1YJNI

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1yjnI00
5JVGF 1YIJI 2E34A 1FOYA 1VQKI 1FOXA 1S72I 1ACIA 4V19K 2ZJPF 2JQ7A 2QA4I 2H8WA 1QA6A 3CCJI 1FOWA 1YJNI 3CMAI 3CC2I 1VQPI 2NXNB 1VQNI 3CD6I 3PIOF 1VQ4I 1YJWI 2E36A 2K3FA 3CMEI 4IOAF 1VQOI 3CCRI 3I55I 1VQ5I 1HC8A 3PIPF 3CCLI 1Y39A 3CCSI 1YITI 1VQMI 5DM7F 3CCUI 3CJTB 2OTLI 3CCMI 3CCVI 1YI2I 3G71I 3CCQI 3J7YJ 2ZJRF 1YJ9I 3CC4I 3I56I 3CC7I 3J7ZI 1VQ7I 1VQ9I 4IO9F 2OTJI 1MMSA 5GAHJ 2ZJQF 3CF5F 3CCEI 5GADJ 5DM6F 4UY8I 2FOWA 4IOCF 5GAEJ 3G6EI 2E35A 1VQ6I 1YHQI 2QEXI 1VQLI 3DLLF 3G4SI 5GAGJ 1VQ8I
chains in the Genus database with same CATH superfamily
2ZKZA 3M1EA 4XN3A 3FK7A 1HBXG 3BG7A 1RR8C 1Z91A 3CDLA 3CZ6A 4OOIA 3VDXA 1ITYA 2ZMEA 3D5LA 2IJLA 3KP7A 1JTXA 3U9GA 2XAHA 3HXLA 5DUKA 4A3MJ 4V19K 4IQ4A 1T0FC 1BOAA 3H5AA 3DU6A 2M2EA 1N78A 2W25A 2V4JC 1FOWA 3PFIA 2OU2A 2LNBA 1R7JA 1E3PA 4PJJA 1ZQ3P 1Q1HA 1SFUA 1DU0A 2KQRA 4NC8A 1YX5A 1HDPA 2EFOA 2F4IA 2PG4A 5BPDA 4A0YA 2LR8A 2BYVE 4MFEA 2RQPA 3HOWJ 2CQ7A 3LAJA 1S9HA 3FHZA 2O9LA 1RETA 1B59A 3S1NJ 5CVJA 1HLVA 3DP7A 2V79A 2OZ6A 3DEUA 4GGGA 3O6BB 2OF7A 2KZVA 3CUQC 3IAM2 5AIPA 5IP6A 3OY9A 2XPUA 2GAUA 1D3YA 4M73A 3REOA 3K4LA 1PUFA 4HW0A 2Q1ZB 2VKEA 1YO5C 1E3HA 1Z7LA 1O3SA 2JVHA 1FTZA 2CUZA 3LMMA 2XRLA 4RLQA 4Q5SF 5E8GA 1SD4A 3L2QA 1CF7A 4RAFA 4IRIA 4ZYHA 3CDHA 4UVBA 3PUBA 2EH3A 3T1BA 2JRMA 2DA7A 3RSNA 2ZJRF 3P9KA 3WTZA 1ETQA 3BJOA 2Z9OA 2D5VA 2LTPA 1U3EM 1FZPB 4IPAA 2IGNA 3GZ5A 3BP8A 4F93B 4C2UA 4IO9F 4C2TA 3WU2C 3ML6A 3M9AA 5ICEA 4OU0A 3RKWA 3ONQA 4KA4A 1PUEE 4A3BJ 3ZCOA 2F5FA 3TP0A 2DOAA 1IXSB 1KU7A 2VE9A 5B66C 3T5XA 4B8XA 1MSEC 5DCMA 4HDVA 2H6BA 3GVAA 1YRNB 3P9IA 4OIPF 1TLHB 3KEOA 3Q0WA 4C2MJ 1A35A 1ZRDA 2QZ8A 3MD2A 2DW4A 5DTDA 2F48A 3HM5A 3NWSA 1SFOJ 2HZDA 2O7OA 2HOEA 3ZMUA 1HQCA 2Y9ZA 4XLHA 3FF5A 4B43A 4DZPA 5M3MJ 2VOOA 3HC7A 3ZN0A 5K5RA 4D5FA 2DK5A 4J01A 4N9HA 1D0XA 1IV8A 2LF7A 2Y0MA 3LQQA 3ELKA 2CO5A 4EGZA 4A93J 1LKXA 4EM0B 1MMNA 1ZYRF 4R1HA 1B6AA 4YIFA 2VOPA 2KJBA 4ETSA 5EF6A 3BR2A 1R1UA 2KMUA 3P7NA 2WAQN 2F5EA 5FKOA 1K7AA 4I02A 3HRSA 4A5MA 5HLGA 1R36A 1WJDA 4WXCA 4I0AA 4L9VA 2COBA 1UHWA 2K3FA 2RNGA 2RV8A 5D5XB 3PSIA 4ESFA 2HNHA 2PMZA 2QUFA 1EH8A 3PJRA 2YUSA 5H6QA 3PQKA 3DPUA 4U7BA 3CJRB 2NS8A 3HOXJ 1VQOI 3N4MA 5B3SH 5FRNA 3QP6A 3I0TA 2BHZA 3EDPA 4EJTA 1G2HA 1MMAA 2E1CA 3GTOJ 4KIBA 1P4XA 3KEYA 5IP9J 3DTIA 2WWYA 1JUPA 3WODF 1R1VA 2M7BA 4RDUA 1WZ2A 1XN7A 4OAZA 4LLNA 2CQNA 1IRFA 1FTTA 3Q9SA 1R71A 2F5CA 4IHWA 2L7FP 3KP6A 4L9JA 5DD8A 3S15J 5JFRA 1FBQA 1IZ1A 3LSMA 4XRMA 1Y0UA 3X2QH 3ZMTA 5HDNA 2V6EA 4M9SA 4XL9A 1R5ID 1QPIA 2PI0A 2X85A 3W2AA 1BA5A 4A3IJ 2L9RA 1K4SA 2STTA 1I39A 2P5KA 3Q3SA 1SD6A 2X48A 2COMA 4DZJA 3E6MA 2DFHA 2HGCA 1G3SA 3I56I 5KK1A 1SAXA 4BHPA 4ZTJA 4BDZA 1SVMA 3N05A 4JQFA 3MKWB 3C7JA 2GQQA 1X1PA 2JA5J 1MMSA 3G2BA 1XDSA 4RGSA 3ECHA 3FK6A 1LFBA 4BHCA 1S29A 3BZ6A 3FXRA 3S3OA 3C3WA 4C3IJ 2Y30A 5FB2A 1VFCA 2ZMEB 3HJEA 4HX7A 4E7JA 1S6LA 2DQRA 3RPUD 3ABKH 4PUSA 2FRHA 5ERIA 4U0VA 1ZN2A 2DJNA 2XV4S 1KQ9A 2M0MA 2UZKA 2D45A 3MKYB 4FCYA 4CUGA 3DFGA 1HKTA 1J9IA 5J1UA 4A3KJ 1STZA 3P9CA 4OINF 4E6KG 1T6SA 2H1LA 1VQ8I 1BR2A 3J80Z 2X1DA 4LK1F 5IOZA 3HOVJ 2CW7A 1UAAA 4X6AJ 1G3WA 3I4MJ 1R5GA 4M71A 2CV0A 1ULYA 2ZJ2A 1ZRCA 2JTVA 2GIVA 2BV6A 4P96A 4C3JJ 1XGMA 1YJNI 4MNUA 3WGGA 4HF1A 2W57A 1J2XA 4CHUA 3DPLC 4H4KC 4WXHA 3K7AJ 1L3LA 4G12A 3IH3A 1LNWA 1F43A 5BPIA 2QGUA 2XGXA 1J5YA 1PUFB 3CO7C 1V54H 2E36A 3K6GA 2E2IJ 3DKXA 3FBIB 2P7CB 1ETWA 4D1QA 4RB2C 4G7OF 3M8JA 4HF0A 4M6YA 2DMUA 1IG7A 1XPXA 1CF7B 4XORA 4P5OA 4LIVA 5F64A 5L3DA 3GWZA 5HNFA 3KYLA 1AKHA 3WG9A 2DCEA 3PIPF 1HW2A 3CCLI 1FEXA 2VI6A 5TJJA 1NH3A 3LNQA 2IS4A 4EVIA 4S0HB 2HQ5A 2JSCA 2H8RA 1AOYA 1FBUA 2NOJB 3HGGA 1MBEA 2HS5A 5J4VA 3H1CA 3LSKA 4K2EA 4E7SA 2X6YA 4CCNA 2DQLA 2RN7A 2KIQA 1BIBA 2VXDA 3W3CA 2ZMEC 1T56A 4EJOA 1YIOA 1UHSA 1QVUA 2RQQA 5KVRA 1VF9A 5DCMB 1HOMA 4F91B 1YG2A 5D4RA 2ECCA 1LE8A 2K9SA 3KP2A 1SD7A 3U2RA 3E6DA 1SC7A 1NTCA 1UFMA 2XF6A 4LFUA 3OYHA 4FX0A 5LHGA 2ME6A 2I8DA 4IQJA 3CP2A 1Y0NA 2RC4A 2DMNA 1NG6A 2ZXJA 2CW0F 5F1RA 1PP8F 4UY8I 4IOCF 1K6YA 2MA3A 3KETA 4KNYA 4CSWA 2R5ZA 4BS9A 2IS2A 3HRUA 2R93J 4DOZA 1WCMJ 1WI3A 5KAFC 2ZXHA 4CICA 1LDDA 3PO2J 3G1MA 2KDOA 2EIJH 4CXFA 3WTUC 3NRVA 2LFBA 3TMOA 1FOXA 5FKMA 2ZSIB 4G7HF 2XGCA 2STWA 4PJ0C 1QBJA 1JTYA 3ZPLA 5BQTA 3KYCB 3HSFA 2W7NA 4XKVA 3QWLA 3MFKA 1E0EA 4HX4A 3TKYA 2IVMA 2EZHA 3FX3A 2DJIA 2QA4I 4IVNA 4O6JA 5IYDJ 4ZZDA 4UB6C 3OYFA 3ZQFA 1S7OA 3I53A 4BGDA 4XIDA 3DKWA 1JJ8C 3G73A 3W2VA 1BI0A 1FPQA 1FSEA 1LVKA 1XGOA 1KZHA 1JJ6C 2WADA 1Z77A 1O7FA 3A01A 3L2VA 1P2FA 3BWGA 3BPVA 3KX2A 4NQWA 3RDIA 3OS2A 2DYSH 2AHQA 3MWMA 4LJZF 3QPSA 3JW4A 3LA2A 5JR3A 2DT5A 4ENNA 2M5WA 1MH3A 5FD6A 5FFXA 1UJ8A 3L2CA 1USSA 3MMYB 4AU7A 3UNGC 4QPQA 2JUCA 1XGNA 2F2EA 4UVCA 4CDGA 4F3QA 4Y13A 4BBSJ 1EH6A 2ID3A 2RVCA 2F5DA 3LWFA 1ZKGA 4IXAA 5LHIA 1Y39A 3OOUA 3U21A 2EILH 2VJIA 2KLOA 1Z7UA 1S3JA 2HPIA 2V26A 3IH4A 4OWRB 2BEOA 2K4BA 4XK4A 1KYZA 1YITI 1LQ1A 4Y17A 3S2DJ 1P4WA 2E60A 3F22A 2X0LA 4C3HJ 2FBIA 3E3VA 2IAIA 2FF4A 1MNMC 2F4MB 1TWCJ 1WKMA 1APLC 2DODA 5E17F 3H3UA 3BJ6A 2MSYA 4N0BA 1R22A 3CC4I 3JRCA 2RREA 3H3VK 5D5UB 1WHUA 2VQLA 2JJ7A 5CQEA 2Y75A 3A1YA 4N9IA 3IRRA 1IO2A 1XDUA 2VT3A 4XSZF 3CF5F 2JZYA 2EIMH 4OIQF 1O7LA 1X3UA 2EZKA 4HF2A 2FQ4A 3S32A 1QO0D 5AONA 2WY7Q 3ZGKA 5DCFA 5F04A 3LSRA 4BXFA 1KU2A 1D1CA 2E35A 2W24A 5C3EJ 2L2OA 3V7CA 1XC5A 1EH7A 4RAZA 2QEXI 5FLVA 3G4SI 5FFZA 4EEFG 4LLLA 3RJPA 1NG7A 2GA1A 2R7QA 4PCQA 3E97A 2ISZA 2HTJA 2VODA 3TDZC 1YIJI 1Z1DA 1YS6A 3H35A 4HV5A 4NC6A 3H0GJ 1T95A 4DIQA 2Q0OA 1U5TA 4HLYA 2M0CA 3DTKA 1WWXA 4U7DA 4CH7A 3K10A 4RBOA 3ZQHA 3UKGA 2HKOA 1R23A 2VBZA 3S1QJ 3BR5A 2FMLA 5FGMA 4XICA 2JQ7A 3L9FA 5A2QK 1YW8A 3QOPA 3JSOA 5E20A 3MZ8A 2FQ3A 3E5XA 2BE5F 1IXRC 4EJVA 1AKHB 4A3CJ 3DBHB 2NXNB 4QSHA 3GCMA 3R6SA 5J8CA 3QU6A 3KPHA 1MBFA 1I3AA 1ODDA 1R9TJ 2EV5A 2AO9A 4MHGA 5C44J 3WTSC 5JVTA 2CUFA 5FO5A 2JA7J 3F9KA 2B63J 2R7ZJ 1A6IA 2LDUA 2O6GE 2HOAA 4IOAF 5FLXZ 4BQNA 3DCFA 2ZXIA 1YRNA 1B72A 2HEOA 3F8CA 4S05A 1WI9A 1LE8B 2EPFA 2WB1A 2R7OA 4M9XA 5E3OA 1TWFJ 4EV0A 2VQCA 4XKWA 1J0RA 3BTCA 3VEPA 3I3LA 2XPVA 1W5TA 4XLNF 1HSTA 2HU9A 2Z5UA 1O3RA 1OPCA 2XPWA 1ZR2A 4D7NA 2VN2A 2R7DA 2Z3YA 3SHFA 2W48A 4RMNA 1K78A 3MAJA 1C0WA 2MGQA 2D1HA 3CESA 1BI2A 3FBNB 5FRMA 1YLFA 2R5ZB 3G71I 3SFZA 1PDNC 1DPUA 3SZTA 1YJ9I 3P5JA 2FJ1A 3QOEA 3DKYA 4I01A 4B09A 5GP9A 5GTIC 3GFIA 3OYMA 4MEYF 4XLAA 2LYCA 4AD9A 3O8GA 3A4CA 2EV0A 4FE7A 3ASNH 1F5TA 4UV9A 3K2ZA 1B1BA 4QPOA 4RB3C 4II3A 2ZXWH 2MFZA 4A3JJ 1MMGA 2L02A 4UB8C 2QSGX 1OCPA 2Y0SN 4NUBA 1IF1A 3TOBA 3RQIA 5J1YA 3QAHA 5LRSA 3S2WA 4UHTA 3PQJA 1D1BA 1JI8A 2JRTA 4KT6A 3OYCA 1OYIA 3VODA 1JUSA 1V5EA 2TCTA 2L4AA 1N25A 2QSFX 4AUXA 2CFOA 3O2PE 4ZJZA 3F6OA 5KCMA 4W1UA 2XIGA 5EJCA 2MG4A 4A2UA 2XF7A 3AKZA 1JKRC 3I71A 4FASD 3E6CC 1TZLA 5GAGJ 2A69F 2KRFA 3JRBA 3H9GA 3FXJA 1TC3C 4HSRA 1REPC 1GUUA 5J6XA 2R7WA 2A6HF 3BTLA 1PJRA 1E2XA 3SZGA 5FD5A 1RPWA 3A01B 3HGYA 4NQWB 2CJJA 4KITB 4PGHA 2XC7A 4XRSA 2DO7A 1XCVA 3LQRA 3LFKA 3HTSB 1JGSA 2QWWA 4YFNF 1WJBA 4CGZA 4ZYAA 3BQZA 1UCRA 2DA1A 4PZJA 4CCLA 1U8RA 3QODA 1OMIA 3CMAI 2FE3A 3FXOA 2DA6A 3M7GA 2M3AA 3KLOA 1G6NA 3VPRA 4U0YA 4ZYDA 3A2KA 1X1AA 3FXKA 1OCZH 4P9UA 3K1MA 5F0HA 1VQ4I 3MKZA 2VQGA 4IHXA 4EMSA 3F8BA 4G9YA 1FYLA 4I0BA 4NC7A 2VLAA 1W1WE 2ZO4A 4IF4A 4KT5C 5GPAA 3ERMA 3A02A 4NNJA 3JAMK 4AVPA 4A5NA 1I1SA 5LEJA 1YYVA 4M3DA 1Z67A 1IN6A 3G1OA 3SDGA 1XMKA 3I59A 2FOKA 1TWHJ 2A05A 3IP4B 4ZH4F 4ZDOA 1ZG3A 2HYJA 1ONVA 4EGYA 1K6OA 3W6JB 1TQPA 2AXLA 2M45A 3ZRGA 2NYXA 5DM7F 2R7TA 5H2FC 4I6ZA 1MBKA 3MQ0A 3FISA 3ABTA 1XG1A 1DP7P 2QENA 2OTLI 2OBPA 3LOCA 3PFYA 2XGDA 2L9SA 2O3FA 2Q8KA 3TO7A 3E6BA 4HV6A 5EG0B 2G9WA 2L3DA 5E3MA 3S3MA 5IYCJ 1IRGA 2DFEA 2H6CA 5KHDA 3GFJA 1SAUA 1K83J 1FY7A 5D5VB 2FBHA 1OQYA 1PP7U 2BY3A 1BC7C 4O5VA 2IP2A 4IEJA 4M3FA 3T8TA 4FHTA 4XM3A 1GXPA 1U5TB 5L3GA 2VASA 5E3LA 3HPHA 3BDDA 1YW9A 2XF5A 1Y8RB 2E1MB 1XS9A 1VQ6I 1WPKA 2QF7A 1E3OC 2PJPA 4IHSA 1A31A 3DEEA 4JP0A 2CRGA 1Z3YA 1MMDA 2HDWA 4U87A 3OYBA 1D5YA 2QM3A 4AIKA 4CO8A 4F92B 1DGRM 2EB7A 4GRIA 3ZXSA 3MVPA 5CVRA 4RB1A 2VONA 3OYAA 4I7HA 2R7UA 4BH9A 3HYIA 2G0EA 2A68F 3SFIA 5BOXA 3S8PA 4E7ZA 1I6XA 3WHCA 1QA6A 2HVSA 1B72B 2BY0A 1JKQC 1QU3A 1QZZA 3ZQLA 1LDKB 5J4YA 2WAEA 4L5JA 2CH0A 2OQGA 4XOTA 4Q4ZF 3RKQA 3V4GA 3CC2I 3PL8A 3EYIA 1RC9A 4KFCA 1D1AA 1W5SA 4E7IA 3TL4X 3ZN1A 1FLIA 2VKHA 1K4TA 4DNCA 1BIAA 1MBHA 3DBRB 4HAMA 4R79A 3JRFA 4EM1A 1OKRA 1K78B 3S17J 1IN8A 2NNNA 3D5RC 3ZQQA 3S16J 2VKDA 2B0LA 3OYEA 4JK1X 4U0WA 1AHDP 3L09A 3BROA 4AYBA 5CPRB 4GDFA 1MJAA 1WJCA 3BCAA 4L0ZB 2RNJA 1KQ0A 2YPRA 2ZFUA 3OYKA 4KUMA 3ZOBA 1XD7A 2DA5A 2DA2A 2HVQA 2FSWA 2RAEA 3HZJA 1EA3A 3I4PA 4DYQA 2MLKA 3GUDA 3WU1B 4HG2A 1MZBA 1U5TC 2GZWA 3HRMA 2CQKA 5EYRA 1M1EB 2JK3A 1ZH5A 5K1YA 2LY9A 5E1XA 2E1MC 1TBXA 3W6VA 3LSTA 2D1VA 2YR2A 5F27A 3M1CA 3R61A 4LITA 3A0HC 1FMVA 3FXLA 1QQIA 2EFQA 2IPQX 3HKZA 4BJTA 1BC8C 1ZRFA 4JX4A 3K4BA 1QZEA 2PMUA 3FMRA 3PNTA 5D6EA 2K9NA 1KONA 1UELB 4EJUA 4BDYA 5D5WB 2L7ZA 1P9QC 5DEQA 3HOTA 2TRTA 4D7MA 1WFXA 5LRRA 3V7RA 1W0TA 4HPQA 1UHMA 1B4AA 3GX4X 2R7SA 2VPLA 5HS9A 2QSHX 1Z6RA 2W84A 2GXBA 2QBYA 3BQYA 3BT9A 3BTIA 4G6QA 2WAQA 1H8AC 2X51A 2IGKA 2Y31A 4Q47A 4BY1J 3OYNA 5D8KB 5LGUA 2CU7A 2JUGA 1RKTA 4P9FA 4CYCA 3HSEA 3KEQA 1VQKI 3Q0UA 5L3FA 4HQMA 2EIKH 2K4JA 4BYYA 1Y8QB 2BVMA 1GT0C 3E5UA 2X6XA 4ZZLA 2ZJPF 1IXCA 2LMDA 2H8WA 2KRHA 4XRFA 1BW5A 3L00A 3K4JA 5B1AH 2CG4A 5HLIA 1E17A 1X19A 3I59B 2V9PA 1VQPI 3T0YA 1R49A 2GXAA 2F5VA 3TQNA 4KMFA 1KU3A 2V7FA 4MEXF 4ESBA 3V7SA 3WGIA 4FTHA 5DDGA 4HQEA 2CYYA 2QKLB 5CVVA 5F1JA 2HVRA 1TT5B 3ASOH 1HXDA 3R4KA 1OCCH 1ZTRA 1T8IA 2VXZA 2HDCA 2VKVA 3L2RA 2JN6A 2L9VA 2FU4A 3SYTA 4HNTA 3CCRI 3AG2H 4P55A 3OSFA 3MZHA 2LBFA 1KYWA 4E7HA 3MN2A 1ETOA 2HTSA 4B1RA 3J81K 1JT0A 1K79A 6PAXA 3GO5A 3HPGA 1X2MA 1HDDC 4PGGA 5IP7J 4MQVA 2OCEA 3K4CA 1TWAJ 2HDDA 3S2HJ 3CJTB 3PSFA 5D4SA 2E5ZA 3OYJA 1WRJA 1YQAA 2K9LA 3QPLA 1U6GA 4CZCA 4KMUX 4LB6B 3CF2A 3FMSA 3F72A 1L0OC 3HHHA 4IZZA 2IA2A 3ZR8X 1J7KA 4KJZA 3ZMVA 5K5OA 2XSJC 1HW1A 3GZ6A 3IKVA 2KJCA 3FXUA 1H9GA 3PNVA 2MH9A 1JXSA 3K4KA 1MGTA 1ZELA 4UVAA 2BY1A 3HOYJ 5GTHC 4BHBA 1ZGJA 5ILSA 3RZOJ 5FKKA 3VSLA 3CO6C 4BU2A 1RIOH 5DS9A 2HXOA 4B44A 3HOZJ 5EEGA 3DLAA 3BG3A 2M8EA 4N4NB 2KT0A 3RPQA 1Y1VJ 5DYMA 5ILVA 4Z2YA 2R5YA 3G6EI 2YU3A 2AQEA 5JLXA 4XOPA 2M8GX 1WJFA 3ZQIA 3K4NA 4FISA 3NEUA 5AIQA 2ZC2A 1O3QA 3FZVA 3BR1A 5TISC 3DEWA 2XB5A 4CCOA 3C1DA 3K2AA 2HYFA 3M4OJ 2UXNA 1X4PA 2K40A 1D5VA 3MEXA 4L5IA 2L4MA 3DU5A 2G7UA 3GLXA 1T2KA 2E2HJ 4QLCU 5F0CA 3AAFA 3TOAA 1ZHFA 1D0YA 2P0WA 4Q48A 3V8KA 1GVDA 3OV8A 1HKQA 3U1DA 1SANA 5LEKA 3VB2A 5HOOA 1RUNA 3BTJA 1MNDA 1OFCX 2PMHA 2VT2A 2X1EA 1ETYA 1ON2A 3A03A 1OCOH 3LA3A 5EZHA 5K5QA 3SJMA 1DDNA 4OIOF 1ZGWA 3GXOA 5LGTA 3TW7A 5DD4A 1FOKA 3ABLH 1OJLA 2QQ8A 5E79C 4ZDPA 1P7JA 2XRNA 2EK5A 2PJRA 4E7KA 4RM2A 2LOOA 4M9ZA 1GXQA 2YX4A 1VQNI 4BEHA 2LD5A 1J59A 3CD6I 2JA6J 4KISA 3GTGJ 2OV7A 4GYIA 2DA3A 1GV5A 1ON1A 2GWRA 4IHTA 2K3PA 4ON0A 1Z9CA 4LK0F 3W2WA 2BHYA 4PSWA 1HCRA 2IXSA 4AC0A 5BS6A 3GFMA 4ENKA 1OR7A 3Q0VA 5FKNA 2Y9YA 3TBIA 5FLMJ 1TNSA 1MH4A 2MC3A 4LMYA 4LB5A 2K5CA 1VZ0A 4XKCA 4X0GA 2HOTA 1JGGA 1VTNC 2LY2A 2OUMA 1IJWC 1AA7A 2CUJA 2W00A 1W0UA 2P6TA 2V1XA 1VQMI 3CCUI 1FMWA 5FLXK 1RKWA 2GBYA 3OIOA 2B7EA 4LD5A 2ACJA 1BI1A 3HTUA 3CCVI 3M07A 3D5SC 3CCQI 2EQRA 1S7AA 5CQGA 2L0KA 2Z1DA 2ESNA 1I6HJ 3B73A 1SVLA 5KAIC 1ERDA 1KQ8A 2XB0X 3ESWB 1ORKA 2QBYB 2UUZA 1LVAA 2LG4A 3GTMJ 2OTJI 2VJ4A 4IRGA 3EYYA 1IDYA 2XGEA 2FX0A 1T33A 4MIMA 1HF0A 2EFNA 4G8XA 2K27A 1N77A 4II2A 4CYCB 3OS0A 2KDZA 4FX4A 1SEUA 4XLCA 1AWCA 1AU7A 2DBBA 3W6KB 3F8MA 3IKTA 1ZG5A 2VB6A 3TP3A 4AIDA 2R7RA 1VQLI 1XSXA 4E7LA 2LRDA 2XKPA 1J09A 1A6QA 1MD0A 1PYVA 3H9JA 3PNYA 3H0DA 1R5HA 3HOUJ 3OR1C 3F23A 3GTJJ 2A5WA 2VQHA 5TRDA 2WC2A 2L5QA 5KNLA 1FIAA 4N4OB 4U88A 5HVQC 5JVGF 4L5EA 2E34A 2MLGA 4QIWN 4FE4A 1GVJA 1ACIA 4HNUA 3K70D 3E1SA 3WGHA 4CYDA 3IRQA 2GXGA 2KZGA 3H36A 4XRSG 4BE1A 2V1NA 4UUVA 4MLOA 3DQVC 4KIFA 3IHUA 2LBFB 5EG0A 5LBQA 1P7IA 3GTPJ 3GTQJ 4QWQA 5M3FJ 2XROA 2HPMA 2BW3A 3QYFA 1YJWI 1XX5A 4LG0A 1BBYA 2X1CA 4JX5A 2JT1A 1FP1D 4WXDA 3RIRA 4Z6YA 3CJQB 3RI4A 4ABZA 5J8FA 1RZ4A 1MNEA 1UB9A 4ASNA 4F7ZA 3PO3J 3S1MJ 1BR4A 1VQ5I 2EBIA 2O8KA 3M8EA 1DQUA 1V5GA 2VJ5A 4GFBA 3VSKA 5J1RA 4D5CA 2FUG2 3KZIC 3IL2A 1W36C 1TNTA 2EFPA 1BOBA 4RAGA 4GO1A 1RR7A 3HHGA 2CW8A 2M1BA 4HX8A 1R00A 2P5LC 4HSTA 1BW6A 4RB0A 5ICCA 4L18B 4XMYA 4A3LJ 1Y6IA 2Z33A 2FNAA 1LPQA 1OLTA 4QTRA 3CCMI 1JHHA 2R5YB 3ZMSA 4BE2A 1ENHA 4RM3A 2ELJA 1YTYA 2MABA 2D2WA 2FMYA 4PFOA 3PM1A 2E2JJ 1SVOA 1LFPA 2XAGA 1H89C 2I10A 2GLOA 1N75A 4MQ9F 2NNYA 3CP8A 1IN5A 1ZLKA 3KLNA 3IUOA 2ESHA 2L9NA 1R58A 3OYGA 1BJZA 3BR0A 4JBAA 2HFHA 1TL8A 1D8JA 2QQBA 1QRYA 3WTVC 4ITVA 1H88C 4XKBA 1X1BA 3ERED 3HOSA 3CLQA 5HS7A 4RLFA 1X3WB 3V8LA 2HYGD 1ZARA 3QYBA 3I9V2 2MC4A 3EUHA 2DAOA 1S8NA 3ZQCA 1Z0XA 1YW7A 3MZYA 3ECOA 3KP4A 4UV8A 2HWVA 2WTEA 2PJRB 1DGWY 3SQNA 4MTDA 2J5PA 4IHVA 4BUPA 4BEHB 1IRZA 4FETA 3VFZA 2X6OA 5LD2C 3C2GA 2PEXA 3PUFA 2NOGA 3AG1H 4BQOA 1S72I 2LLKA 1SD5A 1D0ZA 2HOSA 3IWZA 2QKMB 2QYOA 3GMEA 5EEHA 4MFDA 1U8BA 2LREA 3F8NA 1TP4A 5M5YJ 1ZG1A 4KN4X 4YRVA 5D6FA 2R7FA 1D8KA 2FD5A 3WE2A 3OYLA 2NS7A 3VYUB 2EZLA 3BZCA 2WV1A 1FJLA 2YU9J 3HL2A 2UXXA 3CMEI 1R6RA 1P6RA 2LKXA 2OAZA 3O8HA 1IUYA 5CKTA 1Z6TA 4HLXA 3OIQA 2AS5F 1TTYA 1OCTC 4WWCA 3B6AA 2O61A 1LJ9A 3NAUA 2PQ8A 1IN7A 3OIPA 4GCVA 5HLHA 1K61A 1QNTA 2K85A 2CV2A 1RUOA 5IT9Z 2DOEA 1HC8A 3F8FA 3CUOA 1IV6A 2YS9A 2XAFA 2LKPA 2WY8Q 1DPRA 2Z2SB 4A3EJ 3DF8A 3I58A 1P4AA 5HS8A 4M6XA 2AQFA 2DLLA 1O3TA 3OS1A 5ED4A 1WVRA 3QQAA 4DJAA 2DMTA 4BACA 3HDDA 1W36D 2Y0SA 2OD5A 3WTYC 3COAC 1Z21A 3NARA 3L7WA 5JLWA 3VYTB 5A2QZ 2ZNZA 4LLGF 2XASA 3UR3C 2B9SA 3J7AO 4B48A 3K4MA 2XUBA 5EGOA 3AG4H 2F4OB 1BN5A 2DPUA 1G3YA 1TT0A 2W4SA 2Z99A 5LGNA 3FKJA 2FOWA 3K69A 3Q9VA 4XQFA 3EUKL 4IX7A 1FP2A 3K0LA 2A5YB 2PLYA 3KZZA 2NVXJ 4M6VA 5C4XJ 1ZLJA 5HODA 3C2BA 4PDKA 3JR9A 4XONA 1O4XA 1YHQI 5TGTA 2HZTA 3HG9A 3WE3A 1F36A 2JA2A 1OR7C 2DN0A 4ENJA 3C18A 3CMYA 5EEAA 2ADUA 4YIIA 2H09A 1F4KA 3QPHA 4HBLA 1MBGA 2HKXA 3E5QA 1ETKA 1U9NA 2BW3B 2LY1A 4KIGA 4B3XA 1I1GA 5IPAA 1JT6A 4RGXA 2NVTJ 1LEAA 4BXXJ 4LG0B 3BOQA 5CVUA 1F1ZA 4HRIA 4DQ2A 3TEDA 4A69C 5DUIA 3GTKJ 1W7PB 1S5LC 3SEZA 3RQ4A 3KE2A 5HLTA 1BM9A 2K02A 2NAZA 2R4GA 5ICGA 3FHNA 4AVZA 4BBRJ 2DTZA 3S1RJ 4PJNA 1FYKA 5F0FA 3FXMA 4B4CA 4HA8A 1PVEA 2V9KA 3KIOA 2JMWA 3GEZA 3RKXA 2NRAC 5HDKA 1G3TA 4V2FA 2NVUB 1TWGJ 1IRXA 2GOXB 2KHMA 3OL4A 2IS6A 5JI6A 3DV8A 1X3ZB 1FT9A 3EQLF 2DT7B 4AYBN 3N97A 2E7WA 1XCBA 5BNGA 2R92J 3IAS2 4Y4RA 2WV0A 4W97A 3L1PA 3O3KA 5IYBJ 3RZDJ 5FKLA 5K7HA 1T38A 2OPTA 4JX6A 1MSFC 1DU6A 3NWTA 1SFXA 3J80K 2GM4A 2KRCA 2PMZN 4NDLA 1XTAA 3CCSI 2CMPA 4E4HA 1EKEA 4ZC3A 2DTRA 3JTGA 2P7VB 3K1NA 1OYYA 1XB4A 4UUSA 3L2UA 2CQQA 2BXZA 2LF8A 3JCUC 1QZYA 3B02A 3WU0A 1FBSA 1VNDA 5CYVA 1W4MA 3HB9A 4WF2A 4AWXB 2V9VA 3HKZN 5CVIA 2R7XA 1JUMA 3KYDB 4Y7NJ 2KL4A 1QGPA 3QPTA 4YEJA 1ZREA 1QPMA 3G3ZA 1G59A 3SEQA 3SDBA 2RDPA 4IHYA 5GADJ 1IN4A 4HZFA 5DM6F 4I2OA 4M74A 2QLZA 3S14J 2WA0A 3WTWC 2E19A 5CLSA 2QQAA 3M3YJ 2WBMA 4RS8A 2CWEA 2LH9A 3JREA 3IC7A 2OJED 3JAMZ 1Y56A 3ZMZA 4LIUA 4TV7A 3DXJF 2VE8A 5E1ZB 2FNPA 3OSGA 2HR3A 4V2GA 3MCZA 3J7AY 3DTEA 4OAYA 3GYHX 2FEZA 5H20A 3K9TA 2W82A 1RNLA 5FROA 5IY5H 4EQQA 1WH7A 3BG6A 2MBFA 3I64A 2MD0A 5C4JJ 4KICA 4M3EA 3KFWX 2Z16A 2ZFWA 3L2WA 3JSPA 4O3MA 4PJMA 5LFAA 5IT3A 3KZYA 3VYSB 2E1OA 4XBFA 4FQGA 2HXIA 1IDZA 1SMTA 3PIOF 3V8JA 4NBQA 1EJ9A 4NHJA 5ILUA 1IC8A 1GLNA 3GW2A 4IKFA 2V1DA 1R1TA 3EPZA 1MW7A 3JRDA 1I5ZA 1LUJB 1OCRH 4MTEA 4DBRA 2LSOA 5K7FA 2VUMJ 3GTLJ 9ANTA 1TQMA 1T39A 4AIJA 3WG7H 2OA4A 3SXYA 2PBIA 3I55I 2P6SA 1HA8A 3ABUA 3ABMH 3EUHC 1KU9A 3F21A 3LSJA 2BXYA 3WTXC 3D0SA 3ZQ7A 5EGOB 2CQXA 2IT0A 4LG3A 1TQIA 5HNHA 2JA8J 2WAFA 1HKSA 2KPMA 2YX7A 2NS0A 2VC0A 3MKLA 1NHAA 4G7ZF 1BL0A 3KP5A 2JPBA 4A6EA 1UG2A 2H94A 1IUFA 1V55H 4NB5A 3T8RA 2CS3A 4BXUA 1XGSA 2VC1A 3JRHA 3CC7I 1A04A 1OYWA 2YSRA 2P81A 1IGNA 3I5UA 2HQAA 5J40A 4E70A 3CCEI 2TDXA 3FDYA 5B5EC 4BE0A 3TGNA 4YFKF 1U0JA 2ZSHB 3LSGA 2ZCWA 4KN7X 2ZB9A 3F6VA 2IGOA 1UMQA 3DLLF 4ZYEA 1WGXA 3LSHA 4BJ6C 3IV5A 5L3BA 1KA8A 4G6TB 2CGPA 3H92A 4WK8F 2M30A 2AXTC 1TW2A 4X1EA 4Y3OA 2KIMA 1W7PD 1JKPC 3FKIJ 3CQZJ 4IRHA 1IAWA 4UUTA 1FOYA 3K1PA 2VBWA 2VJJA 3HUGA 2XVCA 3TO9A 3A0BC 1SFEA 3E0JB 2HI3A 4P1WA 2EWNA 2EFWA 2BY2A 5K7ZA 3DPTA 2MW8A 4XNFA 1QHHD 4MO7A 2L54A 1Z05A 5GPCA 3LSIA 3BR3A 2VIXA 2XDVA 4CCMA 2A3SA 1MJBA 3K70C 2IS1A 2IW5A 2V1UA 3GLLA 3H5NA 2DU9A 3OOPA 1GV2A 1X1CA 4BQAA 4XLEA 2E1NA 3ZMDA 2CUEA 2EZIA 2GOMA 2X6WA 4UUSB 3ISPA 3B6CA 1RESA 1V5FA 3D1NI 3GZNB 1JE8A 4L0YB 2UWMA 1DUXC 4D0PA 1RRJA 1EF4A 1G8XA 1O57A 1S7EA 5CJ9A 4OIRF 2KFDA 2HQRA 2F6CA 3C2HA 1W5CC 2QCOA 2DI3A 2FA5A 1ZGAA 1CQTA 1B8IA 1FWZA 1G4DA 1OISA 2MD5A 3CLOA 4I76A 3FM3A 1GHCA 2GIZA 1LEBA 1UG0A 5E1WA 2KIUA 2IGMA 3R0AA 2IBDA 3BZKA 1I3QJ 5JHUA 1T0FA 3EUAA 2Y48A 5F08A 3OL3A 3GFLA 2W1OA 4BKXA 3DWLE 1I50J 3LA7A 1X1DA 2V6CA 1R4NB 1POGA 4GXOA 2DDBA 2XAJA 3BY6A 1ZR4A 4C30A 1BR1A 3BG9A 2DOFA 1ETVA 2A61A 4AIHA 1VQ7I 1VQ9I 3OYDA 3WHBA 1MIJA 5EZGA 4R8HA 2BVLA 1WSUA 3IH2A 1RI7A 4XN0A 1HW5A 1JKOC 2QQ9A 4DW6A 1HSJA 2M87A 4G94A 4BNCA 2E7XA 1IW7F 5EDNA 1SMYF 1UZCA 1H0MA 1X58A 2ECBA 2A6TA 4DYCA 4D9JA 1MDMA 4M3GA 3FIWA 3CDIA 3KP3A 1WJ5A 2HQNA 2KISA 3CUQA 2R7VA 3U1KA 2H27A 1F9NA 1B9NA 1U2WA 1ZK8A 3J81Z 4B47A 1WJAA 2Q2EA 2ZNYA 2DA4A 1ETXA 1LDJA 1X4OA 2PFBA 3LFUA 4HDUA 3DBLB 2K7LA 4BL0B 1FSHA 1YS7A 2DMPA 4A6DA 4ANJA 5FJ8J 2H1KA 3HBLA 4L9NA 2E5NA 3S93A 4OMYA 2BZTA 5J47A 2XHKA 4CCKA 5L3EA 1P92A 2VPRA 2LC2A 3E7LA 3RTRA 3BPXA 4A0ZA 3RPUA 1I27A 2ME0A 3R0JA 1Q1VA 4AM3A 2R3SA 2DMQA 2Y2ZA 2O03A 3TO6A 2FBKA 2LVSA 3NQOA 5IOYA 1Y1WJ 3VYRB 3CMMA 3SZPA 4DBQA 4S04A 2JSPA 1Z3XA 3FM5A 2EJRA 2LP0A 5E3NA 4YG2F 2OCCH 2XAUA 2A6EF 3BJAA 5L3CA 2N8GA 4XLPF 1XSVA 2C6YA 1FX7A 1H9TA 3CCYA 2EA2A 4G6DA 3TW6A 2XAQA 2X4HA 2CFXA 2CSOA 1R4MB 1YX3A 2IEKA 4JOMA 2L7MP 5JHFA 3F0CA 4KYWA 2K9QA 1MKMA 2NVYJ 4WX9A 2RGVA 3OR2C 4I98B 3TDUC 4BAYA 5LLQA 4CCJA 1W7PA 3OWTA 1V4RA 2KP6A 4PFPA 4RA2A 3ROUA 5M5WJ 4MGRA 4A0XA 1YI2I 2WB1N 5IT9K 2IRFG 1U78A 2M34A 2M7AA 4RGRA 2DDAA 3J7YJ 3H3ZA 4L9TA 3V42A 5B1BH 5H6RA 3QRFF 3CTAA 1YFHA 3J7ZI 3JRGA 4CZZA 5LHHA 4Y52J 1QVTA 3KCCA 5HDGA 2QVOA 4PJLA 1U9OA 2M4KA 4CA0A 1LFUP 2ICWG 4RGUA 4BY7J 2JWTA 2ISYA 2OC6A 3HUGB 1WJEA 2ELKA 1SFKA 3RYPA 1CGPA 2DT6A 2P5VA 2ZBKA 3I54A 3M8FA 3JRAA 4J19A 3G1LA 5F6FA 2DXIA 4LGWA 4B3AA 2BGCA 2L7KA 1MJ9A 4HYEA 2O0YA 4KDPA 1FC3A 4LOCA 3JRIA 1FIPA 4WCGA 1KGSA 4ZYGA 3Q5FA 3VWBA 2R0QC 3FXQA 3BC8A 1J75A 2K9MA 2LK2A 2M4GA 3BR6A 1XMAA 2GA2A 3F3XA 2O5RA 4A3FJ 1BI3A 4Y15A 5BMZA 3QU3A 2P8TA 1GDTA 3EETA 1A5JA 3AL0B 2J5OA 4H0EA 1EV7A 2G7HA 4BJ5C 3IWFA 2ETHA 4RAYA 3CCJI 3GBGA 1TW3A 2XKOA 1T08B 1T98A 3HSRA 3GF2A 3ZP5A 2A07F 5E18F 5M5XJ 2XSDC 4J00A 2O8XA 2RKHA 4C9YA 5J3LA 3H9QA 2M9HA 4YIRX 3OMYA 2EINH 4OMZA 3ULQB 4PK4A 2IA0A 2DK8A 4YFXF 2MH2A 3RYRA 3S3NA 1B8IB 1NK3P 2VL8A 1ZAOA 2UV1A 2P4WA 3FMQA 4F52A 2MYSA 3BCBA 1YE9A 4EM2A 2DYRH 2IA1A 5DV5A 2OQRA 2JPCA 3OYIA 3BG5A 3RKYA 1XMXA 2JVGA 4HEA2 2W85A 2K86A 4PSXA 4A12A 4IJAA 2CV1A 1LB2A 5E8IA 2DFFA 4UNOA 4BQQA 2BOLA 3JTHA 3LSPA 2EV6A 2LKSA 3LAPA 2VBYA 4GYGA 4XR6A 4Y33A 3VOEA 2I5UA 2Y69H 2KKOA 2FXAA 3AFHA 3FWEA 2NVQJ 2EA4A 1NK2P 2DPDA 1WH5A 2DFIA 4ENMA 1MDMB 3HEFA 3ZQGA 2OZUA 3R60A 1XSDA 3CUQB 4HNVA 2E71A 3HRTA 4XSXF 4F55A 4FT8A 4A3GJ 1JHFA 2Q2EB 4M72A 4UXNA 5GAHJ 2ELHA 2ZJQF 1DP3A 1A36A 1X2NA 2ID6A 1BJAA 4I99C 4DYRA 4ESJA 4DGWB 1FNNA 3AG3H 3I4NJ 1USTA 3BLYA 4IL6C 4JYKA 1QHGA 3LL7A 4XLFA 1FYMA 1YOVB 3HIFA 5GAEJ 5D8LB 2PN6A 4M3BA 2BBYA 3AL0C 1WQ2A 3QYEA 4I09A 2KIFA 4YELA 4ZDLA 2PX9A 2L01A 1B9MA 3CJNA 3QP5A 4HOBA 1MBJA 1V3FA 3RCOA 3H5RA 4EATA 4A3DJ 5ICFA 2VBXA 1VI0A 3WTTC 2X9DA 4ZTFA 4EJWA
chains in the Genus database with same CATH topology
5JVGF 1YIJI 2E34A 1FOYA 1VQKI 1FOXA 1S72I 1ACIA 4V19K 2ZJPF 2JQ7A 2QA4I 2H8WA 1QA6A 3CCJI 1FOWA 1YJNI 3CMAI 3CC2I 1VQPI 2NXNB 1VQNI 3CD6I 3PIOF 1VQ4I 1YJWI 2E36A 2K3FA 3CMEI 4IOAF 1VQOI 3CCRI 3I55I 1VQ5I 1HC8A 3PIPF 3CCLI 1Y39A 3CCSI 1YITI 1VQMI 5DM7F 3CCUI 3CJTB 2OTLI 3CCMI 3CCVI 1YI2I 3G71I 3CCQI 3J7YJ 2ZJRF 1YJ9I 3CC4I 3I56I 3CC7I 3J7ZI 1VQ7I 1VQ9I 4IO9F 2OTJI 1MMSA 5GAHJ 2ZJQF 3CF5F 3CCEI 5GADJ 5DM6F 4UY8I 2FOWA 4IOCF 5GAEJ 3G6EI 2E35A 1VQ6I 1YHQI 2QEXI 1VQLI 3DLLF 3G4SI 5GAGJ 1VQ8I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JVG F;  1YIJ I;  2E34 A;  1FOY A;  1VQK I;  1FOX A;  1S72 I;  1ACI A;  4V19 K;  2ZJP F;  2JQ7 A;  2QA4 I;  2H8W A;  1QA6 A;  3CCJ I;  1FOW A;  1YJN I;  3CMA I;  3CC2 I;  1VQP I;  2NXN B;  1VQN I;  3CD6 I;  3PIO F;  1VQ4 I;  1YJW I;  2E36 A;  2K3F A;  3CME I;  4IOA F;  1VQO I;  3CCR I;  3I55 I;  1VQ5 I;  1HC8 A;  3PIP F;  3CCL I;  1Y39 A;  3CCS I;  1YIT I;  1VQM I;  5DM7 F;  3CCU I;  3CJT B;  2OTL I;  3CCM I;  3CCV I;  1YI2 I;  3G71 I;  3CCQ I;  3J7Y J;  2ZJR F;  1YJ9 I;  3CC4 I;  3I56 I;  3CC7 I;  3J7Z I;  1VQ7 I;  1VQ9 I;  4IO9 F;  2OTJ I;  1MMS A;  5GAH J;  2ZJQ F;  3CF5 F;  3CCE I;  5GAD J;  5DM6 F;  4UY8 I;  2FOW A;  4IOC F;  5GAE J;  3G6E I;  2E35 A;  1VQ6 I;  1YHQ I;  2QEX I;  1VQL I;  3DLL F;  3G4S I;  5GAG J;  1VQ8 I; 
#chains in the Genus database with same CATH topology
 2ZKZ A;  3M1E A;  4XN3 A;  3FK7 A;  1HBX G;  3BG7 A;  1RR8 C;  1Z91 A;  3CDL A;  3CZ6 A;  4OOI A;  3VDX A;  1ITY A;  2ZME A;  3D5L A;  2IJL A;  3KP7 A;  1JTX A;  3U9G A;  2XAH A;  3HXL A;  5DUK A;  4A3M J;  4V19 K;  4IQ4 A;  1T0F C;  1BOA A;  3H5A A;  3DU6 A;  2M2E A;  1N78 A;  2W25 A;  2V4J C;  1FOW A;  3PFI A;  2OU2 A;  2LNB A;  1R7J A;  1E3P A;  4PJJ A;  1ZQ3 P;  1Q1H A;  1SFU A;  1DU0 A;  2KQR A;  4NC8 A;  1YX5 A;  1HDP A;  2EFO A;  2F4I A;  2PG4 A;  5BPD A;  4A0Y A;  2LR8 A;  2BYV E;  4MFE A;  2RQP A;  3HOW J;  2CQ7 A;  3LAJ A;  1S9H A;  3FHZ A;  2O9L A;  1RET A;  1B59 A;  3S1N J;  5CVJ A;  1HLV A;  3DP7 A;  2V79 A;  2OZ6 A;  3DEU A;  4GGG A;  3O6B B;  2OF7 A;  2KZV A;  3CUQ C;  3IAM 2;  5AIP A;  5IP6 A;  3OY9 A;  2XPU A;  2GAU A;  1D3Y A;  4M73 A;  3REO A;  3K4L A;  1PUF A;  4HW0 A;  2Q1Z B;  2VKE A;  1YO5 C;  1E3H A;  1Z7L A;  1O3S A;  2JVH A;  1FTZ A;  2CUZ A;  3LMM A;  2XRL A;  4RLQ A;  4Q5S F;  5E8G A;  1SD4 A;  3L2Q A;  1CF7 A;  4RAF A;  4IRI A;  4ZYH A;  3CDH A;  4UVB A;  3PUB A;  2EH3 A;  3T1B A;  2JRM A;  2DA7 A;  3RSN A;  2ZJR F;  3P9K A;  3WTZ A;  1ETQ A;  3BJO A;  2Z9O A;  2D5V A;  2LTP A;  1U3E M;  1FZP B;  4IPA A;  2IGN A;  3GZ5 A;  3BP8 A;  4F93 B;  4C2U A;  4IO9 F;  4C2T A;  3WU2 C;  3ML6 A;  3M9A A;  5ICE A;  4OU0 A;  3RKW A;  3ONQ A;  4KA4 A;  1PUE E;  4A3B J;  3ZCO A;  2F5F A;  3TP0 A;  2DOA A;  1IXS B;  1KU7 A;  2VE9 A;  5B66 C;  3T5X A;  4B8X A;  1MSE C;  5DCM A;  4HDV A;  2H6B A;  3GVA A;  1YRN B;  3P9I A;  4OIP F;  1TLH B;  3KEO A;  3Q0W A;  4C2M J;  1A35 A;  1ZRD A;  2QZ8 A;  3MD2 A;  2DW4 A;  5DTD A;  2F48 A;  3HM5 A;  3NWS A;  1SFO J;  2HZD A;  2O7O A;  2HOE A;  3ZMU A;  1HQC A;  2Y9Z A;  4XLH A;  3FF5 A;  4B43 A;  4DZP A;  5M3M J;  2VOO A;  3HC7 A;  3ZN0 A;  5K5R A;  4D5F A;  2DK5 A;  4J01 A;  4N9H A;  1D0X A;  1IV8 A;  2LF7 A;  2Y0M A;  3LQQ A;  3ELK A;  2CO5 A;  4EGZ A;  4A93 J;  1LKX A;  4EM0 B;  1MMN A;  1ZYR F;  4R1H A;  1B6A A;  4YIF A;  2VOP A;  2KJB A;  4ETS A;  5EF6 A;  3BR2 A;  1R1U A;  2KMU A;  3P7N A;  2WAQ N;  2F5E A;  5FKO A;  1K7A A;  4I02 A;  3HRS A;  4A5M A;  5HLG A;  1R36 A;  1WJD A;  4WXC A;  4I0A A;  4L9V A;  2COB A;  1UHW A;  2K3F A;  2RNG A;  2RV8 A;  5D5X B;  3PSI A;  4ESF A;  2HNH A;  2PMZ A;  2QUF A;  1EH8 A;  3PJR A;  2YUS A;  5H6Q A;  3PQK A;  3DPU A;  4U7B A;  3CJR B;  2NS8 A;  3HOX J;  1VQO I;  3N4M A;  5B3S H;  5FRN A;  3QP6 A;  3I0T A;  2BHZ A;  3EDP A;  4EJT A;  1G2H A;  1MMA A;  2E1C A;  3GTO J;  4KIB A;  1P4X A;  3KEY A;  5IP9 J;  3DTI A;  2WWY A;  1JUP A;  3WOD F;  1R1V A;  2M7B A;  4RDU A;  1WZ2 A;  1XN7 A;  4OAZ A;  4LLN A;  2CQN A;  1IRF A;  1FTT A;  3Q9S A;  1R71 A;  2F5C A;  4IHW A;  2L7F P;  3KP6 A;  4L9J A;  5DD8 A;  3S15 J;  5JFR A;  1FBQ A;  1IZ1 A;  3LSM A;  4XRM A;  1Y0U A;  3X2Q H;  3ZMT A;  5HDN A;  2V6E A;  4M9S A;  4XL9 A;  1R5I D;  1QPI A;  2PI0 A;  2X85 A;  3W2A A;  1BA5 A;  4A3I J;  2L9R A;  1K4S A;  2STT A;  1I39 A;  2P5K A;  3Q3S A;  1SD6 A;  2X48 A;  2COM A;  4DZJ A;  3E6M A;  2DFH A;  2HGC A;  1G3S A;  3I56 I;  5KK1 A;  1SAX A;  4BHP A;  4ZTJ A;  4BDZ A;  1SVM A;  3N05 A;  4JQF A;  3MKW B;  3C7J A;  2GQQ A;  1X1P A;  2JA5 J;  1MMS A;  3G2B A;  1XDS A;  4RGS A;  3ECH A;  3FK6 A;  1LFB A;  4BHC A;  1S29 A;  3BZ6 A;  3FXR A;  3S3O A;  3C3W A;  4C3I J;  2Y30 A;  5FB2 A;  1VFC A;  2ZME B;  3HJE A;  4HX7 A;  4E7J A;  1S6L A;  2DQR A;  3RPU D;  3ABK H;  4PUS A;  2FRH A;  5ERI A;  4U0V A;  1ZN2 A;  2DJN A;  2XV4 S;  1KQ9 A;  2M0M A;  2UZK A;  2D45 A;  3MKY B;  4FCY A;  4CUG A;  3DFG A;  1HKT A;  1J9I A;  5J1U A;  4A3K J;  1STZ A;  3P9C A;  4OIN F;  4E6K G;  1T6S A;  2H1L A;  1VQ8 I;  1BR2 A;  3J80 Z;  2X1D A;  4LK1 F;  5IOZ A;  3HOV J;  2CW7 A;  1UAA A;  4X6A J;  1G3W A;  3I4M J;  1R5G A;  4M71 A;  2CV0 A;  1ULY A;  2ZJ2 A;  1ZRC A;  2JTV A;  2GIV A;  2BV6 A;  4P96 A;  4C3J J;  1XGM A;  1YJN I;  4MNU A;  3WGG A;  4HF1 A;  2W57 A;  1J2X A;  4CHU A;  3DPL C;  4H4K C;  4WXH A;  3K7A J;  1L3L A;  4G12 A;  3IH3 A;  1LNW A;  1F43 A;  5BPI A;  2QGU A;  2XGX A;  1J5Y A;  1PUF B;  3CO7 C;  1V54 H;  2E36 A;  3K6G A;  2E2I J;  3DKX A;  3FBI B;  2P7C B;  1ETW A;  4D1Q A;  4RB2 C;  4G7O F;  3M8J A;  4HF0 A;  4M6Y A;  2DMU A;  1IG7 A;  1XPX A;  1CF7 B;  4XOR A;  4P5O A;  4LIV A;  5F64 A;  5L3D A;  3GWZ A;  5HNF A;  3KYL A;  1AKH A;  3WG9 A;  2DCE A;  3PIP F;  1HW2 A;  3CCL I;  1FEX A;  2VI6 A;  5TJJ A;  1NH3 A;  3LNQ A;  2IS4 A;  4EVI A;  4S0H B;  2HQ5 A;  2JSC A;  2H8R A;  1AOY A;  1FBU A;  2NOJ B;  3HGG A;  1MBE A;  2HS5 A;  5J4V A;  3H1C A;  3LSK A;  4K2E A;  4E7S A;  2X6Y A;  4CCN A;  2DQL A;  2RN7 A;  2KIQ A;  1BIB A;  2VXD A;  3W3C A;  2ZME C;  1T56 A;  4EJO A;  1YIO A;  1UHS A;  1QVU A;  2RQQ A;  5KVR A;  1VF9 A;  5DCM B;  1HOM A;  4F91 B;  1YG2 A;  5D4R A;  2ECC A;  1LE8 A;  2K9S A;  3KP2 A;  1SD7 A;  3U2R A;  3E6D A;  1SC7 A;  1NTC A;  1UFM A;  2XF6 A;  4LFU A;  3OYH A;  4FX0 A;  5LHG A;  2ME6 A;  2I8D A;  4IQJ A;  3CP2 A;  1Y0N A;  2RC4 A;  2DMN A;  1NG6 A;  2ZXJ A;  2CW0 F;  5F1R A;  1PP8 F;  4UY8 I;  4IOC F;  1K6Y A;  2MA3 A;  3KET A;  4KNY A;  4CSW A;  2R5Z A;  4BS9 A;  2IS2 A;  3HRU A;  2R93 J;  4DOZ A;  1WCM J;  1WI3 A;  5KAF C;  2ZXH A;  4CIC A;  1LDD A;  3PO2 J;  3G1M A;  2KDO A;  2EIJ H;  4CXF A;  3WTU C;  3NRV A;  2LFB A;  3TMO A;  1FOX A;  5FKM A;  2ZSI B;  4G7H F;  2XGC A;  2STW A;  4PJ0 C;  1QBJ A;  1JTY A;  3ZPL A;  5BQT A;  3KYC B;  3HSF A;  2W7N A;  4XKV A;  3QWL A;  3MFK A;  1E0E A;  4HX4 A;  3TKY A;  2IVM A;  2EZH A;  3FX3 A;  2DJI A;  2QA4 I;  4IVN A;  4O6J A;  5IYD J;  4ZZD A;  4UB6 C;  3OYF A;  3ZQF A;  1S7O A;  3I53 A;  4BGD A;  4XID A;  3DKW A;  1JJ8 C;  3G73 A;  3W2V A;  1BI0 A;  1FPQ A;  1FSE A;  1LVK A;  1XGO A;  1KZH A;  1JJ6 C;  2WAD A;  1Z77 A;  1O7F A;  3A01 A;  3L2V A;  1P2F A;  3BWG A;  3BPV A;  3KX2 A;  4NQW A;  3RDI A;  3OS2 A;  2DYS H;  2AHQ A;  3MWM A;  4LJZ F;  3QPS A;  3JW4 A;  3LA2 A;  5JR3 A;  2DT5 A;  4ENN A;  2M5W A;  1MH3 A;  5FD6 A;  5FFX A;  1UJ8 A;  3L2C A;  1USS A;  3MMY B;  4AU7 A;  3UNG C;  4QPQ A;  2JUC A;  1XGN A;  2F2E A;  4UVC A;  4CDG A;  4F3Q A;  4Y13 A;  4BBS J;  1EH6 A;  2ID3 A;  2RVC A;  2F5D A;  3LWF A;  1ZKG A;  4IXA A;  5LHI A;  1Y39 A;  3OOU A;  3U21 A;  2EIL H;  2VJI A;  2KLO A;  1Z7U A;  1S3J A;  2HPI A;  2V26 A;  3IH4 A;  4OWR B;  2BEO A;  2K4B A;  4XK4 A;  1KYZ A;  1YIT I;  1LQ1 A;  4Y17 A;  3S2D J;  1P4W A;  2E60 A;  3F22 A;  2X0L A;  4C3H J;  2FBI A;  3E3V A;  2IAI A;  2FF4 A;  1MNM C;  2F4M B;  1TWC J;  1WKM A;  1APL C;  2DOD A;  5E17 F;  3H3U A;  3BJ6 A;  2MSY A;  4N0B A;  1R22 A;  3CC4 I;  3JRC A;  2RRE A;  3H3V K;  5D5U B;  1WHU A;  2VQL A;  2JJ7 A;  5CQE A;  2Y75 A;  3A1Y A;  4N9I A;  3IRR A;  1IO2 A;  1XDU A;  2VT3 A;  4XSZ F;  3CF5 F;  2JZY A;  2EIM H;  4OIQ F;  1O7L A;  1X3U A;  2EZK A;  4HF2 A;  2FQ4 A;  3S32 A;  1QO0 D;  5AON A;  2WY7 Q;  3ZGK A;  5DCF A;  5F04 A;  3LSR A;  4BXF A;  1KU2 A;  1D1C A;  2E35 A;  2W24 A;  5C3E J;  2L2O A;  3V7C A;  1XC5 A;  1EH7 A;  4RAZ A;  2QEX I;  5FLV A;  3G4S I;  5FFZ A;  4EEF G;  4LLL A;  3RJP A;  1NG7 A;  2GA1 A;  2R7Q A;  4PCQ A;  3E97 A;  2ISZ A;  2HTJ A;  2VOD A;  3TDZ C;  1YIJ I;  1Z1D A;  1YS6 A;  3H35 A;  4HV5 A;  4NC6 A;  3H0G J;  1T95 A;  4DIQ A;  2Q0O A;  1U5T A;  4HLY A;  2M0C A;  3DTK A;  1WWX A;  4U7D A;  4CH7 A;  3K10 A;  4RBO A;  3ZQH A;  3UKG A;  2HKO A;  1R23 A;  2VBZ A;  3S1Q J;  3BR5 A;  2FML A;  5FGM A;  4XIC A;  2JQ7 A;  3L9F A;  5A2Q K;  1YW8 A;  3QOP A;  3JSO A;  5E20 A;  3MZ8 A;  2FQ3 A;  3E5X A;  2BE5 F;  1IXR C;  4EJV A;  1AKH B;  4A3C J;  3DBH B;  2NXN B;  4QSH A;  3GCM A;  3R6S A;  5J8C A;  3QU6 A;  3KPH A;  1MBF A;  1I3A A;  1ODD A;  1R9T J;  2EV5 A;  2AO9 A;  4MHG A;  5C44 J;  3WTS C;  5JVT A;  2CUF A;  5FO5 A;  2JA7 J;  3F9K A;  2B63 J;  2R7Z J;  1A6I A;  2LDU A;  2O6G E;  2HOA A;  4IOA F;  5FLX Z;  4BQN A;  3DCF A;  2ZXI A;  1YRN A;  1B72 A;  2HEO A;  3F8C A;  4S05 A;  1WI9 A;  1LE8 B;  2EPF A;  2WB1 A;  2R7O A;  4M9X A;  5E3O A;  1TWF J;  4EV0 A;  2VQC A;  4XKW A;  1J0R A;  3BTC A;  3VEP A;  3I3L A;  2XPV A;  1W5T A;  4XLN F;  1HST A;  2HU9 A;  2Z5U A;  1O3R A;  1OPC A;  2XPW A;  1ZR2 A;  4D7N A;  2VN2 A;  2R7D A;  2Z3Y A;  3SHF A;  2W48 A;  4RMN A;  1K78 A;  3MAJ A;  1C0W A;  2MGQ A;  2D1H A;  3CES A;  1BI2 A;  3FBN B;  5FRM A;  1YLF A;  2R5Z B;  3G71 I;  3SFZ A;  1PDN C;  1DPU A;  3SZT A;  1YJ9 I;  3P5J A;  2FJ1 A;  3QOE A;  3DKY A;  4I01 A;  4B09 A;  5GP9 A;  5GTI C;  3GFI A;  3OYM A;  4MEY F;  4XLA A;  2LYC A;  4AD9 A;  3O8G A;  3A4C A;  2EV0 A;  4FE7 A;  3ASN H;  1F5T A;  4UV9 A;  3K2Z A;  1B1B A;  4QPO A;  4RB3 C;  4II3 A;  2ZXW H;  2MFZ A;  4A3J J;  1MMG A;  2L02 A;  4UB8 C;  2QSG X;  1OCP A;  2Y0S N;  4NUB A;  1IF1 A;  3TOB A;  3RQI A;  5J1Y A;  3QAH A;  5LRS A;  3S2W A;  4UHT A;  3PQJ A;  1D1B A;  1JI8 A;  2JRT A;  4KT6 A;  3OYC A;  1OYI A;  3VOD A;  1JUS A;  1V5E A;  2TCT A;  2L4A A;  1N25 A;  2QSF X;  4AUX A;  2CFO A;  3O2P E;  4ZJZ A;  3F6O A;  5KCM A;  4W1U A;  2XIG A;  5EJC A;  2MG4 A;  4A2U A;  2XF7 A;  3AKZ A;  1JKR C;  3I71 A;  4FAS D;  3E6C C;  1TZL A;  5GAG J;  2A69 F;  2KRF A;  3JRB A;  3H9G A;  3FXJ A;  1TC3 C;  4HSR A;  1REP C;  1GUU A;  5J6X A;  2R7W A;  2A6H F;  3BTL A;  1PJR A;  1E2X A;  3SZG A;  5FD5 A;  1RPW A;  3A01 B;  3HGY A;  4NQW B;  2CJJ A;  4KIT B;  4PGH A;  2XC7 A;  4XRS A;  2DO7 A;  1XCV A;  3LQR A;  3LFK A;  3HTS B;  1JGS A;  2QWW A;  4YFN F;  1WJB A;  4CGZ A;  4ZYA A;  3BQZ A;  1UCR A;  2DA1 A;  4PZJ A;  4CCL A;  1U8R A;  3QOD A;  1OMI A;  3CMA I;  2FE3 A;  3FXO A;  2DA6 A;  3M7G A;  2M3A A;  3KLO A;  1G6N A;  3VPR A;  4U0Y A;  4ZYD A;  3A2K A;  1X1A A;  3FXK A;  1OCZ H;  4P9U A;  3K1M A;  5F0H A;  1VQ4 I;  3MKZ A;  2VQG A;  4IHX A;  4EMS A;  3F8B A;  4G9Y A;  1FYL A;  4I0B A;  4NC7 A;  2VLA A;  1W1W E;  2ZO4 A;  4IF4 A;  4KT5 C;  5GPA A;  3ERM A;  3A02 A;  4NNJ A;  3JAM K;  4AVP A;  4A5N A;  1I1S A;  5LEJ A;  1YYV A;  4M3D A;  1Z67 A;  1IN6 A;  3G1O A;  3SDG A;  1XMK A;  3I59 A;  2FOK A;  1TWH J;  2A05 A;  3IP4 B;  4ZH4 F;  4ZDO A;  1ZG3 A;  2HYJ A;  1ONV A;  4EGY A;  1K6O A;  3W6J B;  1TQP A;  2AXL A;  2M45 A;  3ZRG A;  2NYX A;  5DM7 F;  2R7T A;  5H2F C;  4I6Z A;  1MBK A;  3MQ0 A;  3FIS A;  3ABT A;  1XG1 A;  1DP7 P;  2QEN A;  2OTL I;  2OBP A;  3LOC A;  3PFY A;  2XGD A;  2L9S A;  2O3F A;  2Q8K A;  3TO7 A;  3E6B A;  4HV6 A;  5EG0 B;  2G9W A;  2L3D A;  5E3M A;  3S3M A;  5IYC J;  1IRG A;  2DFE A;  2H6C A;  5KHD A;  3GFJ A;  1SAU A;  1K83 J;  1FY7 A;  5D5V B;  2FBH A;  1OQY A;  1PP7 U;  2BY3 A;  1BC7 C;  4O5V A;  2IP2 A;  4IEJ A;  4M3F A;  3T8T A;  4FHT A;  4XM3 A;  1GXP A;  1U5T B;  5L3G A;  2VAS A;  5E3L A;  3HPH A;  3BDD A;  1YW9 A;  2XF5 A;  1Y8R B;  2E1M B;  1XS9 A;  1VQ6 I;  1WPK A;  2QF7 A;  1E3O C;  2PJP A;  4IHS A;  1A31 A;  3DEE A;  4JP0 A;  2CRG A;  1Z3Y A;  1MMD A;  2HDW A;  4U87 A;  3OYB A;  1D5Y A;  2QM3 A;  4AIK A;  4CO8 A;  4F92 B;  1DGR M;  2EB7 A;  4GRI A;  3ZXS A;  3MVP A;  5CVR A;  4RB1 A;  2VON A;  3OYA A;  4I7H A;  2R7U A;  4BH9 A;  3HYI A;  2G0E A;  2A68 F;  3SFI A;  5BOX A;  3S8P A;  4E7Z A;  1I6X A;  3WHC A;  1QA6 A;  2HVS A;  1B72 B;  2BY0 A;  1JKQ C;  1QU3 A;  1QZZ A;  3ZQL A;  1LDK B;  5J4Y A;  2WAE A;  4L5J A;  2CH0 A;  2OQG A;  4XOT A;  4Q4Z F;  3RKQ A;  3V4G A;  3CC2 I;  3PL8 A;  3EYI A;  1RC9 A;  4KFC A;  1D1A A;  1W5S A;  4E7I A;  3TL4 X;  3ZN1 A;  1FLI A;  2VKH A;  1K4T A;  4DNC A;  1BIA A;  1MBH A;  3DBR B;  4HAM A;  4R79 A;  3JRF A;  4EM1 A;  1OKR A;  1K78 B;  3S17 J;  1IN8 A;  2NNN A;  3D5R C;  3ZQQ A;  3S16 J;  2VKD A;  2B0L A;  3OYE A;  4JK1 X;  4U0W A;  1AHD P;  3L09 A;  3BRO A;  4AYB A;  5CPR B;  4GDF A;  1MJA A;  1WJC A;  3BCA A;  4L0Z B;  2RNJ A;  1KQ0 A;  2YPR A;  2ZFU A;  3OYK A;  4KUM A;  3ZOB A;  1XD7 A;  2DA5 A;  2DA2 A;  2HVQ A;  2FSW A;  2RAE A;  3HZJ A;  1EA3 A;  3I4P A;  4DYQ A;  2MLK A;  3GUD A;  3WU1 B;  4HG2 A;  1MZB A;  1U5T C;  2GZW A;  3HRM A;  2CQK A;  5EYR A;  1M1E B;  2JK3 A;  1ZH5 A;  5K1Y A;  2LY9 A;  5E1X A;  2E1M C;  1TBX A;  3W6V A;  3LST A;  2D1V A;  2YR2 A;  5F27 A;  3M1C A;  3R61 A;  4LIT A;  3A0H C;  1FMV A;  3FXL A;  1QQI A;  2EFQ A;  2IPQ X;  3HKZ A;  4BJT A;  1BC8 C;  1ZRF A;  4JX4 A;  3K4B A;  1QZE A;  2PMU A;  3FMR A;  3PNT A;  5D6E A;  2K9N A;  1KON A;  1UEL B;  4EJU A;  4BDY A;  5D5W B;  2L7Z A;  1P9Q C;  5DEQ A;  3HOT A;  2TRT A;  4D7M A;  1WFX A;  5LRR A;  3V7R A;  1W0T A;  4HPQ A;  1UHM A;  1B4A A;  3GX4 X;  2R7S A;  2VPL A;  5HS9 A;  2QSH X;  1Z6R A;  2W84 A;  2GXB A;  2QBY A;  3BQY A;  3BT9 A;  3BTI A;  4G6Q A;  2WAQ A;  1H8A C;  2X51 A;  2IGK A;  2Y31 A;  4Q47 A;  4BY1 J;  3OYN A;  5D8K B;  5LGU A;  2CU7 A;  2JUG A;  1RKT A;  4P9F A;  4CYC A;  3HSE A;  3KEQ A;  1VQK I;  3Q0U A;  5L3F A;  4HQM A;  2EIK H;  2K4J A;  4BYY A;  1Y8Q B;  2BVM A;  1GT0 C;  3E5U A;  2X6X A;  4ZZL A;  2ZJP F;  1IXC A;  2LMD A;  2H8W A;  2KRH A;  4XRF A;  1BW5 A;  3L00 A;  3K4J A;  5B1A H;  2CG4 A;  5HLI A;  1E17 A;  1X19 A;  3I59 B;  2V9P A;  1VQP I;  3T0Y A;  1R49 A;  2GXA A;  2F5V A;  3TQN A;  4KMF A;  1KU3 A;  2V7F A;  4MEX F;  4ESB A;  3V7S A;  3WGI A;  4FTH A;  5DDG A;  4HQE A;  2CYY A;  2QKL B;  5CVV A;  5F1J A;  2HVR A;  1TT5 B;  3ASO H;  1HXD A;  3R4K A;  1OCC H;  1ZTR A;  1T8I A;  2VXZ A;  2HDC A;  2VKV A;  3L2R A;  2JN6 A;  2L9V A;  2FU4 A;  3SYT A;  4HNT A;  3CCR I;  3AG2 H;  4P55 A;  3OSF A;  3MZH A;  2LBF A;  1KYW A;  4E7H A;  3MN2 A;  1ETO A;  2HTS A;  4B1R A;  3J81 K;  1JT0 A;  1K79 A;  6PAX A;  3GO5 A;  3HPG A;  1X2M A;  1HDD C;  4PGG A;  5IP7 J;  4MQV A;  2OCE A;  3K4C A;  1TWA J;  2HDD A;  3S2H J;  3CJT B;  3PSF A;  5D4S A;  2E5Z A;  3OYJ A;  1WRJ A;  1YQA A;  2K9L A;  3QPL A;  1U6G A;  4CZC A;  4KMU X;  4LB6 B;  3CF2 A;  3FMS A;  3F72 A;  1L0O C;  3HHH A;  4IZZ A;  2IA2 A;  3ZR8 X;  1J7K A;  4KJZ A;  3ZMV A;  5K5O A;  2XSJ C;  1HW1 A;  3GZ6 A;  3IKV A;  2KJC A;  3FXU A;  1H9G A;  3PNV A;  2MH9 A;  1JXS A;  3K4K A;  1MGT A;  1ZEL A;  4UVA A;  2BY1 A;  3HOY J;  5GTH C;  4BHB A;  1ZGJ A;  5ILS A;  3RZO J;  5FKK A;  3VSL A;  3CO6 C;  4BU2 A;  1RIO H;  5DS9 A;  2HXO A;  4B44 A;  3HOZ J;  5EEG A;  3DLA A;  3BG3 A;  2M8E A;  4N4N B;  2KT0 A;  3RPQ A;  1Y1V J;  5DYM A;  5ILV A;  4Z2Y A;  2R5Y A;  3G6E I;  2YU3 A;  2AQE A;  5JLX A;  4XOP A;  2M8G X;  1WJF A;  3ZQI A;  3K4N A;  4FIS A;  3NEU A;  5AIQ A;  2ZC2 A;  1O3Q A;  3FZV A;  3BR1 A;  5TIS C;  3DEW A;  2XB5 A;  4CCO A;  3C1D A;  3K2A A;  2HYF A;  3M4O J;  2UXN A;  1X4P A;  2K40 A;  1D5V A;  3MEX A;  4L5I A;  2L4M A;  3DU5 A;  2G7U A;  3GLX A;  1T2K A;  2E2H J;  4QLC U;  5F0C A;  3AAF A;  3TOA A;  1ZHF A;  1D0Y A;  2P0W A;  4Q48 A;  3V8K A;  1GVD A;  3OV8 A;  1HKQ A;  3U1D A;  1SAN A;  5LEK A;  3VB2 A;  5HOO A;  1RUN A;  3BTJ A;  1MND A;  1OFC X;  2PMH A;  2VT2 A;  2X1E A;  1ETY A;  1ON2 A;  3A03 A;  1OCO H;  3LA3 A;  5EZH A;  5K5Q A;  3SJM A;  1DDN A;  4OIO F;  1ZGW A;  3GXO A;  5LGT A;  3TW7 A;  5DD4 A;  1FOK A;  3ABL H;  1OJL A;  2QQ8 A;  5E79 C;  4ZDP A;  1P7J A;  2XRN A;  2EK5 A;  2PJR A;  4E7K A;  4RM2 A;  2LOO A;  4M9Z A;  1GXQ A;  2YX4 A;  1VQN I;  4BEH A;  2LD5 A;  1J59 A;  3CD6 I;  2JA6 J;  4KIS A;  3GTG J;  2OV7 A;  4GYI A;  2DA3 A;  1GV5 A;  1ON1 A;  2GWR A;  4IHT A;  2K3P A;  4ON0 A;  1Z9C A;  4LK0 F;  3W2W A;  2BHY A;  4PSW A;  1HCR A;  2IXS A;  4AC0 A;  5BS6 A;  3GFM A;  4ENK A;  1OR7 A;  3Q0V A;  5FKN A;  2Y9Y A;  3TBI A;  5FLM J;  1TNS A;  1MH4 A;  2MC3 A;  4LMY A;  4LB5 A;  2K5C A;  1VZ0 A;  4XKC A;  4X0G A;  2HOT A;  1JGG A;  1VTN C;  2LY2 A;  2OUM A;  1IJW C;  1AA7 A;  2CUJ A;  2W00 A;  1W0U A;  2P6T A;  2V1X A;  1VQM I;  3CCU I;  1FMW A;  5FLX K;  1RKW A;  2GBY A;  3OIO A;  2B7E A;  4LD5 A;  2ACJ A;  1BI1 A;  3HTU A;  3CCV I;  3M07 A;  3D5S C;  3CCQ I;  2EQR A;  1S7A A;  5CQG A;  2L0K A;  2Z1D A;  2ESN A;  1I6H J;  3B73 A;  1SVL A;  5KAI C;  1ERD A;  1KQ8 A;  2XB0 X;  3ESW B;  1ORK A;  2QBY B;  2UUZ A;  1LVA A;  2LG4 A;  3GTM J;  2OTJ I;  2VJ4 A;  4IRG A;  3EYY A;  1IDY A;  2XGE A;  2FX0 A;  1T33 A;  4MIM A;  1HF0 A;  2EFN A;  4G8X A;  2K27 A;  1N77 A;  4II2 A;  4CYC B;  3OS0 A;  2KDZ A;  4FX4 A;  1SEU A;  4XLC A;  1AWC A;  1AU7 A;  2DBB A;  3W6K B;  3F8M A;  3IKT A;  1ZG5 A;  2VB6 A;  3TP3 A;  4AID A;  2R7R A;  1VQL I;  1XSX A;  4E7L A;  2LRD A;  2XKP A;  1J09 A;  1A6Q A;  1MD0 A;  1PYV A;  3H9J A;  3PNY A;  3H0D A;  1R5H A;  3HOU J;  3OR1 C;  3F23 A;  3GTJ J;  2A5W A;  2VQH A;  5TRD A;  2WC2 A;  2L5Q A;  5KNL A;  1FIA A;  4N4O B;  4U88 A;  5HVQ C;  5JVG F;  4L5E A;  2E34 A;  2MLG A;  4QIW N;  4FE4 A;  1GVJ A;  1ACI A;  4HNU A;  3K70 D;  3E1S A;  3WGH A;  4CYD A;  3IRQ A;  2GXG A;  2KZG A;  3H36 A;  4XRS G;  4BE1 A;  2V1N A;  4UUV A;  4MLO A;  3DQV C;  4KIF A;  3IHU A;  2LBF B;  5EG0 A;  5LBQ A;  1P7I A;  3GTP J;  3GTQ J;  4QWQ A;  5M3F J;  2XRO A;  2HPM A;  2BW3 A;  3QYF A;  1YJW I;  1XX5 A;  4LG0 A;  1BBY A;  2X1C A;  4JX5 A;  2JT1 A;  1FP1 D;  4WXD A;  3RIR A;  4Z6Y A;  3CJQ B;  3RI4 A;  4ABZ A;  5J8F A;  1RZ4 A;  1MNE A;  1UB9 A;  4ASN A;  4F7Z A;  3PO3 J;  3S1M J;  1BR4 A;  1VQ5 I;  2EBI A;  2O8K A;  3M8E A;  1DQU A;  1V5G A;  2VJ5 A;  4GFB A;  3VSK A;  5J1R A;  4D5C A;  2FUG 2;  3KZI C;  3IL2 A;  1W36 C;  1TNT A;  2EFP A;  1BOB A;  4RAG A;  4GO1 A;  1RR7 A;  3HHG A;  2CW8 A;  2M1B A;  4HX8 A;  1R00 A;  2P5L C;  4HST A;  1BW6 A;  4RB0 A;  5ICC A;  4L18 B;  4XMY A;  4A3L J;  1Y6I A;  2Z33 A;  2FNA A;  1LPQ A;  1OLT A;  4QTR A;  3CCM I;  1JHH A;  2R5Y B;  3ZMS A;  4BE2 A;  1ENH A;  4RM3 A;  2ELJ A;  1YTY A;  2MAB A;  2D2W A;  2FMY A;  4PFO A;  3PM1 A;  2E2J J;  1SVO A;  1LFP A;  2XAG A;  1H89 C;  2I10 A;  2GLO A;  1N75 A;  4MQ9 F;  2NNY A;  3CP8 A;  1IN5 A;  1ZLK A;  3KLN A;  3IUO A;  2ESH A;  2L9N A;  1R58 A;  3OYG A;  1BJZ A;  3BR0 A;  4JBA A;  2HFH A;  1TL8 A;  1D8J A;  2QQB A;  1QRY A;  3WTV C;  4ITV A;  1H88 C;  4XKB A;  1X1B A;  3ERE D;  3HOS A;  3CLQ A;  5HS7 A;  4RLF A;  1X3W B;  3V8L A;  2HYG D;  1ZAR A;  3QYB A;  3I9V 2;  2MC4 A;  3EUH A;  2DAO A;  1S8N A;  3ZQC A;  1Z0X A;  1YW7 A;  3MZY A;  3ECO A;  3KP4 A;  4UV8 A;  2HWV A;  2WTE A;  2PJR B;  1DGW Y;  3SQN A;  4MTD A;  2J5P A;  4IHV A;  4BUP A;  4BEH B;  1IRZ A;  4FET A;  3VFZ A;  2X6O A;  5LD2 C;  3C2G A;  2PEX A;  3PUF A;  2NOG A;  3AG1 H;  4BQO A;  1S72 I;  2LLK A;  1SD5 A;  1D0Z A;  2HOS A;  3IWZ A;  2QKM B;  2QYO A;  3GME A;  5EEH A;  4MFD A;  1U8B A;  2LRE A;  3F8N A;  1TP4 A;  5M5Y J;  1ZG1 A;  4KN4 X;  4YRV A;  5D6F A;  2R7F A;  1D8K A;  2FD5 A;  3WE2 A;  3OYL A;  2NS7 A;  3VYU B;  2EZL A;  3BZC A;  2WV1 A;  1FJL A;  2YU9 J;  3HL2 A;  2UXX A;  3CME I;  1R6R A;  1P6R A;  2LKX A;  2OAZ A;  3O8H A;  1IUY A;  5CKT A;  1Z6T A;  4HLX A;  3OIQ A;  2AS5 F;  1TTY A;  1OCT C;  4WWC A;  3B6A A;  2O61 A;  1LJ9 A;  3NAU A;  2PQ8 A;  1IN7 A;  3OIP A;  4GCV A;  5HLH A;  1K61 A;  1QNT A;  2K85 A;  2CV2 A;  1RUO A;  5IT9 Z;  2DOE A;  1HC8 A;  3F8F A;  3CUO A;  1IV6 A;  2YS9 A;  2XAF A;  2LKP A;  2WY8 Q;  1DPR A;  2Z2S B;  4A3E J;  3DF8 A;  3I58 A;  1P4A A;  5HS8 A;  4M6X A;  2AQF A;  2DLL A;  1O3T A;  3OS1 A;  5ED4 A;  1WVR A;  3QQA A;  4DJA A;  2DMT A;  4BAC A;  3HDD A;  1W36 D;  2Y0S A;  2OD5 A;  3WTY C;  3COA C;  1Z21 A;  3NAR A;  3L7W A;  5JLW A;  3VYT B;  5A2Q Z;  2ZNZ A;  4LLG F;  2XAS A;  3UR3 C;  2B9S A;  3J7A O;  4B48 A;  3K4M A;  2XUB A;  5EGO A;  3AG4 H;  2F4O B;  1BN5 A;  2DPU A;  1G3Y A;  1TT0 A;  2W4S A;  2Z99 A;  5LGN A;  3FKJ A;  2FOW A;  3K69 A;  3Q9V A;  4XQF A;  3EUK L;  4IX7 A;  1FP2 A;  3K0L A;  2A5Y B;  2PLY A;  3KZZ A;  2NVX J;  4M6V A;  5C4X J;  1ZLJ A;  5HOD A;  3C2B A;  4PDK A;  3JR9 A;  4XON A;  1O4X A;  1YHQ I;  5TGT A;  2HZT A;  3HG9 A;  3WE3 A;  1F36 A;  2JA2 A;  1OR7 C;  2DN0 A;  4ENJ A;  3C18 A;  3CMY A;  5EEA A;  2ADU A;  4YII A;  2H09 A;  1F4K A;  3QPH A;  4HBL A;  1MBG A;  2HKX A;  3E5Q A;  1ETK A;  1U9N A;  2BW3 B;  2LY1 A;  4KIG A;  4B3X A;  1I1G A;  5IPA A;  1JT6 A;  4RGX A;  2NVT J;  1LEA A;  4BXX J;  4LG0 B;  3BOQ A;  5CVU A;  1F1Z A;  4HRI A;  4DQ2 A;  3TED A;  4A69 C;  5DUI A;  3GTK J;  1W7P B;  1S5L C;  3SEZ A;  3RQ4 A;  3KE2 A;  5HLT A;  1BM9 A;  2K02 A;  2NAZ A;  2R4G A;  5ICG A;  3FHN A;  4AVZ A;  4BBR J;  2DTZ A;  3S1R J;  4PJN A;  1FYK A;  5F0F A;  3FXM A;  4B4C A;  4HA8 A;  1PVE A;  2V9K A;  3KIO A;  2JMW A;  3GEZ A;  3RKX A;  2NRA C;  5HDK A;  1G3T A;  4V2F A;  2NVU B;  1TWG J;  1IRX A;  2GOX B;  2KHM A;  3OL4 A;  2IS6 A;  5JI6 A;  3DV8 A;  1X3Z B;  1FT9 A;  3EQL F;  2DT7 B;  4AYB N;  3N97 A;  2E7W A;  1XCB A;  5BNG A;  2R92 J;  3IAS 2;  4Y4R A;  2WV0 A;  4W97 A;  3L1P A;  3O3K A;  5IYB J;  3RZD J;  5FKL A;  5K7H A;  1T38 A;  2OPT A;  4JX6 A;  1MSF C;  1DU6 A;  3NWT A;  1SFX A;  3J80 K;  2GM4 A;  2KRC A;  2PMZ N;  4NDL A;  1XTA A;  3CCS I;  2CMP A;  4E4H A;  1EKE A;  4ZC3 A;  2DTR A;  3JTG A;  2P7V B;  3K1N A;  1OYY A;  1XB4 A;  4UUS A;  3L2U A;  2CQQ A;  2BXZ A;  2LF8 A;  3JCU C;  1QZY A;  3B02 A;  3WU0 A;  1FBS A;  1VND A;  5CYV A;  1W4M A;  3HB9 A;  4WF2 A;  4AWX B;  2V9V A;  3HKZ N;  5CVI A;  2R7X A;  1JUM A;  3KYD B;  4Y7N J;  2KL4 A;  1QGP A;  3QPT A;  4YEJ A;  1ZRE A;  1QPM A;  3G3Z A;  1G59 A;  3SEQ A;  3SDB A;  2RDP A;  4IHY A;  5GAD J;  1IN4 A;  4HZF A;  5DM6 F;  4I2O A;  4M74 A;  2QLZ A;  3S14 J;  2WA0 A;  3WTW C;  2E19 A;  5CLS A;  2QQA A;  3M3Y J;  2WBM A;  4RS8 A;  2CWE A;  2LH9 A;  3JRE A;  3IC7 A;  2OJE D;  3JAM Z;  1Y56 A;  3ZMZ A;  4LIU A;  4TV7 A;  3DXJ F;  2VE8 A;  5E1Z B;  2FNP A;  3OSG A;  2HR3 A;  4V2G A;  3MCZ A;  3J7A Y;  3DTE A;  4OAY A;  3GYH X;  2FEZ A;  5H20 A;  3K9T A;  2W82 A;  1RNL A;  5FRO A;  5IY5 H;  4EQQ A;  1WH7 A;  3BG6 A;  2MBF A;  3I64 A;  2MD0 A;  5C4J J;  4KIC A;  4M3E A;  3KFW X;  2Z16 A;  2ZFW A;  3L2W A;  3JSP A;  4O3M A;  4PJM A;  5LFA A;  5IT3 A;  3KZY A;  3VYS B;  2E1O A;  4XBF A;  4FQG A;  2HXI A;  1IDZ A;  1SMT A;  3PIO F;  3V8J A;  4NBQ A;  1EJ9 A;  4NHJ A;  5ILU A;  1IC8 A;  1GLN A;  3GW2 A;  4IKF A;  2V1D A;  1R1T A;  3EPZ A;  1MW7 A;  3JRD A;  1I5Z A;  1LUJ B;  1OCR H;  4MTE A;  4DBR A;  2LSO A;  5K7F A;  2VUM J;  3GTL J;  9ANT A;  1TQM A;  1T39 A;  4AIJ A;  3WG7 H;  2OA4 A;  3SXY A;  2PBI A;  3I55 I;  2P6S A;  1HA8 A;  3ABU A;  3ABM H;  3EUH C;  1KU9 A;  3F21 A;  3LSJ A;  2BXY A;  3WTX C;  3D0S A;  3ZQ7 A;  5EGO B;  2CQX A;  2IT0 A;  4LG3 A;  1TQI A;  5HNH A;  2JA8 J;  2WAF A;  1HKS A;  2KPM A;  2YX7 A;  2NS0 A;  2VC0 A;  3MKL A;  1NHA A;  4G7Z F;  1BL0 A;  3KP5 A;  2JPB A;  4A6E A;  1UG2 A;  2H94 A;  1IUF A;  1V55 H;  4NB5 A;  3T8R A;  2CS3 A;  4BXU A;  1XGS A;  2VC1 A;  3JRH A;  3CC7 I;  1A04 A;  1OYW A;  2YSR A;  2P81 A;  1IGN A;  3I5U A;  2HQA A;  5J40 A;  4E70 A;  3CCE I;  2TDX A;  3FDY A;  5B5E C;  4BE0 A;  3TGN A;  4YFK F;  1U0J A;  2ZSH B;  3LSG A;  2ZCW A;  4KN7 X;  2ZB9 A;  3F6V A;  2IGO A;  1UMQ A;  3DLL F;  4ZYE A;  1WGX A;  3LSH A;  4BJ6 C;  3IV5 A;  5L3B A;  1KA8 A;  4G6T B;  2CGP A;  3H92 A;  4WK8 F;  2M30 A;  2AXT C;  1TW2 A;  4X1E A;  4Y3O A;  2KIM A;  1W7P D;  1JKP C;  3FKI J;  3CQZ J;  4IRH A;  1IAW A;  4UUT A;  1FOY A;  3K1P A;  2VBW A;  2VJJ A;  3HUG A;  2XVC A;  3TO9 A;  3A0B C;  1SFE A;  3E0J B;  2HI3 A;  4P1W A;  2EWN A;  2EFW A;  2BY2 A;  5K7Z A;  3DPT A;  2MW8 A;  4XNF A;  1QHH D;  4MO7 A;  2L54 A;  1Z05 A;  5GPC A;  3LSI A;  3BR3 A;  2VIX A;  2XDV A;  4CCM A;  2A3S A;  1MJB A;  3K70 C;  2IS1 A;  2IW5 A;  2V1U A;  3GLL A;  3H5N A;  2DU9 A;  3OOP A;  1GV2 A;  1X1C A;  4BQA A;  4XLE A;  2E1N A;  3ZMD A;  2CUE A;  2EZI A;  2GOM A;  2X6W A;  4UUS B;  3ISP A;  3B6C A;  1RES A;  1V5F A;  3D1N I;  3GZN B;  1JE8 A;  4L0Y B;  2UWM A;  1DUX C;  4D0P A;  1RRJ A;  1EF4 A;  1G8X A;  1O57 A;  1S7E A;  5CJ9 A;  4OIR F;  2KFD A;  2HQR A;  2F6C A;  3C2H A;  1W5C C;  2QCO A;  2DI3 A;  2FA5 A;  1ZGA A;  1CQT A;  1B8I A;  1FWZ A;  1G4D A;  1OIS A;  2MD5 A;  3CLO A;  4I76 A;  3FM3 A;  1GHC A;  2GIZ A;  1LEB A;  1UG0 A;  5E1W A;  2KIU A;  2IGM A;  3R0A A;  2IBD A;  3BZK A;  1I3Q J;  5JHU A;  1T0F A;  3EUA A;  2Y48 A;  5F08 A;  3OL3 A;  3GFL A;  2W1O A;  4BKX A;  3DWL E;  1I50 J;  3LA7 A;  1X1D A;  2V6C A;  1R4N B;  1POG A;  4GXO A;  2DDB A;  2XAJ A;  3BY6 A;  1ZR4 A;  4C30 A;  1BR1 A;  3BG9 A;  2DOF A;  1ETV A;  2A61 A;  4AIH A;  1VQ7 I;  1VQ9 I;  3OYD A;  3WHB A;  1MIJ A;  5EZG A;  4R8H A;  2BVL A;  1WSU A;  3IH2 A;  1RI7 A;  4XN0 A;  1HW5 A;  1JKO C;  2QQ9 A;  4DW6 A;  1HSJ A;  2M87 A;  4G94 A;  4BNC A;  2E7X A;  1IW7 F;  5EDN A;  1SMY F;  1UZC A;  1H0M A;  1X58 A;  2ECB A;  2A6T A;  4DYC A;  4D9J A;  1MDM A;  4M3G A;  3FIW A;  3CDI A;  3KP3 A;  1WJ5 A;  2HQN A;  2KIS A;  3CUQ A;  2R7V A;  3U1K A;  2H27 A;  1F9N A;  1B9N A;  1U2W A;  1ZK8 A;  3J81 Z;  4B47 A;  1WJA A;  2Q2E A;  2ZNY A;  2DA4 A;  1ETX A;  1LDJ A;  1X4O A;  2PFB A;  3LFU A;  4HDU A;  3DBL B;  2K7L A;  4BL0 B;  1FSH A;  1YS7 A;  2DMP A;  4A6D A;  4ANJ A;  5FJ8 J;  2H1K A;  3HBL A;  4L9N A;  2E5N A;  3S93 A;  4OMY A;  2BZT A;  5J47 A;  2XHK A;  4CCK A;  5L3E A;  1P92 A;  2VPR A;  2LC2 A;  3E7L A;  3RTR A;  3BPX A;  4A0Z A;  3RPU A;  1I27 A;  2ME0 A;  3R0J A;  1Q1V A;  4AM3 A;  2R3S A;  2DMQ A;  2Y2Z A;  2O03 A;  3TO6 A;  2FBK A;  2LVS A;  3NQO A;  5IOY A;  1Y1W J;  3VYR B;  3CMM A;  3SZP A;  4DBQ A;  4S04 A;  2JSP A;  1Z3X A;  3FM5 A;  2EJR A;  2LP0 A;  5E3N A;  4YG2 F;  2OCC H;  2XAU A;  2A6E F;  3BJA A;  5L3C A;  2N8G A;  4XLP F;  1XSV A;  2C6Y A;  1FX7 A;  1H9T A;  3CCY A;  2EA2 A;  4G6D A;  3TW6 A;  2XAQ A;  2X4H A;  2CFX A;  2CSO A;  1R4M B;  1YX3 A;  2IEK A;  4JOM A;  2L7M P;  5JHF A;  3F0C A;  4KYW A;  2K9Q A;  1MKM A;  2NVY J;  4WX9 A;  2RGV A;  3OR2 C;  4I98 B;  3TDU C;  4BAY A;  5LLQ A;  4CCJ A;  1W7P A;  3OWT A;  1V4R A;  2KP6 A;  4PFP A;  4RA2 A;  3ROU A;  5M5W J;  4MGR A;  4A0X A;  1YI2 I;  2WB1 N;  5IT9 K;  2IRF G;  1U78 A;  2M34 A;  2M7A A;  4RGR A;  2DDA A;  3J7Y J;  3H3Z A;  4L9T A;  3V42 A;  5B1B H;  5H6R A;  3QRF F;  3CTA A;  1YFH A;  3J7Z I;  3JRG A;  4CZZ A;  5LHH A;  4Y52 J;  1QVT A;  3KCC A;  5HDG A;  2QVO A;  4PJL A;  1U9O A;  2M4K A;  4CA0 A;  1LFU P;  2ICW G;  4RGU A;  4BY7 J;  2JWT A;  2ISY A;  2OC6 A;  3HUG B;  1WJE A;  2ELK A;  1SFK A;  3RYP A;  1CGP A;  2DT6 A;  2P5V A;  2ZBK A;  3I54 A;  3M8F A;  3JRA A;  4J19 A;  3G1L A;  5F6F A;  2DXI A;  4LGW A;  4B3A A;  2BGC A;  2L7K A;  1MJ9 A;  4HYE A;  2O0Y A;  4KDP A;  1FC3 A;  4LOC A;  3JRI A;  1FIP A;  4WCG A;  1KGS A;  4ZYG A;  3Q5F A;  3VWB A;  2R0Q C;  3FXQ A;  3BC8 A;  1J75 A;  2K9M A;  2LK2 A;  2M4G A;  3BR6 A;  1XMA A;  2GA2 A;  3F3X A;  2O5R A;  4A3F J;  1BI3 A;  4Y15 A;  5BMZ A;  3QU3 A;  2P8T A;  1GDT A;  3EET A;  1A5J A;  3AL0 B;  2J5O A;  4H0E A;  1EV7 A;  2G7H A;  4BJ5 C;  3IWF A;  2ETH A;  4RAY A;  3CCJ I;  3GBG A;  1TW3 A;  2XKO A;  1T08 B;  1T98 A;  3HSR A;  3GF2 A;  3ZP5 A;  2A07 F;  5E18 F;  5M5X J;  2XSD C;  4J00 A;  2O8X A;  2RKH A;  4C9Y A;  5J3L A;  3H9Q A;  2M9H A;  4YIR X;  3OMY A;  2EIN H;  4OMZ A;  3ULQ B;  4PK4 A;  2IA0 A;  2DK8 A;  4YFX F;  2MH2 A;  3RYR A;  3S3N A;  1B8I B;  1NK3 P;  2VL8 A;  1ZAO A;  2UV1 A;  2P4W A;  3FMQ A;  4F52 A;  2MYS A;  3BCB A;  1YE9 A;  4EM2 A;  2DYR H;  2IA1 A;  5DV5 A;  2OQR A;  2JPC A;  3OYI A;  3BG5 A;  3RKY A;  1XMX A;  2JVG A;  4HEA 2;  2W85 A;  2K86 A;  4PSX A;  4A12 A;  4IJA A;  2CV1 A;  1LB2 A;  5E8I A;  2DFF A;  4UNO A;  4BQQ A;  2BOL A;  3JTH A;  3LSP A;  2EV6 A;  2LKS A;  3LAP A;  2VBY A;  4GYG A;  4XR6 A;  4Y33 A;  3VOE A;  2I5U A;  2Y69 H;  2KKO A;  2FXA A;  3AFH A;  3FWE A;  2NVQ J;  2EA4 A;  1NK2 P;  2DPD A;  1WH5 A;  2DFI A;  4ENM A;  1MDM B;  3HEF A;  3ZQG A;  2OZU A;  3R60 A;  1XSD A;  3CUQ B;  4HNV A;  2E71 A;  3HRT A;  4XSX F;  4F55 A;  4FT8 A;  4A3G J;  1JHF A;  2Q2E B;  4M72 A;  4UXN A;  5GAH J;  2ELH A;  2ZJQ F;  1DP3 A;  1A36 A;  1X2N A;  2ID6 A;  1BJA A;  4I99 C;  4DYR A;  4ESJ A;  4DGW B;  1FNN A;  3AG3 H;  3I4N J;  1UST A;  3BLY A;  4IL6 C;  4JYK A;  1QHG A;  3LL7 A;  4XLF A;  1FYM A;  1YOV B;  3HIF A;  5GAE J;  5D8L B;  2PN6 A;  4M3B A;  2BBY A;  3AL0 C;  1WQ2 A;  3QYE A;  4I09 A;  2KIF A;  4YEL A;  4ZDL A;  2PX9 A;  2L01 A;  1B9M A;  3CJN A;  3QP5 A;  4HOB A;  1MBJ A;  1V3F A;  3RCO A;  3H5R A;  4EAT A;  4A3D J;  5ICF A;  2VBX A;  1VI0 A;  3WTT C;  2X9D A;  4ZTF A;  4EJW A; 
#chains in the Genus database with same CATH homology
 5JVG F;  1YIJ I;  2E34 A;  1FOY A;  1VQK I;  1FOX A;  1S72 I;  1ACI A;  4V19 K;  2ZJP F;  2JQ7 A;  2QA4 I;  2H8W A;  1QA6 A;  3CCJ I;  1FOW A;  1YJN I;  3CMA I;  3CC2 I;  1VQP I;  2NXN B;  1VQN I;  3CD6 I;  3PIO F;  1VQ4 I;  1YJW I;  2E36 A;  2K3F A;  3CME I;  4IOA F;  1VQO I;  3CCR I;  3I55 I;  1VQ5 I;  1HC8 A;  3PIP F;  3CCL I;  1Y39 A;  3CCS I;  1YIT I;  1VQM I;  5DM7 F;  3CCU I;  3CJT B;  2OTL I;  3CCM I;  3CCV I;  1YI2 I;  3G71 I;  3CCQ I;  3J7Y J;  2ZJR F;  1YJ9 I;  3CC4 I;  3I56 I;  3CC7 I;  3J7Z I;  1VQ7 I;  1VQ9 I;  4IO9 F;  2OTJ I;  1MMS A;  5GAH J;  2ZJQ F;  3CF5 F;  3CCE I;  5GAD J;  5DM6 F;  4UY8 I;  2FOW A;  4IOC F;  5GAE J;  3G6E I;  2E35 A;  1VQ6 I;  1YHQ I;  2QEX I;  1VQL I;  3DLL F;  3G4S I;  5GAG J;  1VQ8 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...