VCLA 1N0XH 3E2HB 1QVOB 4H0HB 2YRPA 2PTTA 1M7IA 4DCQA 4BSWA 2HN7B 1MFDL 2OJEB 1VGKA 2BOBA 4ISVB 5JPMA 4AL8H 3VMOA 4AENA 3HR5A 3VD9A 1X5GA 1RUML 2SEBA 1FRGL 5BVJB 2AW2A 5EFIA 1J0JA 2J5LC 4R0LC 4HUVA 4QRTB 4NZTH 4UQ3B 4HUVB 4BH7B 5KJRL 4FXLA 4YHKL 1KCLA 1MRDL 1KIPB 3O45A 2FEDC 1FZKA 1CDUA 3BP7A 5ID1B 1F6FB 1RMFH 4ELKB 3PP3H 2EZ0C 5CBEB 3R1GL 1OCWL 3DX8A 3AROA 4LQFH 5JIIA 1WBXB 3CFEA 5JIHA 1FVDB 4JFPB 4XNMB 3W82A 1QO3A 4HGMA 1EBAA 4S0TD 4KMTL 1A6AA 5DURB 4G8EB 1PZ5B 2CK2A 2EE9A 3DUSB 3E6HB 2PN5A 3H42L 2CLZA 1QLEL 1GGTA 3D85A 1DP0A 4FQXD 3SKUD 4LEXL 1A1NA 4FFYL 1YC8A 4YHPB 1CGUA 5J1AA 3DX8B 4F2MA 4YHIB 3P40A 2X1WL 1CLOL 5GGSY 2NXZC 4XMLH 2EH7H 4M6OH 4L8SC 3FKUS 1GZPA 1Y0LA 2GY7B 2XT1B 1EJOH 2R29L 4PRBB 3SGJA 1KGCD 3L3OB 4OLZH 3MRPA 1VEOA 1NJ9B 2WWMD 3RIAK 4MWFA 5IQ9B 3B4NA 1KPUB 3TM6A 2ZSVB 4MXQC 4EN3D 1H8SA 3IDIB 4MXVE 1FORH 2QQKL 3OG4B 1AP2A 4AG4L 4EZMA 3WS6C 1IAMA 3K8KA 4JQIL 2ARWA 1NEZB 2UY6A 5LXGH 2PTVA 2C4XA 5DD3L 1OSZA 1RK0A 1GGUA 4TULH 4Y5YB 5J0BA 1LHZA 1V7NL 5JXEA 1EVUA 1BQLH 3H8NA 4KJPC 1EHAA 2F53A 3PV6A 1A1OA 3U4AA 1QA9B 4NNXA 1YEDA 2HN7A 5HYSB 1L0YA 1LO5B 5SWQB 2PR4H 3LQAC 1JYNA 4JHAH 1QLEH 3GEWB 4PYGA 2GSIB 3C60C 3V6OA 1TTFA 1T04B 2ZCKL 1BQHA 3BKYL 1ZT1B 2W60B 4G7VH 4M7JH 2NYYD 5C08B 4JRYB 3RBGA 2X1QA 3AS0A 4ZYKA 1BOYA 4F3FA 5LGHL 3O4LB 1BFVH 4PGDA 3QYCA 4K3EL 3RWGB 2NXYC 4K23H 5HJ3B 2DYPD 4PJIE 4LSVL 1A8JH 4K71C 4ZSOA 1JPGA 4U0RC 3T1FB 4PJXF 4RFOL 4MD4B 2P5ED 3ES6B 1IAKA 2VLMD 2HJFB 1HHKB 4PJXE 2H41A 3HRPA 2XRAL 4GG6B 4RWYL 4N0RA 1DVFB 4G5ZL 3LVEA 4U49A 3F58H 2HJLA 3VH8B 2MQ3A 1XCTA 1F3JB 1IILE 3C8DA 3VH8A 2VNCA 2HTKC 5CEXA 4L8BA 2HVJB 4N90D 1NLDL 1XF4A 1RSFA 5F7WC 5E6ID 3LPGA 4ZOCA 2BVTA 1ZVHA 3SGEH 5IF0B 4YHOH 5D70L 5FDWA 1T1WA 1OAZL 2FX7L 5FGCE 3B9EA 4FTVB 3QDGE 2W0KA 1FCCA 2AKRA 3CFKB 4OSUL 3QDMD 2JJTA 1I1AD 1U8QB 4HUWB 4YHZH 5ESQB 2HRPH 2GQHA 4XCYB 3U2SA 2E7HA 4OF8A 4MHHI 2L7UA 1KNOA 3ZL4H 1P9MA 1FZJB 3MV01 4YFLI 3S4SG 4JRWA 3RNQB 2HFFB 1CXKA 4PJFA 5I19H 4P23C 3T4YB 4P0DA 5I16A 3CSYB 4FQXC 2LFGA 2YPLD 4XH2B 1SMAA 1JFQH 3DX6A 5GRJL 3SQBA 1JGEB 4HC1L 1QBLL 5CINH 3R4DA 5C92A 3MMEA 4C57C 3BZEB 4H88L 1MIEH 1II4E 1BF2A 4M8VA 1XR9B 1CE6A 1GGYA 1IM9B 4XP6L 1BQSA 3VWKB 3KYNA 1UM6L 3ARDA 1X5IA 4AIZA 4J8RA 3L3IA 3ZE0E 3N85L 5GRUH 3U0PA 1RUQL 4NFCA 3LKOB 1P7QA 3T0EA 1BGXH 3PWLB 4AMKL 4PRBA 4HUKB 4CU6A 3ARXA 4QRRD 4U7KA 4TUOA 3DX7B 3QAZC 1CVSC 2D9CA 4EN3A 1S7TA 4JCMA 2WIIA 4A6YH 5A3ID 1MAKA 5H37H 4ZFGH 2AABL 1Y6NR 3V6ZA 2BSED 1U8LB 3BW9A 3QHZL 3VFRB 5FM4A 2QQQA 5TF0A 3QNYA 2HTLC 4H1LH 1PYWA 5GGRA 4FXGB 1KIQA 4NZJA 4F9LC 1MEXL 4QHMA 1FL3B 3S34H 2BMKB 1JHKL 5FO7B 4ZFZA 3NTCH 4O2CB 3WIIH 2EIBA 4PRNA 3V0VA 1CF8L 2DL9A 1JUFB 5DTFA 3KLAB 1VESA 1QO3B 2I07A 2F74A 4JZNB 3RY4A 1MIEL 2P48B 1DANU 1FNAA 2F58H 5IGXH 4XWGL 2FO4A 4L29B 4RFNB 4GAFB 2CLVB 4Y19E 3QCUH 1B0GA 1T22B 5DFVC 3CFJA 3ZZ1A 1XF1A 5HI3C 1YJDL 3VXPA 5JW4N 1J1PH 1VEPA 5EZIH 5C6WH 3EBAA 5D96C 1GGCL 3N50A 4XX1E 3S36X 1B2WH 2B1HL 4K3JH 3MUGA 5B39G 5MI0C 1JF1B 1KEML 1T7VA 1FG2A 2OR9H 3D3VD 4PJDA 5E1AB 2DQCL 4J12A 3HPJB 2WZPD 5EZJA 5CJ5A 1CTNA 5BOPA 5C6TL 5TE6L 1ZTXL 2FH6A 4ZFGL 2ATPB 2ARJA 4GW4A 3VXUA 5C2UB 3ZKMC 4H20H 3DECA 1OAXH 5KS9F 3K4DA 3GNML 4RZCA 2YPVL 1JHTA 4W6WB 3RL1B 2H8PA 3EHBD 2BVYA 3T0XA 4J7RA 5ESAB 4Z7UA 5H8DA 4RQQB 4GG8B 3V6FA 4OZHF 3QFDA 5ALCL 4G8FA 1U6AH 3GJEA 4M9OA 1T3FA 1UB6A 2ERJC 3P73B 1CGWA 1U3JA 1VKXB 5INDA 3CFCL 4CUCA 4NO0D 1DEEB 3EUUA 4QXTB 4Q9QH 3WXVL 1IQWL 2XACC 3PWUB 1A3RL 2F58L 1FFQA 2VITA 5CD5D 3OGOE 4XBEH 4I4WB 3QCVH 4M5ZL 3A67L 4MCYB 1Q9OA 5K9JH 2DLGA 3S3SA 2KBGA 1DBBL 3M8OL 5J13C 3CD4A 2IQAA 3VD5A 3FO2A 4NO5A 1H3PL 2HA1A 5M94B 3KPRD 4YAQA 3MRKA 1MFEH 1UCTA 1XF3B 2IBGA 2A9ML 1OPGL 3DARA 1F3DJ 1D5XA 3L3DB 1I1RA 5JNYA 2FWOA 3GM0A 4QY8B 3ULVL 4CW1B 3HKFA 3Q6FB 4WW2A 4JFXB 4RGNE 4PGJA 4JO4L 3QJFB 4PJ9A 1P6AB 2YWYA 4TUJA 5ISZE 1S8DA 3FO1A 5GSRB 4WUUE 3EJZD 2OLDA 1EAJA 1JHLL 3QP3A 3RZCD 4NNYA 3NFPA 2XTLA 2FD6H 1Y6KR 1CDBA 3HG1D 4FS0A 3BMVA 4KKCD 1MCBA 4RFEB 3GSRA 3FRPA 5I76B 1YPZE 2EXYC 2X4OB 1LEGB 4P57A 5IVXA 2CXKA 3C5ZD 1F45A 1QFPA 3BH8A 3ZT6A 3MV7A 3O6FC 2WUBH 1DQTA 1TCRA 3ARFD 2IC2A 3DXAA 4JDVA 2YUXA 4WO4C 3TO4C 1H3PH 4JPKH 4PJ7B 2DQFB 3CLEH 2GCYB 5ICYB 4HJGA 4PJHF 1TFHA 4OZFA 3KXFD 5ETUA 1KCUL 1E27B 2QKIB 4MNHB 3CVHB 3ZYOA 4YGAB 4LOUD 1U8KB 1WIPA 4MLIA 1JWMB 4LCUB 5JUEL 4YGVA 5IBLC 3INUL 5GHWH 4H1LG 1F4AA 1QRNE 1TCRB 5LQBH 3RWFB 2Y1VA 2DICA 2YZ8A 2EC8A 5L8JB 4JFFB 5MENE 2E27H 5E70A 1HI6B 4N0CD 2BSTA 3OKLB 1KULA 4WW1A 1DL7L 1AR1C 3RWEA 2NY2C 1LEKA 5JORB 5JHLH 3HUJA 1RVFH 1BPVA 4DKDC 4RFEA 4JLRB 5MEPB 1G7HA 5HHXL 1AXTL 1OHQA 1ND0A 5GSRA 4E41B 1A9BA 5DJAA 1EA9C 5ITBH 2HRLA 1YEJL 1HQ4A 1GGIL 3C2SA 3ARTA 1JGUL 4ZQKA 1AGEB 2FEEL 1AD0A 3L5IA 4JFEB 3RGVC 3EO0A 3ULVE 2NY3B 2ZSWA 3CVIL 4OF6A 3STLB 1HIMH 4EJ1C 3QULB 3FN0L 4BQBA 2PYFB 1OP5H 2IBZY 1MFNA 4U6XB 2FLRT 5BRZA 4R96B 4V1DE 5IVXB 4N5EC 1NFDA 5T3XE 3RA7H 4DVBA 4MGXA 1J0ZA 3RWIB 2Y6SD 4K23L 2HKHL 2QADC 2HFGH 4JJ5B 3B3IB 3PXHA 3MUZ1 5DRZB 5HHOE 1DQDL 2IMNA 4P2OB 3QPQC 3NFPB 1KT2B 3Q48A 4X7CC 2VDPH 4F7TB 2QV2A 1R3IL 4LLMA 4ETYA 2FEEI 5D7IB 1FQ9C 2L0DA 2F8OA 4ZAKD 5I1LA 1MPAL 2X44D 5IB2B 3I2CH 2J8OA 1H15A 5JNYB 1E28A 2WBJA 4ZNCD 5DUPH 3U46A 2EDQA 4QGYA 4U1MB 1N6VA 5K9OB 4XNXL 3UDWA 4KI5D 4GW4B 4KK9D 2F5AH 3K8MA 5D1XC 3T0EC 4HIIA 2IANB 4N5UA 4NT6B 3LV3A 4XPAH 1DLFH 1SY6H 4KVNH 5L8LB 3VFTB 4Q2ZB 4XNUH 1YDPA 2VERN 4C4KT 3GRWH 3RY6A 4L4VA 3VG9C 4EIZC 3GSNL 4KPHL 1BVLA 2H1PL 1J05A 5HI5C 1P4IH 4X9IA 1SYVB 3HG1E 5EULV 1MIMH 1KJVA 2HTLD 4H5SB 5I17A 3TN0B 2R2EA 1JZ7A 1LE5B 5D5MB 2VKXA 2VQTA 5FCUH 5B3JE 1WWCA 1RUKL 1KN4L 2GJZB 4HC1H 3UTPD 3SQOH 4L29A 1GXEA 2JIXA 3O8XA 1F11A 3RPIB 5BO1L 2ITCB 5IK3A 2OXHA 2E7CA 1KOAA 1LO0L 2L4OA 3SJVE 2FO1A 3K80A 4G6AC 1TVDA 3QO1B 4OKDA 4O2CA 1CE1L 4X7FC 4F7CA 3DVNA 3HPJA 3C8KA 4APQD 2EYTA 2EDOA 1Q0XH 3CZFB 2CJUH 1BM3L 3V6FB 3W0WE 5LGKA 5KVEL 1DN2A 2CUMA 5L6YH 2XZQH 3R8BB 5TDNB 3TBVB 5T5FH 4L8CA 4LPUA 5CEZD 3RVXD 4H0IA 3X13A 5ALBH 5DI8A 3MRBA 3FB5B 4XCEB 2E8ZA 1CGSL 5K33A 1ZK9A 2YUWA 4KJPD 4LLWA 1A6VH 4NQEB 1GOFA 5EU6A 1B9ZA 3BSZL 1FG2B 1IC7L 3O41B 4HT1L 1XCQB 2X4NA 3MBEA 4JHWH 1XF5B 1G7MA 5MEOA 4YX2H 4LHQB 3ZKND 3DGGB 4O51B 2J4WH 4M6NL 3RDTD 5E5RB 5F7LB 1GZQA 1D6VL 1T0NA 2A6JB 5F7DB 1WFTA 2W1NA 4LDEB 3DVGA 5F96L 2YZ1A 1ZOXA 4M1CC 2J88L 5KSBF 2DQIH 4AEEA 2AJUH 3DX6B 1FFPB 2DWEB 4YWGH 3F7YA 4FNLL 4CDGC 3LQZA 1KCSH 4FQCL 3RJDA 2NXZB 2EIDA 3FFCB 3JWOL 1FDLH 2A74A 4JN2A 4ZAKC 2DAVA 2W9EL 4E5XB 1CU4L 3EYSL 2B2XL 1KYOK 3IS1X 4P5KA 4PV8B 4MJ6A 5JHDA 1CE6B 1UKTA 2H26A 5EU6B 3DETD 4X5WA 4WHDA 1WGOA 1F90H 2EYSA 2PW1A 4LLUA 4H26A 4RAUA 1XCTB 3IFPB 1ADQH 4M4RA 3OXRA 2CRYA 3KG5A 4F15B 3GSXB 1SVCP 1JGLL 4QHLA 4WI5A 3T65A 2OQJA 1S7XB 3UYRH 4PP1C 1QHOA 3C60D 2FBJL 2DJ4A 2D03L 5JA8B 4I2XE 4JG1L 3QG7H 3NABH 2R2BB 1FSKB 1QNZH 4KKLC 3DSFL 2CKNA 2R29H 1FGNL 1MH5A 5L2JB 4KI1A 2ITCA 4MA7L 4QXGH 1EVTC 1XF4B 3MLRH 1Q1JL 1VGEL 3ZLQC 4M61A 4LSTL 4RMQA 4Q6YA 1PGRB 4WEMB 3X17A 3SDXE 4U1KB 3V6OE 4QCIA 3QQ3B 4PG9A 1H3XA 4Y4HA 1N5YL 2ZNWA 4HMDA 5GRWA 1K2DA 1L0XA 4LVNC 1TZIB 4NSKB 5J06A 3O2VL 1IAKB 3LAFA 4R9HA 4LARH 5HPOA 1H3GA 1TPXB 2RQ8A 7CGTA 3VFMB 4PJDE 4QRPB 5AYUH 1BD2A 5B38G 4WO4B 3SDCC 5DGQA 1CT8B 2P49B 4L8BB 4PJHE 3DUHA 4WI4A 4JHAL 4LPWA 1KN2H 3HE6D 1KPUA 3MOBL 3IDXH 3HI5H 1JGLH 1K5NA 4R4BB 5K9KA 5HYJE 3QWOB 1K3IA 2A38A 5FFLA 3OPZL 1URLA 2Q7YA 1ZLUK 1WZLA 3MLSH 1HHGB 3HRZA 4R0LA 4GKZB 2CUIA 4NWTH 1LVEA 3QEQB 3HLAB 1DCLA 3FQTB 4H25B 2P8LB 2Q1EA 5J1AB 4JAMA 3QUXD 1Q9KB 3W81A 4BM7A 2M26A 1WWWX 5I1CL 3ARBD 3MA7A 4DFHA 2G5BB 3LPWA 1KT2A 1SHMA 4JDTH 3FRUA 1PZ5A 1L7IL 1A6ZB 1NCUA 1N7ML 1OP3H 1YYLL 5CGMA 2XN9B 4RAUB 4QRUB 2WBJC 4MB5A 1R3LA 2CXGA 2G5RA 3BP4A 3QUMB 4P2RB 4RNRA 1FNFA 1RVFL 5C0EB 1MNUL 1LO4L 3T0EE 2QEJA 3BO8B 3BP7B 4LGRB 4HWZA 1RFDL 2P4AB 2Q76A 5I18H 2ZUQC 3QWRD 2AGJL 4ELMB 4L9DA 3X12B 4KMTH 4GKOA 1IQDB 1MSPA 2ADJB 2VXSH 5SX4I 2IWGA 4Q97A 3RDTB 4NCDA 5IQ9A 1BBJB 1XGRA 3L6FB 1D5BA 4HWUA 1GGIH 1EIBA 4U3CA 4WU7B 3CC5B 2D2OA 4G6JL 2AEIT 3MJ8A 2AV1B 1HWHB 2CLRA 2EZ0D 4FFZL 4Z7WF 4XWOC 3MRQB 4MAYA 4YDKL 3S5LB 4G8GB 4Y4KD 1ZT7B 1QBLH 1CR9H 4MVBD 4X6DA 4PUBL 3ARFC 1EFQA 1Q8MA 4MNGA 5L2KB 5IIEB 3WLBB 1RUAL 1RURL 3MODH 2AVGA 4XCCL 4BSWB 1WEJL 1K4CB 5DVOA 2LTQC 2R2EB 1HINL 4LK4A 3REVB 1LWRA 3IFNL 1J86A 1K8DA 3FCTA 3BN9D 3AY4A 3DSNA 3KS0H 5DF0A 3K2UL 1QP1A 2FJFB 1X5KA 2BHYA 2BOCA 2IF7A 3BP6B 1YEEH 3QUYB 4Z77A 2BVEA 3HR6A 5D7KD 2NY0D 3TLRA 1DLHB 5FOBB 1YQVL 5EFIB 1I3GH 1FLRH 5FDYA 5K9QG 3NCJH 4HPYH 2F54D 2VXVH 2ILLA 3HR5B 5INDB 4NJ9L 4MCZA 1G6VK 2Z35B 4PJ5B 5EG6C 2NLJA 3MRNB 4MXQD 5LBSH 4K8RC 1AY1H 2DTML 1JHKH 1H15B 5T33L 3KR3H 4FQ1H 4QTHB 5FB8A 1TQCB 1BWMA 1T83A 5D71H 5EORH 3GRWL 1MJUL 1UVQA 5HYJA 1U3HA 3GMLB 3WXWH 4DN3L 4NDMB 2H1PH 1EEZB 3EZ8A 5GS2H 3BE1H 1LO2L 2EO1A 4OV5B 4IJ3B 4HXBH 5AYQA 4BK4A 4WGWB 3ABZA 2P5EB 4OD1H 1FJ1A 1MF2L 3CU7A 1A14L 4ZFOA 1C5DA 4KK5C 4LSPH 4X6FB 1A6WL 3ROOA 5I9QB 5IB4B 4HUUA 4U2ZA 4R96A 1NGQL 3ZKNC 5BMFL 1KF9B 5F1NB 2BNUA 5FO9A 5HDBE 2WLZA 5CJXA 4YPGA 2AJSH 2VWEE 3QEHB 2F53E 3OTTA 3QPQD 3MRLA 3PL6A 1UXSA 4CMHB 3AU1B 1M7DA 3GKWH 4YHOL 3SE3C 1W8NA 2G60L 2WBJD 4H8WL 4U7MA 3VG0L 3SDAB 4NO3A 3KLAA 5BZDB 2XZQL 5B38B 1XGQA 1K8DB 3FCTB 5I73B 2CQVA 2GAZB 1KACB 1LP9B 1BP3B 5T33H 4WV1A 5DEZA 4IRJA 2MFNA 5IB5A 3DMMA 4XP4H 3ZO0A 2X4QA 5EDXA 2IPUK 4EN3C 5I66B 3ARRA 1XH3A 2YHGA 3KYKL 4GG6E 4QHKI 4KKCC 5KZCD 1VFMA 1IC7H 4ENEC 4Y4KC 2QSTA 4GAJH 4LASL 3DRTA 4LQFL 2WIIB 4O2FB 4YX2L 3F65A 3VE0A 5IOPA 4JPWH 3IFLL 4EI5C 1TXKA 2KQNA 3KDMA 2FL5B 2O5ZL 3S35X 5KSAC 3S37L 4K8RL 1LP9F 3RHWF 1KCVL 5LGJB 3PP4L 2HMIC 3ZTJG 5I74B 2OS7A 4UDTA 4UINH 1F58H 3TBSB 3CVHH 4YWGL 3T2QA 3X12A 3O9WB 5DXWA 2C7UA 2XYCA 3FRUB 1DBKH 5DC9B 2XG4A 3BKMH 1TQCC 2X1XR 1HH9B 5GSVB 5E6YA 1W0YT 4GKNA 2CUHA 4HDIB 1PKQE 2VE6B 4WGVB 4P2QA 4X5XB 1JGVH 2UZXB 3GUTB 2DMKA 2GI7A 2X4OA 3CSYA 1LNUA 3BI9X 1A9EA 2EDRA 2NX5D 2V9TA 3D39B 3L3KB 4OCRL 5FGSA 2AK1L 2AI0L 5FGRA 5JW3H 3VXNA 4D0BA 1B0RA 4XNZB 1JN6A 3RVUC 4HK0B 1NMAH 3C6LC 5J6HA 1Y6MR 3IVKA 3BEWA 3M07A 5JORA 1CXHA 1CF8H 3TH3T 4YNYA 4ZOEA 5LXGL 3TO4A 2BNRD 2IAMC 1ZHKA 1WSST 4JAMB 2PR4L 1HH6A 3RU8L 1BQLL 1T1WB 3OB0K 3RGVB 2FWOB 3H0TB 4KK8C 3CLEL 2I9TB 3VRLF 4K8RH 3HRZB 4R0LB 5FYJH 4KKAC 4Y4HB 1IGCH 1KB5B 5EZOH 1CFQB 3QWOA 5JLZA 1QR4A 3DYOA 3OR7A 5KVFL 5T1LA 3GMMA 1ZANL 5FHBL 1SBSL 2V17H 1E27A 4OUUB 3SHSA 3CXDH 2ZJSL 4J8RB 2EXWD 4JVPA 4MB3A 3RX7A 3I6LD 4NPYA 1YC7A 1QSEA 4E42B 5B8CC 4JM2B 1MCJA 4K3EH 1P2CA 4AH2B 2A77L 1SJEB 1YEFH 3HZKB 3STZB 5C0CD 3WLWC 1IGIH 5I1KH 2R4SH 5FGBC 1OOAA 5JR1L 4Y4FD 2CMRH 4OD2A 2F9BT 4MAYC 4PJ5D 3FQTA 5HHXH 4HGKC 5EO0A 2W60A 5I71C 5GGUA 2IMMA 5DZNA 5IVZA 1INDH 3GSXA 1T1ZB 5E2VH 1T2XA 1Z5LB 3G5XB 3PQYA 3OJMB 4ODWB 3QRGH 1J8HD 3UROR 1BD2E 2WW8A 4ODTH 1K5NB 4HLZH 5DHXB 2XNAB 4L3CA 1PFCA 2FECL 4OIAA 4TUJB 1HK6A 1OTUC 4JKLA 3U6RA 4L9LC 5ACMA 2C3VB 5D93C 2NY5C 1KCRL 3DX9A 5ID0B 4NQUA 4HX1B 1SM3L 1XIWD 4E5XA 3PQYE 3PJSB 2D31B 5DJDB 3L3OA 5ICXB 4C54A 2P8MB 4GRMB 1PD6A 1YEFL 1Q9OB 4L4TA 4P23D 1WISA 3QJHB 3KPQA 1DSFH 1L7IH 3HI1A 2BNQB 3GBMH 3GI8H 1FPTL 4K71B 5MEQA 2R2BA 3JV4A 3RZCB 5LWYH 4FFVC 1Z0NA 1HZHH 2WLYA 3SKMB 4IMLA 4NOFA 1OY3B 4OGAD 2K1MA 4AMKH 1PBYA 3FT2A 2NW2A 4OIBA 1T20B 2N56A 1FBIH 1A6AB 1TDQA 2EE3A 5T1LD 4NJAL 1SEQH 1UWXK 1WQVT 3QEUB 3GBNH 5MEND 4QRQB 4N8PA 1SJXA 4IRZH 4YDLC 1WBXA 4N8VG 1ORQA 4P5MA 3VRJB 1YN7A 3S34L 3DVIA 3WIIL 4M1DL 2VXQL 2XWJB 1SM3H 2F8VA 4YIQA 1ETZA 4A2LA 3T2OA 1G6RL 5HHPB 5BZWA 2YD3A 1K9TA 1QKZH 3O4OB 1H5BA 2EYTB 3PGDA 1JZ4A 2XFXB 4ZUTB 4ZTOH 2P44B 1NDMA 4JM2C 1DFBL 2BNRE 2IADB 4XP5H 4N8CL 5FYKU 3JTTA 2BP3A 2WBWB 3QUXC 4KI5F 3SCMC 4JJHA 1YPZB 4M1CD 3TO2A 2E7LC 5EZLB 4S2SB 4PRPD 1OAUH 4HBCH 1EHNA 2OJEA 1ONQB 1QRNA 1UKSA 1D5ZA 3BUYB 4BSVA 1QQDB 1GC1L 5D1QA 3WJLC 1B4RA 3MJ9L 3OMZA 5SWZB 2APVA 1JZ3A 1S7RB 2BNQA 5DVLA 3SGJC 3IDNA 1RUMH 1NGWB 4IRZL 3HNSH 5C86A 1GGBL 2QHLA 3I3EA 1JF6A 2C4FU 5HDQH 3RGVD 3P4MB 3VXSD 1XMWA 1R3HB 2ITDA 2HVJA 1I7ZB 3PABB 1IGML 4FQ1L 2W9LA 3NA9H 4HEME 5B4MD 2JE8A 3S7GA 2VN4A 4JY5L 2KL6A 1Z3GL 4M3JA 5TDOB 1KJVB 2D4FA 4LP4A 5IFJB 3TBVA 4XWOD 3WXVH 4J3TA 4C56E 2DQIL 1BLNB 5GGQH 2X42A 1OAYH 5HHNB 2A0LD 4UQ3A 3HB3D 5DHVH 1FH5L 2VLKB 4GMTL 3RY6C 5A16A 4ODXA 4HCRH 4F7EB 3LKNA 5D2LE 1Z9SA 1MELA 2Y06H 2XNAA 3X3FL 1BOGA 2NY7H 3NIDF 3O11B 4HUMB 3G6DL 1NCAL 5TF1L 1I9EA 3RWDB 3C5JA 5DQJA 3AGVA 4NHCL 5IVZB 4K9EL 4PJ8B 1HSAA 4ETQA 3E3QE 1F3DH 1L4IA 3HG1A 1QLRA 4U1IB 2ZCHL 3PNWB 3PQYD 2A6DB 5DLMH 1J87A 3TCXA 3ZKQD 4K9EC 2G60H 3QDAA 4NM4H 5D96B 1F00I 5BRZB 4U1IA 3IKCA 4TYUA 3V8CA 3FB8B 4RGNB 5D7IA 1J05B 35C8H 1QFWL 4JQVA 5CBAB 3F5WA 5DR5L 3TC9A 1BFTA 4JM2A 3ZT5A 2EH8L 1TJIL 3VXMD 4Z6AT 4XP4L 5C8JB 3W2DH 1ADQL 2NR6D 1FIGH 3TFKD 3IDIA 4MWFB 4HIXL 3R06A 4E9LA 1BLNA 1NLBH 3HNTL 3TPUB 4DW2H 5I8OL 2BNRA 5CIPA 3KGRA 4EBQL 4TOYH 1DE4A 3JV6A 5CHNA 1NGXA 2R1WA 3VFOA 1P4BH 3L5XL 3MREB 4Z7QF 2Y06L 4ZSOB 4YUEH 4ZQKB 4R3SB 2BVPA 4R97B 4YHPA 3UC0L 2BNQD 3G6DH 4KZDH 5JHDD 3QIUC 3TIDA 3OKMA 2W9DH 5C8JA 3VFSA 4E41A 5IW1B 4AEIL 1X5JA 5HGHB 3O3AA 4Z9KB 2I27N 4NKMA 1NC2D 1A5FL 1NFDE 1Q9WA 4Z95H 3C60A 1D5IH 2P45B 4P2CG 4GMSL 2R1XA 4XC3H 1ZT4B 3LDBB 5AZ2H 4OT1L 1I9IL 5IESL 4LOUC 3QG6B 4WW1B 1ONQA 1S9XB 3EJJX 4XP9L 5DYOA 2NXYD 1MLBB 4CNIA 4XPTL 2XICA 1JRHL 1ZE3C 2X4PA 3BGFC 1L7TL 5C3TA 4QYOB 4JFEA 5IJVA 1W0WA 2B4CL 3G5ZB 4JCLA 4I0PA 3UTTA 3HI5L 1WBYA 5C07B 3TIEA 2EDXA 2ORBL 2Q8AH 3V9FA 5TH2B 5DJAB 1NSNH 4UU9B 2Z9TA 3L1OH 1CFTA 2V9QA 5I1HL 4RGMC 2VOTA 5DQ9B 3UTZB 1IL1A 5TDPA 1P4LB 4YIQB 4HWBA 4WUKL 3D85D 4U6YB 4HJJH 2AJUL 4LCYB 1PKQA 4EQ2A 4O2FA 4P4KC 3DRTB 1CL7L 1RQ5A 5CD5C 3HAEB 5E9DB 3WKMH 4I3SL 1H3UA 3B9VA 5CS7A 3EFFB 4S1DC 4WW2B 5F7KC 2UVEA 1LK2A 5J3HC 3HMXA 2PTTB 1A2YA 1X5XA 2FLBT 4J6RH 1IFHL 4MX7A 2ADGB 4OI7A 4TVPH 3FQWA 3GSQA 2F8XC 1I9IH 5SWZD 3RVWC 2HKHH 1R3IH 5D7IF 3CK0L 2CK0L 5JR1H 5D1QB 4NYLB 1QQDA 1T0MB 2OSLA 4GAGH 4TULL 1AR2A 3DXAD 4EI6A 3MRCB 4W70A 1VEMA 4OAWA 4PJFF 4HKXA 5T1MB 4RA0C 3SGEI 3NZ8A 2VYRE 1HCFX 1JYXA 1YPZA 1DUYB 1I7UA 1H3VA 1X4XA 1XF3A 4PGEB 5BJTB 4OZIB 1I75A 3GO1L 3CDGB 1JWSA 3QFDB 5ADOH 4NN7C 4Z7UB 3C6LD 4KVNL 5J1TC 2VWEC 4HC1A 4HGWB 4KK6C 2ZUQB 1FJ1B 2AXHA 3VI3F 4DTGL 3O6FD 3VWJD 1N26A 4MJIB 1JV5B 3H7BB 2H2PD 4WDIB 1A6PA 1MIML 4OD3H 5FHAL 2JF1A 3UJJH 3VRJA 4PJ8C 1IC1A 4UAOB 4MA1C 3KPRB 1CD9B 1AGCA 1UXWB 2VAAB 1X5FA 2Y36H 2IG2L 2VDML 2ZP0T 3QB7C 5HYEA 1OTTD 3G5YB 4NN5B 3FQRA 1AXIB 3NBNA 5DEFA 3GB7A 1TITA 5CCKL 5KW9L 2DM4A 3IXAB 4LLVB 2IQ9L 3VXQA 3MRIA 2OL3A 3U30B 3L3GB 1DDHB 1DQQB 4PYHA 4U05A 3VGHA 2ATPA 2IPKB 1HXYA 3UZEA 5HYQB 2FDBP 5D70H 4UI2A 1N6QL 4NQDA 2FJFA 2VXUL 1B3JA 1UWEH 3ILPA 5DTFB 1R0AL 3LRGA 3RFZC 4FTVE 3QJHA 4L3ED 2PUQT 5I1IL 1R24B 4ODHH 1VFBB 5CILH 4Y5VA 4GKSB 5DRXB 3IRZA 3LN5B 3P73A 1CG9A 1HILA 3OPZH 1ACYL 3BUTA 3PJSA 4NQCE 3QIBD 4GW5B 3I85A 5DMIH 3BE1L 4M8QB 1U9KA 1TZHB 3LSOA 3IF1B 1FYTE 4QHUB 5I1GH 1T1XB 4NQEE 1MF2H 3MV9D 1I9JH 3EOYG 4KI5E 1HNFA 4YHMH 2P46B 1HHHB 3VWKD 3CUPA 3LPFA 1BFSA 1INQB 2YEZB 5DJYA 5IKCA 3UPCA 3VFGH 5FCSH 1BBJA 4PJDB 3ZSTA 2CKBB 3UPRA 3KPSE 2WQ8A 1JTOA 1RK1A 1Z5LA 2VJXA 3RTQD 1AHWB 4OLXL 2GJ6E 1M71B 3WBDA 3L3KA 1UWXH 4H8WH 1A9EB 1DQLL 2PO6B 5IB1A 3D25A 4DKFL 3P4NA 2G2RA 2IGFH 1DBBH 3M8OH 2XY2A 4K7FA 3WDJA 3EO9L 2Z4QB 5TPWH 3THMH 5IJKA 4YBLB 4PRHE 4OZFG 1OGAE 2AXGA 2D0GA 1QSEB 4E42A 2BMKA 5FO7A 3HNSL 2WWMC 5DJXA 5CGYC 1SQ2N 4NN5C 5EO9B 4EDXB 4OFIA 3RVVD 3TBSA 3KPTA 2OK0L 4KK9C 1MRFH 4XGZA 4AT6B 1XGYH 4JPWL 4K7FB 3MGTA 2AV7B 5MP6L 1MI5E 2DS4A 1DBAL 2ZOLA 1WZKA 3D48R 5IMKA 1I7RB 1UCBL 3M1BB 2FATH 32C2B 1JJUA 4I0CC 4YC2C 5LJYH 1F2XK 1NCCH 1ZHKB 4EDWH 3HE7D 5HI5D 3L95B 4KK8D 2YC1A 5I66A 3T0EB 4DWHA 5D7JC 5EUOB 4HLZG 3OHXA 4WIQA 1NMCB 5IB5B 2AJZA 4YHYB 4LLDB 4G3YL 4Y5VB 4TUKH 3LKSA 1R24A 4B53A 1E6OL 2ADIA 4FQIL 3UPAA 3UJTL 1UGNA 3WCYA 5IMKB 1JYVA 4BFGA 3QXVA 2AI0H 3DTXB 2WANA 2M8XA 1A21A 4JPIA 1IVLA 3K81A 3PL6B 1RPQA 3P77B 2I9LA 5I16B 1Q1JH 1F6AB 5DRNA 5EO9A 1FAIH 3UBXI 4GG6A 3QEHA 1HWGB 3JWNC 1EJ6A 2ARJQ 43C9A 2BVOA 5KJRH 5CLWA 1QR1A 1SY6A 4HUWA 1TETL 2R15A 2DF3A 2HWZH 2JCCF 1OLZA 2P5WB 5DHVB 4KHTL 3FL7A 4NO2A 5CJXC 2FHBA 2K9UA 2WP3T 3MLYL 2Y7QB 4F3FB 4JO2L 3T0VA 4NO0A 1QTYT 5C0BD 4Y5YA 2FL5A 1NGYA 2VLRA 4NQVB 3PGFL 2Y72A 4L1HA 3OL2A 4KV5E 5GGTH 2Z8WC 4QHUA 5I8KL 4JKWA 3SE3A 3A6OA 3VJ6A 5KSUA 2HFEA 4OTXL 5EA0H 1FZOA 3WN5A 4EOWL 2X9WA 3WFCL 3RTQC 3CDGA 3ARDC 3GRWA 3H42H 2DIBA 4X6EB 4AQOA 4WEUD 4O58H 2FRGP 1JP5A 5MERA 1A5FH 1OSZB 5B38A 1BECA 3PWJB 5DS8B 4FG6D 4IJ3C 4NZDA 5FOBA 1ZXQA 2A6KB 2PXYB 3MRMA 4YR6A 3IU3B 2ED7A 3VGGA 3MRGB 5J9PB 2V5YA 3NCBB 3C08H 1EO5A 4NRZB 5C1MB 1BQHB 5EU7C 1IKNC 4I18A 4K3HA 4HSQA 1WTLA 3G04A 3QHFL 3H3BC 2VXTL 5KN5B 2HLFC 4G9FB 1G1CA 1ZHNB 2VDRH 1FSKC 1X5AA 3PGCB 2VDNH 4JQIH 1UQSA 5EWIH 4YDLB 1HXMB 5DURD 1RFDH 5I30H 1F97A 1EGJH 1MJ7H 3QH3A 2XQYK 1R3JB 5F88A 2G9HA 3E2HC 1JPFA 1OW0C 4XNQA 4POZC 3G6JA 4XNXH 3W11C 4MQXD 3GK8H 1RZFL 3LB6D 1G7MB 4HGWA 3RUGE 1L9NA 3B5GA 4XNYL 1HEZA 1ZGLP 4UU9A 4X83A 4LVNB 4QWWD 3MODL 3T8XA 1EFXA 3NFSH 5E00B 1U93B 4TSCH 5CZXD 3WUWG 5CBEA 1FE8H 4ZUVB 5GRXG 4FQHA 2JJSC 1TCMA 4JFFE 4LCYA 4ZUVA 1CK0H 1C08B 4JRXA 1MCLA 3CSBA 5JHLL 3CK0H 2UUDK 3C08L 3QCUL 4BH7A 1A1NB 3BP6A 1FFRA 2NZIA 1UWGH 2Z0BA 5C0JB 2P42B 3B9DA 4G9FE 5J57B 1SEQL 5SV3A 2QBWA 3F12B 4XXCA 3C8HA 4B7LA 3FQWB 3RWJB 4YHLL 3VW3L 4IRSD 4HPYL 2JB6B 4CVUA 3ZKXB 2SEBB 1A7RH 4ZD3H 3TT1L 4NUJA 4Q74A 1A0QL 3D0VA 3ARGB 3CU1A 3V4PL 2W0FA 3LN4A 3UTTE 2YPVH 1V3JA 1RZ7H 4HIJB 2DLTA 4JZOA 5DRWA 1PKQB 2HH0L 4PTTA 3S5LA 5CZVH 3U7WH 3V5DA 4Z7QE 1J8KA 4JRYD 4LSQL 3L5WA 4DQOL 3C60B 4K8RD 2ZCLL 3GSQB 1KIPA 2I5YL 4ODVL 3BP5A 4IOFD 2XI9A 5FHAH 1CFSA 1ERNA 3MRRB 1CCZA 4PRAA 1HHJA 1N2RA 4MB4A 4Q9QL 3RDTA 4OB5L 3MRGA 3OKMB 5B39A 1IQDA 2ADJA 1E4WH 4FZEH 2Z92B 4LRIC 5DJ6A 4EIGB 3OKKA 4FQQB 3FQUA 3TIEB 5L0QB 5CJOH 5CP3H 3QUZD 4YFEA 2PXYC 3G5ZA 4DUVA 3OX8A 4PJCF 5J3HD 1A14H 1B90A 4NRYB 5CJ8A 3EO1A 4F8QA 5KW9H 1MPAH 4PTUB 3GSVA 3P2TA 1UWGL 4I0KA 4FP8H 1R3LB 5DUPL 3GIVB 4X8JB 4ZAKA 1VGKB 1MREH 1KELH 1I7TB 4PP2A 4MA8L 2APWA 5E2VL 3C2AH 4LGPB 4XZUB 1J8HB 2OJZH 5GISH 5KG9B 1CICD 2EDEA 3MV8D 2VL5A 4GXUM 1V7MH 1EO8H 1DZBA 3EYOA 5DJZA 3TZVA 1A64A 1MCWW 4XPAL 3FAXA 5HGHA 1SY6L 5C0BB 3VG0H 4F58H 2YXFA 2FX8L 3P4LA 2FR4B 4GSDL 3CH1A 2A83B 5GS3A 3UBXG 3GSNH 2DDQL 2DRUA 4LLAA 1UA6L 5A2FA 2X4TB 2FGWH 4RBPK 4X80L 3TBWA 2ERJB 2VIRB 2CR3A 1KXTB 3A6CH 2I5YH 2FJGB