1YJDC

Crystal structure of human cd28 in complex with the fab fragment of a mitogenic antibody (5.11a1)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a soluble CD28-Fab complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/signaling protein
molecule keywords Fab fragment of 5.11A1 antibody light chain
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15910 V-set_2 ICOS V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yjdC00
4UDTB 1B9ZA 1WWCA 5EO1A 1CK0H 1LK2A 3BPOC 4JY5H 4H8WH 5E2VL 1AGFA 4QCIB 2R1XA 5E5MB 2DI8A 2ITCB 2GJ6A 1MHEB 3IJHA 4F2MA 1WC7B 5EBLA 3PDGA 4IS6A 4Z95H 3SY0A 4DGYH 4D0BA 5JTWA 5DJ8A 2AGJL 4Y16D 1Q38A 4M5YL 4QTIL 1QVOA 1UH4A 3ARGA 3V5HA 4Q9QL 3ZT7A 3CC5A 4OD2B 1Q9KA 1CDJA 4YHKL 1N64H 4PP2B 3CXDH 1A3QA 3MNZB 5DVOA 4PJGB 2H8PB 1KTKE 3MBEC 4U1HB 1TDQA 4HZLA 3VU2A 3UTSD 4OCWL 1LEIA 1P2CA 1DE4B 4JFED 2H2SD 1NCUA 4WO4A 3T65A 1PZ5A 2I60H 4U1LB 5DQDH 2IFFH 1BOYA 5LVEA 1P7QA 5F21B 5HGAA 3HUJB 4WUKL 1I7TB 1G7PB 3M1BB 4HUMB 1MCOL 1LDSA 1ED3B 1HQ4B 3QI9B 3ECBA 2YWZA 1KTLB 1OSPL 4LPCA 4MD5A 4P9ML 1U8IB 4NZTL 2WUCH 4ORGA 4WIQA 3HE6D 1R5WB 3X14A 4JRXE 5D5ME 2D7MA 4R2GB 4M6OH 2VNCA 1CFTB 1P7HL 4EN3C 4M6ML 2E5EA 1U8LA 2R0ZL 3QUZA 4YHZH 5AD0A 4FA8A 4OTXL 2P5WA 3TBYA 4NCC1 5TPWL 2JK5B 3E6HB 1A1OB 2AJZB 4PTTA 4ONFL 2AQ2A 1KPUB 4M61B 1Z9OA 1ONQB 5MI0B 3X11B 4FQ1H 1FYTB 1KPUA 1ZEAL 4JRXD 1AGEA 2CLRA 1HKLH 1MCBA 1R5WA 2IALA 5TDNA 2EE9A 3B2UD 3BD5A 3MV7A 2AXHA 4YK4C 2CIKA 3MQIA 4Z0BH 5D93B 1AXTH 2ADJB 5IG7A 4NZUH 2Z4QB 1JL8A 2RFXB 2FBOJ 2EYTB 4X6BA 4Y5VB 3X14B 4M6AA 3I9GH 2DDQH 4J6RH 4PLKD 1DQDH 5IBLD 1RJZB 1IAIH 3HA0A 3LHPL 5DRWB 2DTML 2ITDB 3LZFL 4GRWE 3QPQC 4QOKA 1JF1B 1FNFA 4BSVB 4L9LA 2DJSA 3QDJB 3KHQA 2JK5A 3E6HA 4N0UA 3UYOD 1AJ7H 4NKQB 4WI2A 1VFMA 2Y5TA 4UQ3B 3HPLB 3LB6C 3PL6A 3S7GA 4ZUWB 5T1KB 1AE6H 3M17A 3PP4L 3RNKA 4Z7NE 1AQKH 2APBA 5F7YC 2BVYA 5TE7L 3CH1A 4HS8H 3TVMB 5I1DA 1JZ6A 5FKPA 3MBEB 2MHAA 5ECJE 4QWWC 1K9TA 1KJMA 3BWUC 5CINH 3T2NL 2PYFA 2F8VA 4CU8A 5JPNA 4MHHI 4U1MA 3T4AA 5JIIA 4QRUA 4XTRC 2JLLA 1TJGL 4HX1A 1TENA 4KKCD 5FKAA 3FQWB 5F96H 1DBMH 2V2TA 3LD8C 1Z3GL 3CUPB 1FVEA 3QEQE 4JO4H 5F1KC 1OT2A 1CI5A 3QFJE 1PG7H 4LLDB 5C1MB 3O3DB 3V6OC 4UTAH 4IOIB 3T3PE 4O5LH 3QFDB 4D8PA 4V2BA 1P5VA 4JQVA 4X9IA 4U33A 1BQHG 3MLSH 5FKPB 4YIQB 2JB6A 4X98A 4NQUA 4I0CC 1RULH 5T1KA 3RBSA 4LLVB 4WW2F 4WI4A 3QP3A 3QCUL 1RVFH 5ESVB 4EDWH 2Q76B 3FTGB 2RQ8A 1TCRA 2J8UF 3GIVA 1ZA6A 4MNQE 4QHLA 2X4RB 2H8PA 3GI8L 5D1QA 1V5JA 1M7IB 3UAJC 5CEZH 5IUSA 2XTJD 5EG6C 2QR0B 1E4KC 5E4EC 3ZKSD 1HZHL 4FQ2H 5BW7C 4OZFB 5IB4B 4G80A 2DQUH 3GJFB 3MLVL 5C6TH 3OGCB 4NJAL 4JO2L 2PXYC 3H9SA 4GRMA 4PRNA 3ROLA 2D7NA 5IHUH 2GY5A 4JO3L 3VG9B 4GAYB 3RWDA 4BK5A 4UV4H 3KPRB 1AI1H 4J8RA 3BT2H 4Y5VC 1RI8A 3V0WL 4Y5YB 4OUOA 3B3IB 1W72L 2MJWA 1FRGH 4JM2C 2BCKA 1BLNB 4PBXA 5HI5D 4WEBL 1FCCA 4OLXH 1UKQA 5E8DH 5F3HB 5IK3A 2NY4D 3GGWB 2FO1A 2C1PB 3GSRA 5EZLA 5C9JB 2HWZH 5HXMA 3C2AH 2VLRB 3FOLA 2JTDA 4RWHA 4NO0A 3GSRB 5EZLB 1A21A 4KKCC 2B4CH 1I3GH 4YDVA 1OTSC 5DYOA 4RX4A 1A3RH 3WBDA 2YUWA 3TVMC 3I3DA 1EHLL 1UJ3B 4GAJL 3MLRH 4AL8H 2ZCKH 4BQ6A 1YEHL 2CR3A 1WAAE 5BOZG 4M1GL 3JTTB 4PGEB 1CD1B 1VPOL 5DUPL 1X5KA 3KYKH 2X9XA 3ROLB 2EIDA 1M05B 2F15A 3A6CL 5IBLC 1FO0B 2NY1D 4CL7A 4JLRA 2XT1B 4Z78B 5FYKL 3MV01 1CL7L 2DLGA 4XP4L 4Y4FB 1IGIH 3BQUB 1F3JA 3TJEH 2FD6H 3T0EB 4NJAH 3OR6A 3GBML 1G7MB 4U6HA 1JIBA 4LEXL 1IAOB 2DLFH 4QYOA 3LH2H 3CZFA 3IFNL 5DQ9B 3O3AB 5IB3A 2E27H 5D7LE 1WISA 5GSRB 1RFDH 1IGCL 4G8EA 1ETZB 2DKMA 1EX0A 4QYOB 3HKFA 4OZHA 4UTBL 3MRJB 3WSQH 1IILE 1IBGL 5SX5K 1BJ8A 3CFEA 3PHOA 1KNOB 4XPGH 4ZYKB 2APFA 4QRPA 43CAB 2B5IB 4JKMA 5HHXL 1WAAA 3GSXB 5DLML 1NEZB 2LU7A 3EDKA 2CRIA 5HYJB 1OGAD 3LOWA 3JWOC 3VXSD 4IS6B 1MWAH 2YRLA 4LLQB 3SGDI 5IJVB 1ACYH 1MY5A 3LQZA 4JZOB 4ALAH 2JELL 4P5TB 3U83A 1QNZL 3SPVA 4PJFB 3CLFH 3CX5K 5C07D 5F88A 3QNXB 1U8JA 2EE3A 1JMXA 4MAYB 3OF6A 4L5FL 4I18C 3RTQC 5A3IC 3C5JA 3VFNA 2XY1A 5LCVL 2XZQH 2YRZA 4UT6L 4RGOH 5DLMH 4RMUA 1MCDA 4K3DL 5F1SA 3GHEH 4LARL 3WIHH 4PRHA 5EOTA 2BCKB 3O2DA 3WIIH 5EOCJ 4JPVH 5CEXA 1QFWH 4LP4A 1XF4B 3NCJH 2A6KB 3LDBB 2HT4C 4NP4L 1ZLWK 1BD2B 1A7QH 3RNQA 5B22A 3QO0B 4F7MA 3TA3C 2G9HA 3OXSB 5C0RH 1Q9LA 3VXUE 3DSFL 3EYUL 4WFFD 3MRLA 4IDJH 4MB5A 4XNYL 1QRNE 2NX5D 4WHDA 4G8IA 3GMQA 4BSWB 4CVUA 4Z5RA 4PG2C 4L8CA 1CF8L 1MCLA 4RQQA 3WXVL 4UAOB 2IF7A 3N1MC 3WIIL 4ENEC 3PXHA 3D2UD 4PP2A 4EN3D 3S4SG 1NGPH 3P4MA 2CDEB 3U6RA 4ONOA 4ELKA 2DQJH 1KTRL 1S9YA 3G6JB 3GJEB 1S78C 1JGLH 2BRRL 2GCYB 1ZLVH 3ZDYE 1ADQL 1NMAL 3IS0X 5EO9A 5GRXG 3H42H 4LSTH 4RGNE 1BIHA 1BLNA 4KPHL 1XGTA 1E4XL 3UBXG 4MDIB 4PLOB 3NCFB 5DRZA 1LEKA 3E6FA 2EDRA 3V9FA 1CDGA 4TUOA 5I8CA 3S88L 2ENSA 2VXSL 4JCMA 3Q5OA 1PG7X 4P2RD 5J6GB 1NAML 3DUUB 4ZXBA 1EBPA 5HJ3B 5I1CL 3RU8H 4OQ1A 3D0VA 1CE6A 4LIQE 4U05A 1KB5B 3CVHA 5I75C 4HV8B 2BSED 4LQFH 4H0GA 3N1PC 3TPKA 3CFDA 5IGXL 3QHTC 5EIVA 1NCCL 4OLVL 1A6UH 4DKEL 1CF8H 1FORL 5DJAA 2MNUA 1ZVSA 2XTLA 2JJTA 1HCFX 3HMXL 1K5NA 4KTDL 4NQDB 2Z8VC 2NTFB 4L29B 2RHEA 1K85A 3IXAB 3QUYC 3QO1B 3BZFB 2DLEA 1HINH 4GO6B 2OL3A 3DOSA 3F5WB 3LEVL 3V6BR 4XP6L 3MRDB 2DM4A 4DTGL 4YXKH 1SYVB 2J8UE 3ESUF 5FM8A 4AEEA 4GS7B 4R26H 3MLTA 4TYUA 2VC2H 2M1KA 5I8KL 5EPMA 2KUTA 3SJVE 1IGTB 4P46C 1V7NH 4Z7QF 2D7TL 4KJPC 2W60B 4Q6IB 2CK0H 5E5RB 4PJ7B 2ADGB 5JR1H 2P5WB 3P40A 3VGEA 2B0SL 3B4NA 4N90E 3PIQB 3BIBX 4PJ9A 3KLHC 1FRGL 2BNRB 1CFTA 1WT5A 1FLRH 1IT9H 4KRMB 1R5IB 3B9KD 3MRPB 2D4DA 4YZFE 3TLRA 3L1OL 3GSVB 4NBYB 5LGHL 5EU6B 4LCCA 2HRPL 2EDHA 4V1DE 1I8IA 4D9RE 4FQIL 4FZEH 2VZTA 4LPUA 3RL1A 5KVDL 5IVXF 2ZNWA 1YEKH 4IRJD 1RURH 5I30L 1O0VA 1YNLL 1UJ3A 2DWEB 4XP5L 3WYRA 4F37K 3KWWA 4NFDA 15C8L 1E6OL 1AC6A 2W9EH 5SWZD 3KYKL 5HVHB 4NQDE 1CFNA 5BMFH 1X5LA 4HK0B 3NBNA 1OARH 4X4MA 5I15L 4JAMA 3QNZA 4YJZL 3NACL 1T89C 1D9KD 4O2EA 3ALWA 4DZBB 5HPMA 2M8XA 4FFYL 5CJXA 5SX4I 1F11B 5EOQH 4LHUB 1KF9B 3IKKA 4JG1H 2FH8A 1INQA 2V6HA 1UYWH 3GFUA 5EOCL 4TSCL 1I3RB 3BKJH 2IBZY 1E27B 2VIRA 3WNMA 3JWOL 1D5ZB 3F12B 3MRMB 5C0NC 4S1QH 5I17A 1FO0A 4P5TD 3IAQA 3T2QA 2NLJB 4OT1L 2VO5A 1WK0A 5C08A 3HI5L 3QHZH 4P4KC 3VXSB 2R56L 5HYJD 4ORGB 3QBTB 5F93C 1JZ4A 2EIZB 3IXTA 4NRZA 1L9MA 3IVKB 4UDUA 3VGHA 2X4TB 2W0KA 3VD4A 4LFHD 5KAQG 4JKKA 3FB5B 2JIXD 1OPGH 4XNQA 1NMCC 1S7VA 3DUUA 4ZXBB 2P46B 2P8PB 2XWJA 1XR8B 5IB2B 4YIQA 1MFAL 3ARBC 2JE8A 1UM4H 2H9GB 1X5ZA 3IRZA 1FG2A 4BYHA 4IOFD 1J10A 4KAQL 1GCFA 4GRLB 4LLYB 4NBZB 5C6TL 1D7FA 4PJ5E 3MV8D 1INQB 2BMKA 2ZUQC 4FN0A 1JJUA 5CEZL 2J8OA 1ZA6B 4QHLB 5HDBF 3P30L 3MRMA 2DQGL 3LEYL 4MGXA 1VESA 4KI5E 3DXAB 2GQHA 1T1WB 4HG4J 3T4AB 2YKLL 3LN4B 1ORQA 1D5BB 3AS1A 5ERWB 3N1GC 3QXWA 3F5WA 4P3CL 4JFDA 4YBLC 3RY5A 4NZRH 3OBAA 5EO1B 3QCVH 5C2UB 4YO0B 3QEQD 3O6ML 4GRLA 2DIBA 1T1ZB 5D2NC 3DX8B 2W07A 4K8RL 1P6AB 1XR8A 3KYMB 2R29L 3SDXA 3V4VH 4NN6B 3VD3A 1OLLA 4E41E 3GSQA 2AERT 5DK2A 2I07A 4QXWA 5E4IA 1NC4A 3L3IB 4OLZL 1VADA 1VFAB 5E00A 4E42A 2DMCA 3Q3GB 1G7JA 3KPRD 4EOWH 4PRDA 1QEWB 4ZFFA 1WSST 1EEQA 3L7FA 1CBVH 4FABL 2IG2L 5E2JA 1U3HC 4HHAB 3OX8B 5KSAD 1TQBB 2QHRL 3H9YA 4O00A 2AQ1A 3MRCA 4JHAL 2HVJB 5JW4N 1MJUH 1WTGT 4Z7VA 2UZIL 5J89A 4X8XA 4E0RA 3I9GL 5ILTH 4U1NA 3LMJL 1FCGA 2VLLA 2Y6SD 3RL2B 3V4UH 1Q94A 2QKIA 2P48B 5KOVC 2YUXA 2XACC 4LCIL 3U0TB 2MQ0A 4L4VA 2J6EL 1KJ3H 1MHPL 4WI7A 4GKZB 5DJ6B 3MNVA 3X17A 4WWKD 4MDIA 4O5LL 3VI4F 2XZAH 4RGMB 4WDIB 4M5YH 3O4LA 3RUGB 4ZXBC 3RBGA 4LLMB 2E3VA 4HCRA 1ZVYA 2UZYB 5BZDB 4KZDH 4I8DA 5HBBA 4PV9B 2VSDA 4FQCH 4QRPB 4TNVF 4LSRH 3K46A 2B4CC 4TNWK 2FLBT 1B3JA 2VJXA 1G9MC 4KUZH 5D7IA 2Y7QA 3ZDXF 1QA9A 4I9WD 2J88L 1K4CB 3IFLH 1UENA 3H7BA 5H37G 4L3AA 2X09A 1D5XA 3O11A 5JXED 1E4WL 3SE8L 3GMOB 3HI6L 3MV7B 5BMFL 3LMJH 3DBXB 4LCYA 3KPMB 5IG7B 4LGPB 2F5AH 4YDJA 3ZYIA 1YPZF 2EDYA 3KDMA 5EUKA 1FNGB 4F57H 3REWA 4NKOA 5GRYA 2IG2H 3IGAA 4KK6C 3PABA 4HKJB 3S98A 4XPHH 5GIRA 4ODWB 2W0FB 4MX7B 4ZOBA 5E0QA 4K7PL 4MMXC 3CSBA 1JP5A 1B0RA 4BH7B 3MLYL 2Z8RA 4LEOB 4FQXD 1IFHH 4OLZH 1CFVH 3ARDD 3DGCR 1S7XB 3UJIH 4NZDA 5EZIL 4YZFF 4HWEL 3VDAA 4WV1B 2A38A 4ZAKD 4NT6A 3L7FB 4L8BA 5JNYB 4X4XA 3ZKND 1TCMA 2YPLB 4S2SB 3N85L 1QYGH 5I1AB 4P0DA 5C0GB 1A3LL 3ECBB 3NGBB 5IVXE 1JMZA 4DKAA 4RFNB 5CIPA 2K1MA 1T1WA 2R15A 4GAYA 4OQTH 5TPWH 3CLEL 1EGJL 1IQDB 4CVWA 4WUUD 2H3NA 1J0ZA 3TZVC 1EAPA 1U9KA 1NCNA 2OQJA 3G04B 4L9DA 3S35H 1ZA3B 4QHNA 3RPIA 5IMKA 3PQYE 1KSRA 3G04A 2OSLB 5F44A 1XT5A 2EYRB 1DBJL 1AD0A 1A14H 3VI3F 4ZOEA 2VRAA 4J3VA 2DTSA 4M5ZH 4LLVA 3S6CA 4MQXD 3QSKB 4HBCL 4KK5D 3D9AH 3CCHB 5CJOH 5F9WC 4Z77B 4RMVA 1RIUH 2IEPA 4U1GB 5D1ZD 2ESVE 4IMKA 2ERJB 3EOAB 5IQ9A 3O6MH 1AFVL 4X7CC 5I18L 5HYSG 4L3CB 3P9WB 5J12C 2R29H 3UTSB 4X7SH 4X5WB 4M6NL 1I8LC 5H8DA 4XVJL 5SWSD 4Q9QH 3VFGH 2VC2L 4DAGL 3BXNB 5KVGL 2BY3A 1QSFB 1L6XA 1CG9B 4BFIA 1TMCB 1Q1JH 1W72A 1CGSL 1ES0B 4U2ZA 3ULVL 2XTJC 5JQHC 1XF3B 4QF1A 3MGAA 3TYGH 4NNPL 1DFBH 1S9WA 3O3EB 4GKSA 3BZEB 4OKDA 3C08H 1EPFA 2DIAA 2M26A 5F3HA 4WFHD 4I18A 5JZ7D 4N0YL 1NEZG 4HCRL 3TESA 3MLWL 1X5FA 3IVKA 3I3BA 1CLCA 1Q9LB 3OHXA 1JGLL 4L4TB 4HS6B 3BKYH 3BH8A 1ZHBB 5HDBE 5DD6B 5I1GL 2E9WA 3W9EA 4JFXB 2DI9A 2XZZA 4S0TD 1G6VK 3MLZH 3U46A 2Z8WC 3B9KC 1FE8H 5FHBL 3TBWA 3HUJE 2HFEA 4HEPG 4YUEH 3ARUA 4X6DA 4KXZH 3GMNB 3RGVD 2BSRA 4QRRB 5F6IB 4DFHA 3NFNA 3L5IA 2VLKA 5IF0A 4P3DA 2IQ9H 2CUIA 3CU7A 4YR6A 4KY1L 2F19H 1IAII 3PP3K 4FZEL 4Z78A 1Q72H 3T3PF 1IQDA 4LLUA 1D5IL 4LMQI 4CADB 5I1JH 2DS4A 1GZPB 1QLEL 3DGGA 3MRGB 2OX5A 5EUOE 1WCBB 3GRWL 5IV2B 5FECB 1GHFH 3OMZA 3QO1A 4O58H 3ARGC 3G5ZA 3QA3B 4DQOL 1EFQA 4ONHB 1AXSB 1A6WH 4IRJC 1FZMB 2DQTL 2MCG1 3ET9F 3D48R 3JWOH 4HJJH 3S88H 3C08L 2D4FA 1HILA 2AW2A 4HSQA 4TSCH 2GEEA 1CR9H 4XPTH 3TPUA 1R0AL 4MNHA 2J5LC 5ADPL 5FIEA 4HUUA 2HFFA 3VWJB 3GMNA 4LLUB 4HV8A 4ISVB 5B21A 2CLVB 3ARFB 5B8CC 1UWGL 5MP6H 5E08L 4Y5YA 4YR6B 1NGWB 4RIRA 5AYUH 3FQTA 5KN5A 3MBXL 3SJVD 5I1DB 4PJDB 1K8DA 3JV6A 5GRVL 4GS7C 4GMSL 3PP3H 5CZVL 3GIZH 1RZKH 1N6QL 3IT8D 2P5EB 3S9DB 3BMVA 4TVPH 1OP9A 15C8H 3SKOB 1QBAA 3HMXH 3ZTJH 3FFCB 4OF6A 1XGTB 3HNSL 5E6ZA 25C8H 3HTLX 4BK4A 4PJGA 4KUCF 5FDWB 4IIQA 1RZKC 1DBBL 4G5ZL 3ARZA 5TE6H 3TJEL 4JGMA 2FL5B 1WGOA 3LRSA 5TDNB 4UU9A 3MR9A 1HXYB 2JCCE 2X4NB 2YMXH 3L1OH 2BNQB 3DMMB 3R0MA 4HG4K 1SY6H 4J4PA 4Z7OF 4G42A 4ZFZA 3NMEA 1T66D 2BVOB 4GRWF 3F7VA 4G8GD 3RWJA 1DP0A 4AEFA 4U1JB 5D6CA 2XFXB 3MRBB 3LAFA 2A1WL 3OKNB 4XNXH 4PREB 2DICA 3MCLL 2FSEB 4G8GE 4LVNC 2DYPB 5JR1L 4NDMA 4C58B 5F1IB 1YN7A 1SJVA 4EXKA 2ZOKA 3CFJA 4P46A 2WZPD 3KLAA 3ARRA 5L88H 5I1HH 1YEJH 1QLRA 7FABL 3V95A 3EW3B 4LOUC 2HJFA 1S7TA 1ZWIA 3KLAB 5D1QC 4ZUWA 3MR9B 1VEOA 5JPNB 5C92A 3L5WB 2CLZB 3M45A 3GMLA 5HHVH 4WEBH 4IIQB 1CFVL 1KEML 4YDJB 1ZSDA 1KLGB 5AAWA 1FBIL 1FNEB 1MUJB 3GBLA 5T1LD 4EQ2A 3WNKA 4RWYL 5MERA 1S78D 1IEAB 5EBGA 4PB9L 3ZHKA 1JRHI 1TZIB 2A9MH 3ZLQC 1R24B 4XNYH 3AS0A 3B5HA 2XA8L 3BP5B 4UTBH 5HHQA 1VDGA 3FFCE 3GUTA 2BC4B 2VXTL 1B0GA 5IFHL 4MVBD 1BECA 3U4BL 2WV3A 3CVHL 4ERSH 5CKAA 1A9EB 1HHGA 1T5XA 4GUPB 5B8CB 3AMKA 3QRFM 4ZFOL 4LHUA 3LVEA 5ALCL 4UT9L 4GUPA 4TUKL 5EOTB 1E0OB 2DQIL 3SDXF 3C60D 3MLWH 5C0GA 1NGZB 3WIHL 3T0BA 1A5FH 5BVPH 3FT4A 4NC2B 5I1HL 4E41D 1SEBB 3V6OE 4MQTB 4R0LB 1BD2A 3FFCA 3DRQA 3VWKB 4LK4A 4Z7VB 1MHCB 1RK0A 4ORZC 4X99A 4QNPF 2W38A 4HXAL 1NGPL 2AJSL 3TT1L 2AEQL 5I74B 1BBDH 1S5IL 1BJMA 4V1DA 3T1WA 4H26A 1ND0A 5GGRA 2Z0BA 3G5XA 4I2XA 3DMMC 5DGRA 1MRCH 2GY7B 3WHE1 1WBXA 3ZKXB 4HWZB 4MCYB 4NYLA 3RI5F 2YA0A 2R2CA 2CQVA 5BW7A 3PDOB 1KB9J 4P4RB 3WDJA 4ZD3L 4LIQL 5B38B 1U41A 4MDJB 3VD9A 4MZ3A 4KVNL 3G6DL 4HDIB 3ZTNL 5C0BA 1MF2H 2A73A 4G7YH 5F1IA 3VGBA 3N9GH 1LO5A 4L4VE 2ESVA 4KJYA 4NOFA 3V6ZB 1Y6NR 2C4XA 3L3JA 1RZIA 5IQ7H 1RZ8A 1AIFA 3MYZA 4P5TC 5GHWH 5DZOA 1ORQB 1OTSD 2MFNA 1I1AB 4J23A 5DRNB 1CICB 1YNTA 3IETB 3PWPB 1RVFL 3QXAA 4Z7UF 4B41A 5I1LB 3ZTNH 4CVXA 4LARH 1ZLSH 1S5IH 2EEDA 4RZCB 2CKNA 1S9VB 2RJMA 4XC3H 1S5HA 3GMPB 3QG7H 4AL8L 5DT1H 1PSKH 1UXSA 1TQBC 5FO9A 3ROOB 1N7MH 4GKZA 4GRMB 8FABB 1UA6L 4XXDA 4G43B 5CD3B 1JI1A 4YHLH 4X0KA 3QNZB 1MFEH 1QFUL 2ESVD 2EDLA 2PN5A 3PV7A 5DJYA 5IEHA 1AR2A 3PWVA 3BH8B 4MJ2A 3NAAL 1OAUL 2R1YB 3JZ7A 2OXGA 1QLEH 3LB6D 4HUVB 1MFDH 1P69B 3TF7C 5F96L 3DRTB 1JE6A 3QH3B 1MH5B 4G6AD 5HYSB 5ISZA 4X5XA 2PW1A 3HNVL 4M8QB 2GSGA 5CGTA 1U3YA 3IKCB 4WY7L 1MJ7H 4GSDH 4JHZA 3UTTE 1MFCL 2DLIA 2G75A 2HLAB 1NFDB 5SWZE 8FABA 4MAYA 4XB8A 4WEMB 4WO4C 1NCBL 2A74B 1JK8B 4CAGA 3GMPA 5KW9L 3BQUA 3GSNA 1DEEA 3MRGA 5KZCB 1EAPB 1T1ZA 4ZSOE 5ICYA 1NJ9A 3P0GB 2C1PA 2ZPKH 5EIQA 5HHNA 3G08A 4Z6AT 4RNRB 2EE6A 4NCDA 4AENB 4U2YA 1J0JA 4ZFOB 3MV8A 2EYSB 1VKXA 4HIXH 2XTJE 5FUCE 1HHGB 1IGJB 4KV5F 3KPSB 3QDAA 5DJ0A 4C83A 5MEND 2LV4A 3TYGL 4ZODA 1CU4L 2ED8A 3FONA 4RISH 2X4RA 1T2JA 1M6OB 5E8NB 1RZIB 1U8MA 4TNVK 3GMQB 2C1OB 2ED7A 1HHIB 2DJ4A 4HPYL 3HZKB 5E8PA 4PJHE 5F72S 5J9PB 1GOHA 4FQHA 3LQAH 4O2FA 3W9DB 2XI9A 4HT1H 5CP7B 5FCUL 1OQOA 5JXAL 4ZOAA 1EUTA 4LGRB 4YHNA 3VFMA 4WW2B 1CD0A 5D1XC 5FFLA 1YMME 4HIIB 1S9XA 3H9ZA 5INDB 3TBTB 4LMQE 4P9HL 3A67L 4WUUE 3MREB 4NZTH 5CINL 3E3QE 3FL7A 4CNIB 1LE9A 4XCCL 4KQ3L 2GTWB 3MJ9A 4HWBA 1KN4H 1NCBH 1RZJL 2YPVL 3S8WA 4NYLB 3SDDD 3C5ZD 4Z8FH 4RFNC 1I9IL 1JYNA 3B8SA 1JWUA 4MQSB 4OLYH 5TE6L 1ZLUK 2FDBP 3ALXA 5IEHB 5HY9B 4MXWL 1BWMA 1GYAA 4N0UE 4NQCD 3UX9B 3F7VB 4JRYE 2XA3A 3LHPH 4G8GA 4PRIA 2X70B 4PYHA 3CPLA 3HMWL 2YPKA 4GXVL 5GGVY 5ID0B 2ZUTA 4P5MB 5AYQA 5SWQA 4JGUA 1UVQA 4PGCA 1UM5H 1S7WB 3HE7D 5LBSL 4XPAL 2P49B 1HDMA 4NNXB 3KHOA 3K8MA 1HWHB 2YN3A 4KJWD 3T1FB 4JFOB 3VFWA 3SDDA 2R9HD 5F9WB 1YEDB 2YZ1A 3BKML 4OCXL 2EC9T 1NANH 4FQ1L 2FECL 3LKQA 4R3SB 3KR3H 5EC1B 4XPTL 1B0RB 4BH7A 1S7UA 3QAZC 2EZ0D 3IAGC 4JFFE 5KVEL 1N5AA 3MFFA 5DK0B 3MGTB 5F6HI 3HCVB 3FOMA 2R2HA 4YHZL 4UB0L 3CPLB 4WFED 1HDMB 4NNXA 4KY1H 1FFQA 2HFGL 4Z7QE 4HS8L 1P4LA 2Z93A 4UI2A 1C1EL 3I75A 4NBXB 1CGVA 1D5XB 3O9WC 5D7SL 1EMTH 5BRZB 4XZUA 4UQ2A 4F9PA 4PJ9B 1M7DB 5ANMB 4MNHB 5F7EH 2YA1A 1R3HB 2VQ1B 2DBLL 4XZUB 3VFNB 1C16A 1CXLA 4Y16C 4PJ7A 2R0WL 3TBTA 1URLA 4S1RH 4DUVA 3DYOA 3D39E 2D03L 4XVSL 4KJQD 4NUGH 3TN0A 2BJML 3REWB 2BOBB 2FO4A 4PGZA 4E42B 2IWGA 5C2BL 3IXAA 5FUOL 4HXAH 3VGFA 3BISA 1HHKA 1PYWB 3MLRL 3CFEB 3PHOB 5DK0A 5ENWA 3S96B 1W0WB 1HCVA 5DD5L 2VISB 4XHQA 1YEFH 5F9OH 4Z7WF 3CFCL 3VFOA 5F7KC 2EDFA 5DUBA 2XNAB 4FMKA 4C4KT 3VFUA 2FR4A 1L0XA 2NXZB 4JDZA 4HS3B 4JFFB 3OB0K 2MTPA 1IC7H 4TOYL 4DGIL 2A77H 5F71A 4CMHC 2GJ6B 3IJHB 4G6JH 3RDTB 3FQTB 3CFJB 3WFHB 1U42A 3KXFB 2R4RH 5IMMB 4Q9BA 3RX7A 5BVJB 4PRHB 4YDVB 2R1YA 1ZKAA 1FL5A 5T3ZE 2XXCB 3BDBA 5I1GH 4TUOB 1H3PH 1T7ZA 1G9MH 4X9FA 4J4PC 3F12A 2VQUA 5T33H 3UJTL 3O2WH 3WFDL 5C0DA 3WUWA 3VCLB 2FZ3B 4QLRA 3B9VA 4HZAA 5E9DE 1R0AH 2V2XA 4NKMA 5CS7A 3C09B 4L8CB 5FYLD 4MJIE 1A7BA 1AGDA 4GRWH 3MRQA 4Z7NF 1P4BL 5LGJA 2DD8L 3ULUL 2J3SA 2QADB 1BD2E 3QUMA 4N8VA 1J8KA 4HK0A 2IPKB 4QRSA 2QR0A 4EN3B 3HG1E 1F2QA 4U6VL 3A6OA 5EU3B 5E2VH 3QDMA 1N2RB 3UROR 3MLYH 4U0QB 3MJ9H 2H45A 3G5YB 3ESVF 4QXTB 4CJ0A 2WWMC 5KBNC 4O58L 3QDMB 4V1DD 3BPOB 2NX5B 4LVNB 5DZLA 5IROC 1LP9B 4NKMB 1DUZB 3S3SA 5JZ7C 4DGIH 2VZ3A 5DD3H 2H6PA 4TOYH 1DQJA 3KXFE 3LKPB 1DR9A 1OGTB 3QYCA 1BD2D 1YY9D 2Q8AL 4KGJA 1KCRL 5F70A 1WC7A 5EBLB 3MYJA 3CDFA 4J3UA 3MLXH 1P5UA 1E28A 4KKAC 1ZHKA 3VRLF 3UBXA 3EJYC 5MENA 3CH8A 4WFGE 4KI5C 2FIKB 3VE0A 4ZFGL 2DWDA 3FFDB 5LKNA 1C5BH 4CMHB 1PKQB 4M1GH 2LE9A 4NN5C 3KXFA 4EI5C 5T1DH 1WEJH 5KTEL 4M8QA 4TSAL 3O9WA 4FQPA 3ULVE 3QWOA 4YHYB 4PJBE 3FMGL 4YHPA 2MKWA 35C8H 3GO1L 3SKMB 1L6ZA 2FX7H 1I8LA 5T1LA 3BO8B 3NFSL 1A6PA 3KDMB 1ITBB 1UCTA 3NCYS 1MEXL 1MAMH 4KK6D 5HHQB 4YDIL 5I1KH 3MLTB 3D3VE 1HOCA 4NWUH 1JWMA 4I77L 1U95A 1FFPB 3VI4E 3OAZH 5IW1B 3WFEL 5FO9B 4KMTL 5ICZB 4FP8H 4NWTL 1JYVA 1G9NH 1JGUL 5FA3A 1XF5A 2Z9TA 4MZ2A 2ENYA 4Q6IA 4YNYB 4GW5A 2V5SA 3V5DB 2VR5A 3WJJC 3WL9A 3BD3A 4GLRI 4KMQA 1MJJA 3NPZB 3VA6A 2VDNL 4PR5A 3GSNL 4P2RE 4UNVA 1IM3A 3PWNA 1R5IA 4Y8AA 4PS4L 4PJCA 1H3WM 4R90H 1ULVA 1KLUA 5HVGB 5CIPH 3LV3B 4LSQL 5FUCC 4J4PD 2XRAH 3HPJB 1XAUA 5TF1H 1JPSL 2ZUXA 5CJXC 4K2UL 5BV7H 1IZJA 2VN4A 3H3BC 4ODVH 2AJUL 3QXTA 5A1AA 2FATL 5MERB 4MD4A 3S37X 1CQYA 2I26N 4TRPL 3SDAC 4OD3L 3JUYA 3CXDL 2YPLE 1AKJD 1F6AB 4HPYH 5KSUA 4OQTL 3MRFB 1BFVL 4MA7L 4XCEB 3ZSTA 3Q6GL 5C6WH 2WMPA 2HT3D 3NFPA 2VUYA 3KPRA 3LEYH 2PO6B 3OKKB 4PG9A 5J0BA 4PREA 3THMH 5BJTB 3S36H 1A1MB 4FXKB 3QUML 4BFEA 2PCPB 4EI5B 5FUZH 5KVMC 5GRZA 3HZVA 5K59F 2D7OA 4LSQH 5F1NB 3SO3B 3T3ME 2PETA 4PLNC 5D7IB 4X4XB 4M48L 4RAUB 1FL3B 1RUQL 4Y4HA 4LHJB 1Y18A 4NZJA 1KLGA 1T03L 1YQ2A 5DJ8B 4N5EC 1MQKL 5C09E 2FYYA 5EH1A 4OKVA 3O9WD 5CSGA 5T3XD 3RY6C 3CDGB 5C7XL 2CDGB 2EDEA 1KBGH 3GSNB 4I3RL 3BP5A 4QTHA 4KK9C 2W65B 3QDHA 4OFIA 4R6UA 4UZGA 1K3IA 4KWUA 4ODWA 5CLWA 1JV5B 2IBZX 4RFEA 1DN0B 4PJEF 1ZXQA 1FN4B 2CSPA 4OGAD 3OAYH 5EOCH 2P8MB 1ZE3C 5JHLH 5EUKB 2AV7A 4RAVA 1F3RB 5I76A 3MUGA 3OB8A 1JPFB 2XZAL 3U0PA 4PJGF 5JA9A 1XFPA 2PW1B 2BRRH 5K9KB 3QXVA 4TULH 5IM7A 5FO7B 1I1FB 3WS6C 4MD5B 3RVTD 1MRFH 1MHPH 1J0YA 4NQEA 2KZ1B 5C86A 1Z2KA 3O8XA 4HIJB 4TVSa 2B5IC 1U8KB 2NY5C 3TZVA 5CHNB 3BRGC 5GGRY 4OGYL 1DBAH 1NCWH 4JFOA 3ZDYF 4KFZC 5CP3A 4PJ5B 2XFXA 3MRBA 4NQVA 1H0DB 4LFHG 2GJZA 4KTEH 5F88B 3HR5B 3KAAA 1Q9WA 2HRLA 5IV2A 4HJGB 4PPTA 1YEIL 5GGTL 4X0KB 3WKMH 3OKDB 2VLJB 2CLRB 2R8SL 2NPLX 4MA8L 1NDGA 3LY6A 1QLFB 5E2WH 1MFDL 3HI1B 4YGAB 3OKDA 4ELMA 4UB0H 3R8BB 3TPUB 1DQTA 5I6XB 3VWJC 4TTGA 3QUZD 3FRUB 1HE7A 1RZ8B 3IJYA 4OZGF 4PRIB 4PJAF 4O4YL 3UPRB 3P77B 4NZRL 1G0YR 2OXHA 1XZ0B 1F13A 5JIKA 3UJJL 4UBDC 3QQ3A 3I2CH 2VLLB 1BOGA 1G6RH 4QRSB 2RCSH 1F3JB 4FFVD 4TN9A 3MZTA 3O6LL 3RZCB 3NPSB 5AD0B 3LIZL 5A2LH 4ZS7L 4Z7WB 4M7KL 4JM4L 3BE1H 1V7NL 3MJ6A 3FN9A 1L7TH 1X5JA 3EYQC 1FZOB 4UAOC 4OQTA 2XWBA 1A2YB 4G6KH 3RVXD 1P4IL 2UWEE 3ILQD 4GW1B 2GHWB 3ARPA 1KN2H 4MJIA 3BUTA 2H6PB 4NHCH 4XNMA 2W9DL 3UTZB 1S7SB 1BGXL 1WF5A 3O6FC 4WI9A 2R8SH 1NGYA 1MLBA 1I3RA 1SQ2N 2WWMD 3GZKA 1WICA 1HSBB 2F53D 2AKRA 4O2CB 4Y16A 2RIKA 4PP1D 2OK0H 4ZUUB 1L4IA 5TQ2H 2FBJL 4RMRA 4JN2B 5M95B 5C0JA 4K7PX 3IJSB 3VFVA 3TT3L 1OGAA 3PWLB 3ZYJA 1JHKH 1VGEH 1XIWC 3C8KA 4G7YL 3RWGA 3FN0L 4FQXA 4KVNH 3T4YB 2X41A 4P2QE 1WIPA 1YEHH 5DJXA 1QQDB 4OUUA 2OQJB 3SDYL 1EJ6A 4GKNB 4PJ5A 4R4NC 4CUCA 4F80A 2VH5H 3QCVL 5DQ9A 2H9GA 1Z6JT 4LCWE 2UYLB 3A6BL 3O41B 3GJFK 3LCYA 3RKDD 5FGSA 1C5CH 4ZO6A 1FL5B 2P44B 2IMNA 4M7LH 4OZIF 4LSTL 3FQRA 5EBWA 2B1HH 3HS0A 4L4TA 4W4OC 3MV7E 1KIQA 4DGVH 5JHDE 4OLWL 5EFIA 3QIUA 4F8TA 3BH9B 4RDQG 4YBQD 5DHVA 43C9A 3DIFB 3FQNB 1P4LB 4KPHH 3LEVH 4YQXL 2NY7H 2P8LB 3CVHH 4ERSL 1R3IH 1QHOA 4I2XE 4FZ8H 1MI5B 2CPCA 4QT5B 3GMMA 4ZQKB 1BREA 1J0HA 1ZK9A 3S5LA 5DRXA 5IVZB 3U7WH 1UGNA 3TT3H 4MCZB 3B5GA 5FAAA 1FG9C 3BEVB 4YHML 5I30H 4OGZA 3R1GH 1UCBH 2PYEA 5HD8D 3RVWC 2E8YA 3RVTC 1CS6A 4XVTL 1D9KC 3BGMB 1S9KC 1IC4H 2P24A 2X4QB 3UZEA 1E27A 5E5UB 5AUMB 2FJFB 2CUMA 2WP3O 3BKCH 4RMTA 4PJ8D 3PQYD 5TF0A 5K33A 1IM9B 5GSVB 1G7QB 3VGAC 3WXWH 5L2KB 3HE7A 1I9RL 4ZSOA 1DQLH 2VE6A 4OIIH 1NFDF 5D7JC 5DVNA 3ZZ1A 1FAKT 1J05A 5HGDB 2FL5A 3LRSB 1YYML 3LKRB 3Q1SL 4R4BA 4YXHH 2XXMB 5IW1A 5K59E 1CT8B 1K4DB 2AGJH 2V9TA 2YBRB 4FMFA 2BHYA 1MUJA 2Q7NA 3H6JA 3QCTH 1A8JH 4HULB 4MLIA 4QGTA 4PJXE 2B0SH 2FEDD 1CFBA 1FO0L 2NXYD 3GK8H 4JFZL 4Q6YA 3FB6B 3FO9A 2YMXL 1GGBL 3IGAB 3ZE0F 3IDXH 5E8EA 2JB5L 1B6DA 5T3XE 3V0VB 1GHFL 4YAQA 1XGRA 5IEKA 1RU9L 2NY0C 4HF5L 1JYXA 1DN0A 1CICC 1LO2H 1N4XH 2IALB 4UUJA 1P84K 3CFBA 1DVFD 3RL2A 1XMWA 5I16A 3MUGB 5EC1A 4AIOA 1AXSA 3SQOL 1CVSC 1V3LA 3HS0B 3WXWL 4L4VB 4NFBA 4OZ4B 4JY4A 2GJJA 4A6YL 5IOPB 3AAZA 4B7LA 4ZFZB 1HHIA 4WWKC 5AYUL 1AO7B 5JW3H 1MCCA 4DVRH 1W0YT 1TZHA 2E8ZA 2J6EA 3DSNA 12E8L 2L7UA 1LGVA 4NFCA 1KN4L 4P23D 4CKVX 4Y1AB 1T7WA 4MA3A 3WFBL 3S3JA 4NQSA 4P2OD 4ZQKA 3QI9A 4P4KB 4NRXA 1NC4B 3L3IA 4MYWB 3OSKA 4XAKD 3FRPG 4TUJB 2CUHA 3PL6B 2ZP0T 4NQXA 3KYMA 2FX7L 3PGFL 5I71B 3QEHB 1T7YA 2YSSB 1ETZA 2R39A 1NPUA 1B0GB 3ZHDA 1NCAL 3MOQA 1NAMA 1ZT1B 1PX4A 1MPAL 1NCTA 4OFVA 3EFFB 5CEZE 3IDIB 4S1DD 1ACYL 2O5YL 5CHNA 2RAMA 4M4PA 4KRPC 5H2BA 1J1OL 2HT3C 2B4CL 1WWWX 2NXYC 2ZCLL 2VE6B 1VACA 3WXVH 5JXEA 3DLQR 4Y4KB 3P0YL 1FP5A 4KK8C 3MV8E 2AV1B 4P5KB 5LWYH 4PRPB 3LN4A 5HHMD 4U1SA 2X42A 1E6JH 5KSUB 4JQXC 1J8HA 1NCCH 3QISA 4Y19B 3ILPA 5D70L 3VWJA 1CXEA 2C3XA 4JN1H 1Q72L 2J2ZA 1EMTL 5CWSA 1EEUA 3FO0H 2FEEL 1GC1L 3VXRA 4YBLB 4M61A 1CIUA 3L3DB 1A47A 5EB9A 2B7DT 3NCJL 3QWRD 4OI7A 2LVEA 1XCTB 4DEPB 1PVHA 1U8MB 1P2CB 3AFLA 1C7SA 2GTZB 4KDTC 3IDGA 5D2NB 4K55A 1KCVH 3GM8A 3U4AA 5HVFB 4IM8A 4WWID 4I4WA 4BZ2H 3EYSH 5J13B 5E8PB 1IAKB 5IMMA 4WU7A 5E6YA 3IKCA 5AG8A 4YPGA 3QWQB 4JFHE 4PJ7F 2KDGA 1YNTB 1T3FA 1MPAH 4IRJA 1OAUH 4KRNA 3ZMRA 3CZJA 4N0YH 3UZQA 1OB1B 1CXHA 3SE9H 1U3HB 3RJQB 5CAYB 1NMCB 1YC8A 5MHSE 5F89A 3JVGA 3MNWB 1NUDA 3RIAK 1T0MB 2E7HA 3B8YA 1V3JA 5ICZA 2E9IA 1NLDH 1U3HA 4L3EB 4RNRA 2AXGB 1TJGH 4WO4D 3WLBA 4WHTA 3AS3A 3R06B 5JA8B 4XHJD 3O2WL 4JJ5A 3QZWA 5C07E 1KEGH 4NO5B 1PAMA 4W6YB 4PB0L 4HWEH 3RTQD 4UOW1 4NHUA 4K8RC 4PBWD 4KXZI 5T5FL 3FHQA 4UV4L 3ZTJG 4YX2L 5HSFA 1XF3A 1PKQA 1BPVA 4PY7A 1F6FB 2YSSA 1DZBA 1U93A 3ZKMC 3ULVC 3SGEH 4NO3A 3IJSA 3VFVB 1LP9F 4DN3L 5K9KA 2DQUL 1SMOA 2H26A 25C8L 5DDHA 1A7QL 4C4KO 1OAZH 1CLYH 2YD1A 2C5DC 4M1DL 1DEDA 2JKXA 2YD8A 4JFDD 4K7FA 4MA8H 4U4BA 2H26B 5EIIA 2PUQT 1MFBL 4OCRH 1MY7A 1G0XA 3BXNA 2FCBA 4OUUB 5LJYH 3QHFH 4KKNA 4A6YA 2NNAB 4YQXH 5HI5C 4Y4KC 4E41A 4NN6C 4Y7MA 3AAZB 3D87B 3ZKNC 4G43A 4NQEE 2PXYD 2VLKB 4JREC 3U7WL 1NUFA 5KS9F 4KZEH 1Z9SA 3QAZB 1J8HB 4ELME 3QI9C 1GL4B 4TULL 2B1HL 1AD0B 5DTFB 1JNLH 5TH2A 5JMRA 1X6LA 4HWBH 4UMGA 3CD4A 3P4OB 3QUXD 2VB5A 1QTYT 4OCSH 2FEEI 1QACA 3BZ4B 3QDGE 1I75A 2QQLL 3Q48A 4PTUA 5DHYB 5D4QA 4LPTA 5DD0H 3NIGE 3WS6A 1W2KT 3B2VL 1QD0A 3MUZ1 3S3PA 1F4WL 3VXNA 4FQJL 3TBWB 3O3BB 3O0RH 3EO1B 1IC5H 1MCPL 2Y4SA 1NBVH 1ZT4A 4PJ9C 1C12B 1F5WA 4RA0C 1VGKB 2GYSA 3RVXC 4G9FE 2JJUA 3MO1A 1ZLVK 3WUWB 5C08D 1MNUL 1T3FB 3BGAA 4ONFH 5EO0A 4M48H 1AE6L 1QFWM 1TXKA 1C1EH 2EECA 3AGVA 2CMRH 2EE2A 4O2EB 3UEZA 3U4BH 3QRGH 4JFHD 1JTTA 1VGEL 4PGBB 4QY8A 3QQ3B 3IDJB 4JM2F 3INUH 2HKHL 1KXVC 4N8CL 1A02N 3C5ZB 4YDLB 1A0QL 4PJFE 4Y19A 4YH6A 4G6MH 1RUML 5IESL 4X9BA 5JW5A 4KHTH 5J7CC 4HXBH 5BS0B 4H25B 3MJ8A 3HI1A 5TFSH 1JTPA 1CGSH 1U93B 3L3GA 1DQML 5I16B 3TO4D 5BQ7B 2J4WH 4H0HB 1SVZA 3CSGA 3MFFB 5FCSH 3FO9B 3FB6A 3R4DA 1OAYL 3BYYA 3BE1L 2F8XC 4V2CB 4AQOA 3QDGB 4N5UA 3SDYH 4Z5RB 3EUUA 1WZLA 4J3WA 5D6DC 5LAXA 5JW4M 2P45B 2ZSVA 3VGDA 5L6YH 1JZ3A 3FT2A 2CIIA 3KPSD 3UJIL 1KBGL 1HQRB 5HPOA 5C8JB 3BT2L 1AD9A 4XPFL 1F58L 1FPTL 2WBJB 4WI5A 4AIXA 5BZDA 3NFPB 4QKXB 4NM4H 4G9FB 3F7RA 4ODXB 2GCYA 4XC1L 4O51B 5E6ID 2IQAA 3DMMA 3IS1X 4UT7H 2G5BA 3B6SA 5H35B 2HJFB 3AREA 1FV1A 1RZJH 2YPVH 3N06B 4F7TB 4GT7A 4PY8J 1IARB 4M5ZL 4JVWA 4AMKH 3C09C 3T77A 4R9HA 3D0VB 4YFLF 4G8FB 1AGFB 2OR8A 4NWUL 3O3DA 3QUMH 1F97A 1I85C 1KCUL 1P4IH 3ARDA 4NCC2 1IEAA 4F2MB 3IF1A 4W4OA 4JG0L 1J1XL 4GMTH 4Z7UA 2PTTB 4P2OC 5E4EB 2YUZA 2XKSA 1N26A 5CJQL 1T66C 5DD5H 4ZUVA 3I02A 2P47B 4MCZA 3GO1H 1T7XA 1EO5A 2X4UA 5IMOA 4ZTOL 1JVKA 4OBRA 4MJIB 3TO2B 4Y2DC 1BIIA 3M1BA 4LU5L 3WO3B 1QBMH 1XGYH 2EH8H 3BDXA 2HG5A 4IHOB 5DMKA 4NN7C 3C5ZC 2Q86B 1UACL 3PWNB 3LSOB 1S9YB 4G9DA 3G6AA 2AJUH 2VLKD 5JIHA 4LPWA 2D03H 4XVSH 5SX5H 1RIHL 3F8UB 4JFEE 5B3NA 3NIFF 5D72H 5HHOA 3MRLB 1G7LA 4NO2B 4U1GC 4XPHL 4J3SA 4APQB 4RRPA 3G6JF 4NC1E 2XOTA 2D0GA 5E8NA 4H88H 1KCKA 2NY2B 2ZPKL 1MAJA 1IFHL 2CIKB 5ALCH 2C3VB 3L7EA 3QDME 3AS2A 3EO1A 1NSNH 2RFXA 2AEPH 3TJHD 2VDNH 1BJ1J 1T20B 4JHAH 4ELKB 1RUAL 3IU4L 3MNZA 5JHDD 5CZXC 1UM6H 2DQFA 3MO1B 4X4YB 5HYIA 3TN0B 2J5LB 5TDOB 3H3KA 5F3BB 2DQFB 2OBGA 4FNLL 2ICEB 1I85A 3U7YL 5FHBH 3ARFC 1NFKA 3MGOA 1IRAY 5BZWB 3OXRB 4HH9A 4LU5H 4LF3B 1IQWH 4WTZA 2QTEA 1CTOA 5I73B 5T5FH 1BMGA 3T0EC 1MCHA 4OM0H 1I1YB 2DQHH 2KPNA 1MLBB 2BNRE 3FQNA 4ZNCD 1RUKH 4EUPB 3RVVD 5EU4A 1CDHA 1UB5B 2CGRH 4R8WL 2W0LA 2NY5H 1FDLL 2J6EH 1K6QH 1YJDC 5EU4B 5D1QD 5T1DL 4XVUD 1Y0LB 4ZPVB 5IF0B 2YKLH 2IAMC 1NBYA 5IROA 1FNLA 2GT9B 5CCKH 5KG9B 4PY7B 2DMBA 5GSRA 4YXKL 5MHSD 1J5OH 1TJHH 1NLBL 4UIMB 2O61A 4QRQB 5E8OB 2A6IB 2ZKHL 2W60A 5D8JH 2X4OA 5CSZA 3GSNH 3ULVF 5BV7L 3ARGB 1Q9OA 4OLYL 1IJ9A 5A2IH 2VR9A 3O8XC 3VXPB 1KCRH 1D5ZA 2LQRA 3SKMA 3I6GB 3PWPA 4FFZL 4GAFB 3KLHD 4I18B 5E24E 4WI8A 2E6JA 1BQLL 4KVCL 3UYRH 1FJ1A 5L0QC 3EYQD 1BFOB 3P73B 1RK1B 4WNQB 1SY6A 5HHMB 3OHXB 4I48A 4PRPD 4PJGE 5KVDH 4XH2A 2N7AA 4LQFL 3ARBD 4OF7A 3VJ6B 1N6QH 4ZD3H 4D8PB 1MNUH 4M62L 1I9EA 1T80A 2I5YH 2B2XH 2KH2B 4GH7B 4HD9A 4K71C 1NEUA 1WITA 4LLDA 4RBPK 4CU7A 2WAHA 1CQKA 3GDBA 1NBYB 3D39A 4YHKH 2XWJB 1RPQA 5J3HC 1VFBA 2BOCA 1BQSA 1LMKA 4PJ8C 2XN9D 1ORSA 2AJSH 2AP2A 5B38G 1KENL 4JZJC 2D31A 1YN6B 3CVIH 3GBNL 1BF2A 1UYWL 5GIRB 3EJZC 4TRPH 1FFOB 4WU5A 1IGMH 1QP1A 3KPTA 1SJEB 2CGRL 1LD9A 4R8WH 3AU1B 2DYPD 4LASH 4U1KB 3LN9A 1LO3L 4N1HB 1P1ZA 2EKJA 2XQYK 1DQMH 5EULV 5I73C 4J8RB 2IAMD 4NT6B 2F58H 3SGEI 1PLGL 1DANT 2BVQB 1VFBB 1ZT7A 4U1MB 3L3GB 1SEBA 1V3MA 3RKDC 3QRGL 4XB7A 3HRPA 4N0CD 1OB1A 1AO7D 3H9SB 4PRNB 1QBBA 4X7TB 3MROB 1U8QA 2BVOA 3N1FC 4R0LC 5DURD 1MFBH 4OCRL 1PY4A 2J12B 2F19L 2FJHB 1JBJA 4RZCA 5MI0C 1LNUA 3BHBB 4KRPB 1OW0A 3EYFA 4FTVB 5T1MA 3CSPA 4ZMAT 3MLUL 1OP3H 3NH7L 4GBXA 4I77H 5EZOL 1GGCH 4C56D 1Z9MA 4YDIH 4ACPA 3RUGF 1HSAB 2J8UB 3O4OB 3SEPA 1LO2L 1N4XL 2DKUA 3ZKXC 3TCLA 4R97C 4IRSA 3DVNB 4X4ZA 5FA3B 1LO4H 2V7HA 3CK0L 2X4OB 3ARXA 4TNWF 1MIMH 2IC2A 5E7BA 3HI5H 1NCAH 2OL3H 4X7TA 5CZXD 3O8XB 2H32H 4K3EL 3QDJE 1BHGA 2X89D 5GS3A 3VW3H 1S7QB 2GUOB 1XCQA 2JJWA 3ZYOA 2AK4D 5HDQL 4OCSL 3L3KB 2Y5EA 2ZUYA 3MRCB 4R26L 2GTWA 3CMOL 4R7DB 5J13C 2YC1B 1I3UA 4FXGB 2JELH 2W0FA 1UVQB 4MX7A 1JNNL 4OZIA 4NRYA 4XBPA 1H15A 5EBMA 4EUPG 3B9KA 4K71B 1T22A 4PRHE 4HUWA 4OFYA 4PJEE 3KJ6H 2PW2A 4PJ8B 2ZOLB 5I15H 2P4AB 1HKFA 3WCYA 3VE0B 5DJ6A 4KV5E 3VXMB 1S7XA 5F8RC 1GXEA 1A7NL 2Q8BL 2OR9L 1ONQA 3X11A 3H9SE 3QEHA 1MREH 1MCKA 2MPAL 2NTSP 4K23H 3VXMA 3LV3A 2YUVA 3MRDA 1J9CT 4R0LA 3UTPD 1G7IA 5F7HA 4PJHF 1BVLB 2QHRH 4PV9A 4D0CB 4PB0H 4FQIH 3ZKQD 1PJ9A 2AK1L 4X4ME 3LQZB 1HIMH 5LWYL 2EYTA 4X6BB 2EDXA 1I1RA 4ZUSA 4P3WA 1UWGH 2YR3A 2C3WA 5IOPA 5FYLH 1Z0MA 3MV9B 3MROA 5GZND 4NQVB 3CMOH 5DS8A 3Q6FA 1P4BH 1T6WA 4HUWB 2AXFB 5DJDA 2OLDA 2DQDL 3AB0C 1NC2B 2NW2A 5GGQL 2XKNA 5CZKA 3STLB 1S7SA 4FFWC 5BJTA 4D0DA 2GITA 1I3GL 5FV2A 5EU5B 5HTSA 4F58L 3H42L 4RCAA 4EVNA 5HGHB 1SJHA 2Z31B 1ZVHA 4RSVA 4NUJB 3LEXB 4WDIA 3I6KB 1I1AC 2Y06H 3MCKB 1X5HA 1LK2B 2UWEB 3DXAA 2ATPA 1ZHLA 3SDDC 3T2OA 5EU7C 4YPGB 5HHXH 1QR4A 4O2FB 3W9DA 1TETL 5E5MA 1F4XL 3V6FA 3DO7A 3K0WA 1AP2A 3U9PL 4YPJA 2FNBA 1IGIL 4X6FA 5IB1A 5AEAA 4P2QD 3WHE0 3OKNA 1A6AB 4YUEL 3SDCB 3MRIB 3ROOA 1J18A 1F8TL 2ICWJ 4U3CA 4UIKH 3LS4L 5JQ6L 1U0QA 3D5OF 3FZUC 4O9HH 2X7LA 2NY7L 1D6EA 2IPUK 2GAZA 1EO8H 2VDRL 3DROA 3W0WA 3HI6H 3IDYC 5A2JH 4YNYA 1O7SA 4NSKB 3S97C 5DHXB 2FWOA 2R1WA 4PLJD 3BH9A 1JFQL 1KELL 1MJ7L 1VEMA 4P2QB 5T1MB 1UXWA 3KPLB 3BYTA 3KLDA 3VXNB 5IB3B 2G9HB 3QHZL 1C5CL 4NUJA 4UT6H 4X7DC 3DUSA 4LBEA 3MJ7B 3WS3B 1HXMA 4EI5A 3VDBA 5AZEH 1JHLH 2VITA 3F7PC 2QV2A 3LIZH 2OI9B 2VH5L 4OLWH 5J1AB 4JN2A 4UILH 5HHPB 1JGEA 1DL7L 1BAFL 3EOTL 5CBAB 5FM5O 3B43A 3D3VD 5FOBB 4OIBA 2EIBA 5DFWH 3V52H 1OT1A 3LKNA 2A74A 4ODHL 1PW3A 2Z31D 3EO9L 1YDPB 3OKLA 1WZKA 1IAIM 3IDMB 5SV4A 2ZG2A 4KZEL 3FO2B 4M62H 3PWLA 3KYOB 1AGDB 2FIKA 1MI5E 1ORSB 3W0WB 3UTSA 2ADFH 2ATKA 1TLKA 5C0CB 3VH8A 4KVCH 5CUSL 3MLPA 4MXQD 3U79A 1RZGA 3H2WA 2C26A 3CX5J 4EUPA 3FONB 1RY7B 4HX1B 3UTZA 4L8BB 4IBLT 2I24N 3FRUA 1MCEA 1EFXB 5KSBA 4P9HH 3EO0B 2FB4L 5DVLA 3LEXA 3GB7A 1QSFE 2EDKA 3BAEL 3QUYA 5CFHA 1A64A 2WWKT 5E2TH 1NUNB 5GPRA 1MWAB 3MLSL 5I66A 4IOSD 2WBJC 4X6DB 4NHCL 2P43B 2FX9H 2VZSA 1EGJH 5GGSY 5J06A 3V4VL 2AV1A 5GRWA 4OZFG 2E7LA 2ADIA 2Q20A 4YHLL 2YD7A 3VXMD 1A6AA 1I8MA 4QXTA 3SDCC 3LDBC 5GRJH 3TIEB 3VD7A 3HPLA 2X1QA 1FFNA 4ODHH 4N68A 3UAJD 1QKZH 3JV6B 1TJIL 3C8DA 3S35X 2DM7A 4U6TA 1LHZA 4P59L 2HWZL 5IFAL 1FGNL 3TNMA 1V7ML 1LO0L 4FXLA 4GW4A 3WSQL 3HZYA 4WWKB 3BPNB 4MNQD 2AK4B 1JGVL 2QSTA 3W11C 5HGDA 2HAZA 5DRNA 1YQVH 1H5BC 1K3ZA 2Z31A 4LEXH 4JAMB 2IPUG 3P4NB 5DWUH 5IQ7L 2A83B 2OJZH 4JM2D 4F8QA 1PEZA 1KCSL 2F54E 5D2LB 1B6UA 5C0AE 5ACZA 1YN7B 1QFWI 4HIEA 2WUCL 4WI3A 3VXOB 2IANE 3QJHA 3ZE0E 4AZ8A 3TWCL 5IW6B 4EI5D 2H1PL 2R23A 2W1NA 2EDTA 4H88L 3RDTA 1BQUA 4GAJH 2XA8H 1MAKA 5DSCB 5F3BA 3GMLB 5KJRH 1U36A 2I60L 4OF3A 5DUPH 1XEDA 3MRPA 1BVKA 4XCYB 1LP9A 5H94A 3BW9A 5INCA 1TTUA 3HNTH 1XGYL 2EH8L 1X9QA 3MC0A 3H9SD 3OX8A 2BY1A 3HZVB 1MRFL 5H35A 4EIGB 1SJXA 4G3YL 4TPRL 4D3CH 4PJDE 3OGCA 1IAMA 4P59H 2I25N 2DLHA 1JWSB 2Y23A 4XVJH 5C0AA 1HXMB 3FN0H 2IAMA 1WLHA 2BERA 3WNLA 3HC0B 1OSZB 3DXAD 3NIDE 4XXCC 1EHNA 1TFHA 1ZGLA 1L9NA 1TVHB 2ICWA 1RIVL 1KYOK 3V0WH 2V2XB 2X1WL 3VFTB 4JPKH 2CJUL 4KJPD 5HYEA 1JRHH 4DKFL 2EKSB 1R3JA 5K9JL 4JO3H 3P11H 5K9QG 1FC1A 3L6FA 4GRLD 4EDWL 4OD2A 4B5EA 3QXUA 1LEGA 2SEBB 3H8NA 4WV1A 2NW3A 1LEKB 5C0AB 4AM0B 1WJ3A 2EO1A 5C0RL 4X7EC 3D85A 2HKFH 2JIXB 2PXYA 4LPXA 5E94B 5FYKD 1XGRB 5IEKB 1N8ZA 4MVBC 1TJHL 4U1KA 1CLZH 4R7DA 2AKRB 1I7ZA 2HA1A 4PRPA 3DHMA 3FB5A 1FLRL 2IFFL 5EBMB 1KG0A 3QQ9D 4NZUL 1AXTL 3S5LB 1KTLA 2L0DA 4MB3A 2A83A 5CJ5A 1UZ6E 4NRZB 1Z3GH 3Q5YA 4JRYD 1LNUB 2VDOL 3C5SB 3SGJA 3MREA 5IVOA 1CIDA 1HXYA 2X4NA 3VW3L 5HI3C 2PCPA 5IW6A 4DZ8A 4L4TE 5FO8B 5B39B 1I4FA 3QDJA 3KPOA 4MJ6B 2BDNH 3ZO0A 4L3EE 5J4MA 3TFKD 1VCAA 3I50L 3AMLA 1GH7A 2Z92B 2APXA 1G9EA 2E6PA 1QG3A 4OFYD 1IGJA 1FFNB 1UXWB 3KPLA 3TCLB 1X7QA 2UZXB 1CL7I 4HZLB 5GGSB 3D25A 8CGTA 4Y2DD 3VJ6A 5CILH 4P57B 1I1AA 1S5HB 3PHQB 2W0PA 2D7PA 4R90L 2FJGB 4HWUA 4YHYC 1MCSA 5EN2A 1KPVB 1P7KA 1T6VN 1JPTH 1I8KB 5IFHH 5DEZA 5HGGS 1E4WH 2OTUB 3LKSB 1MHHB 1MAML 2M2DA 1X5AA 3D0LA 1TVBB 2CKBL 4QHMA 4LRIA 5DR5L 5I9QC 5GS0C 1KC5L 5C0BB 5JOEA 1FIGH 3SE4A 1Q0XH 2GJZB 5GJTH 5MP6L 5E08H 4OT1H 5BXFA 3B9KB 1N0LA 4S1QL 3QNYB 2X44D 2NR6D 1VADB 1VFAA 2BNRD 5HGBB 2ZUWA 5SWZA 4HMCA 5MEQB 1I7TA 3HCVA 4DOHB 2JJSA 4XRCB 2XN9B 2IFGA 4DK3A 3DBXA 4QTIH 4KDWA 4DGVL 1DVFC 1CLOL 1EFXA 5C7XH 3O11B 4APQD 3JTSB 3DX6B 5HYQA 3BRDA 4G80B 1AXIB 4IRZL 4R97B 3IJYB 3EFDH 2FH6A 4P3DB 4MNQA 3ARBB 5EIIB 5IVNA 5HHOD 2BFVL 4PJFA 4U6XB 1IKNC 2DAVA 3RVWD 5HD8C 4M93B 5C0CA 1T4KB 4FG6C 3GGWA 4F33B 5I1JL 2E9JA 2J8HA 2EYSA 3W39B 1DJSA 2FWOB 2R1WB 2ZUQB 2ADIB 1SY6L 4KDVA 3ARGD 3K4DA 4QF1B 2OL3B 4HKZB 2Y72A 3TO4C 2HJKA 2YD9A 2GJ6D 4ONHA 4JJ5B 3JTSA 3F7YB 1UQSB 5M7QA 1MCOH 2P1YA 4JRYA 4FQLH 4S10A 2HVKB 5FYJL 1DLHB 5MEOA 2DQCH 5IP4A 4F3FB 4HKBA 4JDVA 5E70A 5HYQB 2DM3A 2N7BA 4ONGH 3VFPA 2JB5H 1B2WL 4X6FB 1INDL 2AABL 5IBUB 4PIRF 2ED9A 2YEZA 3NCBB 1EVTC 3EFDL 5DDHB 2EDBA 1U8KA 4NKOB 5F1OB 1A2YA 4Z9KB 4HLJA 4W81A 3SO3C 3CFDB 4N0FB 4YFEA 5IBUG 2VERN 1RHHB 4X6CB 1MCNA 4Z76A 4OGXL 3GSVA 3O2VL 3WNPA 4RFEB 3ARTA 5E1HB 1FYHB 2ICEA 2AQ3A 2PR4L 5B4MC 5ICXB 1QO3B 3RQ3A 4ODVL 2X4PA 2ZWLT 2W92A 4XXDB 1L0QA 4HEME 5IQ9B 2XQBH 3GRWA 2OL3L 3GSOB 2EH7L 2HKHH 1CICA 2YK1L 5ENWB 3EFFA 5DJ0B 1LILA 4C83B 1JHTA 3IYLW 4WVRA 3MLXL 1FVDB 3T04D 3VCLA 4ZUTB 4QRPE 4JQXA 3D69A 3PP4H 3TV3H 2Z31C 3LS5H 5MEPB 4YE4H 5I8EB 5GXBB 5IB1B 4HUXA 3QPXL 1R3LA 3KJ6L 5J11B 1CFQB 3MZGB 3HR5A 2CO6B 4OCYL 5DC0A 2NY4C 1IGYB 5IB5B 2PW2B 4PJ8A 4KUZL 5D1ZC 4ZOCA 4OSUL 3SBWA 4G6FD 4F7EB 5IVXA 3V8OA 1A1MA 3L6FB 2QL1A 1U58A 5ETUB 1C08B 1FDLH 1DCLA 5ISZB 4OGXH 4M1CD 2PTUA 5FOJA 2DMKA 1M1SA 4XMKH 3QXDA 4GG6E 3MRRB 1JZ2A 2WQRA 4FFYH 1RIHH 3VI3E 3OPZL 3HE6A 4D0CA 4HGWA 4L1HA 5I19L 3GNML 2WINA 4AG4L 1EA9C 2OR7A 5I1IL 3VXOA 4DUXA 5FHAL 3T77B 1T21A 3U0TA 4OKVB 4XPBL 3QPQD 2VOTA 5DO2D 3VXUA 1EIBA 1QBLH 4OM1H 1EV2E 4R7NA 4X8JA 4X9GA 3IDNB 4AMKL 1YNLH 4QTHB 4JFEA 1KJ3L 3GMRA 1KB5H 2HH0L 3QPXH 1AFVH 1G7HB 1FL6A 2A2QT 4MSWA 3QEGH 4OV5A 1G7HA 2L7JA 1NSNL 4HAGA 5J57B 1KIPB 5ILTL 4UV7L 3S34H 3KPNB 3RVVC 1L0YA 2IQAB 3D9AL 1JN6B 2H2PD 2Y07L 3G6JE 4M7LT 3SKOA 2F58L 2CR6A 4G8EB 1T21B 2DBJA 1A22B 1ZAGA 4K3DH 3TC9A 4QCIA 4RGNB 4K8RH 3BD4A 1S7RA 5F9AC 1ZT4B 4X9HA 4NM4L 4XC1H 5B39G 4R7NB 4X8JB 3VRJA 1FNAA 5E99H 1CDYA 3J7HA 2MQCA 3BEVA 4ZNEA 3TZVB 4D9LH 1UACH 4N8PA 3THML 2NY5L 4ISVA 1MI5A 3BN3B 1LDPL 4ODTL 3U30C 5CCKL 2ZJSL 1KTDA 2P8PA 2IH1B 4JY6A 5DXWA 3S5LG 4CNIA 3BRFA 3U9UB 5F97E 3BKMH 4FRWA 2I9LA 1NGWA 1NFIA 4DVBA 4YXHL 4GG6B 4GXVH 1G7JB 2Y6SC 2EC8A 2IPTL 3L5HA 2VLRD 1VEPA 1K6QL 2FSEA 3RFZC 1FIEA 1H3UA 3OKMB 3PF2A 4N9GB 1N5YH 3V0AC 4U31A 1X5XA 4XPAH 2NY4B 5KSBE 4GJTB 2ZOKB 5E94A 1IGFL 1NFDE 1Q0XL 2YD6A 5GJTL 1WZ1H 1U3HD 5CBEB 4X6CF 2AJZA 1P9MC 3PHSA 1PZ5B 1ED3A 1HQ4A 3KPQB 4HBQA 5C0DB 5CJ8A 2AK4A 4YXLH 3V4PL 4WHCA 4ZSOB 4IMLB 3V5KB 3MXWH 3AXLB 4OB5L 5J12B 1BX2A 2X89A 1W8OA 3L5JA 2D0HA 4H5SA 1F90H 1J8HE 3RZCC 5ADOH 5DHVB 1BEYH 3EHBD 4XX1E 4Z8FL 3SY0B 2XTJB 3WN5B 1N59B 5GS0L 4IRZH 2V9RA 3U36B 2F5AL 4PUBL 3UC0L 2ZCLH 3U46B 4AEIH 5JLZA 4LHUG 4KUCD 2J88H 4OF5A 3ETBF 4MD0B 4G7VH 3CLEH 5JOPE 1QSEE 3RHWK 2XICA 2VKXA 4NHUB 4RIRB 5AUMA 4G6FB 2X5PA 3QUXB 5CEYA 4Y19D 1T7VA 3VXRD 4KI5D 5H2BB 3X3GL 4N0RA 2QQLH 4I0PD 3T0AA 5DGQA 1J8HD 3L3OA 2H2PC 4LKCB 4PJIA 1CD1A 4PJAB 1QOKA 1RD6A 1BVKB 4CN1A 3O0RL 4L1DA 4I48B 3ARQA 3PGDA 1HKLL 1I8IB 4JJHA 2R0WH 4FQJH 5M94B 1GVIA 3EO0A 5JPMB 3J8F7 2G75B 2HLAA 1N59A 1WEJL 3MTRA 4WEUD 4K94H 5GS1B 3BPLC 1TTFA 2QSVA 2BK8A 1CICD 1KXTB 4HWBL 3CU1A 4NQED 2DYPA 2ZSWB 4L8SA 3UP1A 1J0KA 2H2SC 4ZTPL 2GTZA 5FKAB 5D2LF 3UXFA 3V7MA 4IDJL 2AEIT 4POYA 4LCWA 3INUL 1NCDH 2PYEE 2X6MA 3SGKC 2BOCB 2H1PH 4MA1C 1CBVL 2HJLA 43CAA 1JPTL 2UYLA 4EOWL 4BH8A 1DTUA 4NP4H 5T3XH 1PQZB 4Y1AD 3RTQB 5K9OA 3DWTA 4FTVE 3QULB 4JHWL 2NZIA 5FYJD 4O51A 3PGDB 5DJ2A 3REVB 1ITCA 1T0MA 3EJYD 4P57A 3AM8C 5BV7C 1WCQA 4XWOD 1AY1H 3RJDA 3F7QA 1X7QB 4FQCL 4JLRB 3WMSA 2LABA 4X6CA 5DD0L 1DSFL 3VG0L 4U7SA 1OAYH 3DO7B 3MA9L 3JWDL 1NGQH 2G5RA 2HN7B 1OQXA 3RIAF 1ZLSL 1YYMH 4JEGB 2JB6B 4X98B 2EDNA 3LRHA 2VQTA 1NBZB 5TE4L 3ZKMD 3C6SB 1N7ML 4XCNA 5JW4Q 4LL9A 1KT2A 3MCG1 3QFDA 3IDGB 5D2NA 1G7IB 4HMEA 3U9UA 4JPIB 5DSCA 2CXGA 5HGBA 1DLHA 1GGYA 1QFOA 3BGFC 5CP3H 2O5ZH 3RPKA 3VH8G 1NUGA 2ZG3A 3PIQA 1IBGH 2HT2C 3OXRA 4HH9B 1AIFB 4UT9H 1OHQA 5IK3B 2DQGH 3GSWA 2OCFD 3K81A 1RFDL 3P30H 1OAZL 1X5GA 4LP5A 3FQXA 3MXVH 3QUKA 4XCCH 3FOLB 4UINH 5CD5D 2CRMA 1F8TH 2YHGA 3ULUD 5EPMB 5DS8B 1KCVL 1XZ0A 3HE6B 4PJEA 1YNKL 2AXJA 1PKQE 1RK0B 3QXAB 2WUBH 1CGYA 4QNPE 1GJIA 5GZOC 3F65A 5DA0B 1UB6B 5EN2B 1Z0NA 2Z91A 4OLVH 3P9LA 1BM3H 1HH6B 5GGRB 3VFRA 1WFNA 1BZ9B 1NBZA 2YC1A 5HGHA 4XMPL 4IRSD 4JFEB 3L3JB 3OB0H 3OKYA 1U3JA 1CXFA 1R5VA 3MV9E 3QWRA 4PBVC 3DJ9A 1G7MA 3HC3H 3MRNB 2W91A 3T2PA 1G9NC 1ZTXH 3GIVB 3RVUD 3PGFH 2P7TB 3W2DL 1GZQB 4ZUTA 4F7TA 4NPYA 5IR1A 1DLFL 4KH2A 4F15C 4EDXB 4JHBA 1M71B 4FQQA 1JZ8A 1J05B 4KHTL 5BQ7A 4EI6B 4M3KB 1NQBA 3MMEA 4S1RL 4MA3B 3FQWA 2WUBL 2OTUA 3O4LB 3L5XH 2WSKA 3LKOB 4Z7VE 3MLVH 2AK1H 1DVFB 4XBEL 4OFDA 3TWCH 3LS4H 3TV3L 3QFJB 2Q3ZA 4WJ5A 4JN1L 4P46B 1FNSH 4X6EB 4YFDB 4Q6IC 1JV5A 3EYOA 1QO3A 1OD9A 3QCUH 1S7VB 2NXZC 2QSQA 3RU8L 1YEGH 5DJCB 4BJLA 3HHRB 1S7QA 2GUOA 3BGFB 2NXYB 1SJHB 3W82A 2EIEA 4HIHB 4ZO9A 4PJCF 5IFJA 1MSPA 1R3KA 1MRDH 1EEYB 1IM3B 1FAIH 2R2EA 3CX2A 4RAUA 4Y4HB 4X5XB 4HIIA 1OF2B 5JDSA 4K9EH 1F3DJ 2BVUA 2LU3A 4URTB 3BEWB 5I8EA 3O3AA 1RZJC 3OXSA 3K80A 2NYYD 4U1HA 1LEIB 1K8DB 1GGBH 4GW5B 4KROD 1ROWA 1S7WA 3M8OL 3T0EA 1K8IA 2BXYA 1KG0B 1YYLH 3P0VH 3P9LB 3C6LD 5HI4C 2NX5E 2V17H 1E4XI 5TH2B 3T1FA 3VFWB 5HVHC 4XXCA 3WIFA 2FB4H 1Z5LA 4GKNA 4WW1B 4YO0A 4TQEL 1C7TA 1N3NA 3VXUD 1GRWA 1UXSB 4EBQL 4OCLC 5J8OA 4ALAL 4GKSB 5GSVA 2EEBA 4WI6A 3S37L 3RY6A 4JREB 5HI3D 1OCWH 4J1UA 1IC4L 1AGEB 2E27L 3EYUH 5C0CE 1BWWA 1U8JB 3MJ8B 1U8PA 4F7CA 4DN3H 1EO7A 4DFIA 2BP3A 3QUZB 4TVPE 3BIKA 3RWFA 3TO4A 2CRYA 4YX2H 2BVQA 1FORH 1HHHA 1QR1A 1IGCH 3A6CH 2BY2A 2CDEA 4JPVL 2ILLA 1BBDL 4XVTH 4GBXC 4U1SB 2H41A 1A6VL 2VR4A 3WO4C 2FD6L 3RZCA 4RGOL 4N9OB 4UILL 4X6DE 3W0WD 3RWDB 1S9XB 2VAAA 4ODSL 1MCWW 1TNMA 3P0YH 5JXAH 1MJJB 4LCCB 3G5YA 3EKCA 5BVPL 1J1PL 4ZDHA 1ZGLP 2OSLA 2XG5A 1F00I 2N4IA 5SWSB 3DUSB 3OZ9H 1NGYB 1BFOA 2R0LL 4JM2A 3UPRA 3FJTA 1TIUA 5J1AA 4X7SL 4JPWL 5A3ID 2DL9A 3E0GA 5D1ZB 1XGUA 4JM2B 2Y36H 3MJ7A 4NN5B 5EZJA 3WS3A 1SBSL 4OBSA 3RWCB 5EWIL 5JLZB 4MJ4A 4P5MA 5ITFB 2R9HC 5A40E 1F4AA 4EJ1C 3LS5L 1GC1H 2E7BA 1DBBH 1K2DB 4G5ZH 3OV6A 4JO2H 3EDJA 3ZDZF 1V8HA 3MLUH 5EC2B 3K2UL 5DMYA 4FQ2L 3BIAX 2AXGA 1CDCA 2GT9A 1T4KA 5F9JA 5C0FB 3F6IA 4GW1A 4ZO7A 4JFQB 2V9QA 1GZPA 4G9DB 5D9SA 4LRIC 3MRKA 2GKIA 3SDCD 4XCFH 5CILL 1F6LL 3KYOA 2AVGA 4HFUH 2FHBA 5FO7A 1I7RA 1KACB 4HGWB 1BZQK 4S1SH 4J2XA 1XF1A 3BKYL 4D9QD 2HN7A 4HK3N 2ATPB 1QFWL 1U8IA 4C54A 4M43L 3SKUD 1FGNH 4OZHF 4MCYA 4LASL 3IDMA 1G7PA 2HFTA 5HDQH 1FVCB 1KGCD 4HKBB 4X80H 4LNRA 5J1SC 3UJJH 2FATH 4JFQA 3EIFA 1ZHNA 1H0DA 4ZS7H 3AY4C 4G8FA 2OJEA 3WLWD 1PSKL 3P77A 3OJDB 3SKJL 1CFQA 3ARDB 4RGNC 3V6OA 2ADGA 3MRQB 3RTQA 3UTQA 4NDMB 4J7RA 3SKNA 3G6JA 3GJEA 5TDOA 3VD5A 4IHOA 4N8VB 5LG1A 1KPRA 5C0CD 1HYRC 5EO9B 1YEEL 3IFNH 4PLKC 4WW1A 3C9NA 5JNYA 1JNHB 3HAEG 2OK0L 3QEUA 2KL6A 4Y88A 4MAYC 2VL4A 2Y1VA 2CO7B 2PO6C 4NPYB 5IR1B 5DHVH 1PZUB 2F74A 1FNEA 2DIJA 2Q7YA 5FV1L 1ZHLB 2HMID 3EYVB 2Q8BH 4LPVA 1CE1H 1R24A 1I4FB 4XNUH 3H9HB 4OLUH 3NOIA 3V6FB 6CGTA 1H15B 4KKLC 4DVBB 4JM4H 1CD9B 3ARVA 3IFOA 2ZOLA 3D18B 4H20L 4Z7VF 5D71L 3RWEA 5DVKA 3BWAB 4KROB 5DEFA 2DN7A 1QFHA 1DSFH 2F54D 3VG0H 4ZNEE 1W0VA 5F1NA 1FYTA 4NOBA 2VZ1A 2Q7YB 3BSZH 3N1QC 4DW2L 3M17B 3RNKB 3Q5TA 4M1CC 3MOBL 4G42B 3SGKA 4R4BB 5DJZA 1JHKL 1A4KB 5JMOC 3KLSA 4XP9L 5JUEL 3O8XD 3WFZA 3OAUL 1F45A 4PJCE 5IMLA 3MUHL 1ZANH 1CVRA 3SPVB 3V4UL 2BC4A 3VXQB 3OQ3B 4YEFA 2QSCL 1W72H 1ZHKB 1C5DA 5C3TA 2UUDK 1UC6A 4KK8D 1GC1C 1RJLA 1MJUL 1XGUB 1EAJA 2V2WB 3OJVC 1TPXC 2W9LA 2WLZA 4GQPH 4ZS6D 5IKCB 5A16B 3DVGA 4M6OL 4YGVB 1F42A 4NN7B 4L8DA 5SX4H 3ARDC 4JCLA 1FHGA 3AREC 4PTUB 3SCMD 5J3HD 5INCB 3D39D 2PO6D 5T5NG 5TJWK 1LO5B 5FXCH 1NC2D 5D8JL 1K4CA 4UIMA 5IJKA 5GZOD 4APQC 3DECA 3GSWB 4MWFA 5C0BE 5D96B 2NY6C 2VDML 4BQBA 1J11A 3KPRE 4EZMA 3BN9D 3RNQB 1YY8A 3KGRA 2P8LA 3MV9D 3QJFB 4MXQC 1GOGA 1ZTXL 5KVGH 1GIGH 1QEWA 4ZFFB 4M6NH 1HYSC 2Z93B 3C5JB 1I7RB 1T83A 1I7ZB 3H3PL 1DFBL 3FQXB 3QUKB 4OD3H 1IEBB 3DURA 1BFTA 1S7RB 1EERB 5ACZB 5L9DL 2AJXL 3DI2B 1X6NA 4WJ5B 2VWEE 3IF1B 4QHKI 2DQHL 5C6PB 2FZ3A 3BP4B 4IRSB 3TBVB 1ACZA 1U2CA 1RV6X 3FT4B 4L8DB 1KT2B 3HPJA 4U6YB 4XHJC 1I9JL 5FECA 4XBGB 1Q9KB 1T2QH 1VFOA 4FABH 2VDQL 1KGCE 3STZB 4Q9RH 4F7PB 3DVNA 1FFOA 3QIUB 3RWHB 4IJ3B 2IBBA 2P5EA 3VMOA 5TE7H 3EZ8A 1N2RA 3T0EE 1A9BA 3G5VB 1PD6A 1Q94B 2QKIB 3WKML 4J6RL 3N50A 3BPCA 4XPBH 3SDXB 4JO1L 2F5BL 3SE8H 1T22B 4WRLA 3QZWB 1L7TL 4NQTA 3DX6A 3W39A 1RJYA 3JXAA 1WWAX 1P53A 1QRND 1UEYA 2VXQH 3OG6B 3BN9C 4DZ8B 2A73B 4WFFE 1QRKA 1LE9B 3LPWA 3RDTD 2XWBB 3CMGA 3NCEB 5DMIL 5FA4B 2O61B 3CSYA 3MYJB 5FF6B 5IBTL 3BESR 1B4RA 2PNDA 4WHYG 2ZUVA 3FCTB 5HYJE 5F6IC 2AJXH 3BP7A 1I7UA 3FCTA 2NXZD 4PRPE 1NKOA 5D9SB 4HGMA 4FG6D 1X4XA 5TGBA 3VXRE 3EDDA 4Y19E 5MEQA 3K1DA 4HK3J 5HYSA 1TQCB 1AP2B 3EYOB 3DVIA 3VMNA 1AC0A 4CN4A 1GGIL 4Z7OE 3QNYA 5IJVA 1UQSA 2VXQL 3B2UC 3IFPA 3EOAA 3Q0HA 1OLZA 1TITA 1X5YA 1DANU 3ARSA 3EGSB 3F62A 4TUKH 1NFDA 1RUAH 3IAPA 1ZLUH 2DQEH 4YBQC 2AAVA 2NLJA 1UKTA 5FYLE 1R3HA 3CUPA 4D2NA 4YHOL 4IRJB 1E6OH 4NKDA 4D0BB 4OFKA 2JJTC 2ORBH 1OP5K 5GZNC 2GITB 5L2KE 4F15B 1RURL 1EGJA 3FO2A 3V7AE 3TN0D 4GG6A 1ZGLB 4L3EA 1DBAL 3LN5B 2AXFA 5DJDB 4PGJA 5KSAC 4QRQA 5E8OA 2A0LC 5BO1L 3UTQB 3DETC 2BNUA 3QG6A 5E2UL 4HUNB 1S3KL 4MHHG 3IFPB 1PGRB 1N5YL 1Q9OB 4GAGL 4UQ3A 5CGYD 4RFOL 4KTYA 4P2OA 2FLRT 5D7LD 3ZSSA 4CU6A 4JZJA 4IEFB 1HSBA 1WZ1L 2GW5A 3VRIA 4M7JH 4HIHA 5GRVK 4OCWH 3MCKA 2PTVA 1SEQL 1UWEL 5KANI 1KB5A 3ARED 3QIUC 3SCMC 1A1NA 4M02A 5T5NF 4JG0H 3MRIA 3L95A 5CD5C 3DYMA 1MWAA 1DBKH 5I8OH 4BM7A 4F3FA 4H8WL 1CE1L 1T04B 2L4OA 1MOEA 4MJID 2QQKH 4CVZB 3VXRB 2A6JB 3WJJA 4BQ9A 4HC1H 5ACMA 4LLAA 3RVUC 3O4OC 2APVA 3X3FL 5JIPA 3E8UL 4NQDD 2B2XL 1N0XL 3S34L 4IDLA 5CD3A 3ULUF 3O45A 1JPSH 1Q8MA 2E7CA 1EHXA 2Q8AH 2ZCHH 4XI5D 3T8XA 1NEZA 1W0WA 2Y07H 3F6LA 5DQJB 1FGVH 4FP8L 4NWTH 4KHXH 4LRNH 4PGDA 1RIVH 1ZOXA 2CKBA 3LKNB 4UNTA 3QXDB 2XQBL 5DVMA 3WUWG 4TTDD 1VACB 5D1QB 3FQUB 3OKEB 4LCUB 3D25B 1O7VA 4OI9A 4QEGA 5F7FA 4NQCA 5FCUH 4JDZB 3GJFA 4GG8A 3MUJA 1ZS8A 4HT1L 2WP3T 2WBJD 3SDDB 3OR7B 2P5EE 2VAJA 2IPKA 2LVCA 1C5DB 4LNVA 3F58L 3QUZC 2VDPH 4R2GC 1HQRA 5EU6A 3ZE2E 3VFRB 2CLZA 1D6VH 2CXKA 3KJ4C 1SEQH 1A3LH 1X4ZA 2GAZB 1Y6MR 4G9FA 4ODXA 4JDTH 3AXLA 3EJZD 4LF3A 4N1EA 4X83A 3TZVD 5L2KA 4OZ4A 4R96B 4MWFB 1FVDA 5SWQB 4AT6A 4Z7UE 4JQIH 5KSBB 4RGND 3QJHB 2P5WE 2UY7A 4AT6B 1CD8A 1MHEA 5BS0D 4ZFGH 3QA3A 2X1PA 1JGDB 1SYVA 5F7MC 5DMJB 3HRZA 5GS2H 2APTA 2R4RL 1H8NA 5DR5H 2WINB 2XIDA 4HKXB 3P4LA 3KS0H 5EU6E 5F7DB 5C09A 1F4XH 2O5XL 4CADA 4NRYB 4XBPB 5GISH 2C4FU 4JY6B 4HFWA 5FK9B 1CWVA 3V0VA 5KZCD 5LGHH 2ID5A 4OF8A 3GSQB 4LPYA 3B2VH 3MGTA 5C8JA 1G7LB 4NO2A 4OZGA 4MLSA 3L9RB 3MA7B 4JFYA 1JWSA 1SBSH 2X1OA 2Q6WB 1GSMA 1M4KA 3E6FB 4JVUA 3WEXB 2J7LA 3LSOA 1KEGL 1GGIH 2D0FA 2Z4QA 5DZNA 4QRTA 5CGYC 5IHZA 4MAYD 1UG9A 1C12A 2MQ3A 1L7IH 3VFOB 5JORA 5KVEH 3BSZL 1ZHBA 4QOKE 4AIZA 2DF3A 4DCQA 4LSRL 5D5MF 5MEOB 5DT1L